WorldWideScience

Sample records for plant che vang

  1. BIOACTIVITIES AND CHEMICAL CONSTITUENTS OF A VIETNAMESE MEDICINAL PLANT JASMINUM SUBTRIPLINERVE BLUME (CHE VANG )

    OpenAIRE

    Dai, Hue Ngan

    2006-01-01

    #This thesis encompasses two parts. The first part deals with general introduction to isolation, characterization, and bioactivities of natural products, with emphasis on Jasminum Subtriplinerve Blume spp., and its genus. The second is experimental study of J.subtriplinerve Bl. about its bioactivities and chemical constituents. In first part (from chapter 1 to 6), the botanical of two varieties of J.subtriplinerve Bl., a medicinal plant widely distributed in Middle area of Vietnam that has ju...

  2. Bioactivities and chemical constituents of a Vietnamese medicinal plant Che Vang, Jasminum subtriplinerve Blume (Oleaceae).

    Science.gov (United States)

    Ngan, Dai Hue; Hoai, Ho Thi Cam; Huong, Le Mai; Hansen, Poul Erik; Vang, Ole

    2008-01-01

    Five crude extracts were made from leaves and stems of Jasminum subtriplinerve Blume (Oleaceae) and investigated for antimicrobial, antioxidant and cytotoxic activities. The extractions were done with petroleum ether, ethyl acetate, ethanol, methanol or water. All extracts exhibited anti-bacterial activity except the water fraction. On the other hand, all extracts exhibit antioxidant activity except the petroleum ether fraction using the DPPH radical scavenging assay. Only the petroleum ether fraction showed a cytotoxicity activity against tested cell-lines, Hep-G2 and RD with IC(50) values of 19.2 and 20 microg mL(-1), respectively. From the petroleum ether and ethyl acetate extracts, two triterpenes namely 3beta-acetyl-oleanolic acid and lup-20-en-3beta-ol and a sterol, stigmast-5-en-3beta-ol were isolated. The structure of those compounds were elucidated by spectrometric methods IR, MS, 1D-NMR, 2D-NMR and simulated ACD/NMR spectra. The data presented here indicate that J. subtriplinerve do contain compounds with interesting biological activity.

  3. Bioactivities and chemical constituents of a vietnamese medicinal plant Che Vang, Jasminum subtriplinerve Blume (Oleaceae)

    DEFF Research Database (Denmark)

    Dai Hue, Ngan; Thi Cam, Hoai; Le Mai, Huong

    2008-01-01

    Five crude extracts were made from leaves and stems of Jasminum subtriplinerve Blume (Oleaceae) and investigated for antimicrobial, antioxidant and cytotoxic activities. The extractions were done with petroleum ether, ethyl acetate, ethanol, methanol or water. All extracts exhibited anti-bacteria...

  4. A cheZ-Like Gene in Azorhizobium caulinodans Is a Key Gene in the Control of Chemotaxis and Colonization of the Host Plant.

    Science.gov (United States)

    Liu, Xiaolin; Liu, Wei; Sun, Yu; Xia, Chunlei; Elmerich, Claudine; Xie, Zhihong

    2018-02-01

    Chemotaxis can provide bacteria with competitive advantages for survival in complex environments. The CheZ chemotaxis protein is a phosphatase, affecting the flagellar motor in Escherichia coli by dephosphorylating the response regulator phosphorylated CheY protein (CheY∼P) responsible for clockwise rotation. A cheZ gene has been found in Azorhizobium caulinodans ORS571, in contrast to other rhizobial species studied so far. The CheZ protein in strain ORS571 has a conserved motif similar to that corresponding to the phosphatase active site in E. coli The construction of a cheZ deletion mutant strain and of cheZ mutant strains carrying a mutation in residues of the putative phosphatase active site showed that strain ORS571 participates in chemotaxis and motility, causing a hyperreversal behavior. In addition, the properties of the cheZ deletion mutant revealed that ORS571 CheZ is involved in other physiological processes, since it displayed increased flocculation, biofilm formation, exopolysaccharide (EPS) production, and host root colonization. In particular, it was observed that the expression of several exp genes, involved in EPS synthesis, was upregulated in the cheZ mutant compared to that in the wild type, suggesting that CheZ negatively controls exp gene expression through an unknown mechanism. It is proposed that CheZ influences the Azorhizobium -plant association by negatively regulating early colonization via the regulation of EPS production. This report established that CheZ in A. caulinodans plays roles in chemotaxis and the symbiotic association with the host plant. IMPORTANCE Chemotaxis allows bacteria to swim toward plant roots and is beneficial to the establishment of various plant-microbe associations. The level of CheY phosphorylation (CheY∼P) is central to the chemotaxis signal transduction. The mechanism of the signal termination of CheY∼P remains poorly characterized among Alphaproteobacteria , except for Sinorhizobium meliloti , which

  5. Che Guevara

    DEFF Research Database (Denmark)

    Cristoffanini, Pablo Rolando

    2014-01-01

    made Che Guevara a political, religious and cultural icon and an object of consumption, despite his total political and military failure in Bolivia and his violent death. Finally the article contrasts the meanings of his image in the original context with new research that calls into question...... with the achievements and connotations of the Cuban Revolution in the context of the Cold War. The current meanings of the image must be read in the context of the global consumer culture. The article analyzes and explains how a conjunction of factors such as communication strategies and the connotations of his image...

  6. El humanismo del Che Che's Humanism

    OpenAIRE

    Avelino Fernández Espert; Cristina Fernández Rivero

    2004-01-01

    Los autores, estudiosos de la raigal influencia del pensamiento y la obra del Comandante Dr. Ernesto Guevara de la Serna (Che) en Cuba y América, proyectan la estampa humanista de este revolucionario médico, con el empleo de las más trascendentes pinceladas históricas de un amplia hoja de vida en distintas latitudes del mundo. El Che, joven estudiante, médico graduado con prometedoras dotes que sabe ubicar al ser humano y sus valores por encima de un promisorio futuro como científico y profes...

  7. Gran Torino's Hmong Lead Bee Vang on Film, Race, and Masculinity: Conversations with Louisa Schein

    Directory of Open Access Journals (Sweden)

    Louisa Schein

    2010-01-01

    Full Text Available Bee Vang, of Minneapolis, played the Hmong lead Thao Vang Lor in Clint Eastwood's 2008 Gran Torino. He was sixteen when he shot the film and had no acting training. For 27 days on location in urban Detroit he played before a Hollywood crew opposite an icon of the filmindustry doing multiple takes of each scene and camera angle. The shoot was full of unexpected twists and turns some of which he recounts in these interchanges with Hmong media expert Louisa Schein of the Departments of Anthropology and Women's and Gender Studies at Rutgers University. Over several conversations, condensed here, Vang and Schein talk about Gran Torino, about acting and film critique, about immigrants and stereotypes, about masculinity and sexuality, and about Vang's vision for what needs to change to address problems of race and inequality in and beyond media worlds.

  8. C. elegans VANG-1 modulates life span via insulin/IGF-1-like signaling.

    Directory of Open Access Journals (Sweden)

    Sebastian J Honnen

    Full Text Available The planar cell polarity (PCP pathway is highly conserved from Drosophila to humans and a PCP-like pathway has recently been described in the nematode Caenorhabditis elegans. The developmental function of this pathway is to coordinate the orientation of cells or structures within the plane of an epithelium or to organize cell-cell intercalation required for correct morphogenesis. Here, we describe a novel role of VANG-1, the only C. elegans ortholog of the conserved PCP component Strabismus/Van Gogh. We show that two alleles of vang-1 and depletion of the protein by RNAi cause an increase of mean life span up to 40%. Consistent with the longevity phenotype vang-1 animals also show enhanced resistance to thermal- and oxidative stress and decreased lipofuscin accumulation. In addition, vang-1 mutants show defects like reduced brood size, decreased ovulation rate and prolonged reproductive span, which are also related to gerontogenes. The germline, but not the intestine or neurons, seems to be the primary site of vang-1 function. Life span extension in vang-1 mutants depends on the insulin/IGF-1-like receptor DAF-2 and DAF-16/FoxO transcription factor. RNAi against the phase II detoxification transcription factor SKN-1/Nrf2 also reduced vang-1 life span that might be explained by gradual inhibition of insulin/IGF-1-like signaling in vang-1. This is the first time that a key player of the PCP pathway is shown to be involved in the insulin/IGF-1-like signaling dependent modulation of life span in C. elegans.

  9. El humanismo del Che Che's Humanism

    Directory of Open Access Journals (Sweden)

    Avelino Fernández Espert

    2004-08-01

    Full Text Available Los autores, estudiosos de la raigal influencia del pensamiento y la obra del Comandante Dr. Ernesto Guevara de la Serna (Che en Cuba y América, proyectan la estampa humanista de este revolucionario médico, con el empleo de las más trascendentes pinceladas históricas de un amplia hoja de vida en distintas latitudes del mundo. El Che, joven estudiante, médico graduado con prometedoras dotes que sabe ubicar al ser humano y sus valores por encima de un promisorio futuro como científico y profesional de la medicina. El artículo dedica atención especial a sus conceptos sobre el hombre, su vida e historia y a su proverbial apego a una ética revolucionaria de elevado calibre. El artículo contribuye al enriquecimiento de los conocimientos sobre el desarrollo histórico del humanismo médico cubano, al proyectarlo en la figura de uno de sus más míticos modelosThe authors, studious of the extraordinary influence of Commandant and Dr. Ernesto Guevara de la Serna 's thought in Cuba and America, unveil the humanist perspective of this revolutionary doctor, through the most transcendental historical events in this man's life in different latitudes of the world. Che, young student, medicine doctor with promising gifts that knew how to place the human being and his values above his promissory future as scientific and medicine professional. The article dedicates special attention to his concepts about men, as well as his life and history and to his proverbial attachment to valuable revolutionary ethics. The article contributes to the enrichment of knowledge on the historical development of Cuban medical humanism, by reflecting this in the figure of one of its most mythical models

  10. Notas sobre el che

    Directory of Open Access Journals (Sweden)

    Virginia Bertolotti

    2010-06-01

    Full Text Available In the present work, I review, in the first place, the bibliography that summarizes the discussion surrounding the etymology of the word che. Then, I analyze the uses of this term in the diachrony as in the synchrony of the Río de la Plata Spanish, which allows me to propose a classification of the uses of the word che in this region. In the third part of the article, I discuss the categorial adscrption of the word che. Finally, the categorial analysis of the diachronic and synchronic empirical evidence allows me to conclude that the vocative uses of the term are a loan from the nominal determinant of the guaraní language, and not a phonic change in the Spanish interjection, thus resolving the etymological issues.

  11. Identifying orchid hotspots for biodiversity conservation in Laos: the limestone karst vegetation of Vang Vieng District, Vientiane Province

    Directory of Open Access Journals (Sweden)

    Pankaj Kumar

    2016-10-01

    Full Text Available A project to study the phytodiversity of the Indo-Burma Biodiversity Hotspot (IBBH was initiated by Kadoorie Farm and Botanic Garden, Hong Kong, in 2011, with the aim of surveying primary forest fragments and identifying conservation priorities within this expansive but highly threatened ecoregion. Vang Vieng District of Vientiane Province, northern Laos, was chosen as a focus for a pilot expedition, since it features an extensive karst landscape that has barely been explored. Together with officials from the Ministry of Science and Technology, Government of Lao PDR, surveys of three sites were conducted in April 2012, at the end of the dry northeast monsoon season. Emphasis was placed on Orchidaceae because it is among the most species-rich and commercially exploited flowering plant families in the region. A total of 179 specimens were collected, of which approximately 135 were unique taxa accounting for 29.6% of the orchids found in Laos and 5.8% of those found in IBBH as a whole, and equivalent to 0.27 species/hectare within the area surveyed, substantially higher than published figures for other limestone areas in the region, such as Cuc Phuong National Park in Vietnam (0.0055 species/hectare and Perlis State in Peninsular Malaysia (0.0036 species/hectare.  At least one is a species new to science, nine represent new distributional records for Laos and a further nine are new records for Vientiane Province. A list of the species encountered during the study is presented and the significance of the findings is discussed. Major threats to the natural environment in northern Laos are highlighted.

  12. Che: His Own Worst Enemy

    Science.gov (United States)

    2015-04-01

    comprised of Green Berets, to go to Bolivia and train a Ranger battalion 40 in counter-insurgency operations. Leading this 16-man team was Maj...York: Routledge & Kegan Ltd., 1987. Sinclair, Andrew. Che Guevara. New York: The Viking Press, 1970. Study of the “Diary of ‘Che’ Guevara in

  13. Cholinesterase (ChE) response and related mortality among birds fed ChE inhibitors

    Science.gov (United States)

    Ludke, J.L.; Hill, E.F.; Dieter, M.P.

    1975-01-01

    Patterns of mortality and inhibition of brain and plasma ChE in birds treated with ChE inhibitors were studied in an attempt to determine the validity of using ChE activity as a monitoring and diagnostic technique. Analysis of brain ChE activity proved to be reliable for diagnosing and monitoring effects of selected ChE inhibitors in birds. Brain ChE inhibition exceeding 20% indicated exposure, and inhibition greater than 50% was sufficient for diagnosing cause of death. Individuals that died from dietary exposure to parathion or carbofuran had brain ChE activities below 55% of normal; although individuals could survive with brain ChE activity lower than 50%. Problems associated with collection, storage, and analysis of tissues for ChE activity are discussed.

  14. Introduzione. Donne che portano la parrucca

    Directory of Open Access Journals (Sweden)

    Claudia Mattalucci-Yılmaz

    2013-07-01

    Full Text Available Peruk takan kadınlar è l’opera che nel 1999 l’artista e cineasta turco Kutlug Ataman ha presentato alla Biennale di Venezia curata da Harald Szeemann. Quattro schermi giustapposti proiettano le testimonianze di donne che, per un periodo della loro vita, hanno portato una parrucca: un’attivista politica di sinistra che nel 1971, dopo il colpo di stato militare, utilizzava un nome in codice, una divisa delle Turkish Airlines e una parrucca per sfuggire al controllo della polizia; una giornalista, colpita da un tumore al seno, che ha portato una parrucca per mascherare gli effetti della chemioterapia; una studentessa musulmana che indossa una parrucca per frequentare l’università, in un contesto – quello turco – che in nome della laicità dello Stato, interdice l’uso nel foulard nelle scuole, nelle università e nella pubblica amministrazione; e infine un transessuale.

  15. Dicty_cDB: CHE636 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE636 (Link to dictyBase) - - - Contig-U11696-1 CHE636P (Link... to Original site) CHE636F 174 CHE636Z 123 CHE636P 277 - - Show CHE636 Library CH (Link to library) Clone ID CHE636 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11696-1 Original site URL http://dict...ne RP11-15H22, WORKING DRAFT SEQUENCE, 23 unordered pieces. 40 0.19 3 AC149612 |AC149612.1 Ictalurus punctat... %: cytoskeletal 4.0 %: mitochondrial >> prediction for CHE636 is nuc 5' end seq. ID CHE636F 5' end seq. >CH

  16. Structural Insight inot the low Affinity Between Thermotoga maritima CheA and CheB Compared to their Escherichia coli/Salmonella typhimurium Counterparts

    Energy Technology Data Exchange (ETDEWEB)

    S Park; B Crane

    2011-12-31

    CheA-mediated CheB phosphorylation and the subsequent CheB-mediated demethylation of the chemoreceptors are important steps required for the bacterial chemotactic adaptation response. Although Escherichia coli CheB has been reported to interact with CheA competitively against CheY, we have observed that Thermotoga maritima CheB has no detectable CheA-binding. By determining the CheY-like domain crystal structure of T. maritima CheB, and comparing against the T. maritima CheY and Salmonella typhimurium CheB structures, we propose that the two consecutive glutamates in the {beta}4/{alpha}4 loop of T. maritima CheB that is absent in T. maritima CheY and in E. coli/S. typhimurium CheB may be one factor contributing to the low CheA affinity.

  17. Crèche and School

    CERN Multimedia

    EVE et École

    2018-01-01

    IMPORTANT DATES Enrolments 2018-2019 Enrolments to the Crèche and School for the school year 2018-2019 will take place on 5, 6 and 7 March 2018 from 10 am to 1 pm at the Crèche and School of the CERN Staff Association. Registration forms will be available from Thursday 1st March 2018. For more information, please visit the website: http://nurseryschool.web.cern.ch/. * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * Saturday 3 March 2018 Open Day at Crèche and School of the CERN Staff Association Are you considering enrolling your child to the Crèche and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 3 March 2018 from 10 to 12 am It will be our pleasure to present to you our structure, its projects and premises, and answer any questions you may have. Please sign up for one of the two sessions via Doodle before Wednesd...

  18. Che cos’è l’antiziganismo?

    Directory of Open Access Journals (Sweden)

    Leonardo Piasere

    2012-01-01

    Full Text Available Abstract – IT Chi è zingaro? Colui che chiamo zingaro, che assegno a questa identità e che costituisco come "altro" dal resto della società. In questo senso, la storia degli zingari si confonde con quella dell'"antiziganismo", un neologismo che denota una pratica antica. Ma si può dire che la comparsa della nuova parola è legata agliodierni intrecci tra politiche multiculturali da un lato e politiche neoliberiste dall’altro?Abstract – FRQui est Tsigane? Celui que je nomme Tsigane, que j'assigne à cette identité et que je constitue en "autre" du reste de la société. Dans ce sens, l'histoire des Tsiganes se confond avec celle de l'"antitsiganisme", un néologisme qui recouvre une pratique ancienne. Mais peut-on dire que l'apparition de ce nouveau mot estliée aux croisements actuels entre les politiques multiculturelles d'une part, et les politiques néolibéralesde l'autre? Abstract – EN Who is Gypsy? The person I call Gypsy, to whom I assign this identity, is that I establish as "other" than the rest of society. In this sense, the history of Gypsies merges with that of "antigypsism", a neologism that denotes an ancient practice. But can it be said that the appearance ofthis new word is linked to the current entanglement between multi-cultural politics on one side and neo-liberalist politics on the other?

  19. Dicty_cDB: CHE687 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE687 (Link to dictyBase) - - - Contig-U16336-1 - (Link to Or...iginal site) CHE687F 622 - - - - - - Show CHE687 Library CH (Link to library) Clone ID CHE687 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dictycdb.b...KFINQCINEIKEELKGDMQKKTVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICT...LGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIF

  20. Che legend elab ka 40 aastat hiljem / Evelyn Kaldoja

    Index Scriptorium Estoniae

    Kaldoja, Evelyn, 1980-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 9. okt. lk. 10. Argentinas sündinud ja 1967. aastal hukatud revolutsionääri Ernesto Che Guevara poliitikukarjäärist, tema panusest Kuuba revolutsiooni ja poliitikasse. Ernesto Che Guevara mälestamisest Ladina-Ameeerika riikides. Lisa: Kuuba revolutsioon; Che Guevara elu

  1. l'italiano che cambia: apocalisse o palingenesi? alcune riflessioni ...

    African Journals Online (AJOL)

    User

    idea that a real linguistic apocalypse is to be found on one hand, in what. Calvino ... nell'italiano contemporaneo da una prospettiva che, audacemente, definiamo ...... 'terrore semantico', cioè la fuga di fronte a ogni vocabolo che abbia di.

  2. Natural gas prices in Italy. Tariffs geographical distribution; Metano. Paese che vai, prezzo che trovi

    Energy Technology Data Exchange (ETDEWEB)

    Marrocchelli, A. [ENEA, Rome (Italy). Centro Ricerche Casaccia

    2000-11-01

    The annual report on services and activity carries at some evaluations of data concerned the natural gas market: total consumption, costs and prices in Italy and comparative evaluations with other european countries. [Italian] La relazione annuale sullo stato dei servizi e sull'attivita' svolta, presentata dal Presidente dell'Autorita' per l'energia elettrica e il gas, porta ad alcune considerazioni sui dati che riguardano il mercato del gas naturale: i consumi totali, i costi e i prezzi in Italia, il confronto con i costi e i prezzi praticati negli altri paesi europei.

  3. Radioactive investigation in an industrial plant of Ascoli Piceno which makes use of graphite scraps; Indagine radiometrica in un insediamento produttivo di Ascoli Piceno che utilizza rottami di grafite

    Energy Technology Data Exchange (ETDEWEB)

    Di Ciaccio, P.; Grisanti, F.; Sabatini, F. [Istituto Superiore di Sanita' , Working Group on Radioactive Contamination of Graphite Samples, Rome (Italy)

    2001-07-01

    In 1997 a radiological alarm originated in an Italian industrial plant in Ascoli Piceno. This fact required to investigate a peculiar case of a possible radioactive contamination in a working environment up to its solution. A working group made of experts of various Institutes and Organisations, after an analysis of the situation, carried out an experimental study and drew some scientific and radiation protection conclusions. This report contains a review of the work performed by the working group and a summary of the radiation protection intervention at the plant. [Italian] L'allarme radiologico creatosi nel 1997 in un insediamento produttivo di Ascoli Piceno ha portato all'esame ed alla soluzione di un singolare evento di possibile contaminazione di un ambiente di lavoro industriale. Il rapporto riporta il resoconto degli interventi di radioprotezione operativa eseguiti presso l'insediamento, l'analisi del problema e lo studio sperimentale eseguiti da un gruppo di lavoro creato fra varie istituzioni e alcune conclusioni scientifiche e radioprotezionistiche del gruppo stesso.

  4. CheMentor Software System by H. A. Peoples

    Science.gov (United States)

    Reid, Brian P.

    1997-09-01

    CheMentor Software System H. A. Peoples. Computerized Learning Enhancements: http://www.ecis.com/~clehap; email: clehap@ecis.com; 1996 - 1997. CheMentor is a series of software packages for introductory-level chemistry, which includes Practice Items (I), Stoichiometry (I), Calculating Chemical Formulae, and the CheMentor Toolkit. The first three packages provide practice problems for students and various types of help to solve them; the Toolkit includes "calculators" for determining chemical quantities as well as the Practice Items (I) set of problems. The set of software packages is designed so that each individual product acts as a module of a common CheMentor program. As the name CheMentor implies, the software is designed as a "mentor" for students learning introductory chemistry concepts and problems. The typical use of the software would be by individual students (or perhaps small groups) as an adjunct to lectures. CheMentor is a HyperCard application and the modules are HyperCard stacks. The requirements to run the packages include a Macintosh computer with at least 1 MB of RAM, a hard drive with several MB of available space depending upon the packages selected (10 MB were required for all the packages reviewed here), and the Mac operating system 6.0.5 or later.

  5. A crèche on the Meyrin CERN site

    CERN Multimedia

    Association du personnel

    2013-01-01

    A few months ago (see Echo 175) we announced the opening, at the end of August, of a crèche at the CERN Staff Association’s nursery school. After a very active summer, where a new floor was added to the canteen building, the new school year started in excellent conditions and, as expected, the new crèche opened on Tuesday 27 August. This crèche, with 13 full-time equivalent places, can accept 18 children aged between three months and two years in a space fully refitted to care for the little ones. A specially designed space for breastfeeding helps mothers working on the site to respect their baby's rhythm. In compliance with the standards of supervision in the canton of Geneva six educators take care of the children in shifts. This new space is fully integrated in the nursery school so that now the crèche, Kindergarten and school of the CERN Staff Association can welcome children aged from three months to six years, from Monday to Friday, and...

  6. à l'encoche sèche

    African Journals Online (AJOL)

    Chez Hevea brasiliensis, la production de latex est affectée par l'encoche sèche qui se manifeste par l'arrêt de l'écoulement de ... coagulation pour donner le caoutchouc naturel. ..... relationship between latex sugar content, the metabolic ...

  7. Crèche and School - Important dates

    CERN Multimedia

    Staff Association

    2018-01-01

    Enrolments 2018-2019 Enrolments to the Crèche and School for the school year 2018-2019 will take place on 5, 6 and 7 March 2018 from 10 am to 1 pm at the Crèche and School of the CERN Staff Association. Registration forms will be available from Thursday 1st March 2018. For more information, please visit the website: http://nurseryschool.web.cern.ch/. * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * Saturday 3 March 2018 Open Day at Crèche and School of the CERN Staff Association Are you considering enrolling your child to the Crèche and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 3 March 2018 from 10 to 12 am It will be our pleasure to present to you our structure, its projects and premises, and answer any questions you may have. Please sign up for one of the two sessions via Doodle before Friday 2 March 2018: htt...

  8. Che cos'è la vita ?, Scienza e umanesimo

    CERN Document Server

    Schrödinger, Erwin

    1988-01-01

    A cento anni dalla nascita di Erwin Schrödinger (Viena 1887), il suo pensiero e il suo lavoro mantengono inalterati la loro attualità, come dimostra la nuova pubblicazione di molti dei suoi testi e i numerosi convegni che gli vengono dedicati.

  9. Care and education in the Danish Créche

    DEFF Research Database (Denmark)

    Broström, Stig; Hansen, Ole Henrik

    2010-01-01

    This article seeks to identify the relation between policy and lived life, for the small child in the Danish crèche. To accomplish this, the article integrates demography, traditions, national curriculum and psychological, educational, and recent developments in research. It is an attempt to reveal...... research articles. It is used in the exploration of meanings of political, social, and cultural phenomena as experienced by the involved individuals themselves, in their natural context. It is a presumption that the child’s development is a consequence of emotional and cognitive stimulation. To outline...... that, it is vital to emphasize the influence that policy causes on educational practice in the crèche, e.g., the conceptualization of education and care....

  10. La Pubblica Amministrazione in uno scenario che cambia

    Directory of Open Access Journals (Sweden)

    Renzo Carlucci

    2009-03-01

    Full Text Available Questo numero, mirato alle implicazioni dell'utilizzo del dato territoriale nel contesto delle PA, le Pubbliche Amministrazioni, si arricchisce di un contenuto ulteriore, particolarmente spaziale; GEOmedia esce infatti in coincidenza con una manifestazione che possiamo considerare la vetrina mediterranea privilegiata per la promozione culturale, scientifica e commerciale delle istituzioni e del segmento dell’industria aerospaziale europea ed italiana.

  11. Che-1 gene silencing induces osteosarcoma cell apoptosis by inhibiting mutant p53 expression

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Ming; Wang, Dan, E-mail: danwangwdd@163.com; Li, Ning

    2016-04-22

    The transcriptional cofactor Che-1 is an RNA polymerase II (Pol II) which is involved in tumorigenesis, such as breast cancer and multiple myeloma. Che-1 can also regulate mutant p53 expression, which plays roles in many types of cancer. In this study, we aimed to investigate the effects and specific mechanism of Che-1 in the regulation of osteosarcoma (OS) cell growth. We found that Che-1 is highly expressed in several kinds of OS cells compared with osteoblast hFOB1.19 cells. MTT and flow cytometry assays showed that Che-1 depletion by siRNA markedly suppressed MG-63 and U2OS cell proliferation and promoted apoptosis. The chromatin immunoprecipitation (ChIP) assay verified the presence of Che-1 on the p53 promoter in MG-63 and U2OS cells carrying mutant p53. Further studies showed that Che-1 depletion inhibited mutant p53 expression. Notably, our study showed that the loss of Che-1 inhibits proliferation and promotes apoptosis in MG-63 cells by decreasing the level of mutant p53. Therefore, these findings open the possibility that silencing of Che-1 will have therapeutic benefit in OS. - Highlights: • Che-1 is highly expressed in several kinds of OS cells. • Che-1 depletion suppressed MG-63 and U2OS cell growth. • Che-1 is existed in the p53 promoter in MG-63 and U2OS cells. • Che-1 depletion inhibited mutant p53 expression. • Che-1 depletion inhibits cell growth by decreasing the level of mutant p53.

  12. Crystallization and preliminary X-ray crystallographic analysis of Thermotoga maritima CheA P3-P4-P5 domains in complex with CheW

    International Nuclear Information System (INIS)

    Park, SangYoun; Kim, Keon Young; Kim, Sunmin; Crane, Brian R.

    2012-01-01

    T. maritima CheA P3-P4-P5 domains were crystallized in complex with CheW. Low-resolution diffraction data were collected to ∼8 Å using synchrotron X-ray radiation. The CheA–CheW complex plays a key role in bacterial chemotaxis signal transduction by initiating phosphotransfer to response regulators via coupling to the chemoreceptors. CheA (P3-P4-P5 domains) and CheW from Thermotoga maritima were overexpressed in Escherichia coli and crystallized as a complex at 298 K using ammonium dihydrogen phosphate as a precipitant. X-ray diffraction data were collected to ∼8 Å resolution at 100 K using synchrotron radiation. The crystal belonged to space group I222 or I2 1 2 1 2 1 , with unit-cell parameters a = 184.2, b = 286.4, c = 327.7 Å. The asymmetric unit may contain six to ten CheA–CheW molecules

  13. Crystallization and preliminary X-ray crystallographic analysis of CheW from Thermotoga maritima: a coupling protein of CheA and the chemotaxis receptor

    International Nuclear Information System (INIS)

    Park, SangYoun; Crane, Brian R.

    2011-01-01

    CheW from T. maritima has been crystallized (space group P6 3 , unit-cell parameters a = b = 61.265, c = 361.045 Å). Diffraction data have been collected to 3.1 Å resolution using synchrotron X-ray radiation. The CheW protein plays a key role in bacterial chemotaxis signal transduction by coupling CheA to chemotaxis receptors. CheW from Thermotoga maritima has been overexpressed in Escherichia coli and crystallized at 298 K using ammonium sulfate as a salt precipitant. X-ray diffraction data have been collected to 3.10 Å resolution at 100 K using synchrotron radiation. The crystal belonged to space group P6 3 , with unit-cell parameters a = b = 61.265, c = 361.045 Å. The asymmetric unit may contain four to six CheW molecules

  14. Finally, a crèche at CERN!

    CERN Multimedia

    Anaïs Schaeffer

    2013-01-01

    After many years of discussion, the CERN Staff Association’s first crèche will open its doors in September to welcome up to 20 babies and toddlers.   A delicate operation: the installation of 11 modules above the Nursery's School canteen. Image: Sigrid Knoops. The CERN Staff Association’s Nursery School, which will soon turn 50, is pleased to announce the establishment of CERN’s first crèche. This project, which has come to fruition over the past academic year with the support of the CERN Management, meets an established and growing need among the Laboratory’s personnel and users. As a modular construction, the Nursery School’s new second floor was assembled above the existing canteen in a matter of days. Its 11 modules are ultra-modern – they’re even equipped with underfloor heating. “Thanks to this extension, we will be able to accept around twenty babies at the start of the academ...

  15. Perché io credo in colui che ha fatto il mondo

    CERN Document Server

    Zichichi, Antonino

    1999-01-01

    Fin troppo spesso si sente dire che il mondo della scienza e quello della religione sono in completa opposizione e che non condividono alcuna esperienza o caratteristica in comune. Nulla potrebbe essere più falso di queste affermazioni secondo Antonino Zichichi, che in quest'opera afferma come la ricerca scientifica e l'esperienza religiosa abbiano in comune molto più di quanto si possa pensare.

  16. Heterozygous Che-1 KO mice show deficiencies in object recognition memory persistence.

    Science.gov (United States)

    Zalcman, Gisela; Corbi, Nicoletta; Di Certo, Maria Grazia; Mattei, Elisabetta; Federman, Noel; Romano, Arturo

    2016-10-06

    Transcriptional regulation is a key process in the formation of long-term memories. Che-1 is a protein involved in the regulation of gene transcription that has recently been proved to bind the transcription factor NF-κB, which is known to be involved in many memory-related molecular events. This evidence prompted us to investigate the putative role of Che-1 in memory processes. For this study we newly generated a line of Che-1(+/-) heterozygous mice. Che-1 homozygous KO mouse is lethal during development, but Che-1(+/-) heterozygous mouse is normal in its general anatomical and physiological characteristics. We analyzed the behavioral characteristic and memory performance of Che-1(+/-) mice in two NF-κB dependent types of memory. We found that Che-1(+/-) mice show similar locomotor activity and thigmotactic behavior than wild type (WT) mice in an open field. In a similar way, no differences were found in anxiety-like behavior between Che-1(+/-) and WT mice in an elevated plus maze as well as in fear response in a contextual fear conditioning (CFC) and object exploration in a novel object recognition (NOR) task. No differences were found between WT and Che-1(+/-) mice performance in CFC training and when tested at 24h or 7days after training. Similar performance was found between groups in NOR task, both in training and 24h testing performance. However, we found that object recognition memory persistence at 7days was impaired in Che-1(+/-) heterozygous mice. This is the first evidence showing that Che-1 is involved in memory processes. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  17. Altruisti, cooperativi e morali: Perché è più facile esserlo domani che oggi

    NARCIS (Netherlands)

    Giacomantonio, M.; de Dreu, C.K.W.

    2013-01-01

    Un portafogli smarrito e ritrovato. Una donazione ad un ente che si occupa di ricerca sulle malattie degenerative. Una tangente non accettata. Un divorzio che si conclude senza il ricorso al tribunale. Alla base di tutti questi eventi vi è la tendenza umana a cooperare, ad essere altruisti e ad

  18. Discovering Che-1/AATF: a new attractive target for cancer therapy

    Directory of Open Access Journals (Sweden)

    Simona eIezzi

    2015-04-01

    Full Text Available The transcriptional cofactor Che-1/AATF is currently emerging as an important component of the DNA damage response machinery, the complex signaling network that maintains genome integrity and prevents tumorigenesis. Moreover this protein is involved in a wide range of cellular pathways, regulating proliferation and survival in both physiological and pathological conditions. Notably, some evidence indicates that dysregulation of Che-1/AATF levels are associated with the transformation process and elevated levels of Che-1/AATF are required for tumor cell survival. It is for these reasons that Che-1/AATF has been regarded as an attractive, still theoretical, therapeutic target for cancer treatments. In this review, we will provide an updated overview of Che-1/AATF activities, from transcriptional regulation to DNA damage response.

  19. His Excellency Professor Dr Che-Ho Wei, Chairman, National Science Council Executive Yuan, Republic of China

    CERN Multimedia

    Patrice Loïez

    2002-01-01

    Photo 01: Professor Dr. Che-Ho Wei signing the Guest Book with CERN Director-General, L. Maiani. Photo 02: Professor Dr. Che-Ho Wei. Photo 03::Professor Dr. Che-Ho Wei shaking hands with CERN Director-General, L. Maiani.

  20. Los marcadores che y boludo: ¿un caso de rivalidad conversacional?

    Directory of Open Access Journals (Sweden)

    Markéta Šmídová

    2016-11-01

    Full Text Available It has been recently suggested that the Argentinian conversational marker che is being replaced by another typical expression, boludo. The purpose of the present paper is to provide a pilot comparative study of these two Argentinian markers in order to examine their free interchangeability and to refute it eventually. A commutation test has been used as a basic tool to compare the behavior and functions of che and boludo and the results have helped to reveal contexts in which it would be inadmissible or inappropriate to employ boludo instead of che due to the possible violation of politeness norms. In the article, che and boludo are considered mainly from the sociolinguistic and pragmatic approaches although some important cultural phenomena are discussed as well.

  1. I sei numeri dell'universo le forze profonde che spiegano il cosmo

    CERN Document Server

    Rees, Martin

    2002-01-01

    È possibile che sei semplici numeri, sei costanti universali, diano conto dell'infinita varietà e della stupefacente complessità del cosmo? L'astrofisico Martin Rees ci mostra che non soltano ciò è possibile, ma in quei sei numeri sono scritti la storia, la struttura e il futuro dell'universo, e che perfino la comparsa della vita sulla terra, e dunque la nostra stessa esistenza, non sarebbe concepibile se uno solo di quei valori numerici, definiti nell'istante che segnò la nascita del mondo, fosse differente. I sei numeri dell'universo ci introducono così ad alcune delle questioni più profonde su cui si interroga oggi la scienza.

  2. Award ceremony for the "Crèche and School" competition

    CERN Multimedia

    Staff Association

    2018-01-01

    Whenever there is a competition, there are obviously participants – and especially winners! The awards ceremony for the competition to find a new name for the CERN Staff Association's Crèche and School took place on 15 May. During the ceremony, jointly led by Céline Grobon (President of the Crèche and School Steering Committee), Carole Dargagnon (Headmistress of the Crèche and School) and Jean-Baptiste Zenner (Staff Association delegate), the proposals selected by the jury were rewarded. The first place went to Marie-Luz Cavagna for her proposal "Le jardin des petits chercheurs", and the second place to Sarah Palluel for her proposal "Le Jardin des Zélectrons". Finally, Aude Mourey and Sandra Fleury tied for third place with their respective proposals "Les petits atomes" and "La crèche des particules". Can we find the winning name of the competition among...

  3. MSL Chemistry and Mineralogy X-Ray Diffraction X-Ray Fluorescence (CheMin) Instrument

    Science.gov (United States)

    Zimmerman, Wayne; Blake, Dave; Harris, William; Morookian, John Michael; Randall, Dave; Reder, Leonard J.; Sarrazin, Phillipe

    2013-01-01

    This paper provides an overview of the Mars Science Laboratory (MSL) Chemistry and Mineralogy Xray Diffraction (XRD), X-ray Fluorescence (XRF) (CheMin) Instrument, an element of the landed Curiosity rover payload, which landed on Mars in August of 2012. The scientific goal of the MSL mission is to explore and quantitatively assess regions in Gale Crater as a potential habitat for life - past or present. The CheMin instrument will receive Martian rock and soil samples from the MSL Sample Acquisition/Sample Processing and Handling (SA/SPaH) system, and process it utilizing X-Ray spectroscopy methods to determine mineral composition. The Chemin instrument will analyze Martian soil and rocks to enable scientists to investigate geophysical processes occurring on Mars. The CheMin science objectives and proposed surface operations are described along with the CheMin hardware with an emphasis on the system engineering challenges associated with developing such a complex instrument.

  4. Che a 1: recombinant expression, purification and correspondence to the natural form.

    Science.gov (United States)

    Barderas, Rodrigo; Villalba, Mayte; Rodríguez, Rosalía

    2004-12-01

    Pollinosis to chenopods is one of the main causes of allergy in desertic regions and it is increasing in the South of Europe and Western USA. Che a 1 is a major allergen for chenopod-allergic subjects and belongs to the Ole-e-1-like family of proteins. Pichia pastoris yeast has been used as expression system to produce the recombinant form of Che a 1 (rChe a 1). The allergen was isolated using a gel permeation column and reverse-phase/high-performance liquid chromatography. Molecular characterization was performed using Edman degradation, mass spectrometry and concanavalin A staining. Sera from patients allergic to chenopod pollen, as well as polyclonal and monoclonal antibodies raised against Ole e 1, were used in immunoblotting, ELISA and inhibition assays for immunological characterization of rChe a 1. The allergen was purified to homogeneity with a final yield of 15 mg/l of cell culture and showed a glycosylated character. N-terminal amino acid sequence of rChe a 1 and molecular mass were according to those of the protein isolated from chenopod pollen. The recombinant allergen maintained the IgG and IgE epitopes of the natural allergen deduced from the immunological assays. Structural and in vitro immunological properties of rChe a 1 produced in P. pastoris were equivalent to those of the natural form of the allergen and, thus, it could be used in testing patients allergic to chenopods. 2004 S. Karger AG, Basel.

  5. Overexpression, purification, crystallization and preliminary X-ray analysis of CheY4 from Vibrio cholerae O395

    International Nuclear Information System (INIS)

    Biswas, Maitree; Khamrui, Susmita; Sen, Udayaditya; Dasgupta, Jhimli

    2011-01-01

    The chemotaxis response regulator CheY4 from V. cholerae has been cloned, overexpressed, purified and crystallized in monoclinic and hexagonal space groups; the crystals diffracted to 1.67 and 1.9 Å resolution, respectively. Chemotaxis and motility greatly influence the infectivity of Vibrio cholerae, although the role of chemotaxis genes in V. cholerae pathogenesis is poorly understood. In contrast to the single copy of CheY found in Escherichia coli and Salmonella typhimurium, four CheYs (CheY1–CheY4) are present in V. cholerae. While insertional disruption of the cheY4 gene results in decreased motility, insertional duplication of this gene increases motility and causes enhanced expression of the two major virulence genes. Additionally, cheY3/cheY4 influences the activation of the transcription factor NF-κB, which triggers the generation of acute inflammatory responses. V. cholerae CheY4 was cloned, overexpressed and purified by Ni–NTA affinity chromatography followed by gel filtration. Crystals of CheY4 grown in space group C2 diffracted to 1.67 Å resolution, with unit-cell parameters a = 94.4, b = 31.9, c = 32.6 Å, β = 96.5°, whereas crystals grown in space group P3 2 21 diffracted to 1.9 Å resolution, with unit-cell parameters a = b = 56.104, c = 72.283 Å, γ = 120°

  6. The Azospirillum brasilense Che1 chemotaxis pathway controls swimming velocity, which affects transient cell-to-cell clumping.

    Science.gov (United States)

    Bible, Amber; Russell, Matthew H; Alexandre, Gladys

    2012-07-01

    The Che1 chemotaxis-like pathway of Azospirillum brasilense contributes to chemotaxis and aerotaxis, and it has also been found to contribute to regulating changes in cell surface adhesive properties that affect the propensity of cells to clump and to flocculate. The exact contribution of Che1 to the control of chemotaxis and flocculation in A. brasilense remains poorly understood. Here, we show that Che1 affects reversible cell-to-cell clumping, a cellular behavior in which motile cells transiently interact by adhering to one another at their nonflagellated poles before swimming apart. Clumping precedes and is required for flocculation, and both processes appear to be independently regulated. The phenotypes of a ΔaerC receptor mutant and of mutant strains lacking cheA1, cheY1, cheB1, or cheR1 (alone or in combination) or with che1 deleted show that Che1 directly mediates changes in the flagellar swimming velocity and that this behavior directly modulates the transient nature of clumping. Our results also suggest that an additional receptor(s) and signaling pathway(s) are implicated in mediating other Che1-independent changes in clumping identified in the present study. Transient clumping precedes the transition to stable clump formation, which involves the production of specific extracellular polysaccharides (EPS); however, production of these clumping-specific EPS is not directly controlled by Che1 activity. Che1-dependent clumping may antagonize motility and prevent chemotaxis, thereby maintaining cells in a metabolically favorable niche.

  7. A CheR/CheB fusion protein is involved in cyst cell development and chemotaxis in Azospirillum brasilense Sp7.

    Science.gov (United States)

    Wu, Lixian; Cui, Yanhua; Hong, Yuanyuan; Chen, Sanfeng

    2011-12-20

    We here report the sequence and functional analysis of cstB of Azospirillum brasilense Sp7. The predicted cstB contains C-terminal two PAS domains and N-terminal part which has similarity with CheB-CheR fusion protein. cstB mutants had reduced swarming ability compared to that of A. brasilense wild-type strain, implying that cstB was involved in chemotaxis in A. brasilense. A microscopic analysis revealed that cstB mutants developed mature cyst cells more quickly than wild type, indicating that cstB is involved in cyst formation. cstB mutants were affected in colony morphology and the production of exopolysaccharides (EPS) which are essential for A. brasilense cells to differentiate into cyst-like forms. These observations suggested that cstB was a multi-effector involved in cyst development and chemotaxis in A. brasilense. Copyright © 2010 Elsevier GmbH. All rights reserved.

  8. Il lungo freddo storia di Bruno Pontecorvo, lo scienziato che scelse l'URSS

    CERN Document Server

    Mafai, Miriam

    2012-01-01

    Nelle parole della grande giornalista recentemente scomparsa, la documentata narrazione della storia di Bruno Pontecorvo, fisico nucleare di fama mondiale che, nel pieno della Guerra fredda, scelse di abbandonare l'Occidente e di lavorare e vivere nell'Unione Sovietica. Grazie alla capacità della Mafai nel ricostruire gli eventi cruciali della vita di Pontecorvo in un nuovo quadro rivelatore, "Il lungo freddo" non offre solo un'inedita prospettiva sulla drammatica corsa alla bomba atomica - dalle decisive scoperte del Progetto Manhattan alla tragica esplosione di Hiroshima, dalla prima atomica sovietica alla bomba all'idrogeno - ma rappresenta soprattutto la memoria collettiva di una generazione che ha posto la politica al centro delle proprie scelte di vita. E svela i drammi umani di un conflitto che per più di quarant'anni ha diviso il mondo.

  9. The new Meyrin crèche takes its first steps

    CERN Multimedia

    2008-01-01

    The new Meyrin crèche was inaugurated on 10 October and already caters for 16 children of CERN personnel. Copyright: Laurent Barlier. Copyright: Robert Tillmann. At the end of August, the new Meyrin crèche in Champs-Fréchets, the Espace de Vie Enfantine (EVE), welcomed its first intake of infants. They included 16 children of members of the CERN personnel who are benefiting from the agreement signed in 2007 with the commune of Meyrin (see Bulletin n°43&44/2007). The crèche was officially inaugurated on 10 October with several CERN representatives in attendance, including HR Department Head, Enrico Chiaveri, and Head of the Relations with the Host States Service, Friedmann Eder. The following day, EVE held an open day for the inhabitants of Meyrin and interested members of the CERN personnel. The new 1516 m2 building ‘s spaces have very clean and ...

  10. Storie ‘vere’ ed eroine dei romanzi. Rappresentare la Somalia in 'Ilaria Alpi. La ragazza che voleva raccontare l’inferno' e 'Non dirmi che hai paura'

    Directory of Open Access Journals (Sweden)

    Simone Brioni

    2016-09-01

    Full Text Available ‘True’ Stories and Heroines in Novels: The Representation of Somalia in Ilaria Alpi: The Young Woman Who Wanted to Narrate Hell and Don’t Tell Me You Are AfraidThis article analyses Gigliola Alvisi’s Ilaria Alpi: La ragazza che voleva raccontare l’inferno [Ilaria Alpi: The Young Woman Who Wanted to Narrate the Hell] (2014 and Giuseppe Catozzella’s Non dirmi che hai paura [Don’t Tell Me You Are Afraid] (2014, two novels that deal with two recent events in Somali and Italian history, the killing of the journalist Ilaria Alpi in Mogadishu in 1994 and the death of Samia Yosuf Omar while she was trying to reach the Italian shores from Libya by boat. Alvisi’s text is analysed in comparison with other fictional and journalistic representations of Ilaria Alpi, while Non dirmi che hai paura is examined through what Catozzella considers the two constitutive dimensions of the novel: documentation and identification. Drawing on Stefano Jossa’s reflections on the construction of literary heroes, the article challenges Alvisi’s and Catozzella’s claims that they represent ‘true stories’. The article also argues that the main characters of these literary works are portrayed as heroines and role models for the emancipation of Muslim women.

  11. Crèche and School: Open Day on Saturday, 3 March

    CERN Multimedia

    EVE et École

    2018-01-01

    Open Day at Crèche and School of the CERN Staff Association Are you considering enrolling your child to the Crèche and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 3 March 2018 from 10 to 12 am It will be our pleasure to present to you our structure, its projects and premises, and answer any questions you may have. Please sign up for one of the two sessions via Doodle before Wednesday 28 February 2018: https://doodle.com/poll/3qvrb6m73pktqbft

  12. Il fantasma dell'universo che cos'è il neutrino

    CERN Document Server

    Votano, Lucia

    2015-01-01

    Ben prima della luce, a un decimillesimo di secondo dal Big Bang, i neutrini sono apparsi nell'universo. Dopo un secondo il brodo primordiale si era raffreddato abbastanza da consentire loro di muoversi liberi e ancora oggi, dopo quasi quattordici miliardi di anni, sono numerosissimi. Ma che cosa sono i neutrini? Elusivi come fantasmi, camaleontici, viaggiano indenni attraverso la materia arrivando dritti sino a noi dagli angoli più remoti e nascosti dell'universo. Per saperne di più seguiremo i fisici che li studiano in laboratori sotterranei o in luoghi estremi come i ghiacciai polari o le profondità marine.

  13. A crèche for CERN staff The Staff Association project

    CERN Multimedia

    Association du personnel

    2006-01-01

    For many years, the Staff Association has supported the demand for the creation of a crèche for the children of CERN staff. Several studies have been carried out without leading to a concrete plan. The fact that the CERN population is getting younger and the shortage of local facilities have led to a more urgent demand for this type of social service over the past few years. Furthermore, the Equal Opportunities Panel had already recommended that crèche places be made available.

  14. Demonstrating the Open Data Repository's Data Publisher: The CheMin Database

    Science.gov (United States)

    Stone, N.; Lafuente, B.; Bristow, T.; Pires, A.; Keller, R. M.; Downs, R. T.; Blake, D.; Dateo, C. E.; Fonda, M.

    2018-04-01

    The Open Data Repository's Data Publisher aims to provide an easy-to-use software tool that will allow researchers to create and publish database templates and related data. The CheMin Database developed using this framework is shown as an example.

  15. Trent'anni che sconvolsero la fisica la storia della teoria dei quanti

    CERN Document Server

    Gamow, George

    1993-01-01

    Gli anni dal 1900 al 1930 hanno portato un profondo mutamento nella visione che l'uomo aveva dell'universo: tra la prima idea di Max Planck dei quanti di luce nel 1900, e la previsione dell'esistenza delle antiparticelle formulata da P. A. M. Dirac nel 1929, corre un periodo di emozionanti progressi nel campo della fisica teorica.

  16. Reading Strategies: Issues in the Computerization of Machiavelli's "Il demonio che prese moglie".

    Science.gov (United States)

    Morgan, Leslie Zarker

    1994-01-01

    The ideal computer-based foreign language reading program must include cognitive background, a learning taxonomy, sound computer design, and knowledge of what is needed for the specific language. Machiavelli's "Il demonia che prese moglie" is chosen for study due to its historical interest. (63 references) (CK)

  17. Inwentarz fary chełmińskiej i jej biblioteki z XV wieku

    Directory of Open Access Journals (Sweden)

    Mateusz Superczyński

    2017-07-01

    Full Text Available Artykuł niniejszy prezentuje edycję nieznanego szerzej dotychczas inwentarza fary chełmińskiej i wykazu księgozbioru biblioteki farnej z XV w., które znajdują się w księdze miejskiej Chełmna – kopiariuszu przywilejów i dokumentów, założonej przez pisarza Konrada Bitschina w 1431 r. Przekaz źródłowy daje obraz biblioteki fary chełmińskiej jako ośrodka kultury w XV-wiecznym Chełmnie. Pozwala także na porównanie trzech zachowanych spisów księgozbiorów średniowiecznego Chełmna, a więc z klasztoru Franciszkanów z XIII wieku, biblioteki farnej i zrekonstruowanego spisu biblioteki Braci Wspólnego Życia z końca XV stulecia, które pochodzą z różnych okresów i odzwierciedlają przemiany w duchowości, teologii i zainteresowaniach naukowych ówczesnych elit intelektualnych miasta. Podczas gdy księgozbiory biblioteki franciszkanów czy farnej oddają ducha średniowiecznej scholastyki czy nominalizmu, to wydania, które posiadali Bracia Wspólnego Życia, zwiastują nadejście humanizmu. Odnotowane przez pisarza miejskiego tytuły, mimo zniekształceń,pozwalają także na identyfikację i odnalezienie wśród nich fundamentalnych dla średniowiecznej teologii, liturgii, historii i filozofii dzieł.

  18. The Emotional Communication in Hearing Questionnaire (EMO-CHeQ): Development and Evaluation.

    Science.gov (United States)

    Singh, Gurjit; Liskovoi, Lisa; Launer, Stefan; Russo, Frank

    2018-06-11

    The objectives of this research were to develop and evaluate a self-report questionnaire (the Emotional Communication in Hearing Questionnaire or EMO-CHeQ) designed to assess experiences of hearing and handicap when listening to signals that contain vocal emotion information. Study 1 involved internet-based administration of a 42-item version of the EMO-CHeQ to 586 adult participants (243 with self-reported normal hearing [NH], 193 with self-reported hearing impairment but no reported use of hearing aids [HI], and 150 with self-reported hearing impairment and use of hearing aids [HA]). To better understand the factor structure of the EMO-CHeQ and eliminate redundant items, an exploratory factor analysis was conducted. Study 2 involved laboratory-based administration of a 16-item version of the EMO-CHeQ to 32 adult participants (12 normal hearing/near normal hearing (NH/nNH), 10 HI, and 10 HA). In addition, participants completed an emotion-identification task under audio and audiovisual conditions. In study 1, the exploratory factor analysis yielded an interpretable solution with four factors emerging that explained a total of 66.3% of the variance in performance the EMO-CHeQ. Item deletion resulted in construction of the 16-item EMO-CHeQ. In study 1, both the HI and HA group reported greater vocal emotion communication handicap on the EMO-CHeQ than on the NH group, but differences in handicap were not observed between the HI and HA group. In study 2, the same pattern of reported handicap was observed in individuals with audiometrically verified hearing as was found in study 1. On the emotion-identification task, no group differences in performance were observed in the audiovisual condition, but group differences were observed in the audio alone condition. Although the HI and HA group exhibited similar emotion-identification performance, both groups performed worse than the NH/nNH group, thus suggesting the presence of behavioral deficits that parallel self

  19. Open Day at Crèche and School of the CERN Staff Association

    CERN Multimedia

    Staff Association

    2018-01-01

    In the morning of Saturday, 3 March 2018, the Crèche and School of the CERN Staff Association opened its doors for parents who wished to visit the establishment. Once again, the Open Day was a great success and brought together more than 50 families for two information sessions, which included: a general presentation of the establishment by the Headmistress, and a visit of the facilities led by the Headmistress and her deputy. At the end of the visit, parents were invited for a drink. This was an opportunity for both parents and professionals to have interesting discussions regarding the general conditions of the establishment and the pedagogical approach applied in the crèche and the school. The management team was delighted to offer the parents the opportunity to participate in this event, where everyone could express their views, ask questions and find answers in a friendly and relaxed atmosphere.

  20. Sulle ipotesi che stanno alla base della geometria e altri scritti scientifici e filosofici

    CERN Document Server

    Riemann, Bernhard

    1994-01-01

    Il volume raccoglie, oltre al testo della lezione del 1854 che dà il titolo all'opera, alcuni scritti di carattere scientifico e filosofico di Riemann. A saggi di argomento scientifico si affiancano scritti di argomento più direttamente metodologico. La concezione della scienza che ci viene offerta da questi scritti è assai significativa del personaggio e della sua epoca. Per Riemann la matematica non è un mero strumento esteriore da applicare, appunto dall'esterno, ai fenomeni. Al contrario, essa consente di spingersi con il rigore necessario oltre alla superficie dei fenomeni e di penetrare sempre più a fondo nella realtà, nell'ottica di un sistema unitario e quasi metafisico del sapere scientifico.

  1. Il museo che non c’è. Note sulla dispersione del patrimonio in Gran Bretagna

    Directory of Open Access Journals (Sweden)

    Caroline Patey

    2011-03-01

    Full Text Available Indifferente alla loro recente moltiplicazione come al sodalizio che vi si celebra con l’architettura di grido, un fantasma si aggira per i musei. Sordo al nome di Jean Nouvel (Reina Sofia, Louvre quanto a quelli di Herzog & De Meuron (Tate Modern, impermeabile ai fasti del British Museum (Norman Foster come ai restauri della Tate Britain (James Stirling, disinteressato alle fortune del ‘nuovo’ Victoria and Albert Museum e malinconico come si addice alla sua natura, il fantasma invita a interrogare tanta luccicante spettacolarità e forse a non dimenticare che, per quanto custode di memoria e guardiano di culture, il museo è anche il luogo dove vengono consumate, direttamente o meno, amnesie e damnatio memoriae e in nome del quale continuano a perpetrarsi non poche violazioni e disseminazioni.

  2. Site-specific and synergistic stimulation of methylation on the bacterial chemotaxis receptor Tsr by serine and CheW

    Directory of Open Access Journals (Sweden)

    Weis Robert M

    2005-03-01

    Full Text Available Abstract Background Specific glutamates in the methyl-accepting chemotaxis proteins (MCPs of Escherichia coli are modified during sensory adaptation. Attractants that bind to MCPs are known to increase the rate of receptor modification, as with serine and the serine receptor (Tsr, which contributes to an increase in the steady-state (adapted methylation level. However, MCPs form ternary complexes with two cytoplasmic signaling proteins, the kinase (CheA and an adaptor protein (CheW, but their influences on receptor methylation are unknown. Here, the influence of CheW on the rate of Tsr methylation has been studied to identify contributions to the process of adaptation. Results Methyl group incorporation was measured in a series of membrane samples in which the Tsr molecules were engineered to have one available methyl-accepting glutamate residue (297, 304, 311 or 493. The relative rates at these sites (0.14, 0.05, 0.05 and 1, respectively differed from those found previously for the aspartate receptor (Tar, which was in part due to sequence differences between Tar and Tsr near site four. The addition of CheW generated unexpectedly large and site-specific rate increases, equal to or larger than the increases produced by serine. The increases produced by serine and CheW (added separately were the largest at site one, ~3 and 6-fold, respectively, and the least at site four, no change and ~2-fold, respectively. The rate increases were even larger when serine and CheW were added together, larger than the sums of the increases produced by serine and CheW added separately (except site four. This resulted in substantially larger serine-stimulated increases when CheW was present. Also, CheW enhanced methylation rates when either two or all four sites were available. Conclusion The increase in the rate of receptor methylation upon CheW binding contributes significantly to the ligand specificity and kinetics of sensory adaptation. The synergistic effect of

  3. LA LINGUA FILMATA: "L'UOMO CHE VERRÀ" DI GIORGIO DIRITTI

    Directory of Open Access Journals (Sweden)

    Marta Idini

    2016-02-01

    Full Text Available La lingua filmata appare oggi uno dei campi linguistici in cui il dialetto torna ad essere scelta registica e veicolo di nuove istanze comunicative, in stretta relazione con un nuovo modo di intendere e praticare il cinema. Il presente articolo introduce il lettore alla consuetudine cinematografica del dialetto, analizzandone la presenza e le funzioni che gli sono state attribuite nei decenni trascorsi e presenti, e guarda a L’Uomo che verrà quale espressione attuale di una nuova risorgenza dialettale all’interno delle pellicole nostrane. Attraverso un’analisi attenta dei fenomeni vernacolari in esso presenti, l’indagine si sofferma sulle motivazioni e l’efficacia comunicativa cui perviene l’uso del dialetto e si interroga su quale grado di realismo o mimesi linguistica Diritti abbia raggiunto. Language of film: "L’uomo che verrà" by Giorgio DirittiLanguage in films is one of the fields where dialect becomes a choice and a vehicle for new communicative demands, closely related the new way of understanding and practicing the cinema. This article introduces the reader to the use of dialect in films, analyzing the presence and functions that have been attributed to it in the past and present decades, and looks at L’Uomo che verrà as an expression of the new resurgence of dialect in Italian films. Through careful analysis of the vernacular, the paper focuses on the motivations and the communicative effectiveness of the use of dialect and questions the degree of realism or linguistic mimesis that Diritti was able to reach.

  4. CheShift-2 resolves a local inconsistency between two X-ray crystal structures

    International Nuclear Information System (INIS)

    Vila, Jorge A.; Sue, Shih-Che; Fraser, James S.; Scheraga, Harold A.; Dyson, H. Jane

    2012-01-01

    Since chemical shifts provide important and relatively accessible information about protein structure in solution, a Web server, CheShift-2, was developed for structure interrogation, based on a quantum mechanics database of 13 C α chemical shifts. We report the application of CheShift-2 to a local inconsistency between two X-ray crystal structures (PDB IDs 1IKN and 1NFI) of the complex between the p65/p50 heterodimer of NFκB and its inhibitor IκBα. The availability of NMR resonance assignments that included the region of the inconsistency provided an opportunity for independent validation of the CheShift-2 server. Application of the server showed that the 13 C α chemical shifts measured for the Gly270-Pro281 sequence close to the C-terminus of IκBα were unequivocally consistent with the backbone structure modeled in the 1IKN structure, and were inconsistent with the 1NFI structure. Previous NOE measurements had demonstrated that the position of a tryptophan ring in the region immediately N-terminal in this region was not consistent with either structure. Subsequent recalculation of the local structure in this region, based on the electron density of the deposited structure factors for 1IKN, confirmed that the local backbone structure was best modeled by 1IKN, but that the rotamer of Trp258 is consistent with the 1NFI structure, including the presence of a hydrogen bond between the ring NεH of Trp258 and the backbone carbonyl group of Gln278. The consensus between all of these measures suggests that the CheShift-2 server operates well under circumstances in which backbone chemical shifts are available but where local plasticity may render X-ray structural data ambiguous.

  5. Report to EuCheMS Division of Analytical Chemistry on CITAC Activity

    DEFF Research Database (Denmark)

    Andersen, Jens Enevold Thaulov; Wegsheider, Wolfhard

    Although the CITAC organisation [1] was founded on traceability, it embraces a variety of concepts allocated specifically to quality assurance. Collaboration with other organisations that promote practices and procedures of quality assurance is essential, and appointed liaison persons...... are encouraged to support this effort. In continuation of this aim a close contact to EuCheMS is desired together with contacts to IUPAC, ISO/REMCO, BIPM/CCQM, ILAC, EA, APLAC, EUROMET, SIM, APMP, AOACI, IAEA, IFCC and SADCMET....

  6. La macchina che cerca Dio. Nasce LHC forse scoprira' Higgs elusiva particella della creazione

    CERN Multimedia

    Bianucci, P

    2003-01-01

    "LEON Lederman, premio Nobel per la fisica, l'ha misticamente definita la particella di Dio perche' sarebbe il pilastro sul quale si appoggia tutta la materia dell'universo che conosciamo. Piu' tecnicamente, e' la "particella di Higgs", un bosone previsto dal Modello Standard del microcosmo la cui esistenza sarebbe necessaria per giustificare, anche quantitativamente, la massa di tutte le particelle" (1/2 page).

  7. The Pseudomonas aeruginosa chemotaxis methyltransferase CheR1 impacts on bacterial surface sampling.

    Directory of Open Access Journals (Sweden)

    Juliane Schmidt

    Full Text Available The characterization of factors contributing to the formation and development of surface-associated bacterial communities known as biofilms has become an area of intense interest since biofilms have a major impact on human health, the environment and industry. Various studies have demonstrated that motility, including swimming, swarming and twitching, seems to play an important role in the surface colonization and establishment of structured biofilms. Thereby, the impact of chemotaxis on biofilm formation has been less intensively studied. Pseudomonas aeruginosa has a very complex chemosensory system with two Che systems implicated in flagella-mediated motility. In this study, we demonstrate that the chemotaxis protein CheR1 is a methyltransferase that binds S-adenosylmethionine and transfers a methyl group from this methyl donor to the chemoreceptor PctA, an activity which can be stimulated by the attractant serine but not by glutamine. We furthermore demonstrate that CheR1 does not only play a role in flagella-mediated chemotaxis but that its activity is essential for the formation and maintenance of bacterial biofilm structures. We propose a model in which motility and chemotaxis impact on initial attachment processes, dispersion and reattachment and increase the efficiency and frequency of surface sampling in P. aeruginosa.

  8. X-Ray Diffraction on Mars: Scientific Discoveries Made by the CheMin Instrument

    Science.gov (United States)

    Rampe, E. B.; Blake, D. F.; Ming, D. W.; Bristow, T. F.

    2017-01-01

    The Mars Science Laboratory Curiosity landed in Gale crater in August 2012 with the goal to identify and characterize habitable environments on Mars. Curiosity has been studying a series of sedimentary rocks primarily deposited in fluviolacustrine environments approximately 3.5 Ga. Minerals in the rocks and soils on Mars can help place further constraints on these ancient aqueous environments, including pH, salinity, and relative duration of liquid water. The Chemistry and Mineralogy (CheMin) X-ray diffraction and X-ray fluorescence instrument on Curiosity uses a Co X-ray source and charge-coupled device detector in transmission geometry to collect 2D Debye-Scherrer ring patterns of the less than 150 micron size fraction of drilled rock powders or scooped sediments. With an angular range of approximately 2.52deg 20 and a 20 resolution of approximately 0.3deg, mineral abundances can be quantified with a detection limit of approximately 1-2 wt. %. CheMin has returned quantitative mineral abundances from 16 mudstone, sandstone, and aeolian sand samples so far. The mineralogy of these samples is incredibly diverse, suggesting a variety of depositional and diagenetic environments and different source regions for the sediments. Results from CheMin have been essential for reconstructing the geologic history of Gale crater and addressing the question of habitability on ancient Mars.

  9. Pretreatment with P-Nitrophenyl Phosphoramides: Spontaneous Reactivation of Blood ChE after Oral Administration to Guinea Pigs

    National Research Council Canada - National Science Library

    Polhuijs, M

    1997-01-01

    ... and of the reference compounds pyridostigmine and physostigmine has been studied in the guinea pig, as determined by measuring spontaneous reactivation of blood ChE inhibited by these pretreatment compounds...

  10. Distinct Domains of CheA Confer Unique Functions in Chemotaxis and Cell Length in Azospirillum brasilense Sp7.

    Science.gov (United States)

    Gullett, Jessica M; Bible, Amber; Alexandre, Gladys

    2017-07-01

    Chemotaxis is the movement of cells in response to gradients of diverse chemical cues. Motile bacteria utilize a conserved chemotaxis signal transduction system to bias their motility and navigate through a gradient. A central regulator of chemotaxis is the histidine kinase CheA. This cytoplasmic protein interacts with membrane-bound receptors, which assemble into large polar arrays, to propagate the signal. In the alphaproteobacterium Azospirillum brasilense , Che1 controls transient increases in swimming speed during chemotaxis, but it also biases the cell length at division. However, the exact underlying molecular mechanisms for Che1-dependent control of multiple cellular behaviors are not known. Here, we identify specific domains of the CheA1 histidine kinase implicated in modulating each of these functions. We show that CheA1 is produced in two isoforms: a membrane-anchored isoform produced as a fusion with a conserved seven-transmembrane domain of unknown function (TMX) at the N terminus and a soluble isoform similar to prototypical CheA. Site-directed and deletion mutagenesis combined with behavioral assays confirm the role of CheA1 in chemotaxis and implicate the TMX domain in mediating changes in cell length. Fluorescence microscopy further reveals that the membrane-anchored isoform is distributed around the cell surface while the soluble isoform localizes at the cell poles. Together, the data provide a mechanism for the role of Che1 in controlling multiple unrelated cellular behaviors via acquisition of a new domain in CheA1 and production of distinct functional isoforms. IMPORTANCE Chemotaxis provides a significant competitive advantage to bacteria in the environment, and this function has been transferred laterally multiple times, with evidence of functional divergence in different genomic contexts. The molecular principles that underlie functional diversification of chemotaxis in various genomic contexts are unknown. Here, we provide a molecular

  11. L’immaginazione al lavoro. Che cosa e come conosciamo dal romanzo

    Directory of Open Access Journals (Sweden)

    Gianluca Consoli

    2011-12-01

    Full Text Available L’articolo delinea i fondamenti di un’epistemologia del romanzo, rispondendo alle domande di base: che cosa e come possiamo conoscere attraverso il romanzo. A partire dalla definizione del romanzo come racconto di finzione, viene sviluppata  una posizione di cognitivismo radicale, per la quale il romanzo (a produce conoscenza modale; (b giustifica questa conoscenza in base al principio della verosimiglianza; (c favorisce l’apprendimento per esperienza in virtù dell’esemplificazione immaginativa. Le tesi proposte vengono corroborate in riferimento ai recenti dati sperimentali ottenuti dalle scienze cognitive, in particolare dalla psicologia cognitiva, sull’immaginazione, la finzione, la simulazione.

  12. Crew Health Care System (CHeCS) Design Research, Documentations, and Evaluations

    Science.gov (United States)

    CLement, Bethany M.

    2011-01-01

    The Crew Health Care System (CHeCS) is a group within the Space Life Science Directorate (SLSD) that focuses on the overall health of astronauts by reinforcing the three divisions - the Environmental Maintenance System (EMS), the Countermeasures System (CMS), and the Health Maintenance System (HMS). This internship provided opportunity to gain knowledge, experience, and skills in CHeCS engineering and operations tasks. Various and differing tasks allowed for occasions to work independently, network to get things done, and show leadership abilities. Specific exercises included reviewing hardware certification, operations, and documentation within the ongoing Med Kit Redesign (MKR) project, and learning, writing, and working various common pieces of paperwork used in the engineering and design process. Another project focused on the distribution of various pieces of hardware to off-site research facilities with an interest in space flight health care. The main focus of this internship, though, was on a broad and encompassing understanding of the engineering process as time was spent looking at each individual step in a variety of settings and tasks.

  13. Finally a crèche at CERN, thanks to the Staff Association

    CERN Multimedia

    Staff Association

    2013-01-01

    Setting up at CERN a collective structure to mind children younger than two years, a so-called “crèche”, has been discussed at least since the early 1990s. Then, in February 2001, the Equal Opportunities Advisory Panel produced a memo to the Director of Administration in which it “invites the CERN Management to re-consider the possibility of creating a crèche at CERN”. As a result an ad hoc task force (“Bethléem”) was set up, which based its work on an informal questionnaire sent to CERN families with small children. Its study came up with some relevant parameters for “should CERN Management intend to undertake a minimal effort toward solving the crèche problem for its staff members”. Nothing was undertaken at that time. In the framework of the 2005 five yearly review “Working Group 6: Crèche” made another study of public and private  cr&a...

  14. La chiesa che si fa presepe: visita al Presepe della Chiesa del Rosario di Mottola

    Directory of Open Access Journals (Sweden)

    Susy Bigontina

    2012-01-01

    Full Text Available Abstract – IT In occasione del Natale, la vie della città di Mottola (Ta, Italia fioriscono di presepi, che i visitatori possono liberamente ammirare. Quella del presepe è una tradizione molto sentita dagli abitanti della cittadina pugliese, nella quale viene allestito un grande presepe che occupa e cela l’intera navata della Chiesa del Ss. Sacramento e Rosario. Gli allestitori, appartenenti ad una storica Confraternita locale dedicano settimane a costruire un presepe plastico della Betlemme nella notte di Natale, che mescola icone della tradizione italiana della Natività – alcuni pezzi, ad esempio, sono preziosi manufatti di scuola napoletana – ed elementi naturali tipici della terra delle gravine. Il presepe del Rosario, inoltre, mostra un’interessante ricerca dell’effetto prospettico e forse un ancor più interessante cornice di ciclicità, ottenuta tramite l’alternanza del giorno e della notte, musica ed effetti sonori, che proietta la scena verso un orizzonte atemporale. Questo articolo nasce dalla visita degli autori a Mottola, in occasione della presentazione del libro La Settimana Santa a Mottola, di cui essi sono stati co-autori, e quindi rappresenta il frutto di un nuovo capitolo di lavoro con la viva comunità mottolese ed i suoi riti. Abstract – FR Pour l'occasion de Noël, les rues de la villes de Mottola (Ta, Italie sont embellies de crèches que les visiteurs peuvent admirer en toute liberté. La tradition de la crèche est une tradition très ressentie par les habitants de la petite ville pugliaise, dans laquelle on prépare une grande crèche qui occupe et cache tout le nef de l'église du très Ss. Sacramento e Rosario. Les préparateurs qui appartiennent à une Confrérie historique locale dédient plusieurs semaines pour la construction d'une crèche comme celle de Betleemme de la nuit de Noël - certaines pièces, par exemple, sont de précieux produits manufacturés provenant de l'école napolitaine - et

  15. Tempi che cambiano, luoghi che si trasformano: i mutamenti nei nuraghi fra l’età del Bronzo ed il Primo Ferro

    Directory of Open Access Journals (Sweden)

    Mauro Perra

    2017-01-01

    Full Text Available Riassunto: Il lungo percorso della Civiltà Nuragica, compreso fra XVII e X-IX secolo a.C., si caratterizza come un’epoca di grandi trasformazioni che si susseguono nel tempo e lasciano visibili tracce in un paesaggio mutevole, come in un succedersi di macroscopiche unità stratigrafiche. Si trasformano profondamente così non solo i monumenti ed il paesaggio, ma anche le stesse strutture sociali e politiche delle comunità nuragiche fino alla trasfigurazione del ricordo in mito nei centri cerimoniali o santuari. Abstract: The long trajectory of the Nuragic civilisation (17th - 10th/9th centuries B.C. is characterised by a succession of dramatic changes leaving visible traces in a varying landscape, like stratigraphy on a regional scale. These changes affect not only the Nuragic monuments and landscape but also the social and political institutions of Nuragic communities, culminating in a transfiguration of memory and a new mythology apparent in ceremonial centres and sanctuaries.

  16. Serum cholinesterase polymorphism (CHE1 and CHE2 loci) among several Indian groups from Amazon region of Brazil, and segregation of the C5 variant in families.

    Science.gov (United States)

    Guerreiro, J F; Santos, S E; Aguiar, G F

    1989-04-01

    Eight Indian tribes from the Amazon region of Brazil (Araweté, Arara, Yamamadi, Kararaô, Karitiana, Waiampi, Surui and Cinta Larga) were studied for the distribution of the atypical and C5 variants of serum cholinesterase. None of them presented the CHE1*A allele, but the C5 variant was found in the Araweté (20.4%), Kararaô (15.6%), Karitiana (50.5%), Surui (12.3%) and Cinta Larga (19.6%) tribes. The frequency of the C5+ phenotype in the Karitiana is the highest reported thus far in human populations. Segregation studies considering the C5 variant were made among the Karitiana, and also among the Urubu-Kaapor and Munduruku tribes previously studied by Guerreiro et al [1987a, 1987b]. Most of the data were in agreement with the genetic hypothesis, but they also revealed a significant lack of the C5+ phenotype in offspring from C5+ X C5+ matings, as well as the occurrence of two C5+ children from C5- X C5- unions, in the Urubu-Kaapor tribe.

  17. The new "Jardin de Capucine" crèche brings a breath of fresh air for young CERN parents

    CERN Multimedia

    HR Department

    2011-01-01

    On 19 January 2011, CERN's Director-General, Rolf Heuer, signed an agreement with the company "Le Jardin de Zébulon" for the provision of 40 places at the "Jardin de Capucine", a new private crèche due to open this autumn.   In 2008, the "Jardin de Zébulon", a private bilingual crèche for children aged 1 to 4, was opened by Ariane Boucheron at the Technoparc industrial estate in Saint-Genis Pouilly (France). The following year, the number of places was increased from 20 to 37 to meet demand. The "Jardin de Zébulon" has taken in a number of children of CERN personnel ever since it was created. With no let-up in the demand for new crèche places, Ariane Boucher is currently engaged in the construction of a new centre, the "Jardin de Capucine", next-door to the existing crèche. Forty places at the new crèche will...

  18. Data from the Mars Science Laboratory CheMin XRD/XRF Instrument

    Science.gov (United States)

    Vaniman, David; Blake, David; Bristow, Tom; DesMarais, David; Achilles, Cherie; Anderson, Robert; Crips, Joy; Morookian, John Michael; Spanovich, Nicole; Vasavada, Ashwin; hide

    2013-01-01

    The CheMin instrument on the Mars Science Laboratory (MSL) rover Curiosity uses a Co tube source and a CCD detector to acquire mineralogy from diffracted primary X-rays and chemical information from fluoresced X-rays. CheMin has been operating at the MSL Gale Crater field site since August 5, 2012 and has provided the first X-ray diffraction (XRD) analyses in situ on a body beyond Earth. Data from the first sample collected, the Rocknest eolian soil, identify a basaltic mineral suite, predominantly plagioclase (approx.An50), forsteritic olivine (approx.Fo58), augite and pigeonite, consistent with expectation that detrital grains on Mars would reflect widespread basaltic sources. Minor phases (each XRD. This amorphous component is attested to by a broad rise in background centered at approx.27deg 2(theta) (Co K(alpha)) and may include volcanic glass, impact glass, and poorly crystalline phases including iron oxyhydroxides; a rise at lower 2(theta) may indicate allophane or hisingerite. Constraints from phase chemistry of the crystalline components, compared with a Rocknest bulk composition from the APXS instrument on Curiosity, indicate that in sum the amorphous or poorly crystalline components are relatively Si, Al, Mg-poor and enriched in Ti, Cr, Fe, K, P, S, and Cl. All of the identified crystalline phases are volatile-free; H2O, SO2 and CO2 volatile releases from a split of this sample analyzed by the SAM instrument on Curiosity are associated with the amorphous or poorly ordered materials. The Rocknest eolian soil may be a mixture of local detritus, mostly crystalline, with a regional or global set of dominantly amorphous or poorly ordered components. The Rocknest sample was targeted by MSL for "first time analysis" to demonstrate that a loose deposit could be scooped, sieved to <150 microns, and delivered to instruments in the body of the rover. A drilled sample of sediment in outcrop is anticipated. At the time of writing this abstract, promising outcrops are

  19. Astrobiological Significance of Definitive Mineralogical Analysis of Martian Surface Samples Using the CheMin XRD/XRF Instrument

    Science.gov (United States)

    Feldman, S. M.; Blake, D. F.; Sarrazin, P.; Bish, D. L.; Chipera, S. J.; Vaniman, D. T.; Collins, S.

    2004-01-01

    The search for evidence of habitability, or of extant or extinct life on Mars, will initially be a search for evidence of past or present conditions supportive of life. The three key requirements for the emergence of life are thought to be liquid water; a suitable energy source; and chemical building blocks. CheMin is a miniaturized XRD/XRF (X-Ray diffraction / X-ray fluorescence) instrument which has been developed for definitive mineralogic analysis of soils and rocks on the Martian surface. The CheMin instrument can provide information that is highly relevant to each of these habitability requirements as summarized below.

  20. Fractional derivatives. An introduction; Derivate frazionarie. Che cosa sono, a cosa servono

    Energy Technology Data Exchange (ETDEWEB)

    Dattoli, G. [ENEA, Div. Fisica Applicata, Centro Ricerche Frascati, Rome (Italy)

    2001-07-01

    In this item is presented a brief survey of fractional calculus and of the relevant applications. In the work are discussed different points of view of the operation of fractional derivative and present a unifying definition. The role played by fractional derivatives and integrals within the framework of integral transform is analyzed. [Italian] In questo articolo si traccia un profilo del cosidetto calcolo frazionario e delle relative applicazioni a problemi di matematica pura ed applicata. Si discutono varie definizioni dell'operazione di derivata frazionaria, non tutte coincidenti fra loro, e si mostra come sia possibile proporre una definizione univoca che inglobi tutte le altre. Si analizza infine il ruolo giocato dalle derivate e dagli integrali frazionari e, piu' in generale, quello degli operatori differenziali ad esponente frazionario, nell'ambito della teoria delle rappresentazioni integrali.

  1. CheD: chemical database compilation tool, Internet server, and client for SQL servers.

    Science.gov (United States)

    Trepalin, S V; Yarkov, A V

    2001-01-01

    An efficient program, which runs on a personal computer, for the storage, retrieval, and processing of chemical information, is presented, The program can work both as a stand-alone application or in conjunction with a specifically written Web server application or with some standard SQL servers, e.g., Oracle, Interbase, and MS SQL. New types of data fields are introduced, e.g., arrays for spectral information storage, HTML and database links, and user-defined functions. CheD has an open architecture; thus, custom data types, controls, and services may be added. A WWW server application for chemical data retrieval features an easy and user-friendly installation on Windows NT or 95 platforms.

  2. Lessons Learned from the Crew Health Care System (CHeCS) Rack 1 Environmental Control and Life Support (ECLS) Design

    Science.gov (United States)

    Williams, David E.

    2006-01-01

    This paper will provide an overview of the International Space Station (ISS) Environmental Control and Life Support (ECLS) design of the Crew Health Care System (CHeCS) Rack 1 and it will document some of the lessons that have been learned to date for the ECLS equipment in this rack.

  3. Efficient Computation of Sparse Matrix Functions for Large-Scale Electronic Structure Calculations: The CheSS Library.

    Science.gov (United States)

    Mohr, Stephan; Dawson, William; Wagner, Michael; Caliste, Damien; Nakajima, Takahito; Genovese, Luigi

    2017-10-10

    We present CheSS, the "Chebyshev Sparse Solvers" library, which has been designed to solve typical problems arising in large-scale electronic structure calculations using localized basis sets. The library is based on a flexible and efficient expansion in terms of Chebyshev polynomials and presently features the calculation of the density matrix, the calculation of matrix powers for arbitrary powers, and the extraction of eigenvalues in a selected interval. CheSS is able to exploit the sparsity of the matrices and scales linearly with respect to the number of nonzero entries, making it well-suited for large-scale calculations. The approach is particularly adapted for setups leading to small spectral widths of the involved matrices and outperforms alternative methods in this regime. By coupling CheSS to the DFT code BigDFT, we show that such a favorable setup is indeed possible in practice. In addition, the approach based on Chebyshev polynomials can be massively parallelized, and CheSS exhibits excellent scaling up to thousands of cores even for relatively small matrix sizes.

  4. Molecular Interaction and Cellular Location of RecA and CheW Proteins in Salmonella enterica during SOS Response and Their Implication in Swarming.

    Science.gov (United States)

    Irazoki, Oihane; Aranda, Jesús; Zimmermann, Timo; Campoy, Susana; Barbé, Jordi

    2016-01-01

    In addition to its role in DNA damage repair and recombination, the RecA protein, through its interaction with CheW, is involved in swarming motility, a form of flagella-dependent movement across surfaces. In order to better understand how SOS response modulates swarming, in this work the location of RecA and CheW proteins within the swarming cells has been studied by using super-resolution microscopy. Further, and after in silico docking studies, the specific RecA and CheW regions associated with the RecA-CheW interaction have also been confirmed by site-directed mutagenesis and immunoprecipitation techniques. Our results point out that the CheW distribution changes, from the cell poles to foci distributed in a helical pattern along the cell axis when SOS response is activated or RecA protein is overexpressed. In this situation, the CheW presents the same subcellular location as that of RecA, pointing out that the previously described RecA storage structures may be modulators of swarming motility. Data reported herein not only confirmed that the RecA-CheW pair is essential for swarming motility but it is directly involved in the CheW distribution change associated to SOS response activation. A model explaining not only the mechanism by which DNA damage modulates swarming but also how both the lack and the excess of RecA protein impair this motility is proposed.

  5. Molecular interaction and cellular location of RecA and CheW proteins in Salmonella enterica during SOS response and their implication in swarming

    Directory of Open Access Journals (Sweden)

    Oihane Irazoki

    2016-10-01

    Full Text Available In addition to its role in DNA damage repair and recombination, the RecA protein, through its interaction with CheW, is involved in swarming motility, a form of flagella-dependent movement across surfaces. In order to better understand how SOS response modulates swarming, in this work the location of RecA and CheW proteins within the swarming cells has been studied by using super-resolution microscopy. Further, and after in silico docking studies, the specific RecA and CheW regions associated with the RecA-CheW interaction have also been confirmed by site-directed mutagenesis and immunoprecipitation techniques. Our results point out that the CheW distribution changes, from the cell poles to foci distributed in a helical pattern along the cell axis when SOS response is activated or RecA protein is overexpressed. In this situation, the CheW presents the same subcellular location as that of RecA, pointing out that the previously described RecA storage structures may be modulators of swarming motility. Data reported herein not only confirmed that the RecA-CheW pair is essential for swarming motility but it is directly involved in the CheW distribution change associated to SOS response activation. A model explaining not only the mechanism by which DNA damage modulates swarming but also how both the lack and the excess of RecA protein impair this motility is proposed.

  6. European analytical column No. 36 from the Division of Analytical Chemistry (DAC) of the European Association for Chemical and Molecular Sciences (EuCheMS)

    DEFF Research Database (Denmark)

    Karlberg, Bo; Emons, Hendrik; Andersen, Jens Enevold Thaulov

    2008-01-01

    European analytical column no. 36 from the division of analytical chemistry (DAC) of the European association for chemical and molecular sciences (EuCheMS)......European analytical column no. 36 from the division of analytical chemistry (DAC) of the European association for chemical and molecular sciences (EuCheMS)...

  7. El Che - más que médico

    Directory of Open Access Journals (Sweden)

    Natalia I. Osorio Curbelo

    2015-12-01

    Full Text Available Revolucionario, dirigente político, comandante guerrillero, intelectual y médico.  Uno de los íconos del siglo XX.  Nació en Rosario, Argentina, el 14 de junio de 1928. En 1938, con apenas 10 años, el padre le enseñó a jugar Ajedrez en el transcurso del año, deporte que no dejaría de practicar nunca más y lo estudiaría por siempre. En 1939 supo de la existencia de Cuba, pues teniendo 11 años, cuando vivía en Alta Gracia, en Buenos Aires se desarrollaba la VII Olimpiada de Ajedrez y el más conocido de los ajedrecistas cubanos José Raúl Capablanca, obtuvo la medalla de Oro en el primer tablero, convirtiéndose en noticia mundial. La gran pasión por el juego ciencia  se puso de manifiesto durante toda su vida, jugó Ajedrez cuando estaba viajando en un avión, cuando  estuvo detenido en alguna estación policial o, simplemente, a las tres de la madrugada recibía una delegación mexicana para jugar una partida después de conversar sobre los temas generales comunes. Ernesto Guevara, eternamente Che, revolucionario integral y multifacético, sintió gran afición por los deportes y aunque por lo general se le cita como amante del ajedrez y el fútbol, también, desde niño, practicó con derroche de coraje y voluntad otros no tan divulgados. A sus prácticas deportivas también se entregó con la voluntad, coraje y pasión que lo caracterizaron a lo largo de su vida. Luego del triunfo de la Revolución cubana, en la que ganó  los grados de Comandante, hubo  un deporte priorizado  en la vida del Che: el Ajedrez.  Dos veces ganó en los campeonatos patrocinados por el Ministerio de Industria, que él presidía,  y participó, además, en los Torneos del INDER donde ascendió, por los resultados alcanzados, a la primera categoría. Se enfrentó en partidas simultáneas a varios de los mejores jugadores de esos días, entre ellos los grandes maestros soviéticos Victor Korchnoi y Mijail Tal y el argentino Miguel Najdorf, d

  8. Cherenkov and scintillation light separation on the CheSS experiment

    Science.gov (United States)

    Caravaca, Javier; Land, Benjamin; Descamps, Freija; Orebi Gann, Gabriel D.

    2016-09-01

    Separation of the scintillation and Cherenkov light produced in liquid scintillators enables outstanding capabilities for future particle detectors, the most relevant being: particle directionality information in a low energy threshold detector and improved particle identification. The CheSS experiment uses an array of small, fast photomultipliers (PMTs) and state-of-the-art electronics to demonstrate the reconstruction of a Cherenkov ring in liquid scintillator using two techniques: based on the photon density and using the photon hit time information. A charged particle ionizing a scintillation medium produces a prompt Cherenkov cone and late isotropic scintillation light, typically delayed by several ns. The fast response of our PMTs and DAQ provides a precision well below the ns level, making possible the time separation. Furthermore, the usage of the new developed water-based liquid scintillators (WbLS) enhances the separation since it allows tuning of the Cherenkov/Scintillation ratio. Latest results on the separation for pure liquid scintillators and WbLS will be presented.

  9. Start of enrolment for the Champs-Fréchets crèche (EVE)

    CERN Multimedia

    HR Department

    2008-01-01

    As announced in Bulletin 43/2007, CERN signed an agreement with the commune of Meyrin on 17 October 2007 under which 20 places will be reserved for the children of CERN personnel in the Champs-Fréchets day care centre (EVE), which will open on Monday, 25 August, and CERN will contribute to the funding. This agreement allows members of the CERN personnel (employees and associates) access to the crèche, for children aged between 4 months and 4 years, irrespective of where they are living. Applications for the school year starting autumn 2008 will be accepted from Monday 17 March until Monday 30 June 2008. Members of the personnel must complete the enrolment formalities with the Meyrin infant education service themselves: Mairie de Meyrin Service de la Petite Enfance 2 rue des Boudines Case postale 367 - 1217 Meyrin 1 - Tel. + 41 (0)22 782 21 21 mailto:meyrin@meyrin.ch http://www.meyrin.ch/petiteenfance Application forms (in PDF) can be downloaded from the website of the com...

  10. LE SOLUTRÉEN ANCIEN EN ARDÈCHE (FRANCE: UNE RÉVISION CRITIQUE DES INDUSTRIES LITHIQUES

    Directory of Open Access Journals (Sweden)

    Sophie Guegan

    2013-11-01

    Full Text Available S’inscrivant dans un travail de Doctorat sur les peuplements des deux rives de la vallée du Rhône au Maximum Glaciaire, cet article propose un état des connaissances sur la phase ancienne du Solutréen en Ardèche (rive droite du Rhône, donnant lieu à une révision critique des industries lithiques s’y rapportant. En effet, depuis les travaux de P.E.L. Smith et J. Combier, et plus récemment le travail d’A. Barbiero consacré aux pointes à face plance et pointes à cran d’une collection ancienne à la Baume d’Oullins (Gard-Ardèche, France, aucun réexamen global n’avait été entrepris. Trois gisements de référence pour cette phase ancienne, ont ainsi été sélectionnés: les grottes d’Oullins (Gard-Ardèche, France, de Chabot (Gard, France et de Granouly (Ardèche, France. Nous présentons ici les réslutats préliminaires à cette étude. En premier lieu, une approche typologique a été menée principalement autour de la pointe à face plane, objet emblématique de cette phase, permettant d’en préciser les principaux caractères. Dans un deuxième temps, une approche technologique a permis de confirmer l’homogénéité dans les choix techniques des Solutréens entre l’Ardèche et les régions du Sud-Ouest et du Bassin Parisien. Enfin, une étude des matières premières, a révélé pour l’heure des choix économiques étonnants pour le contexte paléo-climatique, avec des déplacements vers le nords et un franchissement du Rhône.In the frame of a doctoral dissertation on the Late Glacial Maximum occupations of both sides of the Rhône valley, this paper presents a state of the art and a critical reappraisal of the lithic assemblages from the early phases of the Solutrean in Ardeche (right bank of the Rhône river. Indeed, since the works of P.E.L. Smith and J. Combier, except the work of A. Barbiero, on the unifacial leaf-points and shouldered points from Baume d'Oullins, no complete study of these

  11. Méthodes de levée de dormance de la noix de cola fraîche ( Cola ...

    African Journals Online (AJOL)

    Cette étude avait pour objectif de proposer une méthode efficace de germination de la noix de cola fraîche, en vue d'une réduction significative du délai de germination à travers un test comparatif de traitement de la noix par blessure, humidification et chaleur. Méthodologie et résultats: L'étude a été mise en place selon un ...

  12. “Nell’occhio che riscopre la luce”: tempo, Storia e memoria nella poesia di Salvatore Quasimodo

    OpenAIRE

    Alessandro Martini

    2015-01-01

    La riflessione sul rapporto dell’uomo con il tempo e con la storia percorre senza soluzione di continuità l’opera poetica di Salvatore Quasimodo. Spesso a disagio in una dimensione temporale fissa e definita, schiacciato tra dolore dell’esilio, insensatezza della guerra e crisi del dopoguerra, il poeta interroga gli evi passati e le ere future in cerca di un’armonia che appare il più delle volte sfuggente.

  13. The chemotaxis-like Che1 pathway has an indirect role in adhesive cell properties of Azospirillum brasilense.

    Science.gov (United States)

    Siuti, Piro; Green, Calvin; Edwards, Amanda Nicole; Doktycz, Mitchel J; Alexandre, Gladys

    2011-10-01

    The Azospirillum brasilense chemotaxis-like Che1 signal transduction pathway was recently shown to modulate changes in adhesive cell surface properties that, in turn, affect cell-to-cell aggregation and flocculation behaviors rather than flagellar-mediated chemotaxis. Attachment to surfaces and root colonization may be functions related to flocculation. Here, the conditions under which A. brasilense wild-type Sp7 and che1 mutant strains attach to abiotic and biotic surfaces were examined using in vitro attachment and biofilm assays combined with atomic force microscopy and confocal microscopy. The nitrogen source available for growth is found to be a major modulator of surface attachment by A. brasilense and could be promoted in vitro by lectins, suggesting that it depends on interaction with surface-exposed residues within the extracellular matrix of cells. However, Che1-dependent signaling is shown to contribute indirectly to surface attachment, indicating that distinct mechanisms are likely underlying flocculation and attachment to surfaces in A. brasilense. © 2011 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

  14. Reconocimiento Mapu-Che de Chile: Tratado ante Constitución, Historia frente a Derecho

    Directory of Open Access Journals (Sweden)

    Bartolomé CLAVERO SALVADOR

    2011-04-01

    Full Text Available Desde el año 1991, el compromiso adquirido por los sucesivos gobiernos chilenos para reconocer a nivel constitucional la presencia indígena en el ordenamiento del Estado ha puesto de manifiesto el desconocimiento académico y jurídico mutuo por parte de Chile con respecto a las evidencias para una reposición de Mapu-Che. El presente trabajo hace un recorrido histórico y jurídico por las formas de relación entre el Estado chileno y el Estado Mapu, que hasta la conquista chilena de Mapu en la década de los ochenta del siglo XIX se manifestaron a través de Tratados y Parlamentos que implicaban un reconocimiento mutuo de ambas entidades en una esfera internacional. Las comisiones de estudios, informes oficiales e invocaciones de verdad para un nuevo trato, primero de las Naciones Unidas, y después de la República de Chile, han observado estas evidencias de la significación constitucional e internacional de los Tratados, pero Chile ha convertido su peculiar forma de reconocimiento constitucional de la presencia indígena en un alarde de unidad e indivisibilidad nacional. Este encubrimiento nace del deseo de mantener una Constitución exclusiva, al que se une la certeza de que otra forma de reconocimiento obligaría a un replanteamiento de las propias raíces de los fundamentos constitucionales de la República de Chile.

  15. RELÉ ELECTRÓNICO PARA LA DETECCIÓN DEL MOVIMIENTO EN LOS TANQUES DE SEDIMENTACIÓN DE LA EMPRESA COMANDANTE ¨ERNESTO CHE GUEVARA¨

    Directory of Open Access Journals (Sweden)

    Orlys Ernesto Torres Breffe

    2011-02-01

    Full Text Available En este trabajo se muestran los resultados del diseño de un dispositivo electrónico para detectar el movimiento del tanquede sedimentación de la planta de lixiviación de la Empresa Ernesto Che Guevara.Estos tanque actualmente se encuentran sin esta protección y su parada por avería solo es detectada de forma visual por eloperario o cuando la densidad de la pulpa aumente a valores tan altos que sea reflejado en el sistema de monitoreo instalado(EROS. La parada inadvertida de estos tanque casi siempre sucede por razones fácilmente corregibles, pero si no se detectaa tiempo la sedimentación del minerales es casi inevitable y las pérdidas de recursos y materiales son cuantiosas.La propuesta electrónica en sustitución a las desechas electromagnéticas, es muy barata y su reproducción es fácilmenterealizable en la propia empresa, dado que los elementos que se utiliza son clásicos, sin exigencias de fabricación, tolerancias,etc.  The main goal of this research paper is to show the electronic device design results while dealing with the location of thesedimentation tank on the leaching plant located on Ernesto Che Guevara factory.Nowadays there is no protection for this tank, thus, if it stops working it can only be noticed by the engine sunner on avisual way or when the extremely high figures of the pulp density are reflected on the available monitor system (EROS.The unnoticed misfunctioning of this device is caused mainly to easily solved reasons. Nevertheless, when not detected ontime, the mineral sedimentation is almost unavoidable which results on the losses of resources.The electronic proposal to substitute the electromagnetic scraps is very cheap and easily to reproduce on the factory itself forthe needed elements are classic with no resistance and manufacture demands.

  16. SYM1, l’ortologo di lievito del gene umano MPV17, codifica per una proteina indotta da stress che modula lo stato bioenergetico e morfogenetico del mitocondrio

    OpenAIRE

    Dallabona, Cristina

    2010-01-01

    Mutazioni nel gene MPV17 causano l’insorgenza di una forma epatocerebrale della sindrome da deplezione del DNA mitocondriale. MPV17 codifica per una piccola proteina idrofobica localizzata nella membrana mitocondriale interna con funzione sconosciuta. Per cercare di chiarire le basi molecolari che causano la patologia, abbiamo utilizzato il lievito S. cerevisiae come organismo modello grazie alla presenza di un ortologo di MPV17: SYM1. Abbiamo dimostrato che la proteina Sym1 è essenziale per ...

  17. La nascita imperfetta delle cose la grande corsa alla particella di Dio e la nuova fisica che cambierà il mondo

    CERN Document Server

    AUTHOR|(CDS)2068901

    2016-01-01

    In quel preciso momento, un centesimo di miliardesimo di secondo dopo il Big Bang, si è deciso il nostro destino. In un universo in cui materia e antimateria si equivalevano, e che quindi avrebbe potuto, in ogni istante, tornare a essere pura energia, può essere bastata una leggerissima preferenza del bosone di Higgs per la materia anziché per l'antimateria ed ecco che si è prodotto il mondo che abbiamo sotto gli occhi. "Ecco qua il minuscolo difetto, la sottile imperfezione da cui è nato tutto. Un'anomalia che dà origine a un universo che può evolvere per miliardi di anni." Se tutto nasce da lì, dobbiamo capire in ogni dettaglio quel momento cruciale, ricostruirlo fotogramma per fotogramma, al rallentatore e da diverse angolature. Per questo al Cern di Ginevra è stato realizzato Lhc, l'acceleratore di particelle più potente del mondo, il posto più simile al primo istante di vita dell'universo che l'uomo sia stato in grado di costruire. Per questo da anni i migliori fisici del mondo lavorano giorno...

  18. The structure and dynamic properties of the complete histidine phosphotransfer domain of the chemotaxis specific histidine autokinase CheA from Thermotoga maritima

    International Nuclear Information System (INIS)

    Vu, Anh; Hamel, Damon J.; Zhou Hongjun; Dahlquist, Frederick W.

    2011-01-01

    The bacterial histidine autokinase CheA contains a histidine phosphotransfer (Hpt) domain that accepts a phosphate from the catalytic domain and donates the phosphate to either target response regulator protein, CheY or CheB. The Hpt domain forms a helix-bundle structure with a conserved four-helix bundle motif and a variable fifth helix. Observation of two nearly equally populated conformations in the crystal structure of a Hpt domain fragment of CheA from Thermotoga maritima containing only the first four helices suggests more mobility in a tightly packed helix bundle structure than previously thought. In order to examine how the structures of Hpt domain homologs may differ from each other particularly in the conformation of the last helix, and whether an alternative conformation exists in the intact Hpt domain in solution, we have solved a high-resolution, solution structure of the CheA Hpt from T. maritima and characterized the backbone dynamics of this protein. The structure contains a four-helix bundle characteristic of histidine phosphotransfer domains. The position and orientation of the fifth helix resembles those in known Hpt domain crystal and solution structures in other histidine kinases. The alternative conformation that was reported in the crystal structure of the CheA Hpt from T. maritima missing the fifth helix is not detected in the solution structure, suggesting a role for the fifth helix in providing stabilizing forces to the overall structure.

  19. The Crèche and School structure of the CERN Staff Association is looking for a new name

    CERN Multimedia

    Staff Association

    2018-01-01

    The CERN Staff Association is launching a competition to find a new name to replace the current acronym EVEE (Espace de Vie Enfantine et École). The competition is open to everyone from Thursday, 1 February 2018 to Thursday, 15 March. All participants can send their name suggestions via the form available on the websites of the Staff Association and the Crèche and School. Good luck to all – may the best one win! P.S. The Rules of the Competition are available on both websites

  20. Determination of the Index of Consumption of Petroleum of the Calcining Kiln of the Ernesto Che Guevara Commander Undertaking

    Directory of Open Access Journals (Sweden)

    Yarilys Gaínza-Delgado

    2016-07-01

    Full Text Available This work presents the results obtained in carrying out the mass and energy balances in the calcining kiln of the company commander Ernesto Che Guevara, for determining the consumption index of petroleum used for obtaining nickel oxide through thermal decomposition of the basic nickel carbonate. It was shown that for a production of basic nickel carbonate of              12 t / h with 69% moisture, it is necessary to feed about 1100 kg / h of fuel, for an consumption index of 91.67 kg of fuel per ton of load.

  1. Il mondo secondo la fisica quantistica segreti e meraviglie della scienza che sta cambiando la nostra vita

    CERN Document Server

    Fracas, Fabio

    2017-01-01

    Questo libro è un'avventura esclusiva e affascinante. Un viaggio, anche nel tempo, alla scoperta di qualcosa di nuovo e di straordinario: la Fisica Quantistica, nelle sue logiche, nelle sue potenzialità, nelle sue applicazioni e nei suoi possibili sviluppi. All'interno del volume vengono ricostruiti passo dopo passo i momenti fondamentali del pensiero quantistico, le questioni su cui si sono interrogati i più grandi scienziati degli ultimi decenni, e i diversi contesti nei quali si sono evoluti i principali modelli della Meccanica Quantistica. Sullo sfondo delle ricerche più attuali - come per esempio quella sulle onde gravitazionali che ha portato al Nobel per la Fisica 2017 -, vengono indagati anche i rapporti esistenti fra Fisica Quantistica, Relatività Einsteiniana e Teoria delle Stringhe. Inoltre, fra i tanti temi trattati nelle sue pagine, trovano spazio persino le incredibili ricadute che gli studi sulla Fisica Quantistica stanno avendo negli ambiti della medicina e delle ricerche sul cervello e s...

  2. Crèche and School of the Staff Association: a programme for children from 2 to 4 year old

    CERN Multimedia

    Staff Association

    2018-01-01

    Find out how children between the ages of two to four and their families can benefit from the Staff Association Crèche and School programme. Classes for children aged between two and four years have been set-up to ensure the initial transition from home to school is as smooth as possible. Children attend mornings only and are welcomed by the same group of teaching staff throughout the week, allowing the children to establish a link between their home life and the crèche/school. The challenge of these classes is to offer the children a happy environment where they can feel emotionally secure, and the teaching staff can create a harmonious atmosphere allowing them to learn by moving, manipulating, exchanging, making mistakes… playing. Creativity takes a central role as it enables the child to express him or herself and increase their ability to handle their emotions constructively. According to Albert Einstein ‘Play is the highest form of research’. &nbs...

  3. The Drosophila gene CheB42a is a novel modifier of Deg/ENaC channel function.

    Directory of Open Access Journals (Sweden)

    Yehuda Ben-Shahar

    2010-02-01

    Full Text Available Degenerin/epithelial Na(+ channels (DEG/ENaC represent a diverse family of voltage-insensitive cation channels whose functions include Na(+ transport across epithelia, mechanosensation, nociception, salt sensing, modification of neurotransmission, and detecting the neurotransmitter FMRFamide. We previously showed that the Drosophila melanogaster Deg/ENaC gene lounge lizard (llz is co-transcribed in an operon-like locus with another gene of unknown function, CheB42a. Because operons often encode proteins in the same biochemical or physiological pathway, we hypothesized that CHEB42A and LLZ might function together. Consistent with this hypothesis, we found both genes expressed in cells previously implicated in sensory functions during male courtship. Furthermore, when coexpressed, LLZ coprecipitated with CHEB42A, suggesting that the two proteins form a complex. Although LLZ expressed either alone or with CHEB42A did not generate ion channel currents, CHEB42A increased current amplitude of another DEG/ENaC protein whose ligand (protons is known, acid-sensing ion channel 1a (ASIC1a. We also found that CHEB42A was cleaved to generate a secreted protein, suggesting that CHEB42A may play an important role in the extracellular space. These data suggest that CHEB42A is a modulatory subunit for sensory-related Deg/ENaC signaling. These results are consistent with operon-like transcription of CheB42a and llz and explain the similar contributions of these genes to courtship behavior.

  4. Animals′ Role in Proper Behaviour: Cheŵa Women′s Instructions in South-Central Africa

    Directory of Open Access Journals (Sweden)

    Leslie F Zubieta

    2016-01-01

    Full Text Available The most common role of animals in the Cheŵa culture of south-central Africa is twofold: they are regarded as an important source of food, and they also provide raw materials for the creation of traditional medicines. Animals, however, also have a nuanced symbolic role that impacts the way people behave with each other by embodying cultural protocols of proper — and not so proper — behaviour. They appear repeatedly in storytelling and proverbs to reference qualities that people need to avoid or pursue and learn from the moral of the story in which animals interplay with each other, just as humans do. For example, someone who wants to prevent the consequences of greed is often advised to heed hyena stories and proverbs. My contribution elaborates on Brian Morris's instrumental work in south-central Africa, which has permitted us to elucidate the symbolism of certain animals and the perception of landscape for Indigenous populations in this region. I discuss some of the ways in which animals have been employed to teach and learn proper behaviour in a particular sacred ceremony of the Cheŵa people which takes place in celebration of womanhood: Chinamwali.

  5. Cloning, overexpression, purification, crystallization and preliminary X-ray analysis of CheY3, a response regulator that directly interacts with the flagellar ‘switch complex’ in Vibrio cholerae

    International Nuclear Information System (INIS)

    Khamrui, Susmita; Biswas, Maitree; Sen, Udayaditya; Dasgupta, Jhimli

    2010-01-01

    A chemotaxis response regulator CheY3 from V. cholerae has been cloned, overexpressed, purified and crystallized. The crystals of CheY3 diffracted to 1.86 Å resolution. Vibrio cholerae is the aetiological agent of the severe diarrhoeal disease cholera. This highly motile organism uses the processes of motility and chemotaxis to travel and colonize the intestinal epithelium. Chemotaxis in V. cholerae is far more complex than that in Escherichia coli or Salmonella typhimurium, with multiple paralogues of various chemotaxis genes. In contrast to the single copy of the chemotaxis response-regulator protein CheY in E. coli, V. cholerae contains four CheYs (CheY1–CheY4), of which CheY3 is primarily responsible for interacting with the flagellar motor protein FliM, which is one of the major constituents of the ‘switch complex’ in the flagellar motor. This interaction is the key step that controls flagellar rotation in response to environmental stimuli. CheY3 has been cloned, overexpressed and purified by Ni–NTA affinity chromatography followed by gel filtration. Crystals of CheY3 were grown in space group R3, with a calculated Matthews coefficient of 2.33 Å 3 Da −1 (47% solvent content) assuming the presence of one molecule per asymmetric unit

  6. A technician monitors the CHeX, a USMP-4 experiment which will be flown on STS-87, in the SSPF

    Science.gov (United States)

    1997-01-01

    United States Microgravity Payload-4 (USMP-4) experiments are prepared to be flown on Space Shuttle mission STS-87 in the Space Station Processing Facility at Kennedy Space Center (KSC). Here, a technician is monitoring the Confined Helium Experiment, or CHeX, that will use microgravity to study one of the basic influences on the behavior and properties of materials by using liquid helium confined between silicon disks. CHeX and several other experiments are scheduled for launch aboard STS-87 on Nov. 19 from KSC.

  7. Novel activation domain derived from Che-1 cofactor coupled with the artificial protein Jazz drives utrophin upregulation.

    Science.gov (United States)

    Desantis, Agata; Onori, Annalisa; Di Certo, Maria Grazia; Mattei, Elisabetta; Fanciulli, Maurizio; Passananti, Claudio; Corbi, Nicoletta

    2009-02-01

    Our aim is to upregulate the expression level of the dystrophin related gene utrophin in Duchenne muscular dystrophy, thus complementing the lack of dystrophin functions. To this end, we have engineered synthetic zinc finger based transcription factors. We have previously shown that the artificial three-zinc finger protein named Jazz fused with the Vp16 activation domain, is able to bind utrophin promoter A and to increase the endogenous level of utrophin in transgenic mice. Here, we report on an innovative artificial protein, named CJ7, that consists of Jazz DNA binding domain fused to a novel activation domain derived from the regulatory multivalent adaptor protein Che-1/AATF. This transcriptional activation domain is 100 amino acids in size and it is very powerful as compared to the Vp16 activation domain. We show that CJ7 protein efficiently promotes transcription and accumulation of the acetylated form of histone H3 on the genomic utrophin promoter locus.

  8. Review: Thomas Bierschenk and Eva Spies (eds, 50 Jahre Unabhängigkeit in Afrika: Kontinuitäten, Brüche, Perspektiven (2012

    Directory of Open Access Journals (Sweden)

    Geert Castryck

    2015-01-01

    Full Text Available Review of the edited volume: Thomas Bierschenk and Eva Spies (eds, 50 Jahre Unabhängigkeit in Afrika: Kontinuitäten, Brüche, Perspektiven, Cologne: Rüdiger Köppe Verlag, 2012, ISBN 9783896458292, 572 pages

  9. Noi siamo quello che ricordiamo - Le frazze di Crucoli: il teatro, il rito, il riscatto sociale

    Directory of Open Access Journals (Sweden)

    Tonia Mingrone

    2012-01-01

    Full Text Available Abstract - IT Questo lavoro nasce da una ricerca di campo sulle frazze, termine dialettale che indica le farse di Carnevale che si rappresentavano fino a cinquant’anni fa in molti paesi calabresi, tra cui il mio, Crucoli, in provincia di Crotone. Lo scopo di questo lavoro non è fare un resoconto esaustivo di tutto ciò che accadeva a Crucoli durante la celebrazione del Carnevale, impresa assai difficile dal momento che non ci sono documenti scritti e quindi bisogna affidarsi ai racconti orali delle persone intervistate, spesso non fedeli alla realtà, perché modificati dal tempo e dalla memoria. L’approccio con cui ho intrapreso questa ricerca è sicuramente legato all’aspetto teatrale e performativo dell’evento, senza trascurarne la rilevanza antropologica. Il materiale raccolto è frutto di interviste e colloqui con la gente del posto unito ad un grande lavoro di ricerca bibliografica di autori che avevano trattato di questo argomento in relazione ai loro paesi di origine.Lo scopo è quello di delineare l’organizzazione e lo svolgimento delle frazze, cercando di ricostruire la sua durata e le ripercussioni sulla comunità, nonché dimostrare ancora una volta come il teatro, messo a disposizione di alcuni eventi, diventi un mezzo forte di liberazione e di contestazione. Abstract - FR Cet article prend sa naissance par une recherche sur champ concernant les frazze, terme dialectal qui dénote les farces du Carnaval mises en scène jusqu'à il y a cinquante ans dans plusieurs villages en Calabria, entre eux le mien, Crucoli, dans la province de Crotone. La raison de ce travail n'est pas d'accomplir un compte rendu exhaustif de tout ce qui avait lieu à Crucoli pendant la célébration du Carnaval, l'exploit étant très difficile, du moment qu'aucun document écrit a été parvenu et par conséquence il est nécessaire de se remettre aux contes des témoins interviewés, souvent pas fidèles au réel, parce-que détournés par les

  10. RESISTENCIA MICROBIANA EN EL CARDIOCENTRO ERNESTO CHE GUEVARA. ESTUDIO DE 5 AÑOS / Microbial resistance at the “Ernesto Che Guevara” Cardiology Hospital. A five year study

    Directory of Open Access Journals (Sweden)

    Nérida Rodríguez Oliva

    2009-06-01

    Full Text Available Introduction and Objectives: The appearance of nosocomial bacterial resistance represents a problem of growing concern because it largely affects the evolution of patients and the health resources devoted to it. The objective of this work was to determine the most common germs and their microbial resistance. Methods: A descriptive retrospective study was carried out analyzing the result of the isolation of germs from all type of secretions and from the blood cultures of a group ofpatients hospitalized at the Ernesto Che Guevara Cardiology Hospital in a five year period. Results: A total of 397 strains were isolated, 77 Staphylococcus aureus and 320 Enterobacteriaceae. The former presented 100% resistance to penicillin. The Staphylococcus sensitive to methicillin presented 4.9 % resistance to cotrimoxazole and gentamicin. The strains resistant to methicillin or oxacillin had a high resistance to gentamicin (87.5 % and ciprofloxacin (81.2 %, a medium resistance to cefazolin and oxacilline (20.5 %, and just 12.5 percent resistance to cotrimoxazole. Conclusions: the Staphylococcus aureus and the Enterobacteriaceae were the most common germs. The preoperative prophylaxis in these patients must not be done with cefazolin as a routine because the staphylococci resistant to methicillin or oxacillin have influence on other antimicrobials.

  11. Development of the full range vange vacuum gauge

    International Nuclear Information System (INIS)

    Oh, B. H.; In, S. R.; Jung, K. S.; Jeong, S. H.

    2001-01-01

    The pirani, enning end full range gauges developed during this study had made good characteristics compared with the measured results of customized other gauges, and this results show the possibility of developing the gauges by ourselves in Korea. In order to make a competition with the customized gauges of other countries, it is necessary to upgrade several points to have good characteristics over the large range of the pressure. The new effort will be made in developing the full scale gauge in the next year

  12. Eksistentsialism Rein Põdra romaanis "Imelik vang" / Maret Vaher

    Index Scriptorium Estoniae

    Vaher, Maret

    2011-01-01

    Artikkel vaatleb J.-P. Sartre'i ja A. Camus' teoste mõju R. Põdra romaanile. Eksistentsialistlik filosoofia on eesti kirjandust sügavalt ja pikaajaliselt mõjutanud ning võib huvitavaid perspektiive pakkuda ka tänapäeva lahtimõtestamisel

  13. Atomistic structural ensemble refinement reveals non-native structure stabilizes a sub-millisecond folding intermediate of CheY

    International Nuclear Information System (INIS)

    Shi, Jade; Schwantes, Christian; Bilsel, Osman

    2017-01-01

    The dynamics of globular proteins can be described in terms of transitions between a folded native state and less-populated intermediates, or excited states, which can play critical roles in both protein folding and function. Excited states are by definition transient species, and therefore are difficult to characterize using current experimental techniques. We report an atomistic model of the excited state ensemble of a stabilized mutant of an extensively studied flavodoxin fold protein CheY. We employed a hybrid simulation and experimental approach in which an aggregate 42 milliseconds of all-atom molecular dynamics were used as an informative prior for the structure of the excited state ensemble. The resulting prior was then refined against small-angle X-ray scattering (SAXS) data employing an established method (EROS). The most striking feature of the resulting excited state ensemble was an unstructured N-terminus stabilized by non-native contacts in a conformation that is topologically simpler than the native state. We then predict incisive single molecule FRET experiments, using these results, as a means of model validation. Our study demonstrates the paradigm of uniting simulation and experiment in a statistical model to study the structure of protein excited states and rationally design validating experiments.

  14. Substitution of the burning PRIOR SSB 10 for SSB7 in the Furnace 10 of the Company Major Ernesto Che Guevara

    Directory of Open Access Journals (Sweden)

    Ivett María Ramírez-Pérez

    2017-01-01

    Full Text Available One of the fundamental causes of massive destruction of chambers and vaults in the Furnace of Reduction at the Ernesto Che Guevara Factory is due to operate the combustion chambers with excess of contribution of heat, causing that the flame of very high temperature penetrates into the homes, affecting the throats of the chambers, the vaults, teeth and arms. The burners current are Prior SSB10. In this paper is demonstrated that the burning Prior SSB 10 have double productivity that the SSB 7 with the same quantity of air to the burner. It is evaluated the substitution of the burning Prior SSB 10 by SSB 7 on the operation of the Furnace of Reduction No. 10 at the Ernesto Che Guevara (ECG Factory. Demonstrating that the change not produce variations in the operation.

  15. Effects of Kapton Sample Cell Windows on the Detection Limit of Smectite: Implications for CheMin on the Mars Science Laboratory Mission

    Science.gov (United States)

    Achilles, C. N.; Ming, Douglas W.; Morris, R. V.; Blake, D. F.

    2012-01-01

    The CheMin instrument on the Mars Science Laboratory (MSL) rover Curiosity is an X-ray diffraction (XRD) and X-ray fluorescence (XRF) instrument capable of providing the mineralogical and chemical compositions of rocks and soils on the surface of Mars. CheMin uses a microfocus X-ray tube with a Co target, transmission geometry, and an energy-discriminating X-ray sensitive CCD to produce simultaneous 2-D XRD patterns and energy-dispersive X-ray histograms from powdered samples. CheMin has two different window materials used for sample cells -- Mylar and Kapton. Instrument details are provided elsewhere. Fe/Mg-smectite (e.g., nontronite) has been identified in Gale Crater, the MSL future landing site, by CRISM spectra. While large quantities of phyllosilicate minerals will be easily detected by CheMin, it is important to establish detection limits of such phases to understand capabilities and limitations of the instrument. A previous study indicated that the (001) peak of smectite at 15 Ang was detectable in a mixture of 1 wt.% smectite with olivine when Mylar is the window material for the sample cell. Complications arise when Kapton is the window material because Kapton itself also has a diffraction peak near 15 Ang (6.8 deg 2 Theta). This study presents results of mineral mixtures of smectite and olivine to determine smectite detection limits for Kapton sample cells. Because the intensity and position of the smectite (001) peak depends on the hydration state, we also analyzed mixtures with "hydrated" and "dehydrated"h smectite to examine the effects of hydration state on detection limits.

  16. Il mito della precarietà: quando la precarietà è un valore che decostruisce l’immaginario della precarietà

    Directory of Open Access Journals (Sweden)

    Antonio Casillo

    2011-07-01

    Full Text Available Oggi la ricerca del posto “fisso” sembra essere il sogno irraggiungibile di molti giovani precari e la “flessibilità”, una parola d’ordine con cui si aspirava a riformare il mondo del lavoro e che tanto in voga sembrava essere negli anni ’90, è diventata sinonimo di incertezza, precarietà, se non addirittura sfruttamento. Ma c’era chi proprio nel lavoro che oggi definiremo precario, vedeva l’unica possibilità per restare libero dalle leggi di mercato e dai potenti poteri editoriali Newyorkesi. In questo articolo proviamo a gettare uno sguardo al mito letterario con cui, il rifiutare un posto fisso, significava rivendicare la propria libertà, un mito romantico certo, e sicuramente distante dalla realtà, ma che ha affascinato un’intera generazione di scrittori, poeti, musicisti. Da Jack London, passando attraverso la San Francisco Renaissance e la Beat Generation, fino ad arrivare al fenomeno della così detta generazione Hippy, il sogno americano sembrava essere quello di una frontiera mobile in cui, la strada, sembrava non avere mai fine.

  17. Un uomo che valuta

    Directory of Open Access Journals (Sweden)

    Massimiliano Nicoli

    2015-12-01

    Full Text Available This article – written as a short story in the second-person narrative mode – focuses on the subjective, everyday experience of an individual concerned by some practices of evaluation. Through the telling of this concrete experience, it aims at giving substance to the idea that the practices of evaluation constitute an «environmental technology of government» typical of neoliberal governmentality as well as a self-disciplined technique of building one’s own «soul» as human capital.

  18. Department of Che

    African Journals Online (AJOL)

    USER

    2015-03-26

    Mar 26, 2015 ... watering, fish culturing and nursery of seedlings. Air is also very ... synthesized organic and inorganic fertilizers are made, synthesized pesticides and herbicides for ..... production and nutritional quality of grains. (Graham and ...

  19. Structural studies of conformational changes of proteins upon phosphorylation: Structures of activated CheY, CheY-N16-FliM complex, and AAA + ATPase domain of NtrC1 in both inactive and active states

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Seok-Yong [Univ. of California, Berkeley, CA (United States)

    2003-04-10

    Protein phosphorylation is a general mechanism for signal transduction as well as regulation of cellular function. Unlike phosphorylation in eukaryotic systems that uses Ser/Thr for the sites of modification, two-component signal transduction systems, which are prevalent in bacteria, archea, and lower eukaryotes, use an aspartate as the site of phosphorylation. Two-component systems comprise a histidine kinase and a receiver domain. The conformational change of the receiver domain upon phosphorylation leads to signal transfer to the downstream target, a process that had not been understood well at the molecular level. The transient nature of the phospho-Asp bond had made structural studies difficult. The discovery of an excellent analogue for acylphosphate, BeF3-, enabled structural study of activated receiver domains. The structure of activated Chemotaxis protein Y (CheY) was determined both by NMR spectroscopy and X-ray crystallography. These structures revealed the molecular basis of the conformational change that is coupled to phosphorylation. Phosphorylation of the conserved Asp residue in the active site allows hydrogen bonding of the T87 Oγ to phospho-aspartate, which in turn leads to the rotation of Y106 into the ''in'' position (termed Y-T coupling). The structure of activated CheY complexed with the 16 N-terminal residues of FliM (N16-FliM), its target, was also determined by X-ray crystallography and confirmed the proposed mechanism of activation (Y-T coupling). First, N16-FliM binds to the region on CheY that undergoes a significant conformational change. Second, the ''in'' position of Y106 presents a better binding surface for FliM because the sidechain of Y106 in the inactive form of CheY (''out'' position) sterically interferes with binding of N16-FliM. In addition to confirmation of Y-T coupling, the structure of the activated CheY-N16-FliM complex suggested that the

  20. Nouvelles fonctions de l'agriculture et dynamiques des exploitations: une analyse chorématique dans les monts d'Ardèche

    Directory of Open Access Journals (Sweden)

    Muriel Bonin

    2001-06-01

    Full Text Available Les modèles spatiaux sont utilisés pour l'analyse des trajectoires d'exploitations agricoles pour mettre en évidence les liens entre les transformations socio-économiques et les dynamiques de territoires. Les traits de dynamiques spatiales sont identifiés et utilisés pour analyser l'impact de l'introduction de l'agritourisme dans les exploitations dans le Parc naturel régional des monts d'Ardèche.

  1. Automatización del control del cálculo de extracciones en la mina de la empresa niquelera Ernesto Che Guevara

    Directory of Open Access Journals (Sweden)

    Arístides A. Legrá-Lobaina

    2010-03-01

    Full Text Available En el artículo se muestran los elementos fundamentales de un algoritmo cuyo objetivo es establecer el contenido y el orden de los procedimientos necesarios para realizar el control del cálculo de extracciones en la mina de la empresa Ernesto Che Guevara que explota, a cielo abierto, yacimientos lateríticos ferroniquelíferos en la región de Moa, Cuba. Asimismo se presenta el diseño de los diálogos informáticos que han automatizado el algoritmo en la aplicación informática Tierra.

  2. A 36,000-Year-Old Volcanic Eruption Depicted in the Chauvet-Pont d’Arc Cave (Ardèche, France)?

    Science.gov (United States)

    Nomade, Sébastien; Genty, Dominique; Sasco, Romain; Scao, Vincent; Féruglio, Valérie; Baffier, Dominique; Guillou, Hervé; Bourdier, Camille; Valladas, Hélène; Reigner, Edouard; Debard, Evelyne; Pastre, Jean–François; Geneste, Jean-Michel

    2016-01-01

    Among the paintings and engravings found in the Chauvet-Pont d’Arc cave (Ardèche, France), several peculiar spray-shape signs have been previously described in the Megaloceros Gallery. Here we document the occurrence of strombolian volcanic activity located 35 km northwest of the cave, and visible from the hills above the cave entrance. The volcanic eruptions were dated, using 40Ar/39Ar, between 29 ± 10 ka and 35 ± 8 ka (2σ), which overlaps with the 14C AMS and thermoluminescence ages of the first Aurignacian occupations of the cave in the Megaloceros Gallery. Our work provides the first evidence of an intense volcanic activity between 40 and 30 ka in the Bas-Vivarais region, and it is very likely that Humans living in the Ardèche river area witnessed one or several eruptions. We propose that the spray-shape signs found in the Chauvet-Pont d’Arc cave could be the oldest known depiction of a volcanic eruption, predating by more than 34 ka the description by Pliny the Younger of the Vesuvius eruption (AD 79) and by 28 ka the Çatalhöyük mural discovered in central Turkey. PMID:26745626

  3. A 36,000-Year-Old Volcanic Eruption Depicted in the Chauvet-Pont d'Arc Cave (Ardèche, France)?

    Science.gov (United States)

    Nomade, Sébastien; Genty, Dominique; Sasco, Romain; Scao, Vincent; Féruglio, Valérie; Baffier, Dominique; Guillou, Hervé; Bourdier, Camille; Valladas, Hélène; Reigner, Edouard; Debard, Evelyne; Pastre, Jean-François; Geneste, Jean-Michel

    2016-01-01

    Among the paintings and engravings found in the Chauvet-Pont d'Arc cave (Ardèche, France), several peculiar spray-shape signs have been previously described in the Megaloceros Gallery. Here we document the occurrence of strombolian volcanic activity located 35 km northwest of the cave, and visible from the hills above the cave entrance. The volcanic eruptions were dated, using 40Ar/39Ar, between 29 ± 10 ka and 35 ± 8 ka (2σ), which overlaps with the 14C AMS and thermoluminescence ages of the first Aurignacian occupations of the cave in the Megaloceros Gallery. Our work provides the first evidence of an intense volcanic activity between 40 and 30 ka in the Bas-Vivarais region, and it is very likely that Humans living in the Ardèche river area witnessed one or several eruptions. We propose that the spray-shape signs found in the Chauvet-Pont d'Arc cave could be the oldest known depiction of a volcanic eruption, predating by more than 34 ka the description by Pliny the Younger of the Vesuvius eruption (AD 79) and by 28 ka the Çatalhöyük mural discovered in central Turkey.

  4. Rachunek dochodów i wydatków budżetu jednostki samorządu terytorialnego na przykładzie gminy Chełmiec w latach 2011-2013

    OpenAIRE

    Rodak, Anna

    2015-01-01

    Przedłożona praca ma na celu wskazanie źródeł i struktury dochodów budżetowych oraz charakteru wydatkowania środków budżetowych gminy Chełmiec, a także dokonanie rzetelnej oceny sytuacji finansowej wymienionej powyżej jednostki. Analiza budżetu obejmuje zakres czasowy od 2011 do 2013 roku. Szczegółowe pytania, na które starano się w niniejszej pracy odpowiedzieć są następujące: Czy gmina Chełmiec jest gospodarna w wykorzystywaniu środków budżetowych? oraz jak gmina Chełmiec mając do dyspozycj...

  5. Sedimentation Effects of Adding Flocculants to Leached Slurries at Lab Scale in the “Comandante Ernesto Che Guevara” plant in Cuba

    Directory of Open Access Journals (Sweden)

    Eluberto Espinosa-Espinosa

    2016-10-01

    Full Text Available The objective of this investigation was to evaluate the effects of adding PICIZ 7010, AN 910SH and Quimifloc N-30 flocculants to leached and magnetized slurries at lab scale. The evaluation was completed through the comparative method in accordance to the NRBI-579 Standard: Sedimentation Tests which use Talmage and Fitch method. The addition of Quimifloc N-30 flocculants to 6 g/t of reduced ore increased slurry density by 5,9 %, improved liquor clarification as result of a reduction of up to 75 % in suspended solids and slightly reduced the required unit area.

  6. Evita Perón y el Che Guevara: De la historia a la construcción literaria del mito biográfico

    Directory of Open Access Journals (Sweden)

    Cecilia López Badano

    2014-06-01

    Full Text Available Eva Perón y el Che Guevara son dos de las figuras paradigmáticas argentinas, conocidas internacionalmente a través no sólo de sus vidas, que pueden reconstruirse a partir de documentos históricos, sino por el mito nacional - e internacional - que la muerte temprana ha configurado con ambos mediante la ayuda de la literatura y el cine, expandiendo ficcionalmente el matiz revolucionario de su accionar. El presente texto se propone, en consecuencia, dar cuenta de esas "capas" ficcionales que conforman la construcción estética de los dos mitos biográficos e inciden en la evaluación de sus protagonistas reales, modelando la percepción de ambos, particularmente, la considerada por el gran público más que por los especialistas.

  7. Nascita e destino della soggettività. Dai ruoli professionali ai processi di cura, attraverso una lettura di "Quel che resta del giorno" di Kazuo Ishiguro

    Directory of Open Access Journals (Sweden)

    Gabriele Profita

    2017-07-01

    Full Text Available Questa riflessione affronta un tema assai rilevante per le professioni di cura, con uno sguardo particolare alla psicoterapia. Per chiarire il ruolo della soggettività e della nascita e maturazione di un ruolo professionale riporterò un’analisi di un testo letterario attraverso il quale sarà più agevole scoprire come si forma l’identità di un ruolo professionale e come si avvia alla sua maturazione e alla sua codificazione. In particolare quali sono i rischi legati ad una sua rigida codificazione rivolta alla sua normatività tecnica? Mi propongo di tracciare un confronto con alcune forme di costruzione della soggettività che nel corso dei secoli hanno fondato il modello dell’uomo occidentale nelle sue articolazioni professionali.

  8. Changes of serum levels of prealbumin (PAB), cholinesterase (CHE), total bile acid (TBA) and ALT as related to the severity of inflammatory process and hepatic fibrosis in patients with chronic virus B hepatitis

    International Nuclear Information System (INIS)

    Chi Xiaoxia; Chen Jianxiong; Xiong Ying

    2005-01-01

    Objective: To study the correlationship between the serum levels of PAB, CHE, TBA, ALT and the severity of the disease process in patients with chronic virus B hepatitis. Methods: Serum levels of PAB, CHE, ALT (with biochemical methods) and TBA (with RIA) were examined in 93 patients with biopsy proven virus B hepatitis and 46 controls. Results: The 93 patients were of two groups: a less advanced group (n=51) and a more advanced group (n=42). Serum TBA, ALT levels were significnatly higher and serum PAB, CHE levels were significantly lower in the more advanced group than those in the less advanced group (P 0 to s 4 . Changes of levels of ALT were of no regular pattern, but serum levels of TBA regularly increased and levels of PAB, CHE regularly decreased as the fibrosis grading proceeded from s 0 to s 4 and the differences between the levels in s 4 and any other grading were significant (P<0.01). Conclusion: Combined determination of these serum markers might reflect the degree of inflammatory process and hepatic fibrosis in patients with virus B hepatitis, leading to earlier detection of cirrhosis. (authors)

  9. Conditions of concentration and composition of suspended load in the Vistula River between Wyszogród and Chełmno

    Science.gov (United States)

    Kaszubski, Michal

    2014-05-01

    The main objective of the study is to explain causes of variations of concentration, particle size distribution and composition of suspended load in the riverbed of the lower Vistula between Wyszogród and Chełmno. The study was conducted in seven bridge cross-sections (three above and four below the Włocławek reservoir). In each cross-section, three water samples were collected in the characteristic parts of the riverbed. Since July 2012 fifteen measurement series were carried out. During each measurement series 22 samples of water were collected. In each sample the overall concentration of suspended load, the proportion of the organic matter and particle size distribution of the mineral fraction were measured. Variation of concentration and characteristics of suspended load were studied both in the cross-sections of the Vistula riverbed and along its longitudinal profile. The study focus primarily on determining the qualitative and quantitative variation in the properties of suspended load in the cross-sections located in different morphological riverbed type, various level of its hydrotechnical management, including the operation on the Włocławek reservoir, and the diversity of the water flow conditions. The author tested the correlation occurring between the size of suspended load concentration as well as the flow rate and flow velocity at the water sampling sites. Moreover, the author determined the effect of morphological variation of the Vistula riverbed (the riverbed depth and the location of points of collecting water samples relative to the riverbed mesoforms) on the concentration size, composition structure and the particle size distribution of suspended load. Measurement sessions were chosen in such a way as to cover the widest possible spectrum of the water flow conditions in the riverbed of the Vistula. In addition to the low and medium flow the variability in concentration during flood flows of various types (ice jam, snowmelt and rainfall) were

  10. The CheMin XRD on the Mars Science Laboratory Rover Curiosity: Construction, Operation, and Quantitative Mineralogical Results from the Surface of Mars

    Science.gov (United States)

    Blake, David F.

    2015-01-01

    The Mars Science Laboratory mission was launched from Cape Canaveral, Florida on Nov. 26, 2011 and landed in Gale crater, Mars on Aug. 6, 2012. MSL's mission is to identify and characterize ancient "habitable" environments on Mars. MSL's precision landing system placed the Curiosity rover within 2 km of the center of its 20 X 6 km landing ellipse, next to Gale's central mound, a 5,000 meter high pile of laminated sediment which may contain 1 billion years of Mars history. Curiosity carries with it a full suite of analytical instruments, including the CheMin X-ray diffractometer, the first XRD flown in space. CheMin is essentially a transmission X-ray pinhole camera. A fine-focus Co source and collimator transmits a 50µm beam through a powdered sample held between X-ray transparent plastic windows. The sample holder is shaken by a piezoelectric actuator such that the powder flows like a liquid, each grain passing in random orientation through the beam over time. Forward-diffracted and fluoresced X-ray photons from the sample are detected by an X-ray sensitive Charge Coupled Device (CCD) operated in single photon counting mode. When operated in this way, both the x,y position and the energy of each photon are detected. The resulting energy-selected Co Kalpha Debye-Scherrer pattern is used to determine the identities and amounts of minerals present via Rietveld refinement, and a histogram of all X-ray events constitutes an X-ray fluorescence analysis of the sample.The key role that definitive mineralogy plays in understanding the Martian surface is a consequence of the fact that minerals are thermodynamic phases, having known and specific ranges of temperature, pressure and composition within which they are stable. More than simple compositional analysis, definitive mineralogical analysis can provide information about pressure/temperature conditions of formation, past climate, water activity and the like. Definitive mineralogical analyses are necessary to establish

  11. Rock shelter occupation during isotopic stage 5: level D of the site of Payre (Ardèche, France. Territorial organisation and intra-site activities

    Directory of Open Access Journals (Sweden)

    Moncel, Marie-Hélène

    2007-06-01

    Full Text Available This paper presents the results obtained from an interdisciplinary study of the level D archaeological assemblages from Payre (Ardèche, France. This site is dated to the final of OIS 6 and the beginning of OIS 5. The combined analysis of the lithic and faunal assemblages accumulated and their management “into” and “out of” the site gives a better understanding of the behaviour of the Neanderthal groups that inhabited it. This study has allowed us to correlate the territorial exploitation for game hunting and for raw material procurement, within the context of seasonal short term occupations probably during the end of autumn and the beginning of winter.  

    Este artículo presenta los resultados obtenidos a través del estudio multidisciplinar del registro arqueológico del nivel D del yacimiento de Payre (Ardèche, Francia datado entre el final del OIS 6 y el comienzo del OIS 5. El análisis conjunto de la industria lítica y de los restos óseos recuperados en el yacimiento y de la gestión de dichos recursos dentro y fuera de él, ha hecho posible la comprensión de los comportamientos humanos de los grupos neandertales que lo ocuparon. Dicho estudio nos ha permitido poner en relación el tipo de explotación del territorio de caza y de captación de materias primas, dentro del marco de ocupaciones estacionales de corta duración desarrolladas probablemente entre el final del otoño y el principio del invierno.  

  12. LA DIAGNOSI DELLE COMPETENZE LINGUISTICHE IN UN CONTESTO MULTILINGUE: UN PROCESSO CONTINUO CHE FAVORISCE L’INSEGNAMENTO E L’APPRENDIMENTO INDIVIDUALIZZATO

    Directory of Open Access Journals (Sweden)

    Drorit Lengyel

    2011-07-01

    Full Text Available Il presente studio affronta il problema della valutazione diagnostica delle competenze linguistiche in contesti educativi multilingui, con particolare attenzione ai bisogni dei bambini e degli adolescenti immigrati. Vengono brevemente esposti gli obiettivi, le funzioni e i principi della valutazione diagnostica e della valutazione formativa considerate parte integrante di una educazione linguistica continua che prevede un insegnamento-apprendimento individualizzato. Sul piano teorico le procedure della valutazione diagnostica delle competenze linguistiche in contesti multilingui fanno riferimento all’apprendimento delle lingue inteso come attività socio-culturale.     Language diagnostics in multilingual settings with respect to continuous procedures as accompaniment of individualized learning and teaching   This study provides an introduction to language diagnostics in multilingual educational settings, with particular reference to the needs of children and adolescents from migrant backgrounds. It summarises the objectives and functions of language diagnostics and the principles that govern diagnostics including formative assessment, considered to be an integral part of continuous language education that emphasises individualised teaching and learning. From a theoretical perspective, diagnostic procedures in multilingual settings treat language learning as a socio-cultural activity.  

  13. Il Salento che abbiamo attraversato: Rina Durante e Bruno Brancher, il racconto di due vite diverse sulle strade di terra d'Otranto

    Directory of Open Access Journals (Sweden)

    Massimo Melillo

    2015-07-01

    Full Text Available Rina Durante ha rappresentato il meglio della cultura meridionale, ne ha raccolto l’eredità e ne è stata tra le interpreti più acute. Abbiamo avuto l’onore della sua amicizia fraterna e solidale, conosciuto l’azzardo e la radicalità delle sue scelte di vita, la sua dolce timidezza e l’ardita padronanza e consapevolezza del suo ruolo: anni di discussioni, di confronto, di legame cementato da infuocati innamoramenti intellettuali per uno scrittore, un poeta, un regista, di accese ironie sui nostri caratteri, di scontri politici e furibondi litigi finiti in un abbraccio. Anche per Bruno Brancher, milanese di tutti e di nessuno, il ricordo si fa memoria per le sue mille improvvise e imprevedibili incursioni in terra salentina. Non era un uomo facile, anche se aveva dalla sua parte il puntiglio dell’innocenza tipica del ladro gentiluomo. Portava leggero il fardello di due vite in una: la prima segnata da una marginalità, fattasi a volte precariamente lussuosa con i proventi di furti e disarmanti rapine; l’altra con la faccia del redento, che con la scoperta della scrittura diventa cosciente di sé.

  14. Evaluation of the Addition liquor with high ammonia and Carbon Dioxide contentin the still 208 of the “Comandante Che Guevara” industry (ECG

    Directory of Open Access Journals (Sweden)

    María Elena Magaña-Haynes

    2015-12-01

    Full Text Available Adding fresh liquor through the 5th ring in still 208 of distilling liquor product (liquor obtained as a result of ammonium carbonate leaching of lateritic ore in the “Comandante Che Guevara” industry, were evaluated with the objective of reducing the dissolved nickel content of the effluent there from, as well as to improve the characteristics of the nickel carbonate which is delivered to the calcinations process. For the development of the survey, the same methodology used in 2001 for the test was applied. The results showed that by adding fresh liquor, it is possible to reduce the dissolved nickel content at the exit of the distillation column, so that the need for precipitation is minimized, thereby reducing the consumption of reagents and the and the cost for their acquisition. It was possible to corroborate the relationship between the content of NH3 at the discharge and the nickel dissolved therein appreciating that to achieve these results it is necessary to maintain the ammonia in the discharge between 1,0-1,8 g/L. The carbonate obtained in the column where liquor is added with high CO2 and NH3 reached high values of this last element in its composition and to the extent that increased sulphur content decreased. It was also seen an increase in the size of the coarse carbonates particles, which will influence in a decrease of energy consumption.

  15. Mineralogy, provenance, and diagenesis of a potassic basaltic sandstone on Mars: CheMin X-ray diffraction of the Windjana sample (Kimberley area, Gale Crater)

    International Nuclear Information System (INIS)

    Treiman, Allan H.; Bish, David L.; Chipera, Steve J.; Blake, David F.

    2015-01-01

    The Windjana drill sample, a sandstone of the Dillinger member (Kimberley formation, Gale Crater, Mars), was analyzed by CheMin X-ray diffraction (XRD) in the MSL Curiosity rover. From Rietveld refinements of its XRD pattern, Windjana contains the following: sanidine (21% weight, ~Or 95 ); augite (20%); magnetite (12%); pigeonite; olivine; plagioclase; amorphous and smectitic material (~25%); and percent levels of others including ilmenite, fluorapatite, and bassanite. From mass balance on the Alpha Proton X-ray Spectrometer (APXS) chemical analysis, the amorphous material is Fe rich with nearly no other cations—like ferrihydrite. The Windjana sample shows little alteration and was likely cemented by its magnetite and ferrihydrite. From ChemCam Laser-Induced Breakdown Spectrometer (LIBS) chemical analyses, Windjana is representative of the Dillinger and Mount Remarkable members of the Kimberley formation. LIBS data suggest that the Kimberley sediments include at least three chemical components. The most K-rich targets have 5.6% K 2 O, ~1.8 times that of Windjana, implying a sediment component with >40% sanidine, e.g., a trachyte. A second component is rich in mafic minerals, with little feldspar (like a shergottite). A third component is richer in plagioclase and in Na 2 O, and is likely to be basaltic. The K-rich sediment component is consistent with APXS and ChemCam observations of K-rich rocks elsewhere in Gale Crater. The source of this sediment component was likely volcanic. Finally, the presence of sediment from many igneous sources, in concert with Curiosity's identifications of other igneous materials (e.g., mugearite), implies that the northern rim of Gale Crater exposes a diverse igneous complex, at least as diverse as that found in similar-age terranes on Earth.

  16. Quality of the Fosso della Casaccia: analysis of the macroinvertebrates colonizing artificial substrates; Stato di qualita` del fosso della Casaccia: analisi dei macroinvertebrati che colonizzano substrati artificiali

    Energy Technology Data Exchange (ETDEWEB)

    Prato, S.; Morgana, J.G.; Antonelli, D.; Folletto, A. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente

    1999-01-01

    Aim of this work is to analyse the environmental quality of a small stream, the Fosso della Casaccia, flowing near Research Centre of ENEA (Rome, Central Italy). The study was carried out comparing zoo benthic communities of two sampling sites, chosen upstream and downstream the sewage of the Research Centre. Macro invertebrates were sampled using artificial substrates and standard hand net. Taxa number and distribution along along the watercourse were compared. Moreover, biotic index values (I.B.E.=Indice Biotico Esteso) were calculated using data on macro invertebrates collected with both sampling methodologies. Artificial substrates were also useful in establishing colonization patterns at each sampling site, and bio masses of individuals belonging to different trophic groups. The results show the greater sampling effectiveness of artificial substrates, confirming their usefulness for establishing the environmental quality. [Italiano] Il presente lavoro prende in considerazione la qualita` ambientale del Fosso della Casaccia, un piccolo corso d`acqua che scorre in prossimita` del Centro di Ricerche ENEA Casaccia (Italia Centrale). Lo studio e` stato realizzato in base al confronto fra le comunita` zoobentoniche di due stazioni sperimentali situate a monte e a valle dello scarico di acque reflue del centro. Il campionamento dei macroinvertebrati e` stato effettuato utilizzando due diversi metodi di raccolta: i substrati artificiali e il retino immanicato standard. Gli organismi sono stati classificati in unita` sistematiche, e si e` analizzata la loro distribuzione lungo il corso d`acqua. Inoltre sono stati calcolati i valori degli indici biotici I.B.E. (Indice Biotico Esteso) utilizzando i dati ottenuti con le due metodologie di campionamento. L`uso di substrati artificiali in ogni stazione di campionamento e` stato utile anche per stabilire il tipo di colonizzazione, l`abbondanza e le biomasse degli individui appartenenti ai vari gruppi trofici. I nostri

  17. Issues relating to classification of colluvial soils in young morainic areas (Chełmno and Brodnica Lake District, northern Poland

    Directory of Open Access Journals (Sweden)

    Świtoniak Marcin

    2015-06-01

    Full Text Available Colluvial soils (in Polish: gleby deluwialne are an important part of the soil cover in young morainic landscapes of northern Poland. They evolved as a result of the accumulation of eroded material at the foot of the slopes and bottoms of closed depressions. The aim of this study was to determine the systematic position of colluvial soils commonly found in the Chełmno and Brodnica Lake District, northern Poland. Ten soil pits located in different types of landscapes were selected for testing soil properties. The colluvial material is characterized by diversified properties: thickness, particle-size distribution, organic carbon content, color, pH, and base saturation. As a result, the investigated soils represent broad spectrum of typological units according to Polish Soil Classification (2011. Some of them contain epipedons mollic and meet the criteria of colluvial chernozemic soils. They were found mainly on buried black earths in areas with small slope inclinations. Many pedons contain pale colored acidic colluvial material with low base saturation and low organic carbon content and must be classified as other types: arenosols (in Polish: arenosole or rusty soils (in Polish: gleby rdzawe. These soils occur mostly in areas with intensive relief and overlay the different soil types, including rusty soil and organic soils. They are formed as a result of soils lessivés and rusty soils truncation. An introduction of the additional units of “proper colluvial soils” which have epipedon ochric, and “rusty-colluvial soils” with endopedon sideric to the next edition of Polish Soil Classification would enable a more precise expression of the genesis of these soils in the type rank. Moreover, the definition of chernozemic colluvial soils could be extended to colluvial soils with umbric horizon. Classifying soils derived from colluvial material as soils of other types leads to the disappearance of this units on maps and underestimation of the

  18. Architecture of buried reverse fault zone in the sedimentary basin: A case study from the Hong-Che Fault Zone of the Junggar Basin

    Science.gov (United States)

    Liu, Yin; Wu, Kongyou; Wang, Xi; Liu, Bo; Guo, Jianxun; Du, Yannan

    2017-12-01

    It is widely accepted that the faults can act as the conduits or the barrier for oil and gas migration. Years of studies suggested that the internal architecture of a fault zone is complicated and composed of distinct components with different physical features, which can highly influence the migration of oil and gas along the fault. The field observation is the most useful methods of observing the fault zone architecture, however, in the petroleum exploration, what should be concerned is the buried faults in the sedimentary basin. Meanwhile, most of the studies put more attention on the strike-slip or normal faults, but the architecture of the reverse faults attracts less attention. In order to solve these questions, the Hong-Che Fault Zone in the northwest margin of the Junggar Basin, Xinjiang Province, is chosen for an example. Combining with the seismic data, well logs and drill core data, we put forward a comprehensive method to recognize the internal architectures of buried faults. High-precision seismic data reflect that the fault zone shows up as a disturbed seismic reflection belt. Four types of well logs, which are sensitive to the fractures, and a comprehensive discriminated parameter, named fault zone index are used in identifying the fault zone architecture. Drill core provides a direct way to identify different components of the fault zone, the fault core is composed of breccia, gouge, and serpentinized or foliated fault rocks and the damage zone develops multiphase of fractures, which are usually cemented. Based on the recognition results, we found that there is an obvious positive relationship between the width of the fault zone and the displacement, and the power-law relationship also exists between the width of the fault core and damage zone. The width of the damage zone in the hanging wall is not apparently larger than that in the footwall in the reverse fault, showing different characteristics with the normal fault. This study provides a

  19. Dose evaluation for workers employed in an industry involving enamel paints containing zirconium silicate; Valutazione di dose per i lavoratori occupati in una industria che utilizza vernici a smalto contenenti silicato di zirconio

    Energy Technology Data Exchange (ETDEWEB)

    Castellani, C.M.; Berico, M.; De Zaiacomo, T.; Formignani, M.; Ianni, A.; Nobili, C.; Sandri, S.; Vasselli, R. [ENEA, Centro Ricerche Ezio Clementel, Bologna (Italy). Dipt. Ambiente

    1999-07-01

    In the frame of the European Recommendations for radiological protection, an evaluation of the annual dose has been made for workers employed in an industry for the production of sanitary equipment involving the use of enamel paints containing zirconium silicate. [Italian] Nella prospettiva dell'applicazione della direttiva europea relativa alla protezione radiologica dei lavoratori, vengono presentati i risultati relativi alla valutazione di dose annuale complessiva per i lavoratori occupati in una industria per la produzione di articoli igienico-sanitari che utilizza vernici a smalto contenenti silicato di zirconio. Il fine e' la valutazione del problema radioprotezionistico per gli addetti a causa delle impurezza radioattive presenti nei materiali utlizzati.

  20. Illustrations to “Gespräche in dem Reiche derer Todten zwischen dem vortreflichen Moscowitischen Czaar Petro Magno und dem grossen Tyrannen Ivan Basilowiz II” (Peter the Great and Ivan the Terrible) by David Fassmann (1725)

    OpenAIRE

    Ekaterina A. Skvortcova

    2017-01-01

    The journal created by David Fassmann (1683–1744), Gespräche in dem Reiche derer Todten, edited in Leipzig, was a huge success. Each of the 240 issues presents a dialogue between two historical figures from the afterworld. In the 83rd–86th Entrevuë, the interlocutors are Peter the Great and Ivan the Terrible. The texts of the four conversations were thoroughly examined by Eckhard Matthes (1987). The present paper explores how the illustrations to the 83rd–86th Entrevuë visualize the texts, w...

  1. ‘Unkind and cruel, to deceive your Son | In borrow’d Shapes, and his Embrace to shun’: Mother-son love in T. S. Eliot’s ‘La Figlia Che Piange’

    Directory of Open Access Journals (Sweden)

    Matthew Geary

    2015-01-01

    Full Text Available T. S. Eliot's "La Figlia Che Piange" (1916 is a curious anomaly in his early works. It stands out as a love poem of outstanding grace portraying a more positive relationship to the feminine compared to other poems contemporaneous with its writing such as "The Love Song of St. Sebastian" (1914 and "Hysteria" (1915. This essay shows the import of Eliot's chosen epigraph for "La Figlia" taken from Virgil's Aeneid to have been largely neglected or misread by critics. As a consequence, it argues that critical readings have crucially missed the presence of a shrouded maternal aspect within the poem. Through the lens of Lacanian psychoanalysis and the work of adherents to Lacanian theory — such as Bruce Fink, Shoshana Felman and Slavoj Zizek — this paper newly argues that the poem's meditation on the issues of union and separation between two lovers is in fact a screen for deeper unconscious ambivalent feelings between mother and son. That is to say, Eliot's "La Figlia Che Piange" shows a failed attempt to reconstruct, traverse and separate from the "fundamental fantasy" unconsciously orientating the male speaker of the poem and his desire.

  2. Vang-like protein 2 and rac1 interact to regulate adherens junctions

    Czech Academy of Sciences Publication Activity Database

    Lindqvist, M.; Horn, Z.; Bryja, Vítězslav; Schulte, G.; Papachristou, P.; Ajima, R.; Dyberg, C.; Arenas, E.; Yamaguchi, T.P.; Lagercrantz, H.; Ringstedt, T.

    2010-01-01

    Roč. 123, č. 3 (2010), s. 472-483 ISSN 0021-9533 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : cell adhesion * neurulation * PCP Subject RIV: BO - Biophysics Impact factor: 6.290, year: 2010

  3. CIA võis lennutada ja hoida vange ka Euroopa idaosas / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2006-01-01

    Amnesty Internationali raportis antakse ülevaade kolme vahistatud Jeemeni mehe kogetust aastatel 2003-2005. Meeste tunnistustest järeldab Amnesty, et neid hoiti kinni ka Ida-Euroopas. Lisa: Kolme Jeemeni mehe tunnistused

  4. Onderzoek naar leverbot deel II: Vang slak in plaats van bot: Leverbotbestrijding risico’s & kansen

    NARCIS (Netherlands)

    Verkaik, J.C.; Neijenhuis, F.; Verwer, Cynthia

    2017-01-01

    Slakken in de zomer wegfrezen uit de greppels minimaliseert de kans op leverbot. In combinatie met opstallen voor opname van besmetting kan zomerfrezen leverbot zelfs voorkomen. De kans op leverbot neemt eveneens aanzienlijk af door runderen evasief te weiden. Botten vangen (en doden) door het vee

  5. Il Vangelo di Ivan Aleksandăr nella tradizione testuale dei vangeli slavi

    Directory of Open Access Journals (Sweden)

    Alberto Alberti

    2009-12-01

    Full Text Available Alberto Alberti, Marcello Garzaniti The Ivan Alexander Gospel in the Textual Tradition of the Slavic Gospels In this article, the Authors analyse the Slavic text of the Gospels in the light of the most recent developments in Greek New Testament studies. Particularly useful is the work carried out at the Institut für neutestamentliche Forschung (Münster. On the basis of the identifi cation of a series of ‘Test Passages’ (Teststellen, the Münster volumes offer all the readings of the Greek tradition (except for lectionaries. In this paper, the fi rst 10 chapters of the Gospel of John and the entire text of the synoptic Gospels are analysed from this point of view, comparing the Greek text with a corpus of 12 Slavic manuscripts. The text of the Ivan Alexander Gospel in some instances refl ects the process of harmonization to the Greek ‘Byzantine text’, but in general terms preserves many archaic features, which is quite unusual for a 14th century Gospel. The revision on the basis of Greek manuscripts is also illustrated by readings which are clearly in harmony with particular forms of the Greek text.

  6. Genesis and classification of the soils developed from the sediments of the former Oleszek mill pond basin (the Chełmińskie Lakeland, N Poland / Geneza i pozycja systematyczna gleb wykształconych z osadów niecki dawnego stawu młyńskiego Oleszek (Pojezierze Chełmińskie

    Directory of Open Access Journals (Sweden)

    Mendyk Łukasz

    2015-03-01

    Full Text Available Budowa i funkcjonowanie młynów wodnych znacznie wpłynęły na przekształcenie środowiska przyrodniczego w ich otoczeniu, przede wszystkim na zmiany rzeźby terenu i warunków wodnych. Obszar badañ obejmuje nieckę dawnego stawu młyńskiego Oleszek w okolicach wsi Borówno, w zachodniej części Pojezierza Chełmińskiego, około 20 km na północny wschód od Torunia. Celem badañ było określenie genezy gleb wykształconych z osadów zakumulowanych w niecce dawnego stawu młyńskiego Oleszek. Pięć profili glebowych w transekcie o długości około 550 m zlokalizowanym wzdłuż Strugi Rychnowskiej stanowiącej oś podłużną niecki. Wszystkie przeanalizowane gleby zbudowane są z osadów wypełniających nieckę dawnego stawu młyńskiego. Gleby w opisywanej niecce powstały w wyniku wielu nakładających się procesów, takich jak: proces mułotwórczy, aluwialny, koluwialny oraz glejowy. Dwa z analizowanych profili glebowych (profile 3 i 4 spełniaj¹ kryteria wydzielania gleb organicznych limnowych typowych (Systematyka gleb Polski 2011. Jako pozycję systematyczną kolejnych dwóch gleb (profile 2 i 5 zaproponowano gleby mułowate. W związku z problemami klasyfikacyjnymi dotyczącymi tego typu gleb, przy opracowaniu aktualizacji Systematyki gleb Polski należałoby wprowadzić w typie gleb glejowych podtyp gleb mułowatych lub mułowato-glejowych, obejmuj¹cy gleby wytworzone z mineralno-organicznych utworów aluwialno-mułowych. Cztery wymienione powyżej profile zostały zaklasyfikowane jako Histosols (3 i 4 i Gleysols (2 i 5 według klasyfikacji WRB (2014. Jednostki glebowe wykształcone z osadów aluwialnych (mady wg SgP 2011 lub Fluvic Phaeozems wg WRB 2014 występują w proksymalnej części stawu (cofce.

  7. Il piu grande centro europeo di ricerca oggi festeggia l'anniversario del Nobel di Rubbia e Van der Meer. Cern, vent'anni guardando al futuro Ora la sfida si gioca sull'acceleratore di particelle pronto per il 2007, che provera a svelare i segreti della materia

    CERN Multimedia

    Durante, E

    2003-01-01

    "CERN, vent'anni guardando al futuro Ora la sfida si gioca sull'acceleratore di particelle pronto per il 2007, che provera a svelare i segreti della materia" [CERN, twenty years of looking towards the future. The present challenge is the particle accelerator that will be ready in 2007, which will try to reveal the secrets of matter] (2 pages)

  8. Louis Blajan, Dottore in Medicina Veterinaria: Il dinamico veterinario che seppe traghettare l’Organizzazione Mondiale per la Sanità Animale (Office International des Épizooties: OIE nel mondo moderno

    Directory of Open Access Journals (Sweden)

    Anon.

    2010-03-01

    Full Text Available Nato il 10 aprile 1924 a Lahage (nell’Alta Garonna, in Francia, Louis Blajan si è spento lo scorso 10 febbraio 2010 a Mont-de-Marsan.Dopo aver frequentato il Lycée Pierre de Fermat di Tolosa, nel 1948 Louis completa gli studi presso la Scuola di Veterinaria di Tolosa. Nel 1949, si diploma all’Institut d’élevage et de médecine vétérinaire des pays tropicaux (IEMVT e dal 1949 al 1952 è nel territorio d’oltremare francese del Mali. Tornato in Francia, dal 1953 al 1968 Louis esercita come veterinario di Stato presso il Ministero dell’Agricoltura, responsabile per l’afta epizootica, la peste suina e la malattia di Newcastle, nonché come Presidente del Comitato consultivo per le malattie infettive. In seguito, viene nominato Ispettore capo veterinario e Responsabile per la politica di controllo delle frontiere.Nel 1952, Louis sposa Janine, moglie affezionata che lo appoggia con ardore in ogni fase della sua carriera e perde la vita in un incidente un mese prima che il marito vada in pensione nel 1990.Dal 1968 al 1977, Louis è Direttore tecnico di Cofranimex (Compagnie Française pour l’importation et l’exportation des animaux reproducteurs et leur semence e dal 1977 al 1978 riveste il ruolo di Direttore dell’Association pour le développement des techniques de l’élevage français (ADETEF.Louis entra a lavorare nell’Office International des Épizooties (oggi noto come Organizzazione Mondiale per la Sanità Animale o ‘OIE’ dove, dal 1978 al 1980, occupa la posizione di Direttore del Dipartimento tecnico. Due anni più tardi, nel 1980, viene eletto Direttore Generale, coronando il sogno di ogni professionista della medicina veterinaria e raggiungendo l’apice della propria carriera. Rieletto nel 1985, si ritira dalla vita lavorativa nel 1990.Durante gli anni in cui fu a capo dell’OIE, Louis seppe trasformare quella che all’epoca era una struttura antiquata in un’organizzazione internazionale moderna ed

  9. Analyse de l’effet du type de tâche sur l’évolution des connaissances à la suite d’un processus d’apprentissage collaboratif

    Directory of Open Access Journals (Sweden)

    Sabine Pohl

    2009-04-01

    Full Text Available L’article analyse l’effet du type de tâche sur le partage des connaissances à la suite d’un processus d’interaction dans un contexte d’apprentissage collaboratif. Cet apprentissage collaboratif est réalisé dans le cadre d’une formation universitaire. Deux types de tâches sont réalisés par les apprenants. Ils se distinguent selon que la solution nécessite ou non la confrontation de points de vue portant sur le champ conceptuel lié à l’apprentissage à réaliser. La méthode de collecte des données consiste en un entretien semi-directif. Les résultats montrent un effet du type de tâches sur l’évolution des connaissances partagées des apprenants.This longitudinal research analyses the effect of the type of task on the development of knowledge following an interaction process in a collaborative learning context. The framework for this collaborative learning is a university education. Two types of tasks are provided to the learners. They differ depending on whether or not the solution requires the comparison of points of view on the conceptual scope of what is to be learned. The data are collected through a semi-directive interview. The results show that the type of task has an effect on the development of shared knowledge.

  10. William Franke, Sulla verità poetica che è superiore alla Storia: Porfirio e la critica filosofica della letteratura William Franke, On the Poetic Truth that is Higher than History: Porphyry and the Philosophical Interpretation of Literature

    Directory of Open Access Journals (Sweden)

    Laura Lucia Rossi

    2010-06-01

    Full Text Available

    In this article we propose the translation of William Franke’s paper On the Poetic Truth that is Higher than History: Porphyry and the Philosophical Criticism of Literature, in which the American scholar presents the hermeneutic method of the ancient commentators of Homer, with particular reference to the critic practice applied by the Neoplatonic Porphyry in his De Antro Nympharum. With this treatment Franke proposes and hopes for the return to an interpretive method, called philosophical or speculative, also for contemporary criticism.

    In questo articolo è presentata la traduzione del saggio di William Franke Sulla verità poetica che è superiore alla Storia: Porfirio e la critica filosofica della letteratura, in cui lo studioso americano presenta il metodo ermeneutico degli antichi commentatori di Omero, con particolare riferimento alla critica praticata dal neoplatonico Porfirio, proponendo e auspicando il ritorno ad una modalità interpretativa, detta filosofica o speculativa, anche per la critica contemporanea.

  11. Medicinal Plants.

    Science.gov (United States)

    Phillipson, J. David

    1997-01-01

    Highlights the demand for medicinal plants as pharmaceuticals and the demand for health care treatments worldwide and the issues that arise from this. Discusses new drugs from plants, anticancer drugs, antiviral drugs, antimalarial drugs, herbal remedies, quality, safety, efficacy, and conservation of plants. Contains 30 references. (JRH)

  12. Plant walkdown

    International Nuclear Information System (INIS)

    Kostov, M.

    2000-01-01

    This report covers the following: preparatory steps for performing plant walk-down; the objective of the first plant walk-down; plant walk-down procedures; earthquake screening evaluation; walk-down documentation; second plant walk-down. The following objectives concerning the plant walk-down(s) were achieved. The plant system configuration is verified in order to proceed with event tree and fault tree analyses. Systems interactions, other types of dependencies or plant unique features are identified. he safety related components that are judged to generically possess high capacities (i.e., larger than the earthquake review level) have been verified to contain no weaknesses. Further analyses needed to establish the capacities of remaining safety-related components are identified and necessary field data are obtained. Information on components is obtained to assist in HCLPF (fragility) evaluation and peer review of the seismic margin study

  13. Aquatic plants

    DEFF Research Database (Denmark)

    Madsen, T. V.; Sand-Jensen, K.

    2006-01-01

    Aquatic fl owering plants form a relatively young plant group on an evolutionary timescale. The group has developed over the past 80 million years from terrestrial fl owering plants that re-colonised the aquatic environment after 60-100 million years on land. The exchange of species between terre...... terrestrial and aquatic environments continues today and is very intensive along stream banks. In this chapter we describe the physical and chemical barriers to the exchange of plants between land and water.......Aquatic fl owering plants form a relatively young plant group on an evolutionary timescale. The group has developed over the past 80 million years from terrestrial fl owering plants that re-colonised the aquatic environment after 60-100 million years on land. The exchange of species between...

  14. Impact of environmental pollution on the incidence of malignant neoplasms of upper respiratory tract in the population of Mysłowice, Imielin and Chełm Śląski

    Directory of Open Access Journals (Sweden)

    Jerzy Stockfisch

    2014-03-01

    Full Text Available Background. The paper presents a retrospective analysis of cases of the upper respiratory tract malignant tumors in the settlement: Mysłowice, Imielin, Chełm Śląski based on the patients’ medical history treated in a hospital laryngological ward in Mysłowice between 1995 and 2004. The inspiration to write the paper was the significant frequency of the upper respiratory tract malignant tumor cases in the main areas of Mysłowice; Piasek and Rymera estate. The aim of the study was the assessment of relationship between environmental pollution and territorial diversity in the morbidity of head and neck cancer. Material and methods. The study involved a group of 130 patients with cancer of the upper respiratory tract and a control group of 145 healthy subjects of similar age and sex, living in the different regions of the surveyed towns in the comparable proportions and in the group of patients. The paper aimed to assess the relationship between territorial diversity of the upper respiratory tract cancers, and environmental risk factors. Results. The analysis was based on environmental pollution data. It was confirmed that the geographic picture of the incidence of the upper airways malignant tumors showed that Mysłowice central districts: Piasek and estate Rymera, indicated this region to be particularly critical one. Conclusions. The increased number of morbidity cases in these districts may be associated with: environmental risk factors, increased consumption of high percentage alcohol, excessive amount of smoked cigarette and low socio-economic status of the patients.

  15. Electronic plants

    Science.gov (United States)

    Stavrinidou, Eleni; Gabrielsson, Roger; Gomez, Eliot; Crispin, Xavier; Nilsson, Ove; Simon, Daniel T.; Berggren, Magnus

    2015-01-01

    The roots, stems, leaves, and vascular circuitry of higher plants are responsible for conveying the chemical signals that regulate growth and functions. From a certain perspective, these features are analogous to the contacts, interconnections, devices, and wires of discrete and integrated electronic circuits. Although many attempts have been made to augment plant function with electroactive materials, plants’ “circuitry” has never been directly merged with electronics. We report analog and digital organic electronic circuits and devices manufactured in living plants. The four key components of a circuit have been achieved using the xylem, leaves, veins, and signals of the plant as the template and integral part of the circuit elements and functions. With integrated and distributed electronics in plants, one can envisage a range of applications including precision recording and regulation of physiology, energy harvesting from photosynthesis, and alternatives to genetic modification for plant optimization. PMID:26702448

  16. Zur chemie der marsoberfläche

    Science.gov (United States)

    Keil, Klaus; Clark, Benton C.; Baird, A.K.; Toulmin, Priestley; Rose, Harry J.

    1978-01-01

    Analyses of 13 samples of Martian surface materials with the Viking X-ray fluorescence spectrometers show SiO2 similar to that of terrestrial mafic rocks, whereas Fe2O3, Cl, and S are higher and Al2O3, K2O, Rb, Sr, Y, and Zr are lower. Low totals suggest presence of CO2, H2O, and Na2O. Duricrust fragments are higher in S than fines, but samples from both landing sites are surprisingly similar. We suggest that Martian surface materials are aeolian deposits of complex mixtures of weathering products of maficultramafic rocks, possibly consisting of iron-rich clays, sulfates, iron oxides, carbonates, and chlorides.

  17. La nuova fisica che ci aspetta

    CERN Multimedia

    Shiga, David

    2007-01-01

    The big accelerator that will enter in function at CERN at the end of the year will have the hard task to verify the relevance of the string theory, today the better candiddate to be the famous "theory of everything" that physicists are looking for since decades. (1 page)

  18. Using Screencasts in ChE Courses

    Science.gov (United States)

    Falconer, John L.; deGrazia, Janet; Medlin, J. Will; Holmberg, Michael P.

    2009-01-01

    Screencasts are digital recordings of the output from a computer monitor, including narration. Their use was piloted in five chemical engineering courses and the feedback from students was overwhelmingly positive. The screencasts were produced on Tablet PCs using Camtasia Studio software and were posted to the Blackboard classroom management…

  19. Plant embryogenesis

    NARCIS (Netherlands)

    Vries, de Sacco C.; Weijers, Dolf

    2017-01-01

    Land plants are called ‘embryophytes’ and thus, their collective name is defined by their ability to form embryos. Indeed, embryogenesis is a widespread phenomenon in plants, and much of our diet is composed of embryos (just think of grains, beans or nuts; Figure 1). However, in addition to embryos

  20. Open-pit coal-mining effects on rice paddy soil composition and metal bioavailability to Oryza sativa L. plants in Cam Pha, northeastern Vietnam.

    Science.gov (United States)

    Martinez, Raul E; Marquez, J Eduardo; Hòa, Hoàng Thị Bích; Gieré, Reto

    2013-11-01

    This study quantified Cd, Pb, and Cu content, and the soil-plant transfer factors of these elements in rice paddies within Cam Pha, Quang Ninh province, northeastern Vietnam. The rice paddies are located at a distance of 2 km from the large Coc Sau open-pit coal mine. Electron microprobe analysis combined with backscattered electron imaging and energy-dispersive spectroscopy revealed a relatively high proportion of carbon particles rimmed by an iron sulfide mineral (probably pyrite) in the quartz-clay matrix of rice paddy soils at 20-30 cm depth. Bulk chemical analysis of these soils revealed the presence of Cd, Cu, and Pb at concentrations of 0.146±0.004, 23.3±0.1, and 23.5±0.1 mg/kg which exceeded calculated background concentrations of 0.006±0.004, 1.9±0.5, and 2.4±1.5 mg/kg respectively at one of the sites. Metals and metalloids in Cam Pha rice paddy soils, including As, Cd, Cr, Cu, Hg, Mn, Ni, Pb, and Zn, were found in concentrations ranging from 0.2±0.1 to 140±3 mg/kg, which were in close agreement with toxic metal contents in mine tailings and Coc Sau coal samples, suggesting mining operations as a major cause of paddy soil contamination. Native and model Oryza sativa L. rice plants were grown in the laboratory in a growth medium to which up to 1.5 mg/kg of paddy soil from Cam Pha was added to investigate the effects on plant growth. A decrease in growth by up to 60% with respect to a control sample was found for model plants, whereas a decrease of only 10% was observed for native (Nep cai hoa vang variety) rice plants. This result suggests an adaptation of native Cam Pha rice plants to toxic metals in the agricultural lands. The Cd, Cu, and Pb contents of the native rice plants from Cam Pha paddies exceeded permitted levels in foods. Cadmium and Pb were highest in the rice plant roots with concentrations of 0.84±0.02 and 7.7±0.3 mg/kg, suggesting an intake of these metals into the rice plant as shown, for example, by Cd and Pb concentrations of 0

  1. Illustrations to “Gespräche in dem Reiche derer Todten zwischen dem vortreflichen Moscowitischen Czaar Petro Magno und dem grossen Tyrannen Ivan Basilowiz II” (Peter the Great and Ivan the Terrible by David Fassmann (1725

    Directory of Open Access Journals (Sweden)

    Ekaterina A. Skvortcova

    2017-12-01

    Full Text Available The journal created by David Fassmann (1683–1744, Gespräche in dem Reiche derer Todten, edited in Leipzig, was a huge success. Each of the 240 issues presents a dialogue between two historical figures from the afterworld. In the 83rd–86th Entrevuë, the interlocutors are Peter the Great and Ivan the Terrible. The texts of the four conversations were thoroughly examined by Eckhard Matthes (1987. The present paper explores how the illustrations to the 83rd–86th Entrevuë visualize the texts, which is significant as they were an important instrument for disseminating certain notions about Russia. While the illustration to the first dialogue of the suite juxtaposes Peter and Ivan, the illustration to the second one emphasizes the similarities between them. So the image of the “tyrant” and “barbarian” Ivan becomes a reference point with which a reader is urged to compare Peter’s deeds, seeing not only the differences but also the similarities. This greatly contributes to the creation of the multifaceted image of Russia of the early 18th century. The characters of the second illustration—a tiger and an executioner—can be identified as Ivan and Peter only if the reader takes into consideration an epigram to the illustration, the illustration to the previous dialogue, the text of the next Entrevuë, and facts about the execution of the strel’tsy known from other texts and images, about which Fassmann remains silent in the spirit of ars dissimulandi, which was typical for baroque culture. The paper offers an attempt to trace the iconography of the tyrant as a tiger. In the frontispiece to the 85th Entrevuë, a secretary bringing news from the world of the living and a portrait of Catherine I emphasize the connection of the past and the present, i.e., history and policy. Finally, the illustration to the last dialogue of the series returns to the glorification of Peter the Great declared in the first dialogue.

  2. Plant Macrofossils

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Records of past vegetation and environmental change derived from plant remains large enough to be seen without a microscope (macrofossils), such as leaves, needles,...

  3. T Plant

    Data.gov (United States)

    Federal Laboratory Consortium — Arguably the second most historic building at Hanford is the T Plant.This facility is historic in that it's the oldest remaining nuclear facility in the country that...

  4. Lunar Plants

    Data.gov (United States)

    National Aeronautics and Space Administration — We present an open design for a first plant growth module on the Moon (LPX). The primary science goal of lunar habitat is to investigate germination and initial...

  5. Alien plants

    Science.gov (United States)

    2018-04-01

    No-one’s ever travelled to an extrasolar planet, or even observed one that we’re sure harbours life. But if plants do exist on such alien worlds, we can have fun speculating what form they might take.

  6. Plant simulator

    International Nuclear Information System (INIS)

    Fukumitsu, Hiroyuki

    1998-01-01

    A simulator of a reactor plant of the present invention comprises a plurality of distributed computers, an indication processing section and an operation section. The simulation calculation functions of various kinds of plant models in the plant are shared by the plurality of computers. The indication processing section controls collection of data of the plant simulated by the computers and instructions of an operator. The operation section is operated by the operator and the results of operation are transmitted to the indication processing section, to conduct operation trainings and display the results of the simulation. Each of the computers and the indication processing portion are connected with each other by a network having a memory for common use. Data such as the results of calculation of plant models and various kinds of parameters of the plant required commonly to the calculators and the indication processing section are stored in the common memory, and adapted to be used by way of the network. (N.H.)

  7. A Comprehensive Model of the Dry Desulphurisation Process Une modélisation non empirique du procédé de désulfuration par voie sèche

    Directory of Open Access Journals (Sweden)

    Flament P.

    2006-11-01

    humide des fumées, le procédé de désulfuration par voie sèche reste un moyen attractif pour éliminer le dioxyde de soufre lorsque le taux de réduction souhaité ne dépasse pas 90 %. Dans cette technique, l'élimination du SO2 se fait en injectant directement dans les produits de combustion de très fines particules d'un absorbant calcique tel que le calcaire (CaCO3 ou la chaux (Ca(OH². L'absorbant est tout d'abord transformé en oxyde de calcium (CaO avant de réagir avec le SO2 pour former un composé stable : le sulfate de calcium (CaSO4. Bien que les réactions globales soient extrêmement simples, une description complète des mécanismes nécessite de connaître à la fois, les propriétés physiques initiales de l'absorbant et leur évolution durant la réaction. De plus, les conditions d'injection des particules jouent un rôle prépondérant dans le procédé de désulfuration par voie sèche. Tous ces aspects sont traités dans ce papier. Le modèle de désulfuration a d'abord été testé seul par comparaison avec les données cinétiques de la Fondation Internationale de Recherches sur les Flammes (FRIF, puis, couplé avec le code KIVA, il a été utilisé pour simuler la désulfuration dans un nouveau type de chaudière développée par Babcock Entreprise et l'Institut Français du Pétrole (chaudière 'AUDE'. Dans ce dernier cas, l'objectif poursuivi était de déterminer la meilleure configuration à donner au système d'injection des particules pour obtenir un taux de désulfuration maximum. La dispersion des particules étant un paramètre important du procédé de désulfuration, un exemple de validation du modèle de dispersion est également traité. L'injection de particules dans une couche de mélange a été choisie comme cas test. L'accord entre les valeurs expérimentales de Ando et al. (1990 et les calculs effectués avec KIVA est satisfaisant.

  8. La spirale dell’azzardo: una subcultura del gioco che “evapora” le relazioni / La spirale du jeu de hasard : une sous-culture qui empêche toute relation / The gambling: a subculture of game that “burns” the relationships

    Directory of Open Access Journals (Sweden)

    Molin Valentina

    2011-07-01

    Full Text Available In this paper I have analysed the characteristics of what I define the “gambling subculture”, which is detectable in certain gaming environments and in subgroups of particularly “rabid” players. Within these subcultures there have been identified rules and sanctions, values, consolidate behaviours, characterization of relationships and interactions, and the conclusion is that what is built within the gambling environment is a separate universe, an “outer reality”, in which the values of the world “outside” change. It was also possible to conclude that, to join the gambling world for a gambler – learning its rules, sharing its values, developing relations inside it – represents a stimulus for gambling habits, as it allows to consider as “normal” their behaviour thanks to positive feedback from their groups of fellow players, and to the neutralization of possible negative feedback from “non-players”.Nel presente contributo vengono analizzate le caratteristiche di quella che ho definito “subcultura dell'azzardo”, rilevabile in determinati ambienti ludici e in sotto-gruppi di giocatori particolarmente “accaniti”. Di queste forme di subcultura sono state individuate norme e sanzioni, valori, comportamenti consolidati, caratterizzazione delle relazioni e delle interazioni, giungendo alla conclusione che quello che viene costruito negli spazi di gioco rappresenta un universo separato, un “extraluogo”, nel quale vengono scritte nuove regole e nel quale cambiano i valori rispetto al mondo “esterno”. È stato possibile inoltre concludere che l'adesione all'“universo gioco” – l'interiorizzazione delle sue norme, la condivisione dei suoi valori, lo sviluppo di relazioni al suo interno – rappresenta un fattore di mantenimento della condotta ludica, poiché permette di considerare “normale” il proprio comportamento grazie ai rinforzi positivi che giungono dal gruppo dei compagni-giocatori e alla

  9. La normativa italiana sui contratti di lavoro a tempo determinato nel settore della scuola è contraria al diritto dell’Unione: la Corte di Giustizia UE apre al risarcimento per i docenti che abbiano svolto supplenze annuali per la copertura di posti vacanti

    Directory of Open Access Journals (Sweden)

    Arando Plaia

    2015-01-01

    Full Text Available La Corte di Giustizia UE con sentenza 26 novembre 2014, cause riunite C-22/13, C-61/13, C-62/13, C-63/13, C-418/13, Mascolo, ha ritenuto che la normativa europea sul lavoro a tempo determinato, applicabile anche al settore pubblico della scuola (casi Rosado Santana, Marrosu Sardino e Adelener, osta ad un sistema di assunzione per svolgere “supplenze annuali” nelle scuole pubbliche che non prevede almeno una delle seguenti “misure di prevenzione”: l’indicazione delle “ragioni oggettive” che giustificano il rinnovo dei contratti; la determinazione della “durata massima totale dei contratti” o del “numero dei loro rinnovi”, in assenza peraltro di una misura sanzionatoria proporzionata, effettiva e dissuasiva, da applicarsi in caso di utilizzo abusivo di successione di contratti a tempo determinato (clausola 5 dell’accordo quadro 18 marzo 1999 allegato dir. 1999/70/CE. Sebbene dunque il settore dell’insegnamento implichi inevitabilmente una certa “flessibilità”, e la normativa europea non enunci un obbligo generale degli Stati membri di prevedere la sanzione della trasformazione dei contratti di lavoro a tempo determinato in contratti a tempo indeterminato (CGUE 3 luglio 2014, Fiamingo, causa C-362/13, la normativa italiana non prevede misure atte a “prevenire” o “sanzionare” l’utilizzo abusivo di successione di contratti a tempo determinato. Questo (e non altro il principio di diritto affermato dalla Corte di giustizia: la sentenza ribadisce l’assenza di misure di prevenzione imposte dalla disciplina europea nonché di una sanzione risarcitoria rispetto al ricorso abusivo ai contratti a tempo determinato nel settore scolastico.

  10. Plant automation

    International Nuclear Information System (INIS)

    Christensen, L.J.; Sackett, J.I.; Dayal, Y.; Wagner, W.K.

    1989-01-01

    This paper describes work at EBR-II in the development and demonstration of new control equipment and methods and associated schemes for plant prognosis, diagnosis, and automation. The development work has attracted the interest of other national laboratories, universities, and commercial companies. New initiatives include use of new control strategies, expert systems, advanced diagnostics, and operator displays. The unique opportunity offered by EBR-II is as a test bed where a total integrated approach to automatic reactor control can be directly tested under real power plant conditions

  11. Doutorado-sanduíche em enfermagem: relato de experiência Doctorado sándwich en enfermería: relato de experiencia Sandwich doctoral program in nursing: an experience report

    Directory of Open Access Journals (Sweden)

    Rosane Arruda Dantas

    2009-06-01

    Full Text Available Relato de experiência acerca de estágio de doutorando-sanduíche realizado com bolsa da Coordenação de Aperfeiçoamento de Pessoal de Nível Superior, durante o período de outubro de 2005 a janeiro de 2006, na Faculdade de Enfermagem de D. Ana Guedes, no Porto, em Portugal, instituição já visitada na graduação. Tive a oportunidade de replicar a metodologia de parte da dissertação com crianças portuguesas. Isso permitiu estudo comparativo entre duas culturas que guardam afinidades, mas têm características distintas. Além disso, ministrei aulas, participei de cursos e seminários e aprofundei os conhecimentos acerca da Teoria da Universalidade e Diversidade do Cuidado Cultural. Considero que esta experiência é um estímulo para a garantia da autonomia do enfermeiro na assistência de enfermagem, como pesquisador e docente, ampliando conhecimentos e os inserindo no processo de cuidado. Ademais, influencia positivamente no amadurecimento psicológico, cultural e social do doutorando.Relato de experiencia acerca de pasantía de doctorado sándwich realizado con suporte financiero de la Coordinación de Mejora del Personal del Nivel Superior, durante el período de octubre de 2005 a enero de 2006, en la Facultad de Enfermería de D. Ana Guedes, en Porto, Portugal, institución ya visitada durante la graduación. Tuve la oportunidad de replicar la metodología de parte de la disertación junto a niños portugueses. Esto permitió un estudio comparativo entre dos culturas que guardan afinidades, pero tienen características distintas. Además, ministré clases, participé de cursos y seminarios y me profundicé en los conocimientos acerca de la Teoría de la Universalidad y Diversidad del Cuidado Cultural. Considero que esta experiencia es un estímulo para la garantía de la autonomía del enfermero en la atención de enfermería, como investigadora y docente, ampliando conocimientos e insertándolos en el proceso de cuidado. Adem

  12. Variations autour de la tâche dans l'enseignement / apprentissage des langues aujourd'hui What kind of tasks are used for L2 teaching and learning today?

    Directory of Open Access Journals (Sweden)

    Elke Nissen

    2011-10-01

    Full Text Available Cet article se donne pour objectif d'identifier les types de tâches, et leurs dénominateurs communs, qui sont présentés aujourd'hui – où "l'approche par les tâches" est soutenue par le Conseil de l'Europe – aux apprenants. Il analyse pour cela les articles issus de deux numéros de revues et un ouvrage collectif récents. Il apparaît que la grande majorité des scénarios pédagogiques s'y inscrit dans la perspective actionnelle... du moins d'après la déclaration des auteurs, car leur définition de ce qu'est une tâche ne correspond pas toujours à celle du CECR. Pour le public visé, étudiants ou professionnels, on propose le plus souvent des mono-tâches, mais également des projets, ou encore des simulations avec un enchaînement de plusieurs tâches. Elles s'inscrivent généralement dans la (future réalité sociale des apprenants, mais certaines laissent également la place à des thèmes artistiques ou (interculturels. Contrairement à ce que l'on aurait pu attendre dans une démarche qui responsabilise l'apprenant, le recours à Internet n'est pas toujours systématique.At a time when action- and task-based learning is sustained by the European Council, this paper explores which types of tasks are given to second language learners today and what aspects these tasks have in common. The paper analyses two recent issues of scientific journals and one collective book. The analysis shows that the majority of pedagogical scenarios described in these texts claim to adopt an action- and task-based approach. However, in reality the way they define a task does not always correspond to the definition given by the European Framework of Reference for Languages. The described tasks are exclusively dedicated to higher and professional education; they are mostly single tasks, but they can also be projects and simulations including several successive tasks. They generally correspond to the learners' (future reality, with themes that are

  13. Approche multidimensionnelle de la difficulté objective dans une tâche d’anticipation coï ncidence Multidimensional approach of objective difficulty in an aiming task

    Directory of Open Access Journals (Sweden)

    P. Deneuve

    2010-09-01

    Full Text Available

     

    Cet article a pour objet de proposer une nouvelle procédure pour classer les tâches motrices à caractère informationnel à partir d’une approche multidimensionnelle de la difficulté. L’expérimentation a consisté à faire passer des tests de pointage à 345 sujets sur cibles mobiles créées et gérées par ordinateur. Les paramètres des cibles ont été choisis pour leur indépendance et la possibilité de les positionner sur des échelles numériques. Trois descripteurs ont été retenus : la vitesse de déplacement, la surface de la cible et l’incertitude spatiale. La performance ne semblant pas être la seule variable dépendante résumant la difficulté, il lui a été adjoint trois autres variables : les tentatives, le temps de réaction et le temps moteur. En utilisant des outils statistiques permettant des analyses de données multidimensionnelles (CAH, AFC, il a été possible soit d’agréger des tâches aux profils identiques soit de les différencier en fonction du poids de chaque descripteur sur les variables dépendantes. Surtout, il est envisageable de préciser l’apport de chaque variable dans la définition de la difficulté que se donne a posteriori le chercheur.
    PALABRAS CLAVE: Difficulté, traitement de l’information, tâche motrice, classification, analyse de données.

    This article deals with a new method to classify informational motor tasks, through a multidimensional approach of difficulty. The following experiment is used: 345 subjects are asked to point at computer-managed mobile targets. The 3 selected target parameters are: velocity, area and spatial uncertainty. Independence and numerical scalability are the reasons for this choice. As performance does not sump up difficulty, other dependent variables have been added: number of attempts, reaction time and motor time. The use of

  14. Plant intelligence

    Science.gov (United States)

    Lipavská, Helena; Žárský, Viktor

    2009-01-01

    The concept of plant intelligence, as proposed by Anthony Trewavas, has raised considerable discussion. However, plant intelligence remains loosely defined; often it is either perceived as practically synonymous to Darwinian fitness, or reduced to a mere decorative metaphor. A more strict view can be taken, emphasizing necessary prerequisites such as memory and learning, which requires clarifying the definition of memory itself. To qualify as memories, traces of past events have to be not only stored, but also actively accessed. We propose a criterion for eliminating false candidates of possible plant intelligence phenomena in this stricter sense: an “intelligent” behavior must involve a component that can be approximated by a plausible algorithmic model involving recourse to stored information about past states of the individual or its environment. Re-evaluation of previously presented examples of plant intelligence shows that only some of them pass our test. “You were hurt?” Kumiko said, looking at the scar. Sally looked down. “Yeah.” “Why didn't you have it removed?” “Sometimes it's good to remember.” “Being hurt?” “Being stupid.”—(W. Gibson: Mona Lisa Overdrive) PMID:19816094

  15. PLANT DIVERSITY

    Science.gov (United States)

    Habitat change statistics and species-area curves were used to estimate the effects of alternative future scenarios for agriculture on plant diversity in Iowa farmlands. Study areas were two watersheds in central Iowa of about 50 and 90 square kilometers, respectively. Future s...

  16. Stress tolerant plants

    OpenAIRE

    Rubio, Vicente; Iniesto Sánchez, Elisa; Irigoyen Miguel, María Luisa

    2014-01-01

    [EN] The invention relates to transgenic plants and methods for modulating abscisic acid (ABA) perception and signal transduction in plants. The plants find use in increasing yield in plants, particularly under abiotic stress.

  17. Reuse of treated waste water for the irrigation of ornamental plants. The case of Pistoia; Riuso di acque reflue depurate di specie ornamentali: l'impianto pilota di Pistoia

    Energy Technology Data Exchange (ETDEWEB)

    Gori, R.; Lubello, C. [Florence Univ., Florence (Italy). Dipt. di Ingegneria Civile

    1999-12-01

    After a brief introduction on irrigation waste water reuse, the paper deals with the case of Pistoia (italy), the most important nursery area in Italy, which has developed an experiment for evaluating the effects of waste water treatment plant effluent irrigation. The better physiological and growth parameters of plants irrigated with the effluent shows that it could be a valid alternative of water and fertilizer nutrients resources for ornamental plants. [Italian] Dopo una breve introduzione sul riuso delle acque reflue a fini irrigui, il lavoro affronta il caso di Pistoia, sede della maggiore area vivaistica italiana, che utilizza le acque reflue dal 1998 con una sperimentazione volta a verificare gli effetti dell'irrigazione con l'effluente dell'impianto di depurazione centrale. Le piante cosi' irrigate hanno mostrato parametri di crescita e fisiologici generalmente migliori di quelli riscontrati sulle piante irrigate con i metodi tradizionali.

  18. Plant Host Finding by Parasitic Plants: A New Perspective on Plant to Plant Communication

    OpenAIRE

    Mescher, Mark C; Runyon, Justin B; De Moraes, Consuelo M

    2006-01-01

    Plants release airborne chemicals that can convey ecologically relevant information to other organisms. These plant volatiles are known to mediate a large array of, often complex, interactions between plants and insects. It has been suggested that plant volatiles may have similar importance in mediating interactions among plant species, but there are few well-documented examples of plant-to-plant communication via volatiles, and the ecological significance of such interactions has been much d...

  19. Nuclear power plants

    International Nuclear Information System (INIS)

    1985-01-01

    Data concerning the existing nuclear power plants in the world are presented. The data was retrieved from the SIEN (Nuclear and Energetic Information System) data bank. The information are organized in table forms as follows: nuclear plants, its status and type; installed nuclear power plants by country; nuclear power plants under construction by country; planned nuclear power plants by country; cancelled nuclear power plants by country; shut-down nuclear power plants by country. (E.G.) [pt

  20. Neanderthal use of fish, mammals, birds, starchy plants and wood 125-250,000 years ago.

    Directory of Open Access Journals (Sweden)

    Bruce L Hardy

    Full Text Available Neanderthals are most often portrayed as big game hunters who derived the vast majority of their diet from large terrestrial herbivores while birds, fish and plants are seen as relatively unimportant or beyond the capabilities of Neanderthals. Although evidence for exploitation of other resources (small mammals, birds, fish, shellfish, and plants has been found at certain Neanderthal sites, these are typically dismissed as unusual exceptions. The general view suggests that Neanderthal diet may broaden with time, but that this only occurs sometime after 50,000 years ago. We present evidence, in the form of lithic residue and use-wear analyses, for an example of a broad-based subsistence for Neanderthals at the site of Payre, Ardèche, France (beginning of MIS 5/end of MIS 6 to beginning of MIS 7/end of MIS 8; approximately 125-250,000 years ago. In addition to large terrestrial herbivores, Neanderthals at Payre also exploited starchy plants, birds, and fish. These results demonstrate a varied subsistence already in place with early Neanderthals and suggest that our ideas of Neanderthal subsistence are biased by our dependence on the zooarchaeological record and a deep-seated intellectual emphasis on big game hunting.

  1. LNG plant combined with power plant

    Energy Technology Data Exchange (ETDEWEB)

    Aoki, I; Kikkawa, Y [Chiyoda Chemical Engineering and Construction Co. Ltd., Tokyo (Japan)

    1997-06-01

    The LNG plant consumers a lot of power of natural gas cooling and liquefaction. In some LNG plant location, a rapid growth of electric power demand is expected due to the modernization of area and/or the country. The electric power demand will have a peak in day time and low consumption in night time, while the power demand of the LNG plant is almost constant due to its nature. Combining the LNG plant with power plant will contribute an improvement the thermal efficiency of the power plant by keeping higher average load of the power plant, which will lead to a reduction of electrical power generation cost. The sweet fuel gas to the power plant can be extracted from the LNG plant, which will be favorable from view point of clean air of the area. (Author). 5 figs.

  2. LNG plant combined with power plant

    International Nuclear Information System (INIS)

    Aoki, I.; Kikkawa, Y.

    1997-01-01

    The LNG plant consumers a lot of power of natural gas cooling and liquefaction. In some LNG plant location, a rapid growth of electric power demand is expected due to the modernization of area and/or the country. The electric power demand will have a peak in day time and low consumption in night time, while the power demand of the LNG plant is almost constant due to its nature. Combining the LNG plant with power plant will contribute an improvement the thermal efficiency of the power plant by keeping higher average load of the power plant, which will lead to a reduction of electrical power generation cost. The sweet fuel gas to the power plant can be extracted from the LNG plant, which will be favorable from view point of clean air of the area. (Author). 5 figs

  3. Plant host finding by parasitic plants: a new perspective on plant to plant communication.

    Science.gov (United States)

    Mescher, Mark C; Runyon, Justin B; De Moraes, Consuelo M

    2006-11-01

    Plants release airborne chemicals that can convey ecologically relevant information to other organisms. These plant volatiles are known to mediate a large array of, often complex, interactions between plants and insects. It has been suggested that plant volatiles may have similar importance in mediating interactions among plant species, but there are few well-documented examples of plant-to-plant communication via volatiles, and the ecological significance of such interactions has been much debated. To date, nearly all studies of volatile-mediated interactions among plant species have focused on the reception of herbivore-induced volatiles by neighboring plants. We recently documented volatile effects in another system, demonstrating that the parasitic plant Cuscuta pentagona uses volatile cues to locate its hosts. This finding may broaden the discussion regarding plant-to-plant communication, and suggests that new classes of volatile-meditated interactions among plant species await discovery.

  4. Plant host finding by parasitic plants: A new perspective on plant to plant communication

    Science.gov (United States)

    Mark C. Mescher; Justin B. Runyon; Consuelo M. De Moraes

    2006-01-01

    Plants release airborne chemicals that can convey ecologically relevant information to other organisms. These plant volatiles are known to mediate a large array of, often complex, interactions between plants and insects. It has been suggested that plant volatiles may have similar importance in mediating interactions among plant species, but there are few well-...

  5. Kansas Power Plants

    Data.gov (United States)

    Kansas Data Access and Support Center — The Kansas Power Plants database depicts, as point features, the locations of the various types of power plant locations in Kansas. The locations of the power plants...

  6. Gender in Plants

    Indian Academy of Sciences (India)

    What is the difference between plant sex and plant gender? Why does stress .... environmental sex determination is often predictable. Sunlit patches favour .... ensures that these self-incompatible plants receive cross-pollen only. i emporal ...

  7. Engineered Plants as Biosensors

    National Research Council Canada - National Science Library

    Stewart, C

    2003-01-01

    The aim of the research was the creation of a model biosensing plant that could detect plant diseases and to characterize the utility of laser induced fluorescence imaging for detecting the inducible (LIFI) plant signal...

  8. Plant stress signalling: understanding and exploiting plant-plant interactions.

    Science.gov (United States)

    Pickett, J A; Rasmussen, H B; Woodcock, C M; Matthes, M; Napier, J A

    2003-02-01

    When plants are attacked by insects, volatile chemical signals can be released, not only from the damaged parts, but also systemically from other parts of the plant and this continues after cessation of feeding by the insect. These signals are perceived by olfactory sensory mechanisms in both the herbivorous insects and their parasites. Molecular structures involved can be characterized by means of electrophysiological assays, using the insect sensory system linked to chemical analysis. Evidence is mounting that such signals can also affect neighbouring intact plants, which initiate defence by the induction of further signalling systems, such as those that increase parasitoid foraging. Furthermore, insect electrophysiology can be used in the identification of plant compounds having effects on the plants themselves. It has been found recently that certain plants can release stress signals even when undamaged, and that these can cause defence responses in intact plants. These discoveries provide the basis for new crop protection strategies, that are either delivered by genetic modification of plants or by conventionally produced plants to which the signal is externally applied. Delivery can also be made by means of mixed seed strategies in which the provoking and recipient plants are grown together. Related signalling discoveries within the rhizosphere seem set to extend these approaches into new ways of controlling weeds, by exploiting the elusive potential of allelopathy, but through signalling rather than by direct physiological effects.

  9. Doutorado sanduíche: considerações para uma experiência de sucesso no exterior Doctorado sándwich: consideraciones para una experiencia exitosa en el extranjero 'Sandwich PhD': considerations for a successful experience abroad

    Directory of Open Access Journals (Sweden)

    Marina de Goes Salvetti

    2013-03-01

    Full Text Available O estágio de doutorado no exterior, conhecido, no Brasil, como "Doutorado Sanduíche", é uma oportunidade de aprimorar as habilidades em pesquisa, destacar-se no meio acadêmico e estabelecer e/ou ampliar oportunidades de trabalho em contexto internacional. Neste artigo, descrevemos elementos-chave do processo de planejamento e desenvolvimento do Doutorado Sanduíche aprendidos por professores e alunos envolvidos na colaboração entre a Escola de Enfermagem da Universidade de São Paulo e a Lawrence S. Bloomberg Faculty of Nursing, Universidade de Toronto, Canadá, e apresentamos a participação em uma rede de doutorados, como alternativa ao Doutorado Sanduíche. A experiência internacional, quando bem planejada e desenvolvida, promove o desenvolvimento pessoal e profissional do aluno, favorece a internacionalização dos programas de pós-graduação e dos grupos de pesquisa brasileiros.Una estancia de doctorado internacional, "Doctorado Sándwich" como es conocido en Brasil, es una oportunidad de mejorar las habilidades de investigación, hacerse conocido académicamente y establecer y/o agrandar las oportunidades de trabajo en el contexto internacional. En este artículo, nosotros describimos factores importantes del proceso de la planificación y desarrollo del "Doctorado Sándwich" aprendidos por estudiantes y profesores involucrados en la colaboración entre la Escuela de Enfermería de la Universidad de São Paulo y la Facultad de Enfermería Lawrence S. Bloomberg, Universidad de Toronto, Canadá y presentamos la participación en una red de doctorados como una alternativa a la estancia doctoral internacional. La experiencia internacional, cuando bien planeada y desarrollada, promueve el desarrollo personal y profesional del estudiante y favorece la internacionalización de los programas de postgrado y de los grupos de investigación brasileños.International PhD internship, named "Sandwich PhD'" in Brazil, is an opportunity to

  10. Plants get sick too!

    Science.gov (United States)

    Although many people may never have given consideration to plant health, plants can suffer from a wide range of diseases. These plant diseases are caused by micro-organisms, including bacteria, fungi, and viruses. The audience will be introduced to short case studies of several plant diseases that m...

  11. Plant extraction process

    DEFF Research Database (Denmark)

    2006-01-01

    A method for producing a plant extract comprises incubating a plant material with an enzyme composition comprising a lipolytic enzyme.......A method for producing a plant extract comprises incubating a plant material with an enzyme composition comprising a lipolytic enzyme....

  12. Radioactive uptake by plants

    Energy Technology Data Exchange (ETDEWEB)

    Horak, O

    1986-01-01

    The fundamentals of radionuclide uptake by plants, both by leaves and roots are presented. Iodine, cesium, strontium and ruthenium are considered and a table of the measured concentrations in several agricultural plants shortly after the Chernobyl accident is presented. Another table gives the Cs and Sr transfer factors soil plants for some plants. By using them estimates of future burden can be obtained.

  13. Plant Biology Science Projects.

    Science.gov (United States)

    Hershey, David R.

    This book contains science projects about seed plants that deal with plant physiology, plant ecology, and plant agriculture. Each of the projects includes a step-by-step experiment followed by suggestions for further investigations. Chapters include: (1) "Bean Seed Imbibition"; (2) "Germination Percentages of Different Types of Seeds"; (3)…

  14. Plants' essential chemical elements

    Science.gov (United States)

    Kevin T. Smith

    2007-01-01

    Every garden center and hardware store sells fertilizer guaranteed to "feed" plants. In a strict sense, we can't feed plants. Food contains an energy source. Green plants capture solar energy and make their own food through photosynthesis! Photosynthesis and other metabolic processes require chemical elements in appropriate doses for plants to survive...

  15. Plant Research '75

    Energy Technology Data Exchange (ETDEWEB)

    1975-01-01

    Research is reported on stomatal regulation of the gas exchanges between plant and environment; inhibitory effects in flower formation; plant growth and development through hormones; hormone action; development and nitrogen fixation in algae; primary cell wall glycoprotein ectensin; enzymic mechanisms and control of polysaccharide and glycoprotein synthesis; molecular studies of membrane studies; sensory transduction in plants; regulation of formation of protein complexes and enzymes in higher plant cell and mechanism of sulfur dioxide toxicity in plants. (PCS)

  16. PLANT BIOPRINTING: NOVEL PERSPECTIVE FOR PLANT BIOTECHNOLOGY

    Directory of Open Access Journals (Sweden)

    Adhityo WICAKSONO

    2015-12-01

    Full Text Available Bioprinting is a technical innovation that has revolutionized tissue engineering. Using conventional printer cartridges filled with cells as well as a suitable scaffold, major advances have been made in the biomedical field, and it is now possible to print skin, bones, blood vessels, and even organs. Unlike animal systems, the application of bioprinting in simple plant tissue cells is still in a nascent phase and has yet to be studied. One major advantage of plants is that all living parts are reprogrammable in the form of totipotent cells. Plant bioprinting may improve scientists’understanding of plant shape and morphogenesis, and could serve for the mass production of desired tissues or plants, or even the production of plant-based biomaterial for industrial uses. This perspectives paper explores these possibilities using knowledge on what is known about bioprinting in other biosystems.

  17. Plutonium Plant, Trombay

    International Nuclear Information System (INIS)

    Yadav, J.S.; Agarwal, K.

    2017-01-01

    The journey of Indian nuclear fuel reprocessing started with the commissioning of Plutonium Plant (PP) at Trombay on 22"n"d January, 1965 with an aim to reprocess the spent fuel from research reactor CIRUS. The basic process chosen for the plant was Plutonium Uranium Reduction EXtraction (PUREX) process. In seventies, the plant was subjected to major design modifications and replacement of hardware, which later met the additional demand from research reactor DHRUVA. The augmented plutonium plant has been operating since 1983. Experience gained from this plant was very much helpful to design future reprocessing plant in the country

  18. Better plants through mutations

    International Nuclear Information System (INIS)

    1988-01-01

    This is a public relations film describing problems associated with the genetic improvement of crop plants through induced mutations. Mutations are the ultimate source of genetic variation in plants. Mutation induction is now established as a practical tool in plant breeding. The Joint FAO/IAEA Division and the IAEA's laboratory at Seibersdorf have supported research and practical implementation of mutation breeding of both seed propagated and vegetatively propagated plants. Plant biotechnology based on in vitro culture and recombinant DNA technology will make a further significant contribution to plant breeding

  19. Plant Phenotype Characterization System

    Energy Technology Data Exchange (ETDEWEB)

    Daniel W McDonald; Ronald B Michaels

    2005-09-09

    This report is the final scientific report for the DOE Inventions and Innovations Project: Plant Phenotype Characterization System, DE-FG36-04GO14334. The period of performance was September 30, 2004 through July 15, 2005. The project objective is to demonstrate the viability of a new scientific instrument concept for the study of plant root systems. The root systems of plants are thought to be important in plant yield and thus important to DOE goals in renewable energy sources. The scientific study and understanding of plant root systems is hampered by the difficulty in observing root activity and the inadequacy of existing root study instrumentation options. We have demonstrated a high throughput, non-invasive, high resolution technique for visualizing plant root systems in-situ. Our approach is based upon low-energy x-ray radiography and the use of containers and substrates (artificial soil) which are virtually transparent to x-rays. The system allows us to germinate and grow plant specimens in our containers and substrates and to generate x-ray images of the developing root system over time. The same plant can be imaged at different times in its development. The system can be used for root studies in plant physiology, plant morphology, plant breeding, plant functional genomics and plant genotype screening.

  20. Plant tissue culture techniques

    Directory of Open Access Journals (Sweden)

    Rolf Dieter Illg

    1991-01-01

    Full Text Available Plant cell and tissue culture in a simple fashion refers to techniques which utilize either single plant cells, groups of unorganized cells (callus or organized tissues or organs put in culture, under controlled sterile conditions.

  1. Plant Tissue Culture

    Indian Academy of Sciences (India)

    Admin

    Plant tissue culture is a technique of culturing plant cells, tissues and organs on ... working methods (Box 2) and discovery of the need for B vita- mins and auxins for ... Kotte (Germany) reported some success with growing isolated root tips.

  2. Fertilization in Flowering Plants

    Indian Academy of Sciences (India)

    IAS Admin

    Ecology and the Environ- ment, Bengaluru as ... remaining plants, it is an abiotic agent (abiotic pollination), .... tion was slow until the origin of flowering plants and evolution of ..... Although pollination is generally a mutual interaction in a major-.

  3. Plant proton pumps

    DEFF Research Database (Denmark)

    Gaxiola, Roberto A.; Palmgren, Michael Gjedde; Schumacher, Karin

    2007-01-01

    Chemiosmotic circuits of plant cells are driven by proton (H+) gradients that mediate secondary active transport of compounds across plasma and endosomal membranes. Furthermore, regulation of endosomal acidification is critical for endocytic and secretory pathways. For plants to react...

  4. Terrestrial plant methane production

    DEFF Research Database (Denmark)

    Mikkelsen, Teis Nørgaard; Bruhn, Dan; Møller, Ian M.

    We evaluate all experimental work published on the phenomenon of aerobic methane (CH4) generation in terrestrial plants. We conclude that the phenomenon is true. Four stimulating factors have been observed to induce aerobic plant CH4 production, i.e. cutting injuries, increasing temperature...... the aerobic methane emission in plants. Future work is needed for establishing the relative contribution of several proven potential CH4 precursors in plant material....

  5. Plant aquaporins: roles in plant physiology.

    Science.gov (United States)

    Li, Guowei; Santoni, Véronique; Maurel, Christophe

    2014-05-01

    Aquaporins are membrane channels that facilitate the transport of water and small neutral molecules across biological membranes of most living organisms. Here, we present comprehensive insights made on plant aquaporins in recent years, pointing to their molecular and physiological specificities with respect to animal or microbial counterparts. In plants, aquaporins occur as multiple isoforms reflecting a high diversity of cellular localizations and various physiological substrates in addition to water. Of particular relevance for plants is the transport by aquaporins of dissolved gases such as carbon dioxide or metalloids such as boric or silicic acid. The mechanisms that determine the gating and subcellular localization of plant aquaporins are extensively studied. They allow aquaporin regulation in response to multiple environmental and hormonal stimuli. Thus, aquaporins play key roles in hydraulic regulation and nutrient transport in roots and leaves. They contribute to several plant growth and developmental processes such as seed germination or emergence of lateral roots. Plants with genetically altered aquaporin functions are now tested for their ability to improve plant resistance to stresses. This article is part of a Special Issue entitled Aquaporins. Copyright © 2013 Elsevier B.V. All rights reserved.

  6. Plants under dual attack

    NARCIS (Netherlands)

    Ponzio, C.A.M.

    2016-01-01

    Though immobile, plants are members of complex environments, and are under constant threat from a wide range of attackers, which includes organisms such as insect herbivores or plant pathogens. Plants have developed sophisticated defenses against these attackers, and include chemical responses

  7. Growing Plants and Minds

    Science.gov (United States)

    Presser, Ashley Lewis; Kamdar, Danae; Vidiksis, Regan; Goldstein, Marion; Dominguez, Ximena; Orr, Jillian

    2017-01-01

    Many preschool classrooms explore plant growth. However, because many plants take a long time to grow, it is often hard to facilitate engagement in some practices (i.e., since change is typically not observable from one day to another, children often forget their prior predictions or cannot recall what plants looked like days or weeks earlier).…

  8. Fundaments of plant cybernetics.

    Science.gov (United States)

    Zucconi, F

    2001-01-01

    A systemic approach is proposed for analyzing plants' physiological organization and cybernesis. To this end, the plant is inspected as a system, starting from the integration of crown and root systems, and its impact on a number of basic epigenetic events. The approach proves to be axiomatic and facilitates the definition of the principles behind the plant's autonomous control of growth and reproduction.

  9. Plant or Animal?

    Science.gov (United States)

    Bowman, Frank; Matthews, Catherine E.

    1996-01-01

    Presents activities that use marine organisms with plant-like appearances to help students build classification skills and illustrate some of the less obvious differences between plants and animals. Compares mechanisms by which sessile plants and animals deal with common problems such as obtaining energy, defending themselves, successfully…

  10. Small hydroelectric power plants

    International Nuclear Information System (INIS)

    Helgesen, Boerre

    2002-01-01

    Small hydroelectric power plants are power plants of 1 - 10 MW. For a supplier, this is an unnatural limit. A more natural limit involves compact engine design and simplified control system. The article discusses most of the engine and electrotechnical aspects in the development, construction and operation of such a plant

  11. Recognizing Plant Defense Priming.

    Science.gov (United States)

    Martinez-Medina, Ainhoa; Flors, Victor; Heil, Martin; Mauch-Mani, Brigitte; Pieterse, Corné M J; Pozo, Maria J; Ton, Jurriaan; van Dam, Nicole M; Conrath, Uwe

    2016-10-01

    Defense priming conditions diverse plant species for the superinduction of defense, often resulting in enhanced pest and disease resistance and abiotic stress tolerance. Here, we propose a guideline that might assist the plant research community in a consistent assessment of defense priming in plants. Copyright © 2016 Elsevier Ltd. All rights reserved.

  12. Plant Physiology in Greenhouses

    NARCIS (Netherlands)

    Heuvelink, E.; Kierkels, T.

    2015-01-01

    Since 2004 Ep Heuvelink and Tijs Kierkels have been writing a continuing series of plant physiology articles for the Dutch horticultural journal Onder Glas and the international edition In Greenhouses. The book Plant Physiology in Greenhouses consists of 50 of their plant physiology articles. The

  13. Plants and people

    Science.gov (United States)

    Kathryn Lynch

    2012-01-01

    Salal! Salmonberries! Sword ferns! The Northwest is home to a great number of native plant species that humans have used for centuries. Sadly, many local children are unaware of the history and culture connecting people and plants. Yet, from the beginning of time, plants have provided us food, medicine, and material for clothing, shelter, transportation, decoration,...

  14. Plant Systems Biology (editorial)

    Science.gov (United States)

    In June 2003, Plant Physiology published an Arabidopsis special issue devoted to plant systems biology. The intention of Natasha Raikhel and Gloria Coruzzi, the two editors of this first-of-its-kind issue, was ‘‘to help nucleate this new effort within the plant community’’ as they considered that ‘‘...

  15. Plants of the Bayshore.

    Science.gov (United States)

    Bachle, Leo; And Others

    This field guide gives pictures and descriptions of plants that can be found along the San Francisco Bayshore, especially along the Hayward shoreline. The plants are divided into three categories, those of the mud-flat zone, the drier zone, and the levee zone. Eighteen plants are represented in all. The guide is designed to be used alone, with an…

  16. TRANSGENIC PLANT CONTAINMENT

    Science.gov (United States)

    The new technology using plant genetics to produce chemicals, pharmaceuticals, and therapeuitics in a wide array of new plant forms requires sufficient testing to ensure that these new plant introductions are benign in the environment. A recent effort to provide necessary guidan...

  17. Plant Breeding Goes Microbial

    NARCIS (Netherlands)

    Wei, Zhong; Jousset, Alexandre

    Plant breeding has traditionally improved traits encoded in the plant genome. Here we propose an alternative framework reaching novel phenotypes by modifying together genomic information and plant-associated microbiota. This concept is made possible by a novel technology that enables the

  18. Plant innate immunity

    Indian Academy of Sciences (India)

    Plants are invaded by an array of pathogens of which only a few succeed in causing disease. The attack by others is countered by a sophisticated immune system possessed by the plants. The plant immune system is broadly divided into two, viz. microbial-associated molecular-patterns-triggered immunity (MTI) and ...

  19. Diagnosing plant problems

    Science.gov (United States)

    Cheryl A. Smith

    2008-01-01

    Diagnosing Christmas tree problems can be a challenge, requiring a basic knowledge of plant culture and physiology, the effect of environmental influences on plant health, and the ability to identify the possible causes of plant problems. Developing a solution or remedy to the problem depends on a proper diagnosis, a process that requires recognition of a problem and...

  20. Hydroelectric Power Plants Dobsina

    International Nuclear Information System (INIS)

    Majercak, V.; Srenkelova, Z.; Kristak, J.G.

    1997-01-01

    In this brochure the Hydroelectric Power Plants Dobsina, (VED), subsidiary of the utility Slovenske Elektrarne, a.s. (Slovak Electric, plc. Bratislava) are presented. VED is mainly aimed at generating peak-load electrical energy and maintenance of operational equipment. Reaching its goals, company is first of all focused on reliability of production, economy and effectiveness, keeping principles of work safety and industry safety standards and also ecology. VED operates eight hydroelectric power plants, from which PVE Ruzin I and PVE Dobsina I are pump storage ones and they are controlled directly by the Slovak Energy Dispatch Centre located in Zilina thought the system LS 3200. Those power plants participate in secondary regulation of electrical network of Slovakia. They are used to compensate balance in reference to foreign electrical networks and they are put into operation independently from VED. Activity of the branch is focused mainly on support of fulfilment of such an important aim as electric network regulation. Beginnings of the subsidiary Hydroelectric Power Plants Dobsina are related to the year of 1948. After commissioning of the pump storage Hydroelectric Power Plants Dobsina in 1953, the plant started to carry out its mission. Since that time the subsidiary has been enlarged by other seven power plants, through which it is fulfilling its missions nowadays. The characteristics of these hydroelectric power plants (The pump-storage power plant Dobsina, Small hydroelectric power plant Dobsina II, Small hydroelectric power plant Rakovec, Small hydroelectric power plant Svedlar, Hydroelectric power plant Domasa, The pump-storage power plant Ruzin, and Small hydroelectric power plant Krompachy) are described in detail. Employees welfare and public relations are presented

  1. Multinationals and plant survival

    DEFF Research Database (Denmark)

    Bandick, Roger

    2010-01-01

    The aim of this paper is twofold: first, to investigate how different ownership structures affect plant survival, and second, to analyze how the presence of foreign multinational enterprises (MNEs) affects domestic plants’ survival. Using a unique and detailed data set on the Swedish manufacturing...... sector, I am able to separate plants into those owned by foreign MNEs, domestic MNEs, exporting non-MNEs, and purely domestic firms. In line with previous findings, the result, when conditioned on other factors affecting survival, shows that foreign MNE plants have lower survival rates than non......-MNE plants. However, separating the non-MNEs into exporters and non-exporters, the result shows that foreign MNE plants have higher survival rates than non-exporting non-MNEs, while the survival rates of foreign MNE plants and exporting non-MNE plants do not seem to differ. Moreover, the simple non...

  2. Plant life management

    International Nuclear Information System (INIS)

    Charbonneau, S.; Framatome, J.B.

    1992-01-01

    Plant life assessment and extension studies have been performed by numerous companies all over the world. Critical equipment has been identified as well as various degradation mechanisms involved in the plant aging process. Nowadays one has to think what to implement to improve the existing situation in the Nuclear Power Plant (NPP). FRAMATOME has undertaken this thought process in order to find the right answers and bring them to utilities facing either critical concern for plant life extension or the problem of management of power plant potential longevity. This is why we prepared a Plant Life Improvement Action Plan, comprising 10 (ten) major items described hereafter using examples of work performed by FRAMATOME for its utility customers desiring to manage the lives of their plants, both in France with EDF and abroad

  3. Photochemical smog and plants

    Energy Technology Data Exchange (ETDEWEB)

    Sawada, T.

    1974-07-01

    Surveys of plant damage due to photochemical smog are summarized. The components of smog which appear to be responsible for plant damage include ozone and peroxyacyl nitrates. Their phytotoxic effects are much greater than those due to sulfur oxides. Damage surveys since 1970 reveal the following symptoms appearing on herbaceous plants (morning glory, cocks comb, dahlia, knotweed, petunia, chickweed, Welsh onion, spinach, Chinese cabbage, chard, taro): yellowish-white leaf discoloration, white and brown spots on matured leaves, and silvering of the lower surfaces of young leaves. Symptoms which appear on arboraceous plants such as zelkova, poplar, ginkgo, planetree, rose mallow, magnolia, pine tree, and rhododendron include early yellowing and reddening, white or brown spots, and untimely leaf-fall. The above plants are now utilized as indicator plants of photochemical smog. Surveys covering a broad area of Tokyo and three other prefectures indicate that plant damage due to photochemical smog extends to relatively unpolluted areas.

  4. Plant Physiology and Development

    DEFF Research Database (Denmark)

    Taiz, Lincoln; Zeiger, Eduardo; Møller, Ian Max

    Throughout its twenty-two year history, the authors of Plant Physiology have continually updated the book to incorporate the latest advances in plant biology and implement pedagogical improvements requested by adopters. This has made Plant Physiology the most authoritative, comprehensive......, and widely used upper-division plant biology textbook. In the Sixth Edition, the Growth and Development section (Unit III) has been reorganized and expanded to present the complete life cycle of seed plants from germination to senescence. In recognition of this enhancement, the text has been renamed Plant...... Physiology and Development. As before, Unit III begins with updated chapters on Cell Walls and Signals and Signal Transduction. The latter chapter has been expanded to include a discussion of major signaling molecules, such as calcium ions and plant hormones. A new, unified chapter entitled Signals from...

  5. Reassessing apoptosis in plants.

    Science.gov (United States)

    Dickman, Martin; Williams, Brett; Li, Yurong; de Figueiredo, Paul; Wolpert, Thomas

    2017-10-01

    Cell death can be driven by a genetically programmed signalling pathway known as programmed cell death (PCD). In plants, PCD occurs during development as well as in response to environmental and biotic stimuli. Our understanding of PCD regulation in plants has advanced significantly over the past two decades; however, the molecular machinery responsible for driving the system remains elusive. Thus, whether conserved PCD regulatory mechanisms include plant apoptosis remains enigmatic. Animal apoptotic regulators, including Bcl-2 family members, have not been identified in plants but expression of such regulators can trigger or suppress plant PCD. Moreover, plants exhibit nearly all of the biochemical and morphological features of apoptosis. One difference between plant and animal PCD is the absence of phagocytosis in plants. Evidence is emerging that the vacuole may be key to removal of unwanted plant cells, and may carry out functions that are analogous to animal phagocytosis. Here, we provide context for the argument that apoptotic-like cell death occurs in plants.

  6. Safe genetically engineered plants

    Energy Technology Data Exchange (ETDEWEB)

    Rosellini, D; Veronesi, F [Dipartimento di Biologia Vegetale e Biotecnologie Agroambientali e Zootecniche, Universita degli Studi di Perugia, Borgo XX giugno 74, 06121 Perugia (Italy)

    2007-10-03

    The application of genetic engineering to plants has provided genetically modified plants (GMPs, or transgenic plants) that are cultivated worldwide on increasing areas. The most widespread GMPs are herbicide-resistant soybean and canola and insect-resistant corn and cotton. New GMPs that produce vaccines, pharmaceutical or industrial proteins, and fortified food are approaching the market. The techniques employed to introduce foreign genes into plants allow a quite good degree of predictability of the results, and their genome is minimally modified. However, some aspects of GMPs have raised concern: (a) control of the insertion site of the introduced DNA sequences into the plant genome and of its mutagenic effect; (b) presence of selectable marker genes conferring resistance to an antibiotic or an herbicide, linked to the useful gene; (c) insertion of undesired bacterial plasmid sequences; and (d) gene flow from transgenic plants to non-transgenic crops or wild plants. In response to public concerns, genetic engineering techniques are continuously being improved. Techniques to direct foreign gene integration into chosen genomic sites, to avoid the use of selectable genes or to remove them from the cultivated plants, to reduce the transfer of undesired bacterial sequences, and make use of alternative, safer selectable genes, are all fields of active research. In our laboratory, some of these new techniques are applied to alfalfa, an important forage plant. These emerging methods for plant genetic engineering are briefly reviewed in this work.

  7. Safe genetically engineered plants

    International Nuclear Information System (INIS)

    Rosellini, D; Veronesi, F

    2007-01-01

    The application of genetic engineering to plants has provided genetically modified plants (GMPs, or transgenic plants) that are cultivated worldwide on increasing areas. The most widespread GMPs are herbicide-resistant soybean and canola and insect-resistant corn and cotton. New GMPs that produce vaccines, pharmaceutical or industrial proteins, and fortified food are approaching the market. The techniques employed to introduce foreign genes into plants allow a quite good degree of predictability of the results, and their genome is minimally modified. However, some aspects of GMPs have raised concern: (a) control of the insertion site of the introduced DNA sequences into the plant genome and of its mutagenic effect; (b) presence of selectable marker genes conferring resistance to an antibiotic or an herbicide, linked to the useful gene; (c) insertion of undesired bacterial plasmid sequences; and (d) gene flow from transgenic plants to non-transgenic crops or wild plants. In response to public concerns, genetic engineering techniques are continuously being improved. Techniques to direct foreign gene integration into chosen genomic sites, to avoid the use of selectable genes or to remove them from the cultivated plants, to reduce the transfer of undesired bacterial sequences, and make use of alternative, safer selectable genes, are all fields of active research. In our laboratory, some of these new techniques are applied to alfalfa, an important forage plant. These emerging methods for plant genetic engineering are briefly reviewed in this work

  8. [Intoxications with plants].

    Science.gov (United States)

    Kupper, Jacqueline; Reichert, Cornelia

    2009-05-01

    Ingestions of plants rarely lead to life-threatening intoxications. Highly toxic plants, which can cause death, are monkshood (Aconitum sp.), yew (Taxus sp.) and autumn crocus (Colchicum autumnale). Lethal ingestions of monkshood and yew are usually suicides, intoxications with autumn crocus are mostly accidental ingestions of the leaves mistaken for wild garlic (Allium ursinum). Severe intoxications can occur with plants of the nightshade family like deadly nightshade (Atropa belladonna), angel's trumpet (Datura suaveolens) or jimsonweed (Datura stramonium). These plants are ingested for their psychoactive effects. Ingestion of plant material by children most often only causes minor symptoms or no symptoms at all, as children usually do not eat great quantities of the plants. They are especially attracted by the colorful berries. There are plants with mostly cardiovascular effects like monkshood, yew and Digitalis sp. Some of the most dangerous plants belong to this group. Plants of the nightshade family cause an anticholinergic syndrome. With golden chain (Laburnum anagyroides), castor bean (Ricinus communis) and raw beans (Phaseolus vulgaris) we see severe gastrointestinal effects. Autumn crocus contains a cell toxin, colchicine, which leads to multiorgan failure. Different plants are irritative or even caustic to the skin. Treatment is usually symptomatic. Activated charcoal is administered within one hour after ingestion (1 g/kg). Endoscopic removal of plant material can be considered with ingestions of great quantities of highly toxic plants. Administration of repeated doses of charcoal (1-2 g/h every 2-4 hours) may be effective in case of oleander poisoning. There exist only two antidotes: Anti-digoxin Fab fragments can be used with cardenolide glycoside-containing plants (Digitalis sp., Oleander). Physostigmine is the antidote for severe anticholinergic symptoms of the CNS. Antibodies against colchicine, having been developed in France, are not available at

  9. A proposal to define when combined cycle can be classified as a cogeneration plants; Proposta di definizione di impianto di cogenerazione a ciclo combinato

    Energy Technology Data Exchange (ETDEWEB)

    Macchi, E. [Milan Politecnico, Milan (Italy)

    1999-09-01

    The recent decree on liberalization of the Italian electric market assigns to the authority for electric energy and natural gas the task of defining under which conditions a combined heat and power plant (CHP) obtains a significant primary energy saving when compared to separate productions. The present paper outlines and discusses the proposal made by a working group of CTI (Italian thermo-technical committee). The most significant features of the proposal are the following: i the use of IRE (Energy saving index), based upon net, annual energy production, certified by independent institutions; ii the adoption of an automatic procedure of yearly updating the reference performance related to conventional power generation, accounting for technology evolution; iii the assumption of a lower limit for the thermal/fuel energy ratio and iv correction procedures in case of usage of non-conventional fuels (municipal wastes, process gases, etc.) [Italian] Il recente decreto sulla liberalizzazione del mercato elettrico prevede che l'autorita per l'energie elettrica e il gas definisca le condizioni per cui un impianto di produzione combinata di energia elettrica e calore garantisce un significativo risparmio di energia rispetto alle produzioni separate. Nella presente nota viene descritta e commentata una proposta operativa avanzata da un gruppo di lavoro del Comitato Termotecnico Italiano (CTI). Elementi caratterizzanti la proposta sono: i) il riferimento all'indice IRE (indice di Risparmio di Energia primaria), valutato su prestazioni annue nette, a consuntivo e certificate da Enti indipendenti, ii) l'introduzione di un meccanismo automatico di revisione annuale di parametri di confronto relativi alla generazione separata che tenga conto dell'evoluzione tecnologica, iii) l'introduzione di un limite inferiore al rapporto fra la generazione di energia termica utile e l'energia introdotta con il combustibile e iv l'inserimento di

  10. Nuclear power plants

    International Nuclear Information System (INIS)

    Margulova, T.Ch.

    1976-01-01

    The textbook focuses on the technology and the operating characteristics of nuclear power plants equiped with pressurized water or boiling water reactors, which are in operation all over the world at present. The following topics are dealt with in relation to the complete plant and to economics: distribution and consumption of electric and thermal energy, types and equipment of nuclear power plants, chemical processes and material balance, economical characteristics concerning heat and energy, regenerative preheating of feed water, degassing and condenser systems, water supply, evaporators, district heating systems, steam generating systems and turbines, coolant loops and pipes, plant siting, ventilation and decontamination systems, reactor operation and management, heat transfer including its calculation, design of reactor buildings, and nuclear power plants with gas or sodium cooled reactors. Numerous technical data of modern Soviet nuclear power plants are included. The book is of interest to graduate and post-graduate students in the field of nuclear engineering as well as to nuclear engineers

  11. Conditional sterility in plants

    Science.gov (United States)

    Meagher, Richard B.; McKinney, Elizabeth; Kim, Tehryung

    2010-02-23

    The present disclosure provides methods, recombinant DNA molecules, recombinant host cells containing the DNA molecules, and transgenic plant cells, plant tissue and plants which contain and express at least one antisense or interference RNA specific for a thiamine biosynthetic coding sequence or a thiamine binding protein or a thiamine-degrading protein, wherein the RNA or thiamine binding protein is expressed under the regulatory control of a transcription regulatory sequence which directs expression in male and/or female reproductive tissue. These transgenic plants are conditionally sterile; i.e., they are fertile only in the presence of exogenous thiamine. Such plants are especially appropriate for use in the seed industry or in the environment, for example, for use in revegetation of contaminated soils or phytoremediation, especially when those transgenic plants also contain and express one or more chimeric genes which confer resistance to contaminants.

  12. Plant synthetic biology.

    Science.gov (United States)

    Liu, Wusheng; Stewart, C Neal

    2015-05-01

    Plant synthetic biology is an emerging field that combines engineering principles with plant biology toward the design and production of new devices. This emerging field should play an important role in future agriculture for traditional crop improvement, but also in enabling novel bioproduction in plants. In this review we discuss the design cycles of synthetic biology as well as key engineering principles, genetic parts, and computational tools that can be utilized in plant synthetic biology. Some pioneering examples are offered as a demonstration of how synthetic biology can be used to modify plants for specific purposes. These include synthetic sensors, synthetic metabolic pathways, and synthetic genomes. We also speculate about the future of synthetic biology of plants. Copyright © 2015 Elsevier Ltd. All rights reserved.

  13. Annual Plant Reviews

    DEFF Research Database (Denmark)

    , three dimensional structures and functions of each protein in a biological system. In plant science, the number of proteome studies is rapidly expanding after the completion of the Arabidopsis thaliana genome sequence, and proteome analyses of other important or emerging model systems and crop plants...... are in progress or are being initiated. Proteome analysis in plants is subject to the same obstacles and limitations as in other organisms, but the nature of plant tissues, with their rigid cell walls and complex variety of secondary metabolites, means that extra challenges are involved that may not be faced when...... analysing other organisms. This volume aims to highlight the ways in which proteome analysis has been used to probe the complexities of plant biochemistry and physiology. It is aimed at researchers in plant biochemistry, genomics, transcriptomics and metabolomics who wish to gain an up-to-date insight...

  14. Dicty_cDB: CHE694 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KLLTEKHIALNVKEDGLDWLADQGYDPIYGARPLKRVIQKXRIKSNGKTNT *r*n*rsxxcynxlrinqkxn*klqvnkik Translated Amino Acid seq...ANXPDNTPSATAREEVMGVVRSRFPPEFLNRIDDMILFNRLXRKDMDKI VEIQLXDLRKLLTEKHIALNVKEDGLDWLADQGYDPIYGARPLKRVIQKXRIKSNGKTNT *r*n*rsxxc

  15. Che cos'è la conoscenza? un universo in espansione

    CERN Document Server

    Franceschini, Guiliano

    2017-01-01

    Il testo propone un viaggio nell'universo della conoscenza, tra le galassie di conoscenza (religione, scienza, arte), nel cervello (percezione, apprendimento, memoria) e nell'etica (dalla conoscenza all'educazione). Le argomentazioni si espandono attraverso un registro comunicativo intuitivo, tra divulgazione e speculazione, attraverso esempi e riferimenti concreti, rivolgendosi in alcuni casi direttamente al lettore.

  16. Dicty_cDB: CHE829 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dsl**sx*frlw*rf*m*n*t*wfpmlcpfrkttpttt*xm**xmpxrp*m* s*stckrmmrccp*tttxmxfkmsxkt*m*sxplx*rmlcxxxpr*mfixmsxrp...xm*s* stwkrmxrccp*ttxkmxixmsxkt*m*nqsxw*rmlc*kxx*lf Frame B: lfnfifnhsn*kknnn*ls*

  17. Dicty_cDB: CHE174 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available stallinum mRNA for putative vacuolar ATPase subunit 100 kDa subunit (vpha-a gene). 46 1e-10 4 CV164410 |CV164410.1 rsmsx...54 8e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Library of Salvia mil

  18. Pragmatic Idealism: Ernesto Che Guevaras Strategic Choice for Bolivia

    Science.gov (United States)

    2017-06-01

    security could be achieved through a more mature guerrilla movement. B. LITERATURE REVIEW A review of previous analysis and criticism regarding...was, he split his time prior to Bolivia between Tanzania and Czechoslovakia.24 Whether Guevara spent the majority of his time nursing the emotional ...believed it rational to pursue revolution prior to the maturation of a revolutionary movement as long as the objective

  19. Che fatica far festa all’Odin Teatret!

    DEFF Research Database (Denmark)

    Chemi, Tatiana

    2004-01-01

    A report of the many activities, planned to celebrate a unique birthday: the one of a theatre group existing for 40 years. A piece of history of contemporary theatre is going to show its past, its present and its future. With a synoptic table for the activities in Denmark.......A report of the many activities, planned to celebrate a unique birthday: the one of a theatre group existing for 40 years. A piece of history of contemporary theatre is going to show its past, its present and its future. With a synoptic table for the activities in Denmark....

  20. Dicty_cDB: CHE366 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce update 2002. 9.10 Translated Amino Acid sequence ---xxxxxxxxnfxxxxxxxxxxxlxsxrxxxxxkxvkxxxxxkxgxxxxxxxx...xxxxg* TIXKXVXXFXXYNIXXXSXXXLVLRLXGGMQXFVKTXXGKTITLEVEGXDNIENVKXKIQ DKEGIPPDQQRXIFX...MQIFVKTLTGKTITLEVEGSDNIENVX Translated Amino Acid sequence (All Frames) Frame A: ---xxxxxxgxxfxxxxxxgxxxx...fxkxkxxxxxxxcxxxxxxxxrxxxxxxxxxxfxwv nnxkxgxxxxgx*hxkxixxpxsfkixrwyanxc*nxxw*nnhfrs*...tirrwsysf*lqyskrihspfsfkikr wyanlc*nshw*nnhfrs*rf**h*kcx Frame B: ---xxxxxxxxnfxxxxxxxxxxxlxsxrxxxxx

  1. Le sfide che i figli degli immigrati devono affrontare

    Directory of Open Access Journals (Sweden)

    Sandra Sicurella

    2015-05-01

    Full Text Available Economic changes, poverty, wars, violence and socio-political conditions generated waves of migrants that irreversibly affect the daily lives in our country too. Children of migrants are requested to face many difficulties which are transformed into challenges on a daily basis in order to assert a position in the host society. The number of admissions of foreign children is constantly growing and often the culture clash may lead to exclusion. This is an extremely difficult situation, especially for children who sometimes do not have the adequate tools to deal with this.

  2. Einstein: I cento anni che sconvolsero il mondo

    CERN Multimedia

    Di Giorgio, Claudia

    2005-01-01

    In 1905, the german physicist published five articles about relativity, a theory which changed for ever our knowledge and our life. This beginning year will be "the mondial Year of Physcis" and the physics Community celebrate the Nobel Prize (⅓ page)

  3. Le parole che noi usiamo: l’errore in storia

    Directory of Open Access Journals (Sweden)

    Aurelio Musi

    2017-04-01

    Full Text Available Unlike the hard sciences, historiography lacks a specific nomenclature. The lexicon employed by historians is drawn from the plain language of everyday life. Therefore, the words of history are to be defined within the spatio-temporal framework, and to be construed through processes of contextualization and comparison. My work here stems from these considerations, and attempts to chart the occurrence of errors in historiography. In particular, I take into account the way in which historiographic mistakes arise from the intermingling of words, space, and historical time. Another significant aspect concerns the relationship between history, fiction, and arbitrariness. The latter concept is linked to historical interpretation, which constitutes the last stage of historiographical work, after the analysis and the reconstruction of events. The last part of this paper offers a typology of frequent errors in historiography.

  4. Dicty_cDB: CHE216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TNTTTAGTTCAATTGCAAACTTTATAANACCTATATTAATCTA TTTGAAATCGATTCAATTTAGAAGAGGTCATANAAAAATGACCCCAGAACANCNACNAAT CCT...ATAANACCTATATTAATCTA TTTGAAATCGATTCAATTTAGAAGAGGTCATANAAAAATGACCCCAGAACANCNACNAAT CCTTAAAACTTTAGNTGCCGAAACTA

  5. Il derubato che sorride. La tragedia umoristica di Pasolini

    Directory of Open Access Journals (Sweden)

    Stefano Casi

    2017-02-01

    Full Text Available In the studies about Pasolini’s work the analysis of the use of comedy and humor is often ignored. This article analyzes the relationship of Pasolini with the forms of comedy, from the indication of Charlot as emblematic point of reference for his own intellectual commitment to the development of an original meaning of the concept of humor. By analyzing statements and plays, a new aspect of Pasolini comes to light. In a conscious and tormented way, Pasolini adheres to humor as the main means of the bourgeoisie, entrusting to it much of its work in the last decade of his life. For Pasolini humor is the communication code of the bourgeoisie, that bourgeoisie uses to distance itself from reality. Thus, by using humor as alienating weapon inside the form-tragedy, Pasolini plans to fight bourgeoisie, challenging it on the ground of the theatrical representation of reality, through its own communication means.

  6. Integrating the ChE Curriculum via a Recurring Laboratory

    Science.gov (United States)

    Kubilius, Matthew B.; Tu, Raymond S.; Anderson, Ryan

    2014-01-01

    A recurring framework has been integrated throughout the curriculum via a Continuously Stirred Tank Reactor (CSTR) platform. This laboratory is introduced during the material and energy balance course, and subsequent courses can use these results when explaining more advanced concepts. Further, this laboratory gives students practical experience…

  7. Dicty_cDB: CHE818 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 8.1 Habrotrocha constricta 82 kDa heat shock protein 2 (hsp82-2) gene, partial cds. 88 3e-48 4 AF143854 |AF143854.1 Sinantherina soci...alis 82 kD heat shock protein (hsp82) gene, partial cds.

  8. CHE COSA RESTA DI CHERUBINI OGGI? DUE CASI DI STUDIO

    Directory of Open Access Journals (Sweden)

    Emanuele Miola

    2016-09-01

    Full Text Available A partire dagli anni Duemila, il fenomeno delle cosiddette risorgenze dialettali si è manifestato, nel panorama linguistico italiano, anche attraverso l’emergenza dei dialetti negli ambiti propri della Comunicazione Mediata dal Computer e, specialmente, sui siti internet creati ‘dal basso’, come l’enciclopedia libera e multilingue online Wikipedia. In questo articolo, si esaminerà il lascito di Cherubini e del suo Vocabolario milanese-italiano sull’edizione regionale lombarda della Wikipedia: gli articoli di quest’ultima saranno passati in rassegna, sia dal punto di vista ortografico, comparando le scelte del lessicografo milanese con quelle più in voga online, sia dal punto di vista morfo-sintattico, discutendo in questo secondo caso la presenza e la produttività di alcuni verbi sintagmatici. What remains of Cherubini today? Two case studies Since the beginning of the twenty-first century, the phenomenon of dialect resurgence has manifested in Italy through the emergence of dialects in Computer Mediated Communication, especially, on bottom-up created Web sites, like the free, multilingual, online encyclopedia Wikipedia. In this article, we will examine the legacy of Cherubini and his Milanese-Italian dictionary on the regional Lombard version of Wikipedia. We will review the articles both in terms of spelling, comparing the choices of Milanese lexicographer with those most utilized currently online, and from a morpho-syntactic point of view, discussing the presence and the productivity of some phrasal verbs.

  9. P. RICOEUR: UN’ANTROPOLOGIA CHE NON ESCLUDE IL FONDAMENTO

    Directory of Open Access Journals (Sweden)

    Attilio Danese

    2013-08-01

    Full Text Available A filosofia de Paul Ricoeur estáligada a uma exigência filosofica de não exclusão das inquietações que dizem respeito ao sentido do agir e do viver, demonstrando o laço indissolúvel entre antropologia, filosofia e busca das verdades últimas que dão sentido ao viver.

  10. Dicty_cDB: CHE850 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DILFNGI EYQCKGWISGFTKCDWKGDSIER--- ---ESLEGNMIENQYITLKTQTHST**r*csl*nlgrlccq*sr*ti*nqylcsrysft* ere*k*tfhslgkr*e*itlmaw**vn*frid...---ESLEGNMIENQYITLKTQTHST**r*csl*nlgrlccq*sr*ti*nqylcsrysft* ere*k*tfhslgkr*e*itlmaw**vn*fridclagikncsticskn

  11. LES VIBRIONS DANS LES PRODUITS DE LA PÊCHE

    African Journals Online (AJOL)

    PC_WINDOWS

    Santé Publique (ENSP) à Rennes et le Centre National de Référence des vibrions et du Choléra (CNRVC) à l'Institut Pasteur ... l'Alimentation, en France, dans le but de normaliser les protocoles d'étude et de recherche de V. cholerae et ..... Vibrio présente dans l'environnement avec les méthodes de détection habituelles.

  12. Dicty_cDB: CHE555 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available la EST MtBC10B03R1 : T7 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrhiza of cultivar J...03F1 : T3 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrhiza ...a EST MtBC39A08F1 : T3 end of clone MtBC39A08 of cDNA library MtBC from arbuscular mycorrhiza of cultivar Je

  13. ChE Undergraduate Research Projects in Biomedical Engineering.

    Science.gov (United States)

    Stroeve, Pieter

    1981-01-01

    Describes an undergraduate research program in biomedical engineering at the State University of New York at Buffalo. Includes goals and faculty comments on the program. Indicates that 58 percent of projects conducted between 1976 and 1980 have been presented at meetings or published. (SK)

  14. Una presenza che si fa ombra in Oriente

    OpenAIRE

    Giovanni Azzaroni

    2017-01-01

    In the contest of Asian culture the “shadow structure” is discussed connected to its native world and then it has to be interpreted starting to the culture of its original world. This essay investigates three different geographic situation, that is Japan (nōtheatre), China (shadow theatre) and Indonesia (shadow theatre), to connect as well as possible the vision and “shadow philosophy” to accurate and cultural perspectives, which can relate it to real cultural images.

  15. Una presenza che si fa ombra in Oriente

    Directory of Open Access Journals (Sweden)

    Giovanni Azzaroni

    2017-03-01

    Full Text Available In the contest of Asian culture the “shadow structure” is discussed connected to its native world and then it has to be interpreted starting to the culture of its original world. This essay investigates three different geographic situation, that is Japan (nōtheatre, China (shadow theatre and Indonesia (shadow theatre, to connect as well as possible the vision and “shadow philosophy” to accurate and cultural perspectives, which can relate it to real cultural images.

  16. 97 Luigi Malerba, Che vergogna scrivere, Milano: Mondadori, 1996 ...

    African Journals Online (AJOL)

    User

    This collection of four loosely-connected essays deals, inter alia, with the status of literature and the writer in society. The first, "Lo scrittore come fantasma", moves from the servile position of the author during the Renaissance, to the author becoming a producer of commodities with the advent of copyright in 1793, pointing.

  17. The bumpy face of che guevara: An interesting case

    Directory of Open Access Journals (Sweden)

    Kingshuk Chatterjee

    2017-01-01

    Full Text Available Placement of decorative tattoo on the skin may lead to various immunological, infective, and coincidental complications. Inoculation of human papillomavirus leading to development of verruca is an uncommon complication of tattoos. The present report highlights the development of verruca vulgaris, developing after 2 years of tattooing in a young male.

  18. à l'encoche sèche

    African Journals Online (AJOL)

    naturel est une matière première importante en industrie. Il intervient à 70% dans la ... caoutchouc naturel de cette région est en constante progression, due au .... L'analyse a été effectuée avec le test statistique de Duncan au risque alpha = 5 % avec les valeurs de LEM transformées en Arc Sinus. Racine carrée de LEM ...

  19. El Che y la natación

    Directory of Open Access Journals (Sweden)

    Ana Maria Peña Rojas

    2009-09-01

    Full Text Available Sobre la vida de Ernesto Guevara de la Serna se puede hablar de una trayectoria tan rica en todos los campos; que se pudiera decir del héroe de nuestra América, el guerrillero, el economista, el escritor, el fotógrafo y un gran apasionado por el deporte. Se aborda algunos aspectos relacionados con el Ché como practicante sistemático de la Natación en el sector residencial y escolar durante su vida, pues siempre le interesó la actividad deportiva a pesar de su escasa salud, por el padecimiento de asma bronquial desde su nacimiento. Tuvo junto a sus padres estancia en varios lugares, buscando condiciones para el progreso de su salud, pues además era el hijo primogénito y su madre padeció de la misma enfermedad durante su niñez, aunque heredó otras cosas muy buenas de ella. Supo sobreponerse con tesón y voluntad, tuvo gran incidencia en actividades relacionadas con la natación y otros deportes. Demostró gran destreza en el estilo Mariposa; aunque también practicaba el estilo pecho y el clavado. Su interactuar apasionado como deportista durante su juventud y adultez, lo hicieron más fuertes para enfrentar la vida, lo que posibilitó una formación integra en su persona; aquí se expresa la versatilidad e integridad y fortaleza de un hombre apasionado por la naturaleza, la formación de un hombre nuevo, con diferentes matices de ejemplaridad y paradigma de los pueblos de América Latina.

  20. LES VIBRIONS DANS LES PRODUITS DE LA PÊCHE

    African Journals Online (AJOL)

    PC_WINDOWS

    polyunsaturated fatty acids omega 3 (EPA and DHA) of frozen sardine. The results ... Keywords : conservability, sardine, freezing, chemical weathering, omega-3 fatty acids, EPA, DHA, TVB-N ...... deterioration of salmon during frozen storage.

  1. L'impronta idrica di quello che mangiamo

    NARCIS (Netherlands)

    Bacenetti, J.; Lovarelli, D.; Fiala, M.; Hoekstra, Arjen Ysbert

    2015-01-01

    È stata recentemente approvata la norma ISO (ISO 14046 Water footprint – requirements and guidelines) per la definizione dell’impronta idrica (Water Footprint) (vedi box). Questo nuovo indicatore di sostenibilità ambientale permette di quantificare il consumo di acqua dolce associato, direttamente o

  2. Dicty_cDB: CHE547 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 25 Translated Amino Acid sequence glleninni*q*tk*INKKKNNNHFFFLXFXIKN--- ---MNWAIRDGTYESFKGSPASKGILQFDMWNVTPS...r*cnsihc*snrisnskts*k*yklnytt*nsn*n skll Frame C: glleninni*q*tk*INKKKNNNHFFFLXFX

  3. Dicty_cDB: CHE515 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hvpkkxv*lilqsilmitmhvplipvhhqlvfptlqltvmi vnpctidscnnstglxxhsnqw****slvp*ih--- --...FGLXGGFXGGGTXGKXDCXTCKN*xtxfi*lxfkk ixkkfxkkfxkkkklfvflsniynf*k*kf Frame C: nkctvdscsnstgcvntpincddsnpctvdscnns

  4. Towards plant wires

    OpenAIRE

    Adamatzky, Andrew

    2014-01-01

    In experimental laboratory studies we evaluate a possibility of making electrical wires from living plants. In scoping experiments we use lettuce seedlings as a prototype model of a plant wire. We approximate an electrical potential transfer function by applying direct current voltage to the lettuce seedlings and recording output voltage. We analyse oscillation frequencies of the output potential and assess noise immunity of the plant wires. Our findings will be used in future designs of self...

  5. Design of chemical plant

    International Nuclear Information System (INIS)

    Lee, Dong Il; Kim, Seung Jae; Yang, Jae Ho; Ryu, Hwa Won

    1993-01-01

    This book describes design of chemical plant, which includes chemical engineer and plan for chemical plant, development of chemical process, cost engineering pattern, design and process development, general plant construction plan, project engineering, foundation for economy on assets and depreciation, estimation for cost on capital investment and manufacturing cost, design with computers optimal design and method like fluid mechanics design chemical device and estimation for cost, such as dispatch of material and device writing on design report and appendixes.

  6. Late Palaeozoic plants.

    Science.gov (United States)

    Feng, Zhuo

    2017-09-11

    Land plants are one of the major constituents of terrestrial ecosystems on Earth, and play an irreplaceable role in human activities today. If we are to understand the extant plants, it is imperative that we have some understanding of the fossil plants from the deep geological past, particularly those that occurred during their early evolutionary history, in the late Palaeozoic. Copyright © 2017 Elsevier Ltd. All rights reserved.

  7. Plant Habitat (PH)

    Science.gov (United States)

    Onate, Bryan

    2016-01-01

    The International Space Station (ISS) will soon have a platform for conducting fundamental research of Large Plants. Plant Habitat (PH) is designed to be a fully controllable environment for high-quality plant physiological research. PH will control light quality, level, and timing, temperature, CO2, relative humidity, and irrigation, while scrubbing ethylene. Additional capabilities include leaf temperature and root zone moisture and oxygen sensing. The light cap will have red (630 nm), blue (450 nm), green (525 nm), far red (730 nm) and broad spectrum white LEDs. There will be several internal cameras (visible and IR) to monitor and record plant growth and operations.

  8. Integrated Nuclear Recycle Plant

    International Nuclear Information System (INIS)

    Patodi, Anuj; Parashar, Abhishek; Samadhiya, Akshay K.; Ray, Saheli; Dey, Mitun; Singh, K.K.

    2017-01-01

    Nuclear Recycle Board (NRB), Tarapur proposes to set up an 'Integrated Nuclear Recycle Plant' at Tarapur. This will be located in the premises of BARC facilities. The project location is at coastal town of Tarapur, 130 Km north of Mumbai. Project area cover of INRP is around 80 hectares. The plant will be designed to process spent fuel received from Pressurized Heavy Water Reactors (PHWRs). This is the first large scale integrated plant of the country. INRP will process spent fuel obtained from indigenous nuclear power plants and perform left over nuclear waste disposal

  9. Towards plant wires.

    Science.gov (United States)

    Adamatzky, Andrew

    2014-08-01

    In experimental laboratory studies we evaluate a possibility of making electrical wires from living plants. In scoping experiments we use lettuce seedlings as a prototype model of a plant wire. We approximate an electrical potential transfer function by applying direct current voltage to the lettuce seedlings and recording output voltage. We analyse oscillation frequencies of the output potential and assess noise immunity of the plant wires. Our findings will be used in future designs of self-growing wetware circuits and devices, and integration of plant-based electronic components into future and emergent bio-hybrid systems. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  10. MBS Native Plant Communities

    Data.gov (United States)

    Minnesota Department of Natural Resources — This data layer contains results of the Minnesota County Biological Survey (MCBS). It includes polygons representing the highest quality native plant communities...

  11. The Kuroshio power plant

    CERN Document Server

    Chen, Falin

    2013-01-01

    By outlining a new design or the Kuroshio power plant, new approaches to turbine design, anchorage system planning, deep sea marine engineering and power plant operations and maintenance are explored and suggested. The impact on the local environment, particularly in the face of natural disasters, is also considered to provide a well rounded introduction to plan and build a 30MW pilot power plant. Following a literature review, the six chapters of this book propose a conceptual design by focusing on the plant's core technologies and establish the separate analysis logics for turbine design and

  12. Plant Transporter Identification

    DEFF Research Database (Denmark)

    Larsen, Bo

    Membrane transport proteins (transporters) play a critical role for numerous biological processes, by controlling the movements of ions and molecules in and out of cells. In plants, transporters thus function as gatekeepers between the plant and its surrounding environment and between organs......, tissues, cells and intracellular compartments. Since plants are highly compartmentalized organisms with complex transportation infrastructures, they consequently have many transporters. However, the vast majority of predicted transporters have not yet been experimentally verified to have transport...... activity. This project contains a review of the implemented methods, which have led to plant transporter identification, and present our progress on creating a high-throughput functional genomics transporter identification platform....

  13. Less power plants

    International Nuclear Information System (INIS)

    TASR

    2003-01-01

    In the Slovak Republic the number of company power plants decreased as against 2001 by two sources. In present time only 35 companies have their own power plants. The companies Slovnaft, Kappa Sturovo, Slovensky hodvab Senica, Matador Puchov, Maytex Liptovsky MikuIas, Kovohuty Krompachy, Chemko Strazske and some Slovak sugar factories belong to the largest company power plants in force of distributing companies. Installed output of present 35 company sources is 531 MW. The largest of separate power plants as Paroplynovy cyklus Bratislava (218 MW) and VD Zilina (72 MW) belong to independent sources. Total installed output of Slovak sources was 8306 MW in the end of last year

  14. Offshore atomic power plants

    International Nuclear Information System (INIS)

    Anon.

    1975-01-01

    Various merits of offshore atomic power plants are illustrated, and their systems are assessed. The planning of the offshore atomic power plants in USA is reviewed, and the construction costs of the offshore plant in Japan were estimated. Air pollution problem may be solved by the offshore atomic power plants remarkably. Deep water at low temperature may be advantageously used as cooling water for condensers. Marine resources may be bred by building artificial habitats and by providing spring-up equipments. In the case of floating plants, the plant design can be standardized so that the construction costs may be reduced. The offshore plants can be classified into three systems, namely artificial island system, floating system and sea bottom-based system. The island system may be realized with the present level of civil engineering, but requires the development of technology for the resistance of base against earthquake and its calculation means. The floating system may be constructed with conventional power plant engineering and shipbuilding engineering, but the aseismatic stability of breakwater may be a problem to be solved. Deep water floating system and deep water submerging system are conceivable, but its realization may be difficult. The sea bottom-based system with large caissons can be realized by the present civil engineering, but the construction of the caissons, stability against earthquake and resistance to waves may be problems to be solved. The technical prediction and assessment of new plant sites for nuclear power plants have been reported by Science and Technology Agency in 1974. The construction costs of an offshore plant has been estimated by the Ministry of International Trade and Industry to be yen71,026/kW as of 1985. (Iwakiri, K.)

  15. Selenium accumulation by plants

    Science.gov (United States)

    White, Philip J.

    2016-01-01

    Background Selenium (Se) is an essential mineral element for animals and humans, which they acquire largely from plants. The Se concentration in edible plants is determined by the Se phytoavailability in soils. Selenium is not an essential element for plants, but excessive Se can be toxic. Thus, soil Se phytoavailability determines the ecology of plants. Most plants cannot grow on seleniferous soils. Most plants that grow on seleniferous soils accumulate 100 mg Se kg–1 dry matter. These plants are considered to be Se accumulators. Some species can even accumulate Se concentrations of 1000–15 000 mg Se kg–1 dry matter and are called Se hyperaccumulators. Scope This article provides an overview of Se uptake, translocation and metabolism in plants and highlights the possible genetic basis of differences in these between and within plant species. The review focuses initially on adaptations allowing plants to tolerate large Se concentrations in their tissues and the evolutionary origin of species that hyperaccumulate Se. It then describes the variation in tissue Se concentrations between and within angiosperm species and identifies genes encoding enzymes limiting the rates of incorporation of Se into organic compounds and chromosomal loci that might enable the development of crops with greater Se concentrations in their edible portions. Finally, it discusses transgenic approaches enabling plants to tolerate greater Se concentrations in the rhizosphere and in their tissues. Conclusions The trait of Se hyperaccumulation has evolved several times in separate angiosperm clades. The ability to tolerate large tissue Se concentrations is primarily related to the ability to divert Se away from the accumulation of selenocysteine and selenomethionine, which might be incorporated into non-functional proteins, through the synthesis of less toxic Se metabilites. There is potential to breed or select crops with greater Se concentrations in their edible tissues, which

  16. Le rêve entendu par les chrétiens de la Communauté Évangélique du Congo

    OpenAIRE

    MANSIANTIMA MIANKENDA , Alain-Fidèle

    2015-01-01

    International audience; Pour Sigmund FREUD, le rêve est une source de connaissance de soi. C'est la « voie royale » de la connaissance de l'inconscient. Selon lui, le sommeil est un état où le dormeur ne veut rien savoir du monde extérieur. Le rêve est donc le gardien du sommeil, c'est lui qui nous permet de rester endormis puisqu'en réalisant les désirs, il supprime le psychisme de ses excitations. Les fidèles de la Communauté Evangélique du Congo, en particulier ceux de la Paroisse de N'dji...

  17. Better Plants Program Overview

    Energy Technology Data Exchange (ETDEWEB)

    None

    2015-09-30

    The U.S. Department of Energy’s (DOE’s) Better Buildings, Better Plants Program is a voluntary partnership initiative to drive significant energy efficiency improvement across energy intensive companies and organizations. 157 leading manufacturers and public water and wastewater treatment utilities are partnering with DOE through Better Plants to improve energy efficiency, slash carbon emissions, and cut energy costs.

  18. Plant Glandular Trichomes

    Indian Academy of Sciences (India)

    landing on the plant. Glandular trichomes in catmint (Nepeta sp.) produce nepetalactone, closely related to the aphid sex pheromone, nepetalactol. Nepetalactone can be reduced to the corresponding nepetalactol. ... Plant glandular trichomes function either as repositories or releasing sites of various chemicals. Interest in ...

  19. Plants as green phones

    NARCIS (Netherlands)

    Soler, R.; Harvey, J.A.; Bezemer, T.M.; Stuefer, J.F.

    2008-01-01

    Plants can act as vertical communication channels or `green phones¿ linking soil-dwelling insects and insects in the aboveground ecosystem. When root-feeding insects attack a plant, the direct defense system of the shoot is activated, leading to an accumulation of phytotoxins in the leaves. The

  20. Solar thermal power plants

    International Nuclear Information System (INIS)

    Schnatbaum, L.

    2009-01-01

    The solar thermal power plant technology, the opportunities it presents and the developments in the market are outlined. The focus is on the technology of parabolic trough power plants, a proven technology for solar power generation on a large scale. In a parabolic trough power plant, trough-shaped mirrors concentrate the solar irradiation onto a pipe in the focal line of the collector. The thermal energy thus generated is used for electricity generation in a steam turbine. Parabolic trough plants can be combined with thermal storage and fossil or biomass fired heat exchangers to generate electricity even when the sun is not shining. Solar Millennium AG in Erlangen has developed the first power plant of this kind in Europe. After two years of construction the plant started operation in Southern Spain in 2008. This one and its sister projects are important steps leading the way for the whole market. The paper also covers the technological challenges, the key components used and the research and development activities concerning this technology. Solar thermal power plants are ideal for covering peak and medium loads in power grids. In hybrid operation they can also cover base-load. The Solar Chimney power plant, another striking technology for the conversion of solar into electric energy, is described briefly. The paper concludes with a look at the future - the import of solar energy from the deserts of North Africa to central Europe. (author)

  1. Redox signaling in plants.

    Science.gov (United States)

    Foyer, Christine H; Noctor, Graham

    2013-06-01

    Our aim is to deliver an authoritative and challenging perspective of current concepts in plant redox signaling, focusing particularly on the complex interface between the redox and hormone-signaling pathways that allow precise control of plant growth and defense in response to metabolic triggers and environmental constraints and cues. Plants produce significant amounts of singlet oxygen and other reactive oxygen species (ROS) as a result of photosynthetic electron transport and metabolism. Such pathways contribute to the compartment-specific redox-regulated signaling systems in plant cells that convey information to the nucleus to regulate gene expression. Like the chloroplasts and mitochondria, the apoplast-cell wall compartment makes a significant contribution to the redox signaling network, but unlike these organelles, the apoplast has a low antioxidant-buffering capacity. The respective roles of ROS, low-molecular antioxidants, redox-active proteins, and antioxidant enzymes are considered in relation to the functions of plant hormones such as salicylic acid, jasmonic acid, and auxin, in the composite control of plant growth and defense. Regulation of redox gradients between key compartments in plant cells such as those across the plasma membrane facilitates flexible and multiple faceted opportunities for redox signaling that spans the intracellular and extracellular environments. In conclusion, plants are recognized as masters of the art of redox regulation that use oxidants and antioxidants as flexible integrators of signals from metabolism and the environment.

  2. Cognition in plants

    NARCIS (Netherlands)

    Calvo, P.; Keijzer, F.A.

    2009-01-01

    To what extent can plants be considered cognitive from the perspective of embodied cognition? Cognition is interpreted very broadly within embodied cognition, and the current evidence for plant intelligence might find an important theoretical background here. However, embodied cognition does stress

  3. Invertebrates and Plants

    Science.gov (United States)

    Wendell R. Haag; Robert J. Distefano; Siobhan Fennessy; Brett D. Marshall

    2013-01-01

    Invertebrates and plants are among the most ubiquitous and abundant macroscopic organisms in aquatic ecosystems; they dominate most habitats in both diversity and biomass and play central roles in aquatic food webs. Plants regulate and create habitats for a wide array of organisms (Cooke et al. 2005). Snail grazing and bivalve filtering profoundly alter habitats and...

  4. Modulating lignin in plants

    Science.gov (United States)

    Apuya, Nestor; Bobzin, Steven Craig; Okamuro, Jack; Zhang, Ke

    2013-01-29

    Materials and methods for modulating (e.g., increasing or decreasing) lignin content in plants are disclosed. For example, nucleic acids encoding lignin-modulating polypeptides are disclosed as well as methods for using such nucleic acids to generate transgenic plants having a modulated lignin content.

  5. Recognizing Plant Defense Priming

    NARCIS (Netherlands)

    Martinez-Medina, Ainhoa; Flors, Victor; Heil, Martin; Mauch-Mani, Brigitte; Pieterse, Corné M J|info:eu-repo/dai/nl/113115113; Pozo, Maria J; Ton, Jurriaan; van Dam, Nicole M; Conrath, Uwe

    2016-01-01

    Defense priming conditions diverse plant species for the superinduction of defense, often resulting in enhanced pest and disease resistance and abiotic stress tolerance. Here, we propose a guideline that might assist the plant research community in a consistent assessment of defense priming in

  6. Exotic invasive plants

    Science.gov (United States)

    Carolyn Hull Sieg; Barbara G. Phillips; Laura P. Moser

    2003-01-01

    Ecosystems worldwide are threatened by nonnative plant invasions that can cause undesirable, irreversible changes. They can displace native plants and animals, out-cross with native flora, alter nutrient cycling and other ecosystem functions, and even change an ecosystem's flammability (Walker and Smith 1997). After habitat loss, the spread of exotic species is...

  7. Plant-Fungus Marriages

    Indian Academy of Sciences (India)

    Every plant requires mineral elements for growth. A mnemonic ... lar coils. More commonly, the hypha forms highly branched, .... stamps on the edible and poisonous mushrooms (Figure 2). One of the ... but these days dogs are used for truffle. 'hunting' . .... example is a non-chlorophyllous plant known as Indian pipe or.

  8. Dormancy in Plant Seeds

    NARCIS (Netherlands)

    Hilhorst, H.W.M.; Finch-Savage, W.E.; Buitink, J.; Bolingue, W.; Leubner-Metzger, G.

    2010-01-01

    Seed dormancy has been studied intensely over the past decades and, at present, knowledge of this plant trait is at the forefront of plant biology. The main model species is Arabidopsis thaliana, an annual weed, possessing nondeep physiological dormancy. This overview presents the state-of-the-art

  9. Slavery in plants

    NARCIS (Netherlands)

    Kabiri, S.; Rodenburg, J.; Ast, van A.; Bastiaans, L.

    2017-01-01

    The rain-fed lowland rice weed Rhamphicarpa fistulosa (Rice Vampireweed) is a facultative root parasitic plant. Growth and reproduction of R. fistulosa benefit considerably from parasitism, but how this affects the host plant is not well established. We determined accumulation and partitioning of

  10. Power plant chemical technology

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-01

    17 contributions covering topies of fossil fuel combustion, flue gas cleaning, power plant materials, corrosion, water/steam cycle chemistry, monitoring and control were presented at the annual meeting devoted to Power Plant Chemical Technology 1996 at Kolding (Denmark) 4-6 September 1996. (EG)

  11. Plant diagnosis device

    International Nuclear Information System (INIS)

    Tozuka, Shin-ichi.

    1996-01-01

    Standard data approximately defined are inputted as 1:1 functional data between at least two or more plant data and each of plant data are inputted. Diagnosis data corresponding to each of process data are formed based on the functional data. Limit value data to be a threshold value which determines whether the diagnosis data are in a predetermined state or not are formed. The diagnosis data and the limit value data are displayed in a recognizable state. If diagnosis data of a plurality of plants are displayed simultaneously, all of the plant data are substantially the same value with one standard datum if the plant is in a normal state. When abnormality should occur in the plant, the difference between the diagnosis data and the standard data is remarkable, and the difference between the diagnosis data of other normal plant data and the standard data are also made remarkably, accordingly, the display of a plurality of diagnosis data is scattered thereby capable of diagnosing the abnormality of the plant. (N.H.)

  12. Methylome evolution in plants

    NARCIS (Netherlands)

    Vidalis, Amaryllis; Živković, Daniel; Wardenaar, René; Roquis, David; Tellier, Aurélien; Johannes, Frank

    2016-01-01

    Despite major progress in dissecting the molecular pathways that control DNA methylation patterns in plants, little is known about the mechanisms that shape plant methylomes over evolutionary time. Drawing on recent intra- and interspecific epigenomic studies, we show that methylome evolution over

  13. Antimicrobial Peptides from Plants

    Directory of Open Access Journals (Sweden)

    James P. Tam

    2015-11-01

    Full Text Available Plant antimicrobial peptides (AMPs have evolved differently from AMPs from other life forms. They are generally rich in cysteine residues which form multiple disulfides. In turn, the disulfides cross-braced plant AMPs as cystine-rich peptides to confer them with extraordinary high chemical, thermal and proteolytic stability. The cystine-rich or commonly known as cysteine-rich peptides (CRPs of plant AMPs are classified into families based on their sequence similarity, cysteine motifs that determine their distinctive disulfide bond patterns and tertiary structure fold. Cystine-rich plant AMP families include thionins, defensins, hevein-like peptides, knottin-type peptides (linear and cyclic, lipid transfer proteins, α-hairpinin and snakins family. In addition, there are AMPs which are rich in other amino acids. The ability of plant AMPs to organize into specific families with conserved structural folds that enable sequence variation of non-Cys residues encased in the same scaffold within a particular family to play multiple functions. Furthermore, the ability of plant AMPs to tolerate hypervariable sequences using a conserved scaffold provides diversity to recognize different targets by varying the sequence of the non-cysteine residues. These properties bode well for developing plant AMPs as potential therapeutics and for protection of crops through transgenic methods. This review provides an overview of the major families of plant AMPs, including their structures, functions, and putative mechanisms.

  14. Nuclear Power Plants. Revised.

    Science.gov (United States)

    Lyerly, Ray L.; Mitchell, Walter, III

    This publication is one of a series of information booklets for the general public published by the United States Atomic Energy Commission. Among the topics discussed are: Why Use Nuclear Power?; From Atoms to Electricity; Reactor Types; Typical Plant Design Features; The Cost of Nuclear Power; Plants in the United States; Developments in Foreign…

  15. NUCLEAR POWER PLANT

    Science.gov (United States)

    Carter, J.C.; Armstrong, R.H.; Janicke, M.J.

    1963-05-14

    A nuclear power plant for use in an airless environment or other environment in which cooling is difficult is described. The power plant includes a boiling mercury reactor, a mercury--vapor turbine in direct cycle therewith, and a radiator for condensing mercury vapor. (AEC)

  16. Caladium plant poisoning

    Science.gov (United States)

    ... enough to prevent normal speaking and swallowing. Home Care If the plant was eaten, wipe out the mouth with a ... to Expect at the Emergency Room Take the plant with you to the hospital, if possible. The health care provider will measure and monitor the person's vital ...

  17. Gold in plants

    International Nuclear Information System (INIS)

    Girling, C.A.; Peterson, P.J.

    1980-01-01

    Many plants have the ability to take up gold from the soil and to accumulate it in their tisssue. Advances have been made in understanding these processes to the point where their exploitation in the field of prospecting for gold appears practically feasible. Neutron activation analysis is used for the determination of the small quantities of gold in plants

  18. Recognizing plant defense priming

    NARCIS (Netherlands)

    Martinez-Medina, A.; Flors, V.; Heil, M.; Mauch-Mani, B.; Pieterse, C.M.J.; Pozo, M.J.; Ton, J.; Van Dam, N.M.; Conrath, U.

    2016-01-01

    Defense priming conditions diverse plant species for the superinduction of defense, often resulting in enhanced pest and disease resistance and abiotic stress tolerance. Here, we propose a guideline that might assist the plant research community in a consistent assessment of defense priming in

  19. Carotenoid metabolism in plants

    Science.gov (United States)

    Carotenoids are mostly C40 terpenoids, a class of hydrocarbons that participate in various biological processes in plants, such as photosynthesis, photomorphogenesis, photoprotection, and development. Carotenoids also serve as precursors for two plant hormones and a diverse set of apocarotenoids. Th...

  20. [Neotropical plant morphology].

    Science.gov (United States)

    Pérez-García, Blanca; Mendoza, Aniceto

    2002-01-01

    An analysis on plant morphology and the sources that are important to the morphologic interpretations is done. An additional analysis is presented on all published papers in this subject by the Revista de Biología Tropical since its foundation, as well as its contribution to the plant morphology development in the neotropics.

  1. Automatic micropropagation of plants

    Science.gov (United States)

    Otte, Clemens; Schwanke, Joerg; Jensch, Peter F.

    1996-12-01

    Micropropagation is a sophisticated technique for the rapid multiplication of plants. It has a great commercial potential due to the speed of propagation, the high plant quality, and the ability to produce disease-free plants. However, micropropagation is usually done by hand which makes the process cost-intensive and tedious for the workers especially because it requires a sterile work-place. Therefore, we have developed a prototype automation system for the micropropagation of a grass species (miscanthus sinensis gigantheus). The objective of this paper is to describe the robotic system in an overview and to discuss the vision system more closely including the implemented morphological operations recognizing the cutting and gripping points of miscanthus plants. Fuzzy controllers are used to adapt the parameters of image operations on-line to each individual plant. Finally, we discuss our experiences with the developed prototype an give a preview of a possible real production line system.

  2. Plants and fluorine

    Energy Technology Data Exchange (ETDEWEB)

    Garber, K

    1962-01-01

    A report is given about the contents of fluorine in soil and different plants. It is stated that spinach and several spice herbages are rich in fluorine (0.98 - 21.8 ppm) while in other plants are not more than 5 ppm maximum. An exception is found in Thea sinensis with 178 ppm and more. Tea is, therefore, a source of fluorine for contamination of the human body. An increase of the fluorine contents of plants by manuring with F-salts or mineral manure is possible but of long duration. Damage to plants by uptake of fluorine from soil as well as in a gaseous condition from the atmosphere are described. The rate of damage is related to the type of soil in which the plant is grown.

  3. Poultry Plant Noise Control

    Science.gov (United States)

    1982-01-01

    A demonstration conducted last winter at the Tip Top Poultry Plant intended to show poultry plant managers from all over the U.S. potential solutions to the problem of plant noise. Plastic covers used over sound absorbing materials need to meet cleanability requirements, high- pressure water cleaning and other harsh maintenance procedures peculiar to the poultry processing industry. For the demonstration, Fiber Flex, Inc. manufactured and donated 750 noise panels; Owens-Corning Fiberglas Corporation donated the fiberglas cores; and the cover material was purchased from Howe and Bainbridge. The Engineering Experiment Station (EES) conducted before and after noise surveys and is evaluating the effect of noise reduction on turnover and productivity in the demonstration plant. EES plans to conduct a noise abatement workshop and update a handbook to help poultry processors with noise problems. EES study and demonstration may be applicable to other food processing plants where similar sanitary constraints exist.

  4. Protein carbonylation in plants

    DEFF Research Database (Denmark)

    Møller, Ian Max; Havelund, Jesper; Rogowska-Wrzesinska, Adelina

    2017-01-01

    This chapter provides an overview of the current knowledge on protein carbonylation in plants and its role in plant physiology. It starts with a brief outline of the turnover and production sites of reactive oxygen species (ROS) in plants and the causes of protein carbonylation. This is followed...... by a description of the methods used to study protein carbonylation in plants, which is also very brief as the methods are similar to those used in studies on animals. The chapter also focuses on protein carbonylation in plants in general and in mitochondria and in seeds in particular, as case stories where...... specific carbonylated proteins have been identified. Protein carbonylation appears to accumulate at all stages of seed development and germination investigated to date. In some cases, such as seed aging, it is probably simply an accumulation of oxidative damage. However, in other cases protein...

  5. Plant control device

    International Nuclear Information System (INIS)

    Sato, Masuo; Ono, Makoto.

    1995-01-01

    A plant control device comprises an intellectual instrumentation group for measuring a predetermined process amount, an intellectual equipment group operating in accordance with a self-countermeasure, a system information space for outputting system information, a system level monitoring and diagnosing information generalization section for outputting system information, a system level maintenance information generalization section for outputting information concerning maintenance, a plant level information space and a plant level information generalization section. Each of them determines a state of the plant autonomously, and when abnormality is detected, each of the intellectual instrumentation, equipments and systems exchange information with each other, to conduct required operations including operations of intellectual robots, as required. Appropriate countermeasures for gauges, equipments and systems can be conducted autonomously at a place where operators can not access to improve reliability of complicate operations in the working site, as well as improve plant safety and reliability. (N.H.)

  6. Plant abnormality inspection device

    International Nuclear Information System (INIS)

    Takenaka, Toshio.

    1990-01-01

    The present invention concerns a plant abnormality inspection device for conducting remote or automatic patrolling inspection in a plant and, more particularly, relates to such a device as capable of detecting abnormal odors. That is, the device comprises a moving device for moving to a predetermined position in the plant, a plurality of gas sensors for different kind of gases to be inspected mounted thereon, a comparator for comparing the concentration of a gas detected by the gas sensor with the normal gas concentration at the predetermined position and a judging means for judging the absence or presence of abnormality depending on the combination of the result of the comparison and deliverying a signal if the state is abnormal. As a result, a slight amount of gas responsible to odors released upon abnormality of the plant can be detected by a plurality of gas sensors for different kinds gases to rapidly and easily find abnormal portions in the plant. (I.S.)

  7. Nuclear power plant siting

    International Nuclear Information System (INIS)

    Sulkiewicz, M.; Navratil, J.

    The construction of a nuclear power plant is conditioned on territorial requirements and is accompanied by the disturbance of the environment, land occupation, population migration, the emission of radioactive wastes, thermal pollution, etc. On the other hand, a nuclear power plant makes possible the introduction of district heating and increases the economic and civilization activity of the population. Due to the construction of a nuclear power plant the set limits of negative impacts must not be exceeded. The locality should be selected such as to reduce the unfavourable effects of the plant and to fully use its benefits. The decision on the siting of the nuclear power plant is preceded by the processing of a number of surveys and a wide range of documentation to which the given criteria are strictly applied. (B.H.)

  8. Manganese deficiency in plants

    DEFF Research Database (Denmark)

    Schmidt, Sidsel Birkelund; Jensen, Poul Erik; Husted, Søren

    2016-01-01

    Manganese (Mn) is an essential plant micronutrient with an indispensable function as a catalyst in the oxygen-evolving complex (OEC) of photosystem II (PSII). Even so, Mn deficiency frequently occurs without visual leaf symptoms, thereby masking the distribution and dimension of the problem...... restricting crop productivity in many places of the world. Hence, timely alleviation of latent Mn deficiency is a challenge in promoting plant growth and quality. We describe here the key mechanisms of Mn deficiency in plants by focusing on the impact of Mn on PSII stability and functionality. We also address...... the mechanisms underlying the differential tolerance towards Mn deficiency observed among plant genotypes, which enable Mn-efficient plants to grow on marginal land with poor Mn availability....

  9. Communal biomass conversion plants

    International Nuclear Information System (INIS)

    Holm-Nielsen, J.B.; Huntingford, S.; Halberg, N.

    1993-03-01

    The aim was to show the agricultural advantages of farmers being in connection with Communal Biogas Plant. Whether a more environmentally protectire distribution of plant nutrients from animal manure takes place through a biogas plants distribution system, whether the nitrogen in the digested slurry is better utilized and whether the connection results in slurry transportation-time reduction, are discussed. The average amount of nitrogen from animal manure used per hectare was reduced. The area of manure distribution was larger. The nitrogen efficiency was increased when using digested slurry and purchase of N mineral fertilizer decreased, resulting in considerable reduction in nitrogen leaching. The amount of slurry delivered to the local storage tanks was approximately 45 per cent of the total amount treated on the biogas plant. Conditions of manure transport improved greatly as this was now the responsibility of the communal biomass conversion plant administrators. (AB) (24 refs.)

  10. Encapsulation plant at Forsmark

    International Nuclear Information System (INIS)

    Nystroem, Anders

    2007-08-01

    SKB has already carried out a preliminary study of an encapsulation plant detached from Clab (Central interim storage for spent fuels). This stand-alone encapsulation plant was named FRINK and its assumed siting was the above-ground portion of the final repository, irrespective of the repository's location. The report previously presented was produced in cooperation with BNFL Engineering Ltd in Manchester and the fuel reception technical solution was examined by Gesellschaft fuer Nuklear-Service mbH (GNS) in Hannover and by Societe Generale pour les Techniques Nouvelles (SGN) in Paris. This report is an update of the earlier preliminary study report and is based on the assumption that the encapsulation plant and also the final repository will be sited in the Forsmark area. SKB's main alternative for siting the encapsulation plant is next to Clab. Planning of this facility is ongoing and technical solutions from the planning work have been incorporated in this report. An encapsulation plant placed in proximity to any final repository in Forsmark forms part of the alternative presentation in the application for permission to construct and operate an installation at Clab. The main technical difference between the planned encapsulation plant at Clab and an encapsulation plant at a final repository at Forsmark is how the fuel is managed and prepared before actual encapsulation. Fuel reception at the encapsulation plant in Forsmark would be dry, i.e. there would be no water-filled pools at the facility. Clab is used for verificatory fuel measurements, sorting and drying of the fuel before transport to Forsmark. This means that Clab will require a measure of rebuilding and supplementary equipment. In purely technical terms, the prospects for building an encapsulation plant sited at Forsmark are good. A description of the advantages and drawbacks of siting the encapsulation plant at Clab as opposed to any final repository at Forsmark is presented in a separate report

  11. Encapsulation plant at Forsmark

    Energy Technology Data Exchange (ETDEWEB)

    Nystroem, Anders

    2007-08-15

    SKB has already carried out a preliminary study of an encapsulation plant detached from Clab (Central interim storage for spent fuels). This stand-alone encapsulation plant was named FRINK and its assumed siting was the above-ground portion of the final repository, irrespective of the repository's location. The report previously presented was produced in cooperation with BNFL Engineering Ltd in Manchester and the fuel reception technical solution was examined by Gesellschaft fuer Nuklear-Service mbH (GNS) in Hannover and by Societe Generale pour les Techniques Nouvelles (SGN) in Paris. This report is an update of the earlier preliminary study report and is based on the assumption that the encapsulation plant and also the final repository will be sited in the Forsmark area. SKB's main alternative for siting the encapsulation plant is next to Clab. Planning of this facility is ongoing and technical solutions from the planning work have been incorporated in this report. An encapsulation plant placed in proximity to any final repository in Forsmark forms part of the alternative presentation in the application for permission to construct and operate an installation at Clab. The main technical difference between the planned encapsulation plant at Clab and an encapsulation plant at a final repository at Forsmark is how the fuel is managed and prepared before actual encapsulation. Fuel reception at the encapsulation plant in Forsmark would be dry, i.e. there would be no water-filled pools at the facility. Clab is used for verificatory fuel measurements, sorting and drying of the fuel before transport to Forsmark. This means that Clab will require a measure of rebuilding and supplementary equipment. In purely technical terms, the prospects for building an encapsulation plant sited at Forsmark are good. A description of the advantages and drawbacks of siting the encapsulation plant at Clab as opposed to any final repository at Forsmark is presented in a separate

  12. Biofuelled heating plants

    International Nuclear Information System (INIS)

    Gulliksson, Hans; Wennerstaal, L.; Zethraeus, B.; Johansson, Bert-Aake

    2001-11-01

    The purpose of this report is to serve as a basis to enable establishment and operation of small and medium-sized bio-fuel plants, district heating plants and local district heating plants. Furthermore, the purpose of this report is to serve as a guideline and basis when realizing projects, from the first concept to established plant. Taking into account all the phases, from selection of heating system, fuel type, selection of technical solutions, authorization request or application to operate a plant, planning, construction and buying, inspection, performance test, take-over and control system of the plant. Another purpose of the report is to make sure that best available technology is used and to contribute to continuous development of the technology. The report deals mainly with bio-fuelled plants in the effect range 0.3 to10 MW. The term 'plant' refers to combined power and heating plants as well as 'simpler' district heating plants. The last-mentioned is also often referred to as 'local heating plant'. In this context, the term bio fuel refers to a wide range of fuel types. The term bio fuel includes processed fractions like powders, pellets, and briquettes along with unprocessed fractions, such as by-products from the forest industry; chips and bark. Bio fuels also include straw, energy crops and cereal waste products, but these have not been expressly studied in this report. The report is structured with appendixes regarding the various phases of the projects, with the purpose of serving as a helping handbook, or manual for new establishment, helping out with technical and administrative advice and environmental requirements. Plants of this size are already expanding considerably, and the need for guiding principles for design/technology and environmental requirements is great. These guiding principles should comply with the environmental legislation requirements, and must contain advice and recommendations for bio fuel plants in this effect range, also in

  13. Populations in clonal plants

    Directory of Open Access Journals (Sweden)

    Jussi Tammisola

    1986-12-01

    Full Text Available Population phenomena in higher plants are reviewed critically, particularly in relation to clonality. An array of concepts used in the field are discussed. In contrast to animals, higher plants are modular in structure. Plant populations show hierarchy at two levels: ramets and genets. In addition, their demography is far more complicated, since even the direction of development of a ramet may change by rejuvenation. Therefore, formulae concerning animal populations often require modification for plants. Furthermore, at the zygotic stage, higher plants are generally less mobile than animals. Accordingly, their population processes tend to be more local. Most populations of plants have a genetic structure: alleles and genotypes are spatially aggregated. Due to the short-ranged foraging behaviour of pollinators, genetically non-random pollination prevails. A generalized formula for parent-offspring dispersal variance is derived. It is used to analyze the effect of clonality on genetic patchiness in populations. In self-compatible species, an increase in clonality will tend to increase the degree of patchiness, while in self-incompatible species a decrease may result. Examples of population structure studies in different species are presented. A considerable degree of genetic variation appears to be found also in the populations of species with a strong allocation of resources to clonal growth or apomictic seed production. Some consequences of clonality are considered from the point of view of genetic conservation and plant breeding.

  14. Experimental mutagenesis in plants

    International Nuclear Information System (INIS)

    Conger, B.V.

    1979-01-01

    Considerable progress has been made in directed or controlled mutagenesis with bacterial systems, the genetic resolving power of which is much greater than that of higher plants. The mutagen specificity in higher plants has been of great interest, and numerous results and observations have been reported. The advances in the culture of plant cells and tissues have created much interest concerning the possibility of inducing and recovering mutants at the cellular level. There are great problems including the failure to regenerate plants from cells in all but a few species. The genetic and cytogenetic instability in the culture of plant tissues is well known, and the most common nuclear change is polyploidy including aneuploidy. The degree of polyploidy increases with calluses or culture age. In rice, the frequency of aneuploidy is greater in the calluses derived from roots than those derived from stem internodes. Polyploid and/or self-incompatible plant species are not as amenable to conventional mutation breeding techniques as diploid, self-fertilizing species. Inducing mutations in somatic tissues creates the problem of chimeras. However, the new cultivars of highly heterozygous, outcrossing, self-incompatible species are produced by combining several different clones. The performance of the progeny of at least 4 generations removed from the polycross of the parent clones is the important factor, and a high amount of heterozygocity is tolerated within cultivars and even on the same plants. (Yamashita, S.)

  15. Plant state display device

    International Nuclear Information System (INIS)

    Kadota, Kazuo; Ito, Toshiichiro.

    1994-01-01

    The device of the present invention conducts information processing suitable for a man to solve a problem in a plant such as a nuclear power plant incorporating a great amount of information, where safety is required and provides information to an operator. Namely, theories and rules with respect to the flow and balanced state of materials and energy upon plant start-up, and a vapor cycle of operation fluids are symbolized and displayed on the display screen of the device. Then, the display of the plant information suitable to the information processing for a man to dissolve problems is provided. Accordingly, a mechanism for analyzing a purpose of the plant is made more definite, thereby enabling to prevent an erroneous judgement of an operator and occurrence of plant troubles. In addition, a simular effect can also be expected when the theories and rules with respect to the flow and the balanced state of materials and energy and thermohydrodynamic behavior of the operation fluids in a state of after-heat removing operation during shutdown of the plant are symbolized and displayed. (I.S.)

  16. Physiology of woody plants

    CERN Document Server

    Hazewinkel, Michiel; Pallardy, Stephen G

    1996-01-01

    This completely revised classic volume is an up-to-date synthesis of the intensive research devoted to woody plants. Intended primarily as a text for students and a reference for researchers, this interdisciplinary book should be useful to a broad range of scientists from agroforesters, agronomists, and arborists to plant pathologists, ecophysiologists, and soil scientists. Anyone interested in plant physiology will find this text invaluable. Key Features * Includes supplementary chapter summaries and lists of general references * Provides a solid foundation of reference information * Thoroughly updated classic text/reference.

  17. Interelement correlations in plants

    International Nuclear Information System (INIS)

    Markert, B.

    1987-01-01

    The concentration of 25 elements in 4 plant species (Citrus aurantia, Brassica oleracea, Lycopersicon esculentum and Pinus strobus) were linearly correlated. For some element pairs (Ce-Fe, Ce-Ni, Ce-Sb, Ce-Sc, Ce-Zn, Fe-Sb, Fe-Sc, Fe-U, Fe-Zn, K-Cd, La-U, Ni-Sb, Sc-U and Sc-Zn) a high positive correlation coefficient (r = +1) was found. The element pairs Ca-Mg, Hg-U, Ni-Sr and Sr-Zn show a significant negative correlation (r = -1). Plants seem to process some constant interelement relations, independent of plant species. (orig.)

  18. Radiation hormesis in plant

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jae Sung; Song, Hi Sup; Lee, Young Keun; Lee, Byung Hun; Shin, In Chul; Lim, Young Taek

    2000-04-01

    This research was performed to investigate the effects of low dose {gamma}-ray radiation on the seed germination and the following physiological responses in vegetable crops. Special attention was focused on whether the resistance of vegetables against the unfavorable conditions of environment such as subsequent high doses of radiation or Phytophthora blight of pepper could be enhanced as an aspect of radiation hormesis. Analysis and characterization of antioxidant enzyme from plant culture cells and radiation tolerant of transformed plants from antioxidant (POD) were accomplished in the plant irradiated with different dose of {gamma}-ray. (author)

  19. Selenium accumulation by plants.

    Science.gov (United States)

    White, Philip J

    2016-02-01

    Selenium (Se) is an essential mineral element for animals and humans, which they acquire largely from plants. The Se concentration in edible plants is determined by the Se phytoavailability in soils. Selenium is not an essential element for plants, but excessive Se can be toxic. Thus, soil Se phytoavailability determines the ecology of plants. Most plants cannot grow on seleniferous soils. Most plants that grow on seleniferous soils accumulate plant species have evolved tolerance to Se, and commonly accumulate tissue Se concentrations >100 mg Se kg(-1) dry matter. These plants are considered to be Se accumulators. Some species can even accumulate Se concentrations of 1000-15 000 mg Se kg(-1 )dry matter and are called Se hyperaccumulators. This article provides an overview of Se uptake, translocation and metabolism in plants and highlights the possible genetic basis of differences in these between and within plant species. The review focuses initially on adaptations allowing plants to tolerate large Se concentrations in their tissues and the evolutionary origin of species that hyperaccumulate Se. It then describes the variation in tissue Se concentrations between and within angiosperm species and identifies genes encoding enzymes limiting the rates of incorporation of Se into organic compounds and chromosomal loci that might enable the development of crops with greater Se concentrations in their edible portions. Finally, it discusses transgenic approaches enabling plants to tolerate greater Se concentrations in the rhizosphere and in their tissues. The trait of Se hyperaccumulation has evolved several times in separate angiosperm clades. The ability to tolerate large tissue Se concentrations is primarily related to the ability to divert Se away from the accumulation of selenocysteine and selenomethionine, which might be incorporated into non-functional proteins, through the synthesis of less toxic Se metabilites. There is potential to breed or select crops

  20. Radiation hormesis in plant

    International Nuclear Information System (INIS)

    Kim, Jae Sung; Song, Hi Sup; Lee, Young Keun; Lee, Byung Hun; Shin, In Chul; Lim, Young Taek

    2000-04-01

    This research was performed to investigate the effects of low dose γ-ray radiation on the seed germination and the following physiological responses in vegetable crops. Special attention was focused on whether the resistance of vegetables against the unfavorable conditions of environment such as subsequent high doses of radiation or Phytophthora blight of pepper could be enhanced as an aspect of radiation hormesis. Analysis and characterization of antioxidant enzyme from plant culture cells and radiation tolerant of transformed plants from antioxidant (POD) were accomplished in the plant irradiated with different dose of γ-ray. (author)

  1. Nuclear power plants maintenance

    International Nuclear Information System (INIS)

    Anon.

    1988-01-01

    Nuclear power plants maintenance now appears as an important factor contributing to the competitivity of nuclea energy. The articles published in this issue describe the way maintenance has been organized in France and how it led to an actual industrial activity developing and providing products and services. An information note about Georges Besse uranium enrichment plant (Eurodif) recalls that maintenance has become a main data not only for power plants but for all nuclear industry installations. (The second part of this dossier will be published in the next issue: vol. 1 January-February 1989) [fr

  2. Optofluidics of plants

    Directory of Open Access Journals (Sweden)

    Demetri Psaltis

    2016-05-01

    Full Text Available Optofluidics is a tool for synthesizing optical systems, making use of the interaction of light with fluids. In this paper we explore optofluidic mechanisms that have evolved in plants where sunlight and fluidic control combine to define most of the functionality of the plan. We hope that the presentation of how plants function, from an optofluidics point of view, will open a window for the optics community to the vast literature of plant physiology and provide inspiration for new ideas for the design of bio-mimetic optofluidic devices.

  3. Competitive breeder power plants

    International Nuclear Information System (INIS)

    Winkleblack, R.K.

    1984-01-01

    To utilize the fissile material that is accumulating in the utilities' spent fuel pools, breeder plants must be less expensive than current LWR costs (or utilities will not buy nuclear plants in the near future) and also be highly reliable. The fundamental differences between LWRs and LMFBRs are discussed and recommendations are made for making the most of these differences to design a superior breeder plant that can sell in the future, opening the way to U.S. utilities becoming self-sufficient for fuel supply for centuries

  4. Radiation hormesis in plant

    International Nuclear Information System (INIS)

    Kim, Jae Sung; Song, Hi Sup; Lee, Young Keun; Cun, Ki Jung; Shin, In Chul; Lim, Young Taek

    1999-04-01

    This research was performed to investigate the effects of low dose γ-ray radiation on the seed germination and the following physiological responses in vegetable crops. Special attention was focused on whether the resistance of vegetables against the unfavorable conditions of environment such as acid rain or soil types could be enhanced as an aspect of radiation hormesis. Analysis and characterization of antioxidant enzyme from plant culture cells and radiation tolerant of transformed plants from antioxidant enzyme (POD) were accomplished in the plant irradiated with difference dosage of γ-ray

  5. Coal gasification plant

    Energy Technology Data Exchange (ETDEWEB)

    1977-09-29

    The proposal concerns a stage in the process of cooling the synthetic gas produced in a coal gasification plant at temperatures above 900/sup 0/C. The purpose is to keep the convection heating surface of the subsequent waste heat plant free of dirt. According to the invention, the waste heat plant has a radiation area connected before it, on the heating surfaces of which the slack carried over solidifies. This radiation area has a hydraulic and thermal cleaning system, which can be raised or lowered in a water bath. The subclaims concern all the constructional characteristics of this cleaning system, which causes the solidified slack to crack.

  6. TOR signalling in plants.

    Science.gov (United States)

    Rexin, Daniel; Meyer, Christian; Robaglia, Christophe; Veit, Bruce

    2015-08-15

    Although the eukaryotic TOR (target of rapamycin) kinase signalling pathway has emerged as a key player for integrating nutrient-, energy- and stress-related cues with growth and metabolic outputs, relatively little is known of how this ancient regulatory mechanism has been adapted in higher plants. Drawing comparisons with the substantial knowledge base around TOR kinase signalling in fungal and animal systems, functional aspects of this pathway in plants are reviewed. Both conserved and divergent elements are discussed in relation to unique aspects associated with an autotrophic mode of nutrition and adaptive strategies for multicellular development exhibited by plants. © 2015 Authors; published by Portland Press Limited.

  7. Radiation hormesis in plant

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jae Sung; Song, Hi Sup; Lee, Young Keun; Cun, Ki Jung; Shin, In Chul; Lim, Young Taek

    1999-04-01

    This research was performed to investigate the effects of low dose {gamma}-ray radiation on the seed germination and the following physiological responses in vegetable crops. Special attention was focused on whether the resistance of vegetables against the unfavorable conditions of environment such as acid rain or soil types could be enhanced as an aspect of radiation hormesis. Analysis and characterization of antioxidant enzyme from plant culture cells and radiation tolerant of transformed plants from antioxidant enzyme (POD) were accomplished in the plant irradiated with difference dosage of {gamma}-ray.

  8. Nuclear power plant outages

    International Nuclear Information System (INIS)

    1998-01-01

    The Finnish Radiation and Nuclear Safety Authority (STUK) controls nuclear power plant safety in Finland. In addition to controlling the design, construction and operation of nuclear power plants, STUK also controls refuelling and repair outages at the plants. According to section 9 of the Nuclear Energy Act (990/87), it shall be the licence-holder's obligation to ensure the safety of the use of nuclear energy. Requirements applicable to the licence-holder as regards the assurance of outage safety are presented in this guide. STUK's regulatory control activities pertaining to outages are also described

  9. FRIB Cryogenic Plant Status

    Energy Technology Data Exchange (ETDEWEB)

    Dixon, Kelly D. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Ganni, Venkatarao [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Knudsen, Peter N. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Casagranda, Fabio [Michigan State Univ., East Lansing, MI (United States)

    2015-12-01

    After practical changes were approved to the initial conceptual design of the cryogenic system for MSU FRIB and an agreement was made with JLab in 2012 to lead the design effort of the cryogenic plant, many activities are in place leading toward a cool-down of the linacs prior to 2018. This is mostly due to using similar equipment used at CHLII for the 12 GeV upgrade at JLab and an aggressive schedule maintained by the MSU Conventional Facilities department. Reported here is an updated status of the cryogenic plant, including the equipment procurement status, plant layout, facility equipment and project schedule.

  10. Plant-soil feedbacks: role of plant functional group and plant traits

    NARCIS (Netherlands)

    Cortois, R.; Schröder-Georgi, T.; Weigelt, A.; van der Putten, W.H.; De Deyn, G.B.

    2016-01-01

    Plant-soil feedback (PSF), plant trait and functional group concepts advanced our understanding of plant community dynamics, but how they are interlinked is poorly known. To test how plant functional groups (FGs: graminoids, small herbs, tall herbs, legumes) and plant traits relate to PSF, we grew

  11. Plant Growth Promoting Rhizobacteria

    Indian Academy of Sciences (India)

    IAS Admin

    known to improve plant growth in many ways when compared to ... roles in agricultural productivity. ... Sustainable agriculture: Sustainable agriculture involves the successful management of agricultural re- ... For the first time Kloepper et al.

  12. KWU Nuclear Plant Analyzer

    International Nuclear Information System (INIS)

    Bennewitz, F.; Hummel, R.; Oelmann, K.

    1986-01-01

    The KWU Nuclear Plant Analyzer is a real time engineering simulator based on the KWU computer programs used in plant transient analysis and licensing. The primary goal is to promote the understanding of the technical and physical processes of a nuclear power plant at an on-site training facility. Thus the KWU Nuclear Plant Analyzer is available with comparable low costs right at the time when technical questions or training needs arise. This has been achieved by (1) application of the transient code NLOOP; (2) unrestricted operator interaction including all simulator functions; (3) using the mainframe computer Control Data Cyber 176 in the KWU computing center; (4) four color graphic displays controlled by a dedicated graphic computer, no control room equipment; and (5) coupling of computers by telecommunication via telephone

  13. Nuclear Power Plants (Rev.)

    Energy Technology Data Exchange (ETDEWEB)

    Lyerly, Ray L.; Mitchell III, Walter [Southern Nuclear Engineering, Inc.

    1973-01-01

    Projected energy requirements for the future suggest that we must employ atomic energy to generate electric power or face depletion of our fossil-fuel resources—coal, oil, and gas. In short, both conservation and economic considerations will require us to use nuclear energy to generate the electricity that supports our civilization. Until we reach the time when nuclear power plants are as common as fossil-fueled or hydroelectric plants, many people will wonder how the nuclear plants work, how much they cost, where they are located, and what kinds of reactors they use. The purpose of this booklet is to answer these questions. In doing so, it will consider only central station plants, which are those that provide electric power for established utility systems.

  14. Ferrous Metal Processing Plants

    Data.gov (United States)

    Department of Homeland Security — This map layer includes ferrous metal processing plants in the United States. The data represent commodities covered by the Minerals Information Team (MIT) of the...

  15. Nonferrous Metal Processing Plants

    Data.gov (United States)

    Department of Homeland Security — This map layer includes nonferrous metal processing plants in the United States. The data represent commodities covered by the Minerals Information Team (MIT) of the...

  16. Plutonium Finishing Plant

    Data.gov (United States)

    Federal Laboratory Consortium — The Plutonium Finishing Plant, also known as PFP, represented the end of the line (the final procedure) associated with plutonium production at Hanford.PFP was also...

  17. Plant Vascular Biology 2010

    Energy Technology Data Exchange (ETDEWEB)

    Ding, Biao

    2014-11-17

    This grant supported the Second International Conference on Plant Vascular Biology (PVB 2010) held July 24-28, 2010 on the campus of Ohio State University, Columbus, Ohio. Biao Ding (Ohio State University; OSU) and David Hannapel (Iowa State University; ISU) served as co-chairs of this conference. Biao Ding served as the local organizer. PVB is defined broadly here to include studies on the biogenesis, structure and function of transport systems in plants, under conditions of normal plant growth and development as well as of plant interactions with pathogens. The transport systems cover broadly the xylem, phloem, plasmodesmata and vascular cell membranes. The PVB concept has emerged in recent years to emphasize the integrative nature of the transport systems and approaches to investigate them.

  18. Bituminization plant Jaslovske Bohunice

    International Nuclear Information System (INIS)

    1999-01-01

    In this leaflet the principle of the bituminization plant for radioactive concentrate (the intermediate liquid radioactive waste generated during the NPP A1, V-1, V-2 operations) solidification used in the Bohunice Radwaste Treatment Centre (BSC RAO) is presented

  19. Plant stem cell niches.

    Science.gov (United States)

    Aichinger, Ernst; Kornet, Noortje; Friedrich, Thomas; Laux, Thomas

    2012-01-01

    Multicellular organisms possess pluripotent stem cells to form new organs, replenish the daily loss of cells, or regenerate organs after injury. Stem cells are maintained in specific environments, the stem cell niches, that provide signals to block differentiation. In plants, stem cell niches are situated in the shoot, root, and vascular meristems-self-perpetuating units of organ formation. Plants' lifelong activity-which, as in the case of trees, can extend over more than a thousand years-requires that a robust regulatory network keep the balance between pluripotent stem cells and differentiating descendants. In this review, we focus on current models in plant stem cell research elaborated during the past two decades, mainly in the model plant Arabidopsis thaliana. We address the roles of mobile signals on transcriptional modules involved in balancing cell fates. In addition, we discuss shared features of and differences between the distinct stem cell niches of Arabidopsis.

  20. Biogas plants; Biogasanlagen

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-07-01

    Within the KRdL expert meeting at 30th October, 2012 in Bonn (Federal Republic of Germany), the following lectures were held: (1) New requirements on biomass conversion plants based on the Federal Nuisance Control Ordinance (Hans-Peter Ewens); (2) State of the art of the operation of biomass conversion plants (Christina Dornack); (3) Implementation of the regulation VDI 3475 sheet 4 (Markus Helm); (4) Handling of constraints of residents in the licensing procedure as well as during operation (Helmar Hentschke); (5) Explosion protection for biomass conversion plants considering the matters of immission control (Michael Faber); (6) Microbiological and epidemic-hygienic aspects of agricultural biomass conversion plants and their fermentation residues (Werner Philipp); (7) Emissions of climatic relevant gases at the biogas production (Jacqueline Daniel-Gromke); (8) State of the art in the biogas processing (Joachim Krassowski).

  1. Nuclear power plant construction

    International Nuclear Information System (INIS)

    Lima Moreira, Y.M. de.

    1979-01-01

    The legal aspects of nuclear power plant construction in Brazil, derived from governamental political guidelines, are presented. Their evolution, as a consequence of tecnology development is related. (A.L.S.L.) [pt

  2. Nuclear power plant decommissioning

    International Nuclear Information System (INIS)

    Yaziz Yunus

    1986-01-01

    A number of issues have to be taken into account before the introduction of any nuclear power plant in any country. These issues include reactor safety (site and operational), waste disposal and, lastly, the decommissioning of the reactor inself. Because of the radioactive nature of the components, nuclear power plants require a different approach to decommission compared to other plants. Until recently, issues on reactor safety and waste disposal were the main topics discussed. As for reactor decommissioning, the debates have been academic until now. Although reactors have operated for 25 years, decommissioning of retired reactors has simply not been fully planned. But the Shippingport Atomic Power Plant in Pennysylvania, the first large scale power reactor to be retired, is now being decommissioned. The work has rekindled the debate in the light of reality. Outside the United States, decommissioning is also being confronted on a new plane. (author)

  3. Advanced stellarator power plants

    International Nuclear Information System (INIS)

    Miller, R.L.

    1994-01-01

    The stellarator is a class of helical/toroidal magnetic fusion devices. Recent international progress in stellarator power plant conceptual design is reviewed and comparisons in the areas of physics, engineering, and economics are made with recent tokamak design studies

  4. Protoplasts and plant viruses

    International Nuclear Information System (INIS)

    Murakishi, H.; Lesney, M.S.; Carlson, P.

    1984-01-01

    The use of protoplasts in the study of plant viruses has attracted considerable attention since its inception in the late 1960s. This article is an attempt to assess the current status of protoplasts (primarily) and all cell cultures (in some instances) in studies of virus infection, virus replication, cytopathology, cross-protection, virus resistance, and the use of in vitro methods and genetic engineering to recover virus-resistant plants. These areas of study proved difficult to do entirely with whole plants or plant parts. However, because protoplasts could be synchronously infected with virus, they provided a valuable alternative means of following biochemical and cytological events in relation to the virus growth cycle in a more precise manner than previously possible

  5. Fertilization in Flowering Plants

    Indian Academy of Sciences (India)

    Ecology and the. Environment ... agents (pollinators), the next step before fertilization is to se- .... the embryo sac are referred to as pollen-pistil interaction and play ..... evolutionary success of flowering plants when compared to other groups of ...

  6. Competition between herbage plants

    NARCIS (Netherlands)

    Wit, de C.T.; Bergh, van den J.P.

    1965-01-01

    Starting from work with annuals a model of competition between herbage plants is discussed. It is shown that their mutual interference can only be described adequately if they are grown in mixture and also in monoculture

  7. Photomorphogenesis in plants

    National Research Council Canada - National Science Library

    Kendrick, Richard E; Kronenberg, G. H. M

    1994-01-01

    ... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. ... VII VIII XXXI Part 1 Introduction 1. Introduction by Lars Olof Bjorn 1.1 1.2 1.3 1.4 1.5 1.6 A developing research field ... Plant vision...

  8. Reprocessing plants safety

    International Nuclear Information System (INIS)

    Davies, A.G.; Leighton, C.; Millington, D.

    1989-01-01

    The reprocessing of irradiated nuclear fuel at British Nuclear Fuels (BNFL) Sellafield site consists of a number of relatively self-contained activities carried out in separate plants across the site. The physical conditions and time scales applied in reprocessing and storage make it relatively benign. The potential for minor releases of radioactivity under fault conditioning is minimised by plant design definition of control procedures, training and supervision. The risks to both the general public and workforce are shown to be low with all the safety criteria being met. Normal operating conditions also have the potential for some occupational radiation exposure and the plant and workers are monitored continuously. Exposure levels have been reduced steadily and will continue to fall with plant improvements. (U.K.)

  9. International power plant business

    Energy Technology Data Exchange (ETDEWEB)

    Grohe, R.

    1986-03-03

    At the Brown Boveri press seminar 'Energy' in Baden-Baden Rainer Grohe, member of the Brown Boveri board, Mannheim, gave a survey of the activities on the international power plant market in recent years. He showed the vacuities which must be taken into account in this sector today. The drastic escalation of demands on power plant suppliers has lead not to a reduction of protagonists but to an increase. (orig.).

  10. Wind power plant

    Energy Technology Data Exchange (ETDEWEB)

    Caneghem, A.E. von

    1975-07-24

    The invention applies to a wind power plant in which the wind is used to drive windmills. The plant consists basically of a vertical tube with a lateral wind entrance opening with windmill on its lower end. On its upper end, the tube carries a nozzle-like top which increases the wind entering the tube by pressure decrease. The wind is thus made suitable for higher outputs. The invention is illustrated by constructional examples.

  11. Janata biogas plant

    Energy Technology Data Exchange (ETDEWEB)

    Bahadur, S; Singh, K K

    1980-03-01

    The Janata biogas plant is based on the use of local materials and locally available skills only. It is a proven technology at low cost and easy maintenance which should facilitate its extension at a much faster pace especially among the low income groups. This technology is important at this time because of the current crisis in the availability of firewood and mineral fuels. This handbook explains in non-technical language the basic features, design, and construction of this biogas plant. (DC)

  12. The plant mitochondrial proteome

    DEFF Research Database (Denmark)

    Millar, A.H.; Heazlewood, J.L.; Kristensen, B.K.

    2005-01-01

    The plant mitochondrial proteome might contain as many as 2000-3000 different gene products, each of which might undergo post-translational modification. Recent studies using analytical methods, such as one-, two- and three-dimensional gel electrophoresis and one- and two-dimensional liquid...... context to be defined for them. There are indications that some of these proteins add novel activities to mitochondrial protein complexes in plants....

  13. NMR, water and plants

    International Nuclear Information System (INIS)

    As, H. van.

    1982-01-01

    This thesis describes the application of a non-destructive pulsed proton NMR method mainly to measure water transport in the xylem vessels of plant stems and in some model systems. The results are equally well applicable to liquid flow in other biological objects than plants, e.g. flow of blood and other body fluids in human and animals. The method is based on a pulse sequence of equidistant π pulses in combination with a linear magnetic field gradient. (Auth.)

  14. Plant Formate Dehydrogenase

    Energy Technology Data Exchange (ETDEWEB)

    John Markwell

    2005-01-10

    The research in this study identified formate dehydrogenase, an enzyme that plays a metabolic role on the periphery of one-carbon metabolism, has an unusual localization in Arabidopsis thaliana and that the enzyme has an unusual kinetic plasticity. These properties make it possible that this enzyme could be engineered to attempt to engineer plants with an improved photosynthetic efficiency. We have produced transgenic Arabidopsis and tobacco plants with increased expression of the formate dehydrogenase enzyme to initiate further studies.

  15. Detergent zeolite filtration plant

    OpenAIRE

    Stanković Mirjana S.; Pezo Lato L.

    2003-01-01

    The IGPC Engineering Department designed basic projects for detergent zeolite filtration plant, using technology developed in the IGPC laboratories. Several projects were completed: technological, machine, electrical, automation. On the basis of these projects, a production plant with a capacity of 75,000 t/y was manufactured, at "Zeolite Mira", Mira (VE), Italy, in 1997, for increasing detergent zeolite production, from 50,000 to 100,000 t/y. The main goal was to increase the detergent zeoli...

  16. Plant extracts as radioprotectors

    Energy Technology Data Exchange (ETDEWEB)

    Baydoun, S; Al-Oudat, M [Atomic Energy Commission, Department of Radiation Protection and Nuclear Safety, Damascus (Syrian Arab Republic); Al-Achkar, W [Atomic Energy Commission, Department of Radiobiology and Health, Damascus (Syrian Arab Republic)

    1996-09-01

    Several studies show that the extracts of some plants, namely containing vitamins or sulfide components, have radioprotection properties against the effects of ionizing radiation. In Syria, many of hates plants are available. This experiment was conducted in order to test the ability of ten different plants to protect against the radiation damages. These plants are Daucus carota L., Brassica oleracea L, Aloe vera L., Opuntia ficus-indica, Allium cepa L., Capsicum annuum L., Scilla maritima L., Allium sativum L., Rubus sanctus L. and Rosa canina L.Their effects on the protection of E. Coli growth after the exposure to L.D 50 of gamma radiation (100 Gy) were investigated . Two concentrations to each plant extract were tested, both were than 1%. Our results are indicating that the protection depend on plant. The radioprotection factors were ranged between 1.42 to 2.39. The best results were obtained by using the extract of Allium sativum L. (2.01), Opuntia ficus-indica (2.14) and Capsiucum annuum L. (2.39). (author) 16 refs., 2 tabs., 4 figs.

  17. Medicinal plants of Lorestan

    Directory of Open Access Journals (Sweden)

    shahla ahmadi

    2010-03-01

    Full Text Available Collection and determination of medicinal plants in Lorestan province have been carried out for 6 years in the agriculture and natural resources research of center of Lorestan. The aims of this study were collection and identification the medicinal plans that grow in Loretta province, their distribution, habitat, traditional uses, utilized organ, manner of usage, botany specification, local name, Persian name and scientific name. Material and methods: Medicinal plants were collected from different regions by using field and library study for these goals we prepared a list of recorded medicinal plants from Lorestan, identified the local herbal experts. Results: Finally we collected 151 medicinal plant identified that related to 63 families and 90 genuses. The Lamiaceae, Compositae, Legominosae , Liliaceae, Umbelliferae and . Rosaceae are the greatest family in the Lorestan province. Diction: According to the literature 96 medicinal plans were recorded from Lorestan, but during this study we collected and identified 151 medicinal plants in Lorestan province. Comparing with those that recorded from Bushehr 70 sp.(9, Hormozgan 113 sp.(10, Markazi 144 sp. And Kordestan 144 sp(11. We have more diversity but comparing with Zanjan 163 sp.(13, Hamedan 315 sp.(14 And Qazvin 250 sp.(15 We have less diversity in medicinal plants.

  18. Plant extracts as radioprotectors

    International Nuclear Information System (INIS)

    Baydoun, S.; Al-Oudat, M.; Al-Achkar, W.

    1996-09-01

    Several studies show that the extracts of some plants, namely containing vitamins or sulfide components, have radioprotection properties against the effects of ionizing radiation. In Syria, many of hates plants are available. This experiment was conducted in order to test the ability of ten different plants to protect against the radiation damages. These plants are Daucus carota L., Brassica oleracea L, Aloe vera L., Opuntia ficus-indica, Allium cepa L., Capsicum annuum L., Scilla maritima L., Allium sativum L., Rubus sanctus L. and Rosa canina L.Their effects on the protection of E. Coli growth after the exposure to L.D 50 of gamma radiation (100 Gy) were investigated . Two concentrations to each plant extract were tested, both were than 1%. Our results are indicating that the protection depend on plant. The radioprotection factors were ranged between 1.42 to 2.39. The best results were obtained by using the extract of Allium sativum L. (2.01), Opuntia ficus-indica (2.14) and Capsiucum annuum L. (2.39). (author) 16 refs., 2 tabs., 4 figs

  19. Plant extracts as radioprotectors

    International Nuclear Information System (INIS)

    Baydoun, S.; Al-Oudat, M.; Al-Achkar, W.

    1997-01-01

    Several studies show that the extracts of some plants, namely containing vitamins or sulfide components, have radioprotection properties against the effects of ionizing radiation. In Syria, many of hates plants are available. This experiment was conducted in order to test the ability of ten different plants to protect against the radiation damages. These plants are Daucus carota L., Brassica oleracea L, Aloe vera L., Opuntia ficus-indica, Allium cepa L., Capsicum annuum L., Scilla maritima L., Allium sativum L., Rubus sanctus L. and Rosa canina L.Their effects on the protection of E. Coli growth after the exposure to L.D 50 of gamma radiation (100 Gy) were investigated . Two concentrations to each plant extract were tested, both were than 1%. Our results are indicating that the protection depend on plant. The radioprotection factors were ranged between 1.42 to 2.39. The best results were obtained by using the extract of Allium sativum L. (2.01), Opuntia ficus-indica (2.14) and Capsiucum annuum L. (2.39). (author)

  20. Power plants 2010. Lectures

    International Nuclear Information System (INIS)

    2010-01-01

    The proceedings include the following lectures: Facing the challenges - new structures for electricity production. Renewable energies in Europe - chances and challenges. Nuclear outlook in the UK. Sustainable energy for Europe. Requirements of the market and the grid operator at the electricity production companies. Perspectives for the future energy production. Pumped storage plants - status and perspectives. Nuclear power/renewable energies -partners or opponents? New fossil fired power stations in Europe - status and perspectives. Nuclear energy: outlook for new build and lifetime extension in Europe. Biomass in the future European energy market - experiences for dong energy. Meeting the EU 20:20 renewable energy targets: the offshore challenges. DESERTEC: sustainable electricity for Europe, Middle East and North Africa. New power plants in Europe - a challenge for project and quality management. Consideration of safely in new build activities of power plants. Challenges to an integrated development in Maasvlakte, Netherlands. Power enhancement in EnBW power plants. Operational experiences of CCS pilot plants worldwide. Two years of operational experiences with Vattenfall's oxyfuel pilot plant. Pre-conditions for CCS. Storage technologies for a volatile generation. Overview: new generation of gas turbines.

  1. Plant monitoring device

    International Nuclear Information System (INIS)

    Ito, Toru.

    1994-01-01

    The device of the present invention comprises a data collecting section for periodically collecting processed data sent from plant equipments, a top node induction and processing section for an important plant function model for inducing the plant function to be noted particularly by an operator from important plant function models by using process data and a window screen selection section for selecting a window screen to be displayed based on the result of the evaluation for each of function nodes based on the processing described above and determining the layout and automatically forming the display screen. It is constituted so that the kind and the layout of the window under display are checked if they are the same as those one cycle before or not and, if they are different, the screen is automatically switched to a new screen display. Then, operator's psychological burdens such as selection of information and judgement for the operation upon occurrence of plant abnormality and accident can be mitigated, to provide a safe operation circumstance having reinforced monitoring of the function of the whole plant can be provided. (N.H.)

  2. Uranium speciation in plants

    International Nuclear Information System (INIS)

    Guenther, A.; Bernhard, G.; Geipel, G.; Reich, T.; Rossberg, A.; Nitsche, H.

    2003-01-01

    Detailed knowledge of the nature of uranium complexes formed after the uptake by plants is an essential prerequisite to describe the migration behavior of uranium in the environment. This study focuses on the determination of uranium speciation after uptake of uranium by lupine plants. For the first time, time-resolved laser-induced fluorescence spectroscopy and X-ray absorption spectroscopy were used to determine the chemical speciation of uranium in plants. Differences were detected between the uranium speciation in the initial solution (hydroponic solution and pore water of soil) and inside the lupine plants. The oxidation state of uranium did not change and remained hexavalent after it was taken up by the lupine plants. The chemical speciation of uranium was identical in the roots, shoot axis, and leaves and was independent of the uranium speciation in the uptake solution. The results indicate that the uranium is predominantly bound as uranyl(VI) phosphate to the phosphoryl groups. Dandelions and lamb's lettuce showed uranium speciation identical to lupine plants. (orig.)

  3. Plant critical concept

    International Nuclear Information System (INIS)

    O'Regan, P.J.

    1996-01-01

    The objective of the effort summarized in this paper is to support O and M cost reduction efforts by focusing resources on components and processes critical to plant performance. This effort will identify where resources on nonplant critical components and processes can be reduced or eliminated. This method will use a functional assessment as the basis for component-specific evaluations and ranking. This effort consists of two stages conducted in series. The first stage is to deterministically identify that set of plant components that are relevant from a plant performance perspective (i.e., safety, economics, reliability). The second stage probabilistically ranks that set of plant components from an importance perspective, where importance pertains to the particular application and is probabilistically weighted. The results of a pilot study identified that only a relatively small set of components are truly critical from an integrated plant performance perspective. These results are consistent with work being conducted at other nuclear power plants, as well as other commercial facilities. Initial implementation of this effort is estimated to reduce O and M costs on the order of $1 million per year. Subsequent applications are anticipated to increase that savings to $4--$5 million per year

  4. Landscaping plant epigenetics.

    Science.gov (United States)

    McKeown, Peter C; Spillane, Charles

    2014-01-01

    The understanding of epigenetic mechanisms is necessary for assessing the potential impacts of epigenetics on plant growth, development and reproduction, and ultimately for the response of these factors to evolutionary pressures and crop breeding programs. This volume highlights the latest in laboratory and bioinformatic techniques used for the investigation of epigenetic phenomena in plants. Such techniques now allow genome-wide analyses of epigenetic regulation and help to advance our understanding of how epigenetic regulatory mechanisms affect cellular and genome function. To set the scene, we begin with a short background of how the field of epigenetics has evolved, with a particular focus on plant epigenetics. We consider what has historically been understood by the term "epigenetics" before turning to the advances in biochemistry, molecular biology, and genetics which have led to current-day definitions of the term. Following this, we pay attention to key discoveries in the field of epigenetics that have emerged from the study of unusual and enigmatic phenomena in plants. Many of these phenomena have involved cases of non-Mendelian inheritance and have often been dismissed as mere curiosities prior to the elucidation of their molecular mechanisms. In the penultimate section, consideration is given to how advances in molecular techniques are opening the doors to a more comprehensive understanding of epigenetic phenomena in plants. We conclude by assessing some opportunities, challenges, and techniques for epigenetic research in both model and non-model plants, in particular for advancing understanding of the regulation of genome function by epigenetic mechanisms.

  5. Plant monitoring device

    International Nuclear Information System (INIS)

    Moriyama, Kunio.

    1991-01-01

    The monitoring device of the present invention is most suitable to early detection for equipment abnormality, or monitoring of state upon transient conditions such as startup and shutdown of an electric power plant, a large-scaled thermonuclear device and an accelerator plant. That is, in existent moitoring devices, acquired data are stored and the present operation states are monitored in comparison. A plant operation aquisition data reproduction section is disposed to the device. From the past operation conditions stored in the plant operation data aquisition reproducing section, the number of operation cycles that agrees with the present plant operation conditions is sought, to determine the agreed aquired data. Since these aquired data are time sequential data measured based on the standard time determined by the operation sequence, aquired data can be reproduced successively on every sample pitches. With such a constitution, aquired data under the same operation conditions as the present conditions are displayed together with the measured data. Accordingly, accurate monitoring can be conducted from the start-up to the shutdown of the plant. (I.S.)

  6. Molecular plant volatile communication.

    Science.gov (United States)

    Holopainen, Jarmo K; Blande, James D

    2012-01-01

    Plants produce a wide array of volatile organic compounds (VOCs) which have multiple functions as internal plant hormones (e.g., ethylene, methyl jasmonate and methyl salicylate), in communication with conspecific and heterospecific plants and in communication with organisms of second (herbivores and pollinators) and third (enemies of herbivores) trophic levels. Species specific VOCs normally repel polyphagous herbivores and those specialised on other plant species, but may attract specialist herbivores and their natural enemies, which use VOCs as host location cues. Attraction of predators and parasitoids by VOCs is considered an evolved indirect defence, whereby plants are able to indirectly reduce biotic stress caused by damaging herbivores. In this chapter we review these interactions where VOCs are known to play a crucial role. We then discuss the importance of volatile communication in self and nonself detection. VOCs are suggested to appear in soil ecosystems where distinction of own roots from neighbours roots is essential to optimise root growth, but limited evidence of above-ground plant self-recognition is available.

  7. Conservation law of plants' energy value dependence of plants ...

    African Journals Online (AJOL)

    The plants differences in biochemical composition are analyzed, and the conservation law of energy value in plants is obtained. The link between the need for the nutrients and the plants biochemical composition is examined, Liebig's law is specified. Keywords: plant's biochemical composition, biochemistry, energy value in ...

  8. Chapter 15. Plant pathology and managing wildland plant disease systems

    Science.gov (United States)

    David L. Nelson

    2004-01-01

    Obtaining specific, reliable knowledge on plant diseases is essential in wildland shrub resource management. However, plant disease is one of the most neglected areas of wildland resources experimental research. This section is a discussion of plant pathology and how to use it in managing plant disease systems.

  9. Chemical signaling between plants and plant-pathogenic bacteria.

    Science.gov (United States)

    Venturi, Vittorio; Fuqua, Clay

    2013-01-01

    Studies of chemical signaling between plants and bacteria in the past have been largely confined to two models: the rhizobial-legume symbiotic association and pathogenesis between agrobacteria and their host plants. Recent studies are beginning to provide evidence that many plant-associated bacteria undergo chemical signaling with the plant host via low-molecular-weight compounds. Plant-produced compounds interact with bacterial regulatory proteins that then affect gene expression. Similarly, bacterial quorum-sensing signals result in a range of functional responses in plants. This review attempts to highlight current knowledge in chemical signaling that takes place between pathogenic bacteria and plants. This chemical communication between plant and bacteria, also referred to as interkingdom signaling, will likely become a major research field in the future, as it allows the design of specific strategies to create plants that are resistant to plant pathogens.

  10. Plants in alpine environments

    Science.gov (United States)

    Germino, Matthew J.

    2014-01-01

    Alpine and subalpine plant species are of special interest in ecology and ecophysiology because they represent life at the climate limit and changes in their relative abundances can be a bellwether for climate-change impacts. Perennial life forms dominate alpine plant communities, and their form and function reflect various avoidance, tolerance, or resistance strategies to interactions of cold temperature, radiation, wind, and desiccation stresses that prevail in the short growing seasons common (but not ubiquitous) in alpine areas. Plant microclimate is typically uncoupled from the harsh climate of the alpine, often leading to substantially warmer plant temperatures than air temperatures recorded by weather stations. Low atmospheric pressure is the most pervasive, fundamental, and unifying factor for alpine environments, but the resulting decrease in partial pressure of CO2 does not significantly limit carbon gain by alpine plants. Factors such as tree islands and topographic features create strong heterogeneous mosaics of microclimate and snow cover that are reflected in plant community composition. Factors affecting tree establishment and growth and formation of treeline are key to understanding alpine ecology. Carbohydrate and other carbon storage, rapid development in a short growing season, and physiological function at low temperature are prevailing attributes of alpine plants. A major contemporary research theme asks whether chilling at alpine-treeline affects the ability of trees to assimilate the growth resources and particularly carbon needed for growth or whether the growth itself is limited by the alpine environment. Alpine areas tend to be among the best conserved, globally, yet they are increasingly showing response to a range of anthropogenic impacts, such as atmospheric deposition.

  11. Advanced plant design recommendations from Cook Nuclear Plant experience

    International Nuclear Information System (INIS)

    Zimmerman, W.L.

    1993-01-01

    A project in the American Electric Power Service Corporation to review operating and maintenance experience at Cook Nuclear Plant to identify recommendations for advanced nuclear plant design is described. Recommendations so gathered in the areas of plant fluid systems, instrument and control, testing and surveillance provisions, plant layout of equipment, provisions to enhance effective maintenance, ventilation systems, radiological protection, and construction, are presented accordingly. An example for a design review checklist for effective plant operations and maintenance is suggested

  12. Design and build of fieldbus-based control systems for ENEL thermoelectric plants; Sistemi di controllo con bus di campo. Applicazioni in impianti termoelettrici

    Energy Technology Data Exchange (ETDEWEB)

    Mazzola, G [Automazione e Robotica, Cesi (Italy); Prandoni, W [Business Unit Processi per la Generazione, Milan (Italy)

    2000-06-01

    The intention to start first plant-wide control applications based on fieldbus in ENEL (Electric Power Production Company) combined cycle plants demands to define appropriate requirements for design, planning, implementation, technical management and maintenance of control systems. One of the first needs is to express, in the bid specifications for Dc san other plant components, those requirements necessary on one side to guarantee the same levels of performance and reliability of traditional systems, and on the other side to ensure the improvement of the operations of installation and commissioning and of management of normal and abnormal plant behaviour, which are among the main benefits expected from this new technology. The definition of such requirements appears to be complex due to the variety and lack of a homogenous approach of the different market solutions, and also because a real experience of systems of considerable size is still missing. The memory introduces the results and problems met in the requirement specification phase, and the activity of definition of a pilot control system for demineralized water production of Fusina power plant. [Italian] In vista delle prime applicazioni negli impianti ENEL a ciclo combinato della tecnologia a bus di campo si presenta la necessita' di esprimere, nelle specifiche di acquisizione del Dcs e dei componenti, i requisiti necessari da un lato a garantire i medesimi livelli di prestazione e sicurezza dei sistemi tradizionali, dall'altro ad assicurare il miglioramento delle operazioni di installazione e delle strategie di conduzione e manutenzione dell'impianto, che sono come i ritorni piu' promettenti di questa nuova tecnologia. L'articolo presenta le principali problematiche emerse e l'attivita' di definizione di un'esperienza pilota su un impianto in esercizio nella centrale termoelettrica di Fusina.

  13. Design and build of fieldbus-based control systems for ENEL thermoelectric plants; Sistemi di controllo con bus di campo. Applicazioni in impianti termoelettrici

    Energy Technology Data Exchange (ETDEWEB)

    Mazzola, G. [Automazione e Robotica, Cesi (Italy); Prandoni, W. [Business Unit Processi per la Generazione, Milan (Italy)

    2000-06-01

    The intention to start first plant-wide control applications based on fieldbus in ENEL (Electric Power Production Company) combined cycle plants demands to define appropriate requirements for design, planning, implementation, technical management and maintenance of control systems. One of the first needs is to express, in the bid specifications for Dc san other plant components, those requirements necessary on one side to guarantee the same levels of performance and reliability of traditional systems, and on the other side to ensure the improvement of the operations of installation and commissioning and of management of normal and abnormal plant behaviour, which are among the main benefits expected from this new technology. The definition of such requirements appears to be complex due to the variety and lack of a homogenous approach of the different market solutions, and also because a real experience of systems of considerable size is still missing. The memory introduces the results and problems met in the requirement specification phase, and the activity of definition of a pilot control system for demineralized water production of Fusina power plant. [Italian] In vista delle prime applicazioni negli impianti ENEL a ciclo combinato della tecnologia a bus di campo si presenta la necessita' di esprimere, nelle specifiche di acquisizione del Dcs e dei componenti, i requisiti necessari da un lato a garantire i medesimi livelli di prestazione e sicurezza dei sistemi tradizionali, dall'altro ad assicurare il miglioramento delle operazioni di installazione e delle strategie di conduzione e manutenzione dell'impianto, che sono come i ritorni piu' promettenti di questa nuova tecnologia. L'articolo presenta le principali problematiche emerse e l'attivita' di definizione di un'esperienza pilota su un impianto in esercizio nella centrale termoelettrica di Fusina.

  14. Japanese national reference reprocessing plant

    International Nuclear Information System (INIS)

    1978-08-01

    This paper gives a general description of the proposed Japanese national reprocessing plant and of the design philosophy. The plant is in most respects similar to the base case reprocessing plant, with an annual throughput of 100-1500 tU. The plant would be co-located with a fuel fabrication facility

  15. African names for American plants

    NARCIS (Netherlands)

    Andel, van T.R.

    2015-01-01

    African slaves brought plant knowledge to the New World, sometimes applying it to related plants they found there and sometimes bringing Old World plants with them. By tracing the linguistic parallels between names for plants in African languages and in communities descended from African slaves,

  16. Cadmium uptake by plants

    Energy Technology Data Exchange (ETDEWEB)

    Haghiri, F.

    1973-01-01

    Absorption of /sup 115m/Cd by soybean (Gylcine max l.) plants via foliar and root systems and translocation into the seed was determined. The uptake of /sup 115m/Cd by soybeans via the root system was more efficient than that of the foliar placement. Growth and Cd concentrations of soybean and wheat (Triticum aestivum l.) tops were influenced by soil-applied Cd. In both crops, the Cd concentration of plant tops increased while yield decreased with increasing levels of applied Cd. Cadmium toxicitiy began to occur in both crops at the lowest level of soil applied Cd (2.5 ppM). With soybean plants, Cd toxicity symptoms resembled fe chlorosis. For wheat plants there were no visual symptoms other than the studied growth. The relative concentration of Cd found in several vegetable crops varied depending on the plant species. The relative Cd concentration in descending order for various vegetables was lettuce (Lactuca sativa l.) > radish top (Raphanus sativus l.) > celery stalk (Apium graveolens l.) > celery leaves greater than or equal to green pepper (Capsicum frutescens l.) > radish roots.

  17. Plant critical concept

    International Nuclear Information System (INIS)

    O'Regan, P.J.

    1995-01-01

    The achievement of operation and maintenance (O ampersand M) cost reductions is a prime concern for plant operators. Initiatives by the nuclear industry to address this concern are under way and/or in development. These efforts include plant reliability studies, reliability-centered maintenance, risk ranking and testing philosophies, performance-based testing philosophies, graded quality assurance, and so forth. This paper presents the results of an effort to develop a methodology that integrates and applies the common data and analysis requirements for a number of risk-based and performance-based initiatives. This initial phase of the effort applied the methodology and its results to two initiatives. These were the procurement function and the preventive maintenance function. This effort integrated multiple programs and functions to identify those components that are truly critical from an integrated plant performance perspective. The paper describes the scope of the effort, the development of a methodology to identify plant critical components, and the application of these results to the maintenance rule compliance, preventive maintenance, and procurement functions at the candidate plant

  18. Benchmarking Nuclear Power Plants

    International Nuclear Information System (INIS)

    Jakic, I.

    2016-01-01

    One of the main tasks an owner have is to keep its business competitive on the market while delivering its product. Being owner of nuclear power plant bear the same (or even more complex and stern) responsibility due to safety risks and costs. In the past, nuclear power plant managements could (partly) ignore profit or it was simply expected and to some degree assured through the various regulatory processes governing electricity rate design. It is obvious now that, with the deregulation, utility privatization and competitive electricity market, key measure of success used at nuclear power plants must include traditional metrics of successful business (return on investment, earnings and revenue generation) as well as those of plant performance, safety and reliability. In order to analyze business performance of (specific) nuclear power plant, benchmarking, as one of the well-established concept and usual method was used. Domain was conservatively designed, with well-adjusted framework, but results have still limited application due to many differences, gaps and uncertainties. (author).

  19. Ornamental Plant Breeding

    Directory of Open Access Journals (Sweden)

    Flávia Barbosa Silva Botelho

    2015-04-01

    Full Text Available World’s ornamental plant market, including domestic market of several countries and its exports, is currently evaluated in 107 billion dollars yearly. Such estimate highlights the importance of the sector in the economy of the countries, as well as its important social role, as it represents one of the main activities, which contributes to income and employment. Therefore a well-structured plant breeding program, which is connected with consumers’ demands, is required in order to fulfill these market needs globally. Activities related to pre-breeding, conventional breeding, and breeding by biotechnological techniques constitute the basis for the successful development of new ornamental plant cultivars. Techniques that involve tissue culture, protoplast fusion and genetic engineering greatly aid conventional breeding (germplasm introduction, plant selection and hybridization, aiming the obtention of superior genotypes. Therefore it makes evident, in the literature, the successful employment of genetic breeding, since it aims to develop plants with commercial value that are also competitive with the ones available in the market.

  20. Plant arginyltransferases (ATEs

    Directory of Open Access Journals (Sweden)

    Tatiana Domitrovic

    Full Text Available Abstract Regulation of protein stability and/or degradation of misfolded and damaged proteins are essential cellular processes. A part of this regulation is mediated by the so-called N-end rule proteolytic pathway, which, in concert with the ubiquitin proteasome system (UPS, drives protein degradation depending on the N-terminal amino acid sequence. One important enzyme involved in this process is arginyl-t-RNA transferase, known as ATE. This enzyme acts post-translationally by introducing an arginine residue at the N-terminus of specific protein targets to signal degradation via the UPS. However, the function of ATEs has only recently begun to be revealed. Nonetheless, the few studies to date investigating ATE activity in plants points to the great importance of the ATE/N-end rule pathway in regulating plant signaling. Plant development, seed germination, leaf morphology and responses to gas signaling in plants are among the processes affected by the ATE/N-end rule pathway. In this review, we present some of the known biological functions of plant ATE proteins, highlighting the need for more in-depth studies on this intriguing pathway.

  1. Soft valves in plants

    Science.gov (United States)

    Park, Keunhwan; Tixier, Aude; Christensen, Anneline; Arnbjerg-Nielsen, Sif; Zwieniecki, Maciej; Jensen, Kaare

    2017-11-01

    Water and minerals flow from plant roots to leaves in the xylem, an interconnected network of vascular conduits that spans the full length of the organism. When a plant is subjected to drought stress, air pockets can spread inside the xylem, threatening the survival of the plant. Many plants prevent propagation of air by using hydrophobic nano-membranes in the ``pit'' pores that link adjacent xylem cells. This adds considerable resistance to flow. Interestingly, torus-margo pit pores in conifers are open and offer less resistance. To prevent propagation of air, conifers use a soft gating mechanism, which relies on hydrodynamic interactions between the xylem liquid and the elastic pit. However, it is unknown exactly how it is able to combine the seemingly antagonist functions of high permeability and resistance to propagation of air. We conduct experiments on biomimetic pores to elucidate the flow regulation mechanism. The design of plant valves is compared to other natural systems and optimal strategies are discussed. This work was supported by a research Grant (13166) from VILLUM FONDEN.

  2. AECL's plant Information Technologies

    International Nuclear Information System (INIS)

    DeVerno, M.; Lupton, L.; Didsbury, R.; Judd, R.

    1998-01-01

    The competitiveness of the world-wide energy market is a continual driving force for improvements to CANDU performance and lower operating, maintenance, and administration costs. As in other industries, advanced Information Technologies (IT) are changing the way we work and conduct business. The nuclear industry is no different and there exists strong incentives to improve work processes and provide faster and more flexible access to the information needed to effectively manage and maintain nuclear plant assets. AECL has responded to these forces through the development of a vision of integrated IT systems addressing all phases of nuclear plant development and operations. This includes the initial engineering, design, and construction processes as well as support to the long-term operations and maintenance. Integral to the AECL vision is the need for cost-effective engineering and operational configuration management systems, proactive maintenance processes and systems, and advanced plant surveillance and diagnostics. This paper presents the vision and describes the integrated information systems needed to manage both the design basis and operating plant data systems to ensure the cost-effective, long-term viability of CANDU plants. (author)

  3. Antidiabetic Plants of Iran

    Directory of Open Access Journals (Sweden)

    Ashrafeddin Goushegir

    2011-10-01

    Full Text Available To identify the antidiabetic plants of Iran, a systematic review of the published literature on the efficacy of Iranian medicinal plant for glucose control in patients with type 2 diabetes mellitus was conducted. We performed an electronic literature search of MEDLINE, Science Direct, Scopus, Proquest, Ebsco, Googlescholar, SID, Cochrane Library Database, from 1966 up to June 2010. The search terms were complementary and alternative medicine (CAM, diabetes mellitus, plant (herb, Iran, patient, glycemic control, clinical trial, RCT, natural or herbal medicine, hypoglycemic plants, and individual herb names from popular sources, or combination of these key words. Available Randomized Controlled Trials (RCT published in English or Persian language examined effects of an herb (limited to Iran on glycemic indexes in type 2 diabetic patients were included. Among all of the articles identified in the initial database search, 23 trials were RCT, examining herbs as potential therapy for type 2 diabetes mellitus. The key outcome for antidiabetic effect was changes in blood glucose or HbA1 c, as well as improves in insulin sensitivity or resistance. Available data suggest that several antidiabetic plants of Iran need further study. Among the RCT studies, the best evidence in glycemic control was found in Citrullus colocynthus, Ipomoea betatas, Silybum marianum and Trigonella foenum graecum.

  4. Geothermal Power Generation Plant

    Energy Technology Data Exchange (ETDEWEB)

    Boyd, Tonya [Oregon Inst. of Technology, Klamath Falls, OR (United States). Geo-Heat Center

    2013-12-01

    Oregon Institute of Technology (OIT) drilled a deep geothermal well on campus (to 5,300 feet deep) which produced 196°F resource as part of the 2008 OIT Congressionally Directed Project. OIT will construct a geothermal power plant (estimated at 1.75 MWe gross output). The plant would provide 50 to 75 percent of the electricity demand on campus. Technical support for construction and operations will be provided by OIT’s Geo-Heat Center. The power plant will be housed adjacent to the existing heat exchange building on the south east corner of campus near the existing geothermal production wells used for heating campus. Cooling water will be supplied from the nearby cold water wells to a cooling tower or air cooling may be used, depending upon the type of plant selected. Using the flow obtained from the deep well, not only can energy be generated from the power plant, but the “waste” water will also be used to supplement space heating on campus. A pipeline will be construction from the well to the heat exchanger building, and then a discharge line will be construction around the east and north side of campus for anticipated use of the “waste” water by facilities in an adjacent sustainable energy park. An injection well will need to be drilled to handle the flow, as the campus existing injection wells are limited in capacity.

  5. Pinellas Plant facts

    International Nuclear Information System (INIS)

    1986-09-01

    This plant was built in 1956 in response to a need for the manufacture of neutron generators, a principal component in nuclear weapons. The neutron generators consist of a miniaturized linear ion accelerator assembled with the pulsed electrical power supplies required for its operation. The ion accelerator, or neutron tube, requires ultra clean, high vacuum technology: hermetic seals between glass, ceramic, glass-ceramic, and metal materials: plus high voltage generation and measurement technology. The existence of these capabilities at the Pinellas Plant has led directly to the assignment of the lightning arrester connector, specialty capacitor, vacuum switch, and crystal resonator. Active and reserve batteries and the radioisotopically-powered thermoelectric generator draw on the materials measurement and controls technologies which are required to ensure neutron generator life. A product development and production capability in alumina ceramics, cermet (electrical) feedthroughs, and glass ceramics has become a specialty of the plant; the laboratories monitor the materials and processes used by the plant's commercial suppliers of ferroelectric ceramics. In addition to the manufacturing facility, a production development capability is maintained at the Pinellas Plant

  6. Latina nuclear power plant

    International Nuclear Information System (INIS)

    1976-03-01

    In the period under review, the Latina power plant produced 1009,07 million kWh with a utilization factor of 72% and an availability factor of 80,51%. The disparity between the utilization and availability factors was mainly due to the shutdown of the plant owing to trade union strife. The reasons for non-availability (19,49%) were almost all related to the functioning of the conventional part and the general servicing of the plant (18 September-28 October). During the shutdown for maintenance, an inspection of the steel members and parts of the core stabilizing structure was made in order to check for the familiar oxidation phenomena caused by CO 2 ; the results of the inspection were all satisfactory. Operation of the plant during 1974 was marked by numerous power cutbacks as a result of outages of the steam-raising units (leaks from the manifolds) and main turbines (inspection and repairs to the LP rotors). Since it was first brought into commercial operation, the plant has produced 13,4 thousand million kWh

  7. Plants cultivation in controlled containments

    International Nuclear Information System (INIS)

    2000-01-01

    The plants cultivation in controlled containments permits to the - Departement d'Ecophysiologie Vegetale et de Microbiologie (DVEM) - of the CEA to lead several topics of research. The works of DVEM which are based on the molecular labelling, technique adapted to plants, contribute to understand the plant - soil relationships and the plant growth process. In addition, the staff of DVEM study the impact of pollutant heavy metals, existing in the soil, on plants and the plant stress induced by oxygen, light, ionizing radiations,... and defence mechanisms of plants (F. M.)

  8. Owners of nuclear power plants

    International Nuclear Information System (INIS)

    Wood, R.S.

    1991-07-01

    This report indicates percentage ownership of commercial nuclear power plants by utility companies. The report includes all plants operating, under construction, docketed for NRC safety and environmental reviews, or under NRC antitrust review, but does not include those plants announced but not yet under review or those plants formally cancelled. Part 1 of the report lists plants alphabetically with their associated applicants or licensees and percentage ownership. Part 2 lists applicants or licensees alphabetically with their associated plants and percentage ownership. Part 1 also indicates which plants have received operating licenses (OLS)

  9. The biological quality of Sieve downriver the Sabatta waster water plant; La qualita biologica del fiume Sieve a valle del depuratore di Rabatta

    Energy Technology Data Exchange (ETDEWEB)

    Banchetti, Rosalba; Gasperini, Federico; Bicocchi, Allegra; Cecchini, Agnese; Nolan, Brigitte; Stramaccia, Tania [Pisa Univ., Pisa (Italy). Dipartimento di etologia, ecologia ed evoluzione

    2005-10-15

    An evaluation study of the environmental condition of Sieve river, based on the Extended Biotic Index method (E.B.I.) applied to macro invertebrates was carried out in 2003. Three sampling locations were selected upriver and downriver a depuration plant and upriver of the confluence of a tributary that flow into the Sieve, the Ensa. The monitoring, carried out in two separate campaigns, in winter and spring, revealed how efficient is the sludge-active plant in determining a good quality of the water. Moreover Bilancino reservoir, with constant discharges, keeps Sieve river flow with a constant regime all through the year, avoiding the summer dry-up of the river and allowing the settlement of a biodiversified macrobenthonic community. [Italian] Nal 2003 e stato condotto uno studio di valutazione dello stato ecologico del fiume Sieve sulla base della comunita di macroinvertebrati, usando il metodo dell'I.B.E. (Indice Biotico Esteso). Sono stati scelti tre punti di campionamento a monte e a valle dello scarico di un impianto di depurazione, in funzione dal 1998, che tratta reflui di origine civile. Il monitoraggio eseguito ha rivelato l'utilita dell'impianto a fanghi attivi nel determinare un netto miglioramento della qualita delle acque.

  10. Intercâmbio educacional internacional na modalidade doutorado sanduíche em enfermagem: relato de experiência Intercambio educacional internacional en la modalidad doctorado sándwich: relato de experiencia International educational exchange in nursing s andwich doctorate modality: experience report

    Directory of Open Access Journals (Sweden)

    Kleyde Ventura de Souza

    2008-06-01

    Full Text Available Relato de experiência de estágio de Doutorado Sanduíche oferecido pela Coordenação de Aperfeiçoamento de Pessoal de Nível Superior, realizado na Faculté des Sciences Infirmières/Université de Montreal, no período de agosto a dezembro de 2004. O estágio teve como enfoque o aprofundamento dos aspectos conceituais e práticos relacionados à saúde da mulher e seus direitos sexuais e reprodutivos. Este artigo tem como propósito apresentar as atividades realizadas e despertar o interesse dos estudantes de doutorado dos programas brasileiros de pós-graduação nessa modalidade de intercâmbio. Destacam-se a participação em cursos, reuniões de grupos de pesquisas e em eventos científicos; visitas técnicas e troca de experiências com pesquisadores e integrantes de organizações sociais e conferências. Com esta experiência, verificou-se a importância da cooperação entre pesquisadores e instituições do Brasil e do exterior e fortaleceu-se o compromisso com um projeto de emancipação profissional e social, por meio da pesquisa e deste tipo de cooperação.El artículo relaciona a la experiencia del entrenamiento del Doctorado Sándwich, ofrecido por Cordenación de Perfeccionamiento de Personal de Nivel Superior y realizado en la Faculté de Sciences Infirmières/Université de Montreal, de agosto al diciembre de 2004. El entrenamiento enfocó en profundizar los aspectos conceptuales y prácticos relacionados con la salud de la mujer y con sus derechos sexuales y reproductivos. Este artículo se trata de presentar las actividades realizadas e inspirar el interés de estudiantes de los programas brasileños de la post-grado en esta modalidad del intercambio. Este intercambio era distinguido por la participación en cursos, en reuniones de grupos de investigación y en conferencias científicos, y en las visitas técnicas y el intercambio de experiencias entre investigadores y miembros de organizaciones social. La experiencia

  11. Computer codes application to evaluate comparative analysis of environmental compatibility between waste treatment plants and site characterization of Matera (southern Italy); Applicazioni del codice di calcolo SITEVAL per l'analisi della compatibilita' ambientale degli impianti di smaltimento e recupero dei rifiuti alle discariche non controllate presenti nella provincia di Matera

    Energy Technology Data Exchange (ETDEWEB)

    Cautilli, F.; Musmeci, F.; Tassoni, E. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente

    1998-07-01

    The report presents the software SITEVAL aimed at tackling the comparative analysis of environmental compatibility between waste treatment plants and hosting areas. The SITEVAL application for non-monitored urban waste landfills in the province of Matera (southern Italy) is showed with the objective to identify the more relevant environmental components in such landfills. [Italian] L'articolo illustra il codice di calcolo SITEVAL utilizzato per analisi comparative di compatibilita' ambientale di impianti di smaltimento di rifiuti con i siti che li ospitano e poi riporta l'applicazione del codice nella situazione della provincia di Matera riguardo allo smaltimento non controllato di rifiuti solidi urbani e alla individuazione delle componenti ambientali piu' sensibili alla presenza di tali discariche nel territorio. Il codice ha permesso di stilare graduatorie di compatibilita' delle discariche non controllate e di definire l'interdipendenza dei risultati dalla scelta dei parametri di input del programma.

  12. PV power plants

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-07-01

    Within the international seminar of the Ostbayerisches Technologie-Transfer-Institut e.V. (OTTI) at 11th June, 2012 in Munich (Federal Republic of Germany), the following lectures were held: (1) Technical due diligence (Dietmar Obst); (2) Certification / rating system for large PV plants (Robert Pfatischer); (3) O and M requirements (Lars Rulf); (4) IR photography for large scale systems (Bernhard Weinreich); (5) New market models for PV systems - direct marketing and sales of PV electricity (Martin Schneider); (6) Needs and benefits for plant certification for grid connection and operation (Christoph Luetke-Lengerich); (7) Lare volume module testing / Screening in the field and workshop (Semir Merzoug); (8) Dismantling costs of large scale PV plants (Siegfried Schimpf).

  13. Plant redox proteomics

    DEFF Research Database (Denmark)

    Navrot, Nicolas; Finnie, Christine; Svensson, Birte

    2011-01-01

    PTMs in regulating enzymatic activities and controlling biological processes in plants. Notably, proteins controlling the cellular redox state, e.g. thioredoxin and glutaredoxin, appear to play dual roles to maintain oxidative stress resistance and regulate signal transduction pathways via redox PTMs......In common with other aerobic organisms, plants are exposed to reactive oxygen species resulting in formation of post-translational modifications related to protein oxidoreduction (redox PTMs) that may inflict oxidative protein damage. Accumulating evidence also underscores the importance of redox....... To get a comprehensive overview of these types of redox-regulated pathways there is therefore an emerging interest to monitor changes in redox PTMs on a proteome scale. Compared to some other PTMs, e.g. protein phosphorylation, redox PTMs have received less attention in plant proteome analysis, possibly...

  14. Collective biogas plants

    International Nuclear Information System (INIS)

    1992-01-01

    Papers contributed to the European seminar on collective biogas plants held at Herning, Denmark on October 22-23 under the auspices of the Commission of the European Communities, Directorate-General for Energy (DG XVII) are presented. Within the framework of the THERMIE programme, a network of OPETs (Organizations for the Promotion of Energy Technologies) was set up in order to disseminate information on new energy technologies throughout the European communities. The potential for further implementation of centralized capacity for the conversion of animal manures and other organic wastes to bio-fuels, not only in central and eastern Europe but also in the developing countries, is discussed in addition to the relevant technologies. Actual biomass conversion plants are described and details are given on operational experience and plant management. Agricultural, economic and policy aspects are also dealt with. (AB)

  15. Town gas plants

    International Nuclear Information System (INIS)

    Anastos, G.J.; Johnson, G.M.; Schapot, R.M.; Velez, V.G.

    1990-01-01

    Town gas plant sites are receiving increasing attention from the utility industry and regulatory communities. This attention has been prompted by greater environmental awareness of impacts due to past disposal practices and the understanding that gas plant wastes contain a wide range of chemical constituents that have persisted in the environment. This paper discusses the history of the town gas plant industry, the various processes utilized and the resultant by-products and wastes. Potential problem areas relating to these sites as well as potential approaches to site characterization are addressed. Included are recommendations for the phasing of site investigations and the use of relatively inexpensive and rapid field screening techniques to identify contamination

  16. Plant stem cell niches.

    Science.gov (United States)

    Stahl, Yvonne; Simon, Rüdiger

    2005-01-01

    Stem cells are required to support the indeterminate growth style of plants. Meristems are a plants stem cell niches that foster stem cell survival and the production of descendants destined for differentiation. In shoot meristems, stem cell fate is decided at the populational level. The size of the stem cell domain at the meristem tip depends on signals that are exchanged with cells of the organizing centre underneath. In root meristems, individual stem cells are controlled by direct interaction with cells of the quiescent centre that lie in the immediate neighbourhood. Analysis of the interactions and signaling processes in the stem cell niches has delivered some insights into the molecules that are involved and revealed that the two major niches for plant stem cells are more similar than anticipated.

  17. Nuclear plant life extension

    International Nuclear Information System (INIS)

    Negin, C.A.

    1989-01-01

    The nuclear power industry's addressing of life extension is a natural trend in the maturation of this technology after 20 years of commercial operation. With increasing emphasis on how plants are operated, and less on how to build them, attention is turning on to maximizing the use of these substantial investments. The first studies of life extension were conducted in the period from 1978 and 1982. These were motivated by the initiation, by the Nuclear Regulatory Commission (NRC), of studies to support decommissioning rulemaking. The basic conclusions of those early studies that life extension is feasible and worth pursuing have not been changed by the much more extensive investigations that have since been conducted. From an engineering perspective, life extension for nuclear plants is fundamentally the same as for fossil plants

  18. Individual plant examination: Submittal guidance

    International Nuclear Information System (INIS)

    1989-08-01

    Based on a Policy Statement on Severe Accidents Regarding Future Designs and Existing Plants, the performance of a plant examination is requested from the licensee of each nuclear power plant. The plant examination looks for vulnerabilities to severe accidents and cost-effective safety improvements that reduce or eliminate the important vulnerabilities. This document delineates guidance for reporting the results of that plant examination. 38 refs., 2 tabs

  19. Urea metabolism in plants.

    Science.gov (United States)

    Witte, Claus-Peter

    2011-03-01

    Urea is a plant metabolite derived either from root uptake or from catabolism of arginine by arginase. In agriculture, urea is intensively used as a nitrogen fertilizer. Urea nitrogen enters the plant either directly, or in the form of ammonium or nitrate after urea degradation by soil microbes. In recent years various molecular players of plant urea metabolism have been investigated: active and passive urea transporters, the nickel metalloenzyme urease catalyzing the hydrolysis of urea, and three urease accessory proteins involved in the complex activation of urease. The degradation of ureides derived from purine breakdown has long been discussed as a possible additional metabolic source for urea, but an enzymatic route for the complete hydrolysis of ureides without a urea intermediate has recently been described for Arabidopsis thaliana. This review focuses on the proteins involved in plant urea metabolism and the metabolic sources of urea but also addresses open questions regarding plant urea metabolism in a physiological and agricultural context. The contribution of plant urea uptake and metabolism to fertilizer urea usage in crop production is still not investigated although globally more than half of all nitrogen fertilizer is applied to crops in the form of urea. Nitrogen use efficiency in crop production is generally well below 50% resulting in economical losses and creating ecological problems like groundwater pollution and emission of nitric oxides that can damage the ozone layer and function as greenhouse gasses. Biotechnological approaches to improve fertilizer urea usage bear the potential to increase crop nitrogen use efficiency. Copyright © 2010 Elsevier Ireland Ltd. All rights reserved.

  20. Ion channels in plants.

    Science.gov (United States)

    Hedrich, Rainer

    2012-10-01

    Since the first recordings of single potassium channel activities in the plasma membrane of guard cells more than 25 years ago, patch-clamp studies discovered a variety of ion channels in all cell types and plant species under inspection. Their properties differed in a cell type- and cell membrane-dependent manner. Guard cells, for which the existence of plant potassium channels was initially documented, advanced to a versatile model system for studying plant ion channel structure, function, and physiology. Interestingly, one of the first identified potassium-channel genes encoding the Shaker-type channel KAT1 was shown to be highly expressed in guard cells. KAT1-type channels from Arabidopsis thaliana and its homologs from other species were found to encode the K(+)-selective inward rectifiers that had already been recorded in early patch-clamp studies with guard cells. Within the genome era, additional Arabidopsis Shaker-type channels appeared. All nine members of the Arabidopsis Shaker family are localized at the plasma membrane, where they either operate as inward rectifiers, outward rectifiers, weak voltage-dependent channels, or electrically silent, but modulatory subunits. The vacuole membrane, in contrast, harbors a set of two-pore K(+) channels. Just very recently, two plant anion channel families of the SLAC/SLAH and ALMT/QUAC type were identified. SLAC1/SLAH3 and QUAC1 are expressed in guard cells and mediate Slow- and Rapid-type anion currents, respectively, that are involved in volume and turgor regulation. Anion channels in guard cells and other plant cells are key targets within often complex signaling networks. Here, the present knowledge is reviewed for the plant ion channel biology. Special emphasis is drawn to the molecular mechanisms of channel regulation, in the context of model systems and in the light of evolution.

  1. Integrated Gasification SOFC Plant with a Steam Plant

    DEFF Research Database (Denmark)

    Rokni, Masoud; Pierobon, Leonardo

    2011-01-01

    A hybrid Solid Oxide Fuel Cell (SOFC) and Steam Turbine (ST) plant is integrated with a gasification plant. Wood chips are fed to the gasification plant to produce biogas and then this gas is fed into the anode side of a SOFC cycle to produce electricity and heat. The gases from the SOFC stacks...... enter into a burner to burn the rest of the fuel. The offgases after the burner are now used to generate steam in a Heat Recovery Steam Generator (HRSG). The generated steam is expanded in a ST to produce additional power. Thus a triple hybrid plant based on a gasification plant, a SOFC plant...... and a steam plant is presented and studied. The plant is called as IGSS (Integrated Gasification SOFC Steam plant). Different systems layouts are presented and investigated. Electrical efficiencies up to 56% are achieved which is considerably higher than the conventional integrated gasification combined...

  2. Plant biotechnology: transgenic crops.

    Science.gov (United States)

    Shewry, Peter R; Jones, Huw D; Halford, Nigel G

    2008-01-01

    Transgenesis is an important adjunct to classical plant breeding, in that it allows the targeted manipulation of specific characters using genes from a range of sources. The current status of crop transformation is reviewed, including methods of gene transfer, the selection of transformed plants and control of transgene expression. The application of genetic modification technology to specific traits is then discussed, including input traits relating to crop production (herbicide tolerance and resistance to insects, pathogens and abiotic stresses) and output traits relating to the composition and quality of the harvested organs. The latter include improving the nutritional quality for consumers as well as the improvement of functional properties for food processing.

  3. Wind power plant

    Energy Technology Data Exchange (ETDEWEB)

    Weiss, G

    1975-11-20

    A wind power plant is proposed suitable for electicity generation or water pumping. This plant is to be self-adjusting to various wind velocities and to be kept in operation even during violent storms. For this purpose the mast, carrying the wind rotor and pivotable around a horizontal axis is tiltable and equipped with a wind blind. Further claims contain various configurations of the tilting base resp. the cut in of an elastic link, the attachment and design of the wind blind as well as the constructive arrangement of one or more dynamos.

  4. Power plant process computer

    International Nuclear Information System (INIS)

    Koch, R.

    1982-01-01

    The concept of instrumentation and control in nuclear power plants incorporates the use of process computers for tasks which are on-line in respect to real-time requirements but not closed-loop in respect to closed-loop control. The general scope of tasks is: - alarm annunciation on CRT's - data logging - data recording for post trip reviews and plant behaviour analysis - nuclear data computation - graphic displays. Process computers are used additionally for dedicated tasks such as the aeroball measuring system, the turbine stress evaluator. Further applications are personal dose supervision and access monitoring. (orig.)

  5. Savannah River Plant environment

    International Nuclear Information System (INIS)

    Dukes, E.K.

    1984-03-01

    On June 20, 1972, the Atomic Energy Commission designated 192,323 acres of land near Aiken, SC, as the nation's first National Environmental Research Park. The designated land surrounds the Department of Energy's Savannah River Plant production complex. The site, which borders the Savannah River for 17 miles, includes swampland, pine forests, abandoned town sites, a large man-made lake for cooling water impoundment, fields, streams, and watersheds. This report is a description of the geological, hydrological, meteorological, and biological characteristics of the Savannah River Plant site and is intended as a source of information for those interested in environmental research at the site. 165 references, 68 figures, 52 tables

  6. Quantitative plant ecology

    DEFF Research Database (Denmark)

    Damgaard, Christian

    2014-01-01

    This e-book is written in the Wolfram' CDF format (download free CDF player from Wolfram.com) The objective of this e-book is to introduce the population ecological concepts for measuring and predicting the ecological success of plant species. This will be done by focusing on the measurement...... and statistical modelling of plant species abundance and the relevant ecological processes that control species abundance. The focus on statistical modelling and likelihood function based methods also means that more algorithm based methods, e.g. ordination techniques and boosted regression tress...

  7. PLANTS, SOURCE FOR BIOFUELS

    Directory of Open Access Journals (Sweden)

    Irina Ramona PECINGINĂ

    2016-12-01

    Full Text Available The most affordable alternative energy sources to fossil plants with hydropower are some oils that accumulate in different organs other accumulating carbohydrates with high energy value. They are known worldwide and cultivated a number of plant species entering the oilseeds, which provides significant production of edible oil (soybean, sunflower, etc. Vegetable oils or their product derived biodiesel fuels are potential diesel engines, representing an alternative to fuels. The most promising suitable for the production of oil crops "with short circuit "or biodiesel are fruits and seeds, both herbaceous and tree.

  8. ITER plant systems

    International Nuclear Information System (INIS)

    Kolbasov, B.; Barnes, C.; Blevins, J.

    1991-01-01

    As part of a series of documents published by the IAEA that summarize the results of the Conceptual Design Activities for the ITER project, this publication describes the conceptual design of the ITER plant systems, in particular (i) the heat transport system, (ii) the electrical distribution system, (iii) the requirements for radioactive equipment handling, the hot cell, and waste management, (iv) the supply system for fluids and operational chemicals, (v) the qualitative analyses of failure scenarios and methods of burn stability control and emergency shutdown control, (vi) analyses of tokamak building functions and design requirements, (vii) a plant layout, and (viii) site requirements. Refs, figs and tabs

  9. Fossil power plant automation

    International Nuclear Information System (INIS)

    Divakaruni, S.M.; Touchton, G.

    1991-01-01

    This paper elaborates on issues facing the utilities industry and seeks to address how new computer-based control and automation technologies resulting from recent microprocessor evolution, can improve fossil plant operations and maintenance. This in turn can assist utilities to emerge stronger from the challenges ahead. Many presentations at the first ISA/EPRI co-sponsored conference are targeted towards improving the use of computer and control systems in the fossil and nuclear power plants and we believe this to be the right forum to share our ideas

  10. Plant engineering network

    International Nuclear Information System (INIS)

    Angus, M.J.; Goossen, J.

    1996-01-01

    The Plant Engineering Network (PEN) is a utility-vendor relationship focussed on reducing O and M costs, while maintaining the safe and reliable operation of partner plants through sharing resources, using telecommunications systems for collaborative engineering, coordinating and streamlining work processes, and sharing financial risk and reward. This paper examines how Pacific Gas and Electric (PG and E) established a PEN organization and realized over =0.5 million U.S. in 1994, the first year of implementation, and approximately =2 million U.S. savings in 1995. (author)

  11. Total Logistic Plant Solutions

    Directory of Open Access Journals (Sweden)

    Dusan Dorcak

    2016-02-01

    Full Text Available The Total Logistics Plant Solutions, plant logistics system - TLPS, based on the philosophy of advanced control processes enables complex coordination of business processes and flows and the management and scheduling of production in the appropriate production plans and planning periods. Main attributes of TLPS is to create a comprehensive, multi-level, enterprise logistics information system, with a certain degree of intelligence, which accepts the latest science and research results in the field of production technology and logistics. Logistic model of company understands as a system of mutually transforming flows of materials, energy, information, finance, which is realized by chain activities and operations

  12. Methylome evolution in plants.

    Science.gov (United States)

    Vidalis, Amaryllis; Živković, Daniel; Wardenaar, René; Roquis, David; Tellier, Aurélien; Johannes, Frank

    2016-12-20

    Despite major progress in dissecting the molecular pathways that control DNA methylation patterns in plants, little is known about the mechanisms that shape plant methylomes over evolutionary time. Drawing on recent intra- and interspecific epigenomic studies, we show that methylome evolution over long timescales is largely a byproduct of genomic changes. By contrast, methylome evolution over short timescales appears to be driven mainly by spontaneous epimutational events. We argue that novel methods based on analyses of the methylation site frequency spectrum (mSFS) of natural populations can provide deeper insights into the evolutionary forces that act at each timescale.

  13. Power plants 2009. Lectures

    International Nuclear Information System (INIS)

    2009-01-01

    Within the Annual Conference 2009 of the VGB PowerTech e.V. (Essen, Federal Republic of Germany) from 23rd to 25th May, 2009, in Lyon (France) the following lectures were held: (1) Electricity demand, consequences of the financial and economic crisis - Current overview 2020 for the EU-27 (Hans ten Berge); (2) Status and perspectives of the electricity generation mix in France (Bernard Dupraz); (3) European electricity grid - status and perspective (Dominique Maillard); (4) Technologies and acceptance in the European energy market (Gordon MacKerran); (5) EPR construction in Finland, China, France, (Claude Jaouen); (6) EPR Flamanville 3: A project on the path towards nuclear revival (Jacques Alary); (7) Worldwide nuclear Revival and acceptance (Luc Geraets); (8) An overview on the status of final disposal of radioactive wastes worldwide (Piet Zuidema); (9) Who needs pumped storage plants? PSP are partner to grid stability and renewable energies (Hans-Christoph Funke); (10) Sustainable use of water resources to generate electricity safely and efficiently (Patrick Tourasse); (11) The growth strategy of RWE Innogy - Role of RES in RWE strategy (Fritz Vahrenholt); (12) Solar technologies towards grid parity - key factors and timeframe (G. Gigliucci); (13) Overview on CCS technologies and results of Vattenfalls oxyfuel pilot plant (Philippe Paelinck); (14) Development perspectives of lignite-based IGCC-plants with CCS (Dietmar Keller); (15) Post combustion capture plants - concept and plant integration (Wolfgang Schreier); (16) CCS fossil power generation in a carbon constraint world (Daniel Hofmann); (17) CEZ group strategy in Central and South Eastern Europe (Jan Zizka); (18) Strategy and projects of DONG Energy (Jens Erik Pedersen); (19) E.ON coal-based power generation of the future - The highly efficient power plant and downstream separation of carbon dioxide (Gerhard Seibel); (20) Final sage of first supercritical 460 MW e l. CFB Boiler construction - firs

  14. Wind power plant

    Energy Technology Data Exchange (ETDEWEB)

    Kling, A

    1977-01-13

    The wind power plant described has at least one rotor which is coupled to an electricity generator. The systems are fixed to a suspended body so that it is possible to set up the wind power plant at greater height where one can expect stronger and more uniform winds. The anchoring on the ground or on a floating body is done by mooring cables which can simultaneously have the function of an electric cable. The whole system can be steered by fins. The rotor system itself consists of at least one pair of contrarotating, momentum balanced rotors.

  15. Conceptualizing Pharmaceutical Plants

    DEFF Research Database (Denmark)

    Larsen, Bent Dalgaard; Jensen, Klaes Ladeby; Gjøl, Mikkel

    2006-01-01

    In the conceptual design phase of pharmaceutical plants as much as 80%-90% of the total cost of a project is committed. It is therefore essential that the chosen concept is viable. In this design process configuration and 3D models can help validate the decisions made. Designing 3D models...... is a complex task and requires skilled users. We demonstrate that a simple 2D/3D configuration tool can support conceptualizing of pharmaceutical plants. Present paper reports on preliminary results from a full scale implementation project at a Danish engineering company....

  16. Ardennes nuclear power plant

    International Nuclear Information System (INIS)

    1974-12-01

    The SENA nuclear power plant continued to operate, as before, at authorized rated power, namely 905MWth during the first half year and 950MWth during the second half year. Net energy production:2028GWh; hours phased to the line: 7534H; availability factor: 84%; utilization factor: 84%; total shutdowns:19; number of scrams:10; cost per KWh: 4,35 French centimes. Overall, the plant is performing very satisfactory. Over the last three years net production has been 5900GWh, corresponding to in average utilization factor of 83%

  17. Nuclear power plant

    International Nuclear Information System (INIS)

    Orlov, V.V.; Rineisky, A.A.

    1975-01-01

    The invention is aimed at designing a nuclear power plant with a heat transfer system which permits an accelerated fuel regeneration maintaining relatively high initial steam values and efficiency of the steam power circuit. In case of a plant with three circuits the secondary cooling circuit includes a steam generator with preheater, evaporator, steam superheater and intermediate steam superheater. At the heat supply side the latter is connected with its inlet to the outlet of the evaporator and with its outlet to the low-temperature side of the secondary circuit

  18. Monitoring wood heating plants

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-07-01

    The overall aim of the project is to support the increased use of biomass heating plant in the UK by improving the quality and quantity of information available to suppliers and users. This aim will be achieved by: providing a qualitative assessment of the operational performance of a representative range of biomass heating installations including summaries of technical information; providing good case studies for a range of installations addressing the varied market demands; collating performance data of existing installations so as to improve the performance and/or reduce capital and operating costs of existing and future installations; and providing basic operator training and recommending methods optimising/improving plant performance. (author)

  19. Apoplastic interactions between plants and plant root intruders

    Directory of Open Access Journals (Sweden)

    Kanako eMitsumasu

    2015-08-01

    Full Text Available Numerous pathogenic or parasitic organisms attack plant roots to obtain nutrients, and the apoplast including the plant cell wall is where the plant cell meets such organisms. Root-parasitic angiosperms and nematodes are two distinct types of plant root parasites but share some common features in their strategies for breaking into plant roots. Striga and Orobanche are obligate root parasitic angiosperms that cause devastating agricultural problems worldwide. Parasitic plants form an invasion organ called a haustorium, where plant cell wall degrading enzymes (PCWDEs are highly expressed. Plant-parasitic nematodes are another type of agriculturally important plant root parasite. These nematodes breach the plant cell walls by protruding a sclerotized stylet from which PCWDEs are secreted. Responding to such parasitic invasion, host plants activate their own defense responses against parasites. Endoparasitic nematodes secrete apoplastic effectors to modulate host immune responses and to facilitate the formation of a feeding site. Apoplastic communication between hosts and parasitic plants also contributes to their interaction. Parasitic plant germination stimulants, strigolactones (SLs, are recently identified apoplastic signals that are transmitted over long distances from biosynthetic sites to functioning sites. Here, we discuss recent advances in understanding the importance of apoplastic signals and cell walls for plant-parasite interactions.

  20. Apoplastic interactions between plants and plant root intruders.

    Science.gov (United States)

    Mitsumasu, Kanako; Seto, Yoshiya; Yoshida, Satoko

    2015-01-01

    Numerous pathogenic or parasitic organisms attack plant roots to obtain nutrients, and the apoplast including the plant cell wall is where the plant cell meets such organisms. Root parasitic angiosperms and nematodes are two distinct types of plant root parasites but share some common features in their strategies for breaking into plant roots. Striga and Orobanche are obligate root parasitic angiosperms that cause devastating agricultural problems worldwide. Parasitic plants form an invasion organ called a haustorium, where plant cell wall degrading enzymes (PCWDEs) are highly expressed. Plant-parasitic nematodes are another type of agriculturally important plant root parasite. These nematodes breach the plant cell walls by protruding a sclerotized stylet from which PCWDEs are secreted. Responding to such parasitic invasion, host plants activate their own defense responses against parasites. Endoparasitic nematodes secrete apoplastic effectors to modulate host immune responses and to facilitate the formation of a feeding site. Apoplastic communication between hosts and parasitic plants also contributes to their interaction. Parasitic plant germination stimulants, strigolactones, are recently identified apoplastic signals that are transmitted over long distances from biosynthetic sites to functioning sites. Here, we discuss recent advances in understanding the importance of apoplastic signals and cell walls for plant-parasite interactions.

  1. B Plant hazards assessment

    International Nuclear Information System (INIS)

    Broz, R.E.

    1994-01-01

    This document establishes the technical basis in support of Emergency Planning Activities for B Plant on the Hanford Site. The document represents an acceptable interpretation of the implementing guidance document for DOE Order 5500.3A. Through this document, the technical basis for the development of facility specific , Emergency Action Levels and the Emergency Planning Zone is demonstrated

  2. Nuclear power plant analyzer

    International Nuclear Information System (INIS)

    Stritar, A.

    1986-01-01

    The development of Nuclear Power Plant Analyzers in USA is described. There are two different types of Analyzers under development in USA, the forst in Idaho and Los Alamos national Lab, the second in brookhaven National lab. That one is described in detail. The computer hardware and the mathematical models of the reactor vessel thermalhydraulics are described. (author)

  3. Plant research '76

    Energy Technology Data Exchange (ETDEWEB)

    1976-01-01

    Overall objective remains unchanged: to contribute to the knowledge, with strong emphasis on fundamental problems, of how plants function, the roles they play in the environment and energy relations of the world, and how these roles may be optimized for the benefit of mankind. (PCS)

  4. Drought Signaling in Plants

    Indian Academy of Sciences (India)

    depending upon the source and nature of signaling: (i) hormone signal, (ii) .... plants to regulate the rate of transpiration through minor structural .... cell has to keep spending energy (in the form of A TP) to maintain a .... enzymes and proteins in the regulation of cellular metabolism can be determined by either inactivating.

  5. Nuclear power plant

    International Nuclear Information System (INIS)

    Wieser, R.

    1979-01-01

    The reactor pressure vessel consists of two parts. A cylindrical lower part with a hemispherical steel roof is placed at some distance within an equally shaped pressure vessel of concrete. Both vessels are standing on a common bottom plate. The interspace is kept at subpressure. It serves to contain ring galleries, elevator shafts, and power plant components. (GL) [de

  6. Recombinant Cytokines from Plants

    Czech Academy of Sciences Publication Activity Database

    Sirko, A.; Vaněk, Tomáš; Gora-Sochacka, A.; Redkiewicz, P.

    2011-01-01

    Roč. 12, č. 6 (2011), s. 3536-3552 ISSN 1661-6596 Institutional research plan: CEZ:AV0Z50380511 Keywords : cytokines * pharmaceutical proteins * plant-based production systems Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.598, year: 2011

  7. Phenolics and Plant Allelopathy

    Directory of Open Access Journals (Sweden)

    De-An Jiang

    2010-12-01

    Full Text Available Phenolic compounds arise from the shikimic and acetic acid (polyketide metabolic pathways in plants. They are but one category of the many secondary metabolites implicated in plant allelopathy. Phenolic allelochemicals have been observed in both natural and managed ecosystems, where they cause a number of ecological and economic problems, such as declines in crop yield due to soil sickness, regeneration failure of natural forests, and replanting problems in orchards. Phenolic allelochemical structures and modes of action are diverse and may offer potential lead compounds for the development of future herbicides or pesticides. This article reviews allelopathic effects, analysis methods, and allelopathic mechanisms underlying the activity of plant phenolic compounds. Additionally, the currently debated topic in plant allelopathy of whether catechin and 8-hydroxyquinoline play an important role in Centaurea maculata and Centaurea diffusa invasion success is discussed. Overall, the main purpose of this review is to highlight the allelopacthic potential of phenolic compounds to provide us with methods to solve various ecology problems, especially in regard to the sustainable development of agriculture, forestry, nature resources and environment conservation.

  8. Plant breeding and genetics

    Science.gov (United States)

    The ultimate goal of plant breeding is to develop improved crops. Improvements can be made in crop productivity, crop processing and marketing, and/or consumer quality. The process of developing an improved cultivar begins with intercrossing lines with high performance for the traits of interest, th...

  9. Plant monitor system

    International Nuclear Information System (INIS)

    Scarola, K.; Jamison, D.; Manazir, R.; Rescori, R.; Harmon, D.

    1991-01-01

    An advanced control room complex for a nuclear power plant, including a discrete indicator and alarm system which is nuclear qualified for rapid response to changes in plant parameters and a component control system which together provide a discrete monitoring and control capability at a panel in the control room. A separate data processing system, which need not be nuclear qualified, provides integrated and overview information to the control room and to each panel, through CRTs and a large, overhead integrated process status overview board. The discrete indicator and alarm system and the data processing system receive inputs from common plant sensors and validate the sensor outputs to arrive at a representative value of the parameter for use by the operator during both normal and accident conditions, thereby avoiding the need for him to assimilate data from each sensor individually. The integrated process status board is at the apex of an information hierarchy that extends through four levels and provides access at each panel to the full display hierarchy. The control room panels are preferably of a modular construction, permitting the definition of inputs and outputs, the main machine interface, and the plant specific algorithms, to proceed in parallel with the fabrication of the panels, the installation of the equipment and the generic testing thereof. (author)

  10. TAPCHAN Wave Power Plants

    Energy Technology Data Exchange (ETDEWEB)

    1983-10-01

    The Tapered Channel Wave Power Plant (TAPCHAN) is based on a new method for wave energy conversion. The principle of operation can be explained by dividing the system into the following four sub-systems: Firstly, a collector which is designed to concentrate the water energy and optimize collection efficiency for a range of frequencies and directions. Secondly, the energy converter, in which the energy of the collected waves is transformed into potential energy in an on-shore water reservoir. This is the unique part of the power plant. It consists of a gradually narrowing channel with wall heights equal to the filling level of the reservoir (typical heights 3-7 m). The waves enter the wide end of the channel and as they propagate down the narrowing channel, the wave height is amplified until the wavecrests spill over the walls. Thirdly, a reservoir which provides a stable water supply for the turbines. Finally, the hydroelectric power plant, where well established techniques are used for the generation of electric power. The water turbine driving the electric generator is of a low head type, such as a Kaplan or a tubular turbine. It must be designed for salt water operation and should have good regulation capabilities. Power plants based on the principle described, are now offered on a commercial basis.

  11. Plant Modernization Programs

    International Nuclear Information System (INIS)

    O'Hara, John

    2004-01-01

    Most nuclear plants were designed and built from the 1960's through the 1990's. These plants employ predominantly analog instrumentation and control (I and C) technology, and their control rooms are made up of primarily hardwired controls (e.g., switches, knobs and handles) and displays (e.g., gauges, linear scales and indicator lights). Over the past several years, these plants have been modernized with digital I and C and computer-based human-system interfaces (HSIs) such as software-based process controls, touch-screen interfaces and large-screen, overview displays. As these computer based HIS technologies are integrated into control rooms based on conventional technology, hybrid control rooms are created. The paper summarizes lessons learned from the study of plant modernization programs over the past ten years so that they can be used to help improve the modification process. While the research focused on the impact of technology change on human performance, a number of organizational and programmatic issues were observed as well. Eleven lessons learned are presented

  12. Plants under continuous light

    NARCIS (Netherlands)

    Velez Ramirez, A.I.; Ieperen, van W.; Vreugdenhill, D.; Millenaar, F.F.

    2011-01-01

    Continuous light is an essential tool for understanding the plant circadian clock. Additionally, continuous light might increase greenhouse food production. However, using continuous light in research and practice has its challenges. For instance, most of the circadian clock-oriented experiments

  13. Nuclear plant scram reduction

    International Nuclear Information System (INIS)

    Wiegle, H.R.

    1986-01-01

    The Nuclear Utility Management and Human Resources Committee (NUMARC) is a confederation of all 55 utilities with nuclear plants either in operation or under construction. NUMARC was formed in April 1984 by senior nuclear executives with hundreds of man-years of plant experience to improve (plant) performance and resolve NRC concerns. NUMARC has adopted 10 commitments in the areas of management, training, staffing and performance. One of these commitments is to strive to reduce automatic trips to 3 per year per unit for calendar year 1985 for plants in commercial operation greater than 3 years (with greater than 25% capacity factor). This goal applies to any unplanned automatic protection system trips at any time when the reactor is critical. Each utility has committed to develop methods to thoroughly evaluate all unplanned automatic trips to identify the root causes and formulate plans to correct the root causes thus reducing future unplanned scrams. As part of this program, the Institute of Nuclear Power Operations (INPO) collects and evaluates information on automatic reactor trips. It publishes the results of these evaluations to aid the industry to identify root causes and corrective actions

  14. Italian steam power plants

    Energy Technology Data Exchange (ETDEWEB)

    von Rautenkranz, J

    1939-01-01

    A brief history of geothermal power production in Italy is presented. Boric acid has been produced on an industrial scale since 1818. The first electrical power was generated in 1904, and by 1939 the output of geothermal power plants had reached 500 GWh, with major expansion of facilities planned.

  15. Plants and Medicinal Chemistry

    Science.gov (United States)

    Bailey, D.

    1977-01-01

    This is the first of two articles showing how plants that have been used in folk medicine for many centuries are guiding scientists in the design and preparation of new and potent drugs. Opium and its chemical derivatives are examined at length in this article. (Author/MA)

  16. Whitebark pine planting guidelines

    Science.gov (United States)

    Ward McCaughey; Glenda L. Scott; Kay L. Izlar

    2009-01-01

    This article incorporates new information into previous whitebark pine guidelines for planting prescriptions. Earlier 2006 guidelines were developed based on review of general literature, research studies, field observations, and standard US Forest Service survival surveys of high-elevation whitebark pine plantations. A recent study of biotic and abiotic factors...

  17. Power plant at sea

    International Nuclear Information System (INIS)

    Roggen, M.

    2000-01-01

    Drilling platforms are rather inefficient when it comes to their own power supply. In view of ecotax and their environmental image, the offshore industry particularly the Norwegians is highly committed to changing this situation. An efficient power plant, specially designed for the offshore industry, might just prove to be the answer to their prayers

  18. Mechanisms in Plant Development

    Energy Technology Data Exchange (ETDEWEB)

    Hake, Sarah [USDA ARS Plant Gene Expression Center

    2013-08-21

    This meeting has been held every other year for the past twenty-two years and is the only regularly held meeting focused specifically on plant development. Topics covered included: patterning in developing tissues; short and long distance signaling; differentiation of cell types; the role of epigenetics in development; evolution; growth.

  19. Plant Biotech Lab Manual.

    Science.gov (United States)

    Tant, Carl

    This book provides laboratory experiments to enhance any food science/botany curriculum. Chapter 1, "Introduction," presents a survey of the techniques used in plant biotechnology laboratory procedures. Chapter 2, "Micronutrition," discusses media and nutritional requirements for tissue culture studies. Chapter 3, "Sterile Seeds," focuses on the…

  20. Radiosensitivity in plants

    International Nuclear Information System (INIS)

    Nauman, A.F.

    1979-01-01

    The report presents a compilation of available data on the sensitivity of plants to ionizing radiation, and provides basic information on methods of determining such sensitivities, or of estimating radiosensitivities by calcuation of the nuclear factors upon which they depend. The scope of the data presented here is necessarily limited to the most generally useful radiobiological end points and to the most commonly-used types of radiation. Many of the factors which influence radiosensitivity, particularly nuclear factors, will be discussed. Emphasis will be upon whole-plant studies done at Brookhaven National Laboratory by A.H. Sparrow and his associates, since these studies are the source of most of the available radiosensitivity data and of all the sensitivity predictions listed here. Data presented here include summaries of experimentally-determined radiosensitivities at various end points for both herbaceous and woody higher plants, and for a few species of ferns and lower plants. The algae and fungi have not been considered here due to space limitations

  1. Chromosome painting in plants.

    NARCIS (Netherlands)

    Schubert, I.; Fransz, P.F.; Fuchs, J.; Jong, de J.H.

    2001-01-01

    The current 'state-of-art' as to chromosome painting in plants is reviewed. We define different situations described as painting so far: i) Genomic in situ hybridisation (GISH) with total genomic DNA to distinguish alien chromosomes on the basis of divergent dispersed repeats, ii) 'Chromosomal in

  2. Nuclear Power Plant Technician

    Science.gov (United States)

    Randall, George A.

    1975-01-01

    The author recognizes a body of basic knowledge in nuclear power plant technoogy that can be taught in school programs, and lists the various courses, aiming to fill the anticipated need for nuclear-trained manpower--persons holding an associate degree in engineering technology. (Author/BP)

  3. Plant cell culture initiation

    NARCIS (Netherlands)

    Hall, R.D.

    2000-01-01

    The use of cultured plant cells in either organized or unorganized form has increased vey considerably in the last 10-15 yr. Many new technologies have been developed and applications in both fundamental and applied research have led to the development of some powerful tools for improving our

  4. Screening for Plant Features

    NARCIS (Netherlands)

    Heijden, van der G.W.A.M.; Polder, G.

    2015-01-01

    In this chapter, an overview of different plant features is given, from (sub)cellular to canopy level. A myriad of methods is available to measure these features using image analysis, and often, multiple methods can be used to measure the same feature. Several criteria are listed for choosing a

  5. The plant exocyst

    NARCIS (Netherlands)

    Zhang, Y.; Emons, A.M.C.; Ketelaar, T.

    2010-01-01

    exocyst is an octameric vesicle tethering complex that functions upstream of SNARE mediated exocytotic vesicle fusion with the plasma membrane. All proteins in the complex have been conserved during evolution, and genes that encode the exocyst subunits are present in the genomes of all plants

  6. Plants flex their skeletons

    DEFF Research Database (Denmark)

    Foster, Randy; Mattsson, Ole; Mundy, John

    2003-01-01

    Recent work on the fragile fiber mutants of Arabidopsis has identified microtubule-associated proteins that affect the orientation of cellulose microfibrils in cell walls, a major determinant of plant elongation growth. These same proteins are implicated in responses to gibberellin, provoking fresh...

  7. Quality maintenance Tropical Plants

    Directory of Open Access Journals (Sweden)

    Gláucia Moraes Dias

    2016-11-01

    Full Text Available The climatic characteristics of the country favor the cultivation of tropical flowers. The continued expansion of this market is due the beauty, exoticit nature and postharvest longevity of flower. However, little is known about the postharvest of tropical plants. Therefore, this paper provides information on harvest, handling and storage of cut tropical plantspostharvest, storage temperature, conditioning solution.

  8. Radiosensitivity in plants

    Energy Technology Data Exchange (ETDEWEB)

    Nauman, A F

    1979-01-01

    The report presents a compilation of available data on the sensitivity of plants to ionizing radiation, and provides basic information on methods of determining such sensitivities, or of estimating radiosensitivities by calcuation of the nuclear factors upon which they depend. The scope of the data presented here is necessarily limited to the most generally useful radiobiological end points and to the most commonly-used types of radiation. Many of the factors which influence radiosensitivity, particularly nuclear factors, will be discussed. Emphasis will be upon whole-plant studies done at Brookhaven National Laboratory by A.H. Sparrow and his associates, since these studies are the source of most of the available radiosensitivity data and of all the sensitivity predictions listed here. Data presented here include summaries of experimentally-determined radiosensitivities at various end points for both herbaceous and woody higher plants, and for a few species of ferns and lower plants. The algae and fungi have not been considered here due to space limitations.

  9. Peru, People and Plants.

    Science.gov (United States)

    Thompson, Dennis

    Designed for horticulture, horticulture therapy, and botany students at Edmonds Community College (Washington), this 6-hour module explores the pre-Columbian use of plant materials in Peru and its relationships to cultural practices in modern Peru. The first sections provide basic information about the module, such as its objectives, the concepts…

  10. Fertilization in Flowering Plants

    Indian Academy of Sciences (India)

    ... for the right pollen,the pistil imposes a tough competition amongst them, comparableto a swayamvara of Indian mythology, to select the bestavailable pollen. Flowering plants have evolved into a matriarchalsociety. The selection of the male partner is totally theprerogative of the mother (pistil); the boy (pollen grain) andthe ...

  11. T Plant hazards assessment

    International Nuclear Information System (INIS)

    Broz, R.E.

    1994-01-01

    This document establishes the technical basis in support of Emergency Planning activities for the T Plant on the Hanford Site. The document represents an acceptable interpretation of the implementing guidance document for DOE ORDER 5500.3A. Through this document, the technical basis for the development of facility specific Emergency Action Levels and the Emergency Planning Zone is demonstrated

  12. Steam power plant

    International Nuclear Information System (INIS)

    Campbell, J.W.E.

    1981-01-01

    This invention relates to power plant forced flow boilers operating with water letdown. The letdown water is arranged to deliver heat to partly expanded steam passing through a steam reheater connected between two stages of the prime mover. (U.K.)

  13. Garigliano nuclear power plant

    International Nuclear Information System (INIS)

    1976-03-01

    During the period under review, the Garigliano power station produced 1,028,77 million kWh with a utilization factor of 73,41% and an availability factor of 85,64%. The disparity between the utilization and availability factors was mainly due to a shutdown of about one and half months owing to lack of staff at the plant. The reasons for nonavailability (14.36%) break down as follows: nuclear reasons 11,49%; conventional reasons 2,81%; other reasons 0,06%. During the period under review, no fuel replacements took place. The plant functioned throughout with a single reactor reticulation pump and resulting maximum available capacity of 150 MWe gross. After the month of August, the plant was operated at levels slightly below the maximum available capacity in order to lengthen the fuel cycle. The total number of outages during the period under review was 11. Since the plant was brought into commercial operation, it has produced 9.226 million kWh

  14. Evolution of plant senescence

    Directory of Open Access Journals (Sweden)

    Young Mike

    2009-07-01

    Full Text Available Abstract Background Senescence is integral to the flowering plant life-cycle. Senescence-like processes occur also in non-angiosperm land plants, algae and photosynthetic prokaryotes. Increasing numbers of genes have been assigned functions in the regulation and execution of angiosperm senescence. At the same time there has been a large expansion in the number and taxonomic spread of plant sequences in the genome databases. The present paper uses these resources to make a study of the evolutionary origins of angiosperm senescence based on a survey of the distribution, across plant and microbial taxa, and expression of senescence-related genes. Results Phylogeny analyses were carried out on protein sequences corresponding to genes with demonstrated functions in angiosperm senescence. They include proteins involved in chlorophyll catabolism and its control, homeoprotein transcription factors, metabolite transporters, enzymes and regulators of carotenoid metabolism and of anthocyanin biosynthesis. Evolutionary timelines for the origins and functions of particular genes were inferred from the taxonomic distribution of sequences homologous to those of angiosperm senescence-related proteins. Turnover of the light energy transduction apparatus is the most ancient element in the senescence syndrome. By contrast, the association of phenylpropanoid metabolism with senescence, and integration of senescence with development and adaptation mediated by transcription factors, are relatively recent innovations of land plants. An extended range of senescence-related genes of Arabidopsis was profiled for coexpression patterns and developmental relationships and revealed a clear carotenoid metabolism grouping, coordinated expression of genes for anthocyanin and flavonoid enzymes and regulators and a cluster pattern of genes for chlorophyll catabolism consistent with functional and evolutionary features of the pathway. Conclusion The expression and phylogenetic

  15. Plant life management optimized utilization of existing nuclear power plants

    International Nuclear Information System (INIS)

    Watzinger, H.; Erve, M.

    1999-01-01

    For safe, reliable and economical nuclear power generation it is of central importance to understand, analyze and manage aging-related phenomena and to apply this information in the systematic utilization and as-necessary extension of the service life of components and systems. An operator's overall approach to aging and plant life management which also improves performance characteristics can help to optimize plant operating economy. In view of the deregulation of the power generation industry with its increased competition, nuclear power plants must today also increasingly provide for or maintain a high level of plant availability and low power generating costs. This is a difficult challenge even for the newest, most modern plants, and as plants age they can only remain competitive if a plant operator adopts a strategic approach which takes into account the various aging-related effects on a plant-wide basis. The significance of aging and plant life management for nuclear power plants becomes apparent when looking at their age: By the year 2000 roughly fifty of the world's 434 commercial nuclear power plants will have been in operation for thirty years or more. According to the International Atomic Energy Agency, as many as 110 plants will have reached the thirty-year service mark by the year 2005. In many countries human society does not push the construction of new nuclear power plants and presumably will not change mind within the next ten years. New construction licenses cannot be expected so that for economical and ecological reasons existing plants have to be operated unchallengeably. On the other hand the deregulation of the power production market is asking just now for analysis of plant life time to operate the plants at a high technical and economical level until new nuclear power plants can be licensed and constructed. (author)

  16. Nuclear power plant safety

    International Nuclear Information System (INIS)

    Otway, H.J.

    1974-01-01

    Action at the international level will assume greater importance as the number of nuclear power plants increases, especially in the more densely populated parts of the world. Predictions of growth made prior to October 1973 [9] indicated that, by 1980, 14% of the electricity would be supplied by nuclear plants and by the year 2000 this figure would be about 50%. This will make the topic of international co-operation and standards of even greater importance. The IAEA has long been active in providing assistance to Member States in the siting design and operation of nuclear reactors. These activities have been pursued through advisory missions, the publication of codes of practice, guide books, technical reports and in arranging meetings to promote information exchange. During the early development of nuclear power, there was no well-established body of experience which would allow formulation of internationally acceptable safety criteria, except in a few special cases. Hence, nuclear power plant safety and reliability matters often received an ad hoc approach which necessarily entailed a lack of consistency in the criteria used and in the levels of safety required. It is clear that the continuation of an ad hoc approach to safety will prove inadequate in the context of a world-wide nuclear power industry, and the international trade which this implies. As in several other fields, the establishment of internationally acceptable safety standards and appropriate guides for use by regulatory bodies, utilities, designers and constructors, is becoming a necessity. The IAEA is presently planning the development of a comprehensive set of basic requirements for nuclear power plant safety, and the associated reliability requirements, which would be internationally acceptable, and could serve as a standard frame of reference for nuclear plant safety and reliability analyses

  17. Photooxidative stress in plants

    International Nuclear Information System (INIS)

    Foyer, C.H.; Lelandais, M.; Kunert, K.J.

    1994-01-01

    The light-dependent generation of active oxygen species is termed photooxidative stress. This can occur in two ways: (1) the donation of energy or electrons directly to oxygen as a result of photosynthetic activity; (2) exposure of tissues to ultraviolet irradiation. The light-dependent destruction of catalase compounds the problem. Although generally detrimental to metabolism, superoxide and hydrogen peroxide may serve useful functions if rigorously controlled and compartmentalised. During photosynthesis the formation of active oxygen species is minimised by a number of complex and refined regulatory mechanisms. When produced, active oxygen species are eliminated rapidly by efficient antioxidative systems. The chloroplast is able to use the production and destruction of hydrogen peroxide to regulate the thermal dissipation of excess excitation energy. This is an intrinsic feature of the regulation of photosynthetic electron transport. Photoinhibition and photooxidation only usually occur when plants are exposed to stress. Active oxygen species are part of the alarm-signalling processes in plants. These serve to modify metabolism and gene expression so that the plant can respond to adverse environmental conditions, invading organisms and ultraviolet irradiation. The capacity of the antioxidative defense system is often increased at such times but if the response is not sufficient, radical production will exceed scavenging and ultimately lead to the disruption of metabolism. Oxidative damage arises in high light principally when the latter is in synergy with additional stress factors such as chilling temperatures or pollution. Environmental stress can modify the photooxidative processes in various ways ranging from direct involvement in light-induced free radical formation to the inhibition of metabolism that renders previously optimal light levels excessive. It is in just such situations that the capacity for the production of active oxygen species can exceed that

  18. Heating plant privatization stagnates

    International Nuclear Information System (INIS)

    Janoska, J.; Benka, M.; Sobinkovic, B.; Haluza, I.

    2005-01-01

    The state has been talking about privatization of 6 municipal heating plants since 2001. The tenders were to start last year. But nothing has happened and the future is uncertain. The city councils would prefer to receive, if not 100%, then at least a majority stake in the heating plants free of charge. But the Cabinet has decided to sell 51% to investors. The privatization agency - the National Property Fund (FNM) is preparing a proposal to increase the stake offered for sale to 67%. According to information provided by the FNM the sale will begin after Cabinet approval. The Fund intends to apply the same model to the sale of all the heating plants. Last year, a major German company Verbundnetz Gas declared its interest in purchasing large municipal heating plants in Slovakia. But it has been waiting for a response ever since. The French company - Dalkia, which has 10-years' experience of doing business in Slovakia, is interested in all the heating plants to be offered for sale. The Austrian company - Stefe is not new to the business either, it is interested mainly in the regions where it has already established itself - Central and Eastern Slovakia. Strategic investors expect financial groups to show interest too. The Penta Group has not hid its ambitions - it has already privatised a company which represents the key to the future development of heat management in Bratislava - Paroplynovy cyklus. Whereas Penta is not new to the heat production business another financial group - Slavia Capital is still surveying the sector. Should it not succeed, it plans several projects that would allow it to take a stake in the sector

  19. Radiochemistry in nuclear power plants

    International Nuclear Information System (INIS)

    Schwarz, W.

    2007-01-01

    Radiochemistry is employed in nuclear power plants not as an end in itself but, among other things, as a main prerequisite of optimum radiation protection. Radiochemical monitoring of various loops provides important information about sources of radioactivity, activity distribution in the plant and its changes. In the light of these analytical findings, plant crews are able to take measures having a positive effect on radiation levels in the plant. The example of a BWR plant is used to show, among other things, how radiochemical analyses helped to reduce radiation levels in a plant and, as a consequence, to decrease clearly radiation exposure of the personnel despite higher workloads. (orig.)

  20. Stainless steels in power plant and plant construction. Papers

    International Nuclear Information System (INIS)

    1994-01-01

    The conference report comprises 14 papers on the corrosion characteristics of stainless steels in power plant and plant engineering. 9 papers are available as separate records in the ENERGY database. (MM) [de

  1. Remediation Using Plants and Plant Enzymes: A Progress Report

    National Research Council Canada - National Science Library

    1995-01-01

    .... In every case, the sources are plants growing near the sediment. The use of plants for remediation of hazardous materials such as TNT or other munitions like RDX and HMX has led to a new approach to remediation-- phytoremediation...

  2. Design of plant safety model in plant enterprise engineering environment

    International Nuclear Information System (INIS)

    Gabbar, Hossam A.; Suzuki, Kazuhiko; Shimada, Yukiyasu

    2001-01-01

    Plant enterprise engineering environment (PEEE) is an approach aiming to manage the plant through its lifecycle. In such environment, safety is considered as the common objective for all activities throughout the plant lifecycle. One approach to achieve plant safety is to embed safety aspects within each function and activity within such environment. One ideal way to enable safety aspects within each automated function is through modeling. This paper proposes a theoretical approach to design plant safety model as integrated with the plant lifecycle model within such environment. Object-oriented modeling approach is used to construct the plant safety model using OO CASE tool on the basis of unified modeling language (UML). Multiple views are defined for plant objects to express static, dynamic, and functional semantics of these objects. Process safety aspects are mapped to each model element and inherited from design to operation stage, as it is naturally embedded within plant's objects. By developing and realizing the plant safety model, safer plant operation can be achieved and plant safety can be assured

  3. Plant responses to plant growth-promoting rhizobacteria

    NARCIS (Netherlands)

    Loon, L.C. van

    2007-01-01

    Non-pathogenic soilborne microorganisms can promote plant growth, as well as suppress diseases. Plant growth promotion is taken to result from improved nutrient acquisition or hormonal stimulation. Disease suppression can occur through microbial antagonism or induction of resistance in the plant.

  4. Plant air systems safety study: Portsmouth Gaseous Diffusion Plant

    International Nuclear Information System (INIS)

    1982-05-01

    The Portsmouth Gaseous Diffusion Plant Air System facilities and operations are reviewed for potential safety problems not covered by standard industrial safety procedures. Information is presented under the following section headings: facility and process description (general); air plant equipment; air distribution system; safety systems; accident analysis; plant air system safety overview; and conclusion

  5. Dipping Strawberry Plants in Fungicides before Planting to Control Anthracnose

    Directory of Open Access Journals (Sweden)

    Myeong Hyeon Nam

    2014-03-01

    Full Text Available Anthracnose crown rot (ACR, caused by Colletotrichum fructicola, is a serious disease of strawberry in Korea. The primary inoculums of ACR were symptomless strawberry plants, plant debris, and other host plants. To effectively control anthracnose in symptomless transplanted strawberries, it is necessary to use diseasefree plants, detect the disease early, and apply a fungicide. Therefore, in 2010 and 2011, we evaluated the efficacy of pre-plant fungicide dips by using strawberry transplants infected by C. fructicola for the control of anthracnose. Dipping plants in prochloraz-Mn for 10 min before planting was most effective for controlling anthracnose in symptomless strawberry plants and resulted in more than 76% control efficacy. Azoxystrobin showed a control efficacy of over 40%, but plants treated with pyraclostrobin, mancozeb and iminoctadine tris showed high disease severity. The control efficacy of the dip treatment with prochloraz-Mn did not differ with temperature and time. Treatment with prochloraz-Mn for more than an hour caused growth suppression in strawberry plants. Therefore, the development of anthracnose can be effectively reduced by dipping strawberry plants for 10 min in prochloraz-Mn before planting.

  6. Plant neurobiology and green plant intelligence : science, metaphors and nonsense

    NARCIS (Netherlands)

    Struik, P.C.; Yin, X.; Meinke, H.B.

    2008-01-01

    This paper analyses the recent debates on the emerging science of plant neurobiology, which claims that the individual green plant should be considered as an intelligent organism. Plant neurobiology tries to use elements from animal physiology as elegant metaphors to trigger the imagination in

  7. Nicotinic plant poisoning.

    Science.gov (United States)

    Schep, Leo J; Slaughter, Robin J; Beasley, D Michael G

    2009-09-01

    A wide range of plants contain nicotinic and nicotinic-like alkaloids. Of this diverse group, those that have been reported to cause human poisoning appear to have similar mechanisms of toxicity and presenting patients therefore have comparable toxidromes. This review describes the taxonomy and principal alkaloids of plants that contain nicotinic and nicotinic-like alkaloids, with particular focus on those that are toxic to humans. The toxicokinetics and mechanisms of toxicity of these alkaloids are reviewed and the clinical features and management of poisoning due to these plants are described. This review was compiled by systematically searching OVID MEDLINE and ISI Web of Science. This identified 9,456 papers, excluding duplicates, all of which were screened. Reviewed plants and their principal alkaloids. Plants containing nicotine and nicotine-like alkaloids that have been reported to be poisonous to humans include Conium maculatum, Nicotiana glauca and Nicotiana tabacum, Laburnum anagyroides, and Caulophyllum thalictroides. They contain the toxic alkaloids nicotine, anabasine, cytisine, n-methylcytisine, coniine, n-methylconiine, and gamma-coniceine. These alkaloids act agonistically at nicotinic-type acetylcholine (cholinergic) receptors (nAChRs). The nicotinic-type acetylcholine receptor can vary both in its subunit composition and in its distribution within the body (the central and autonomic nervous systems, the neuromuscular junctions, and the adrenal medulla). Agonistic interaction at these variable sites may explain why the alkaloids have diverse effects depending on the administered dose and duration of exposure. Nicotine and nicotine-like alkaloids are absorbed readily across all routes of exposure and are rapidly and widely distributed, readily traversing the blood-brain barrier and the placenta, and are freely distributed in breast milk. Metabolism occurs predominantly in the liver followed by rapid renal elimination. Following acute exposure

  8. Aquatic Plant Control Research Program

    National Research Council Canada - National Science Library

    Cofrancesco, Alfred

    1998-01-01

    .... This search for natural plant enemies (insects and fungal pathogens) has led researchers to the native ranges of noxious aquatic plants, located throughout the continents of Africa, Asia, Europe, and Australia...

  9. Emission Facilities - Air Emission Plants

    Data.gov (United States)

    NSGIC Education | GIS Inventory — Represents the Primary Facility type Air Emission Plant (AEP) point features. Air Emissions Plant is a DEP primary facility type related to the Air Quality Program....

  10. Mathematical Modelling Plant Signalling Networks

    KAUST Repository

    Muraro, D.; Byrne, H.M.; King, J.R.; Bennett, M.J.

    2013-01-01

    methods for modelling gene and signalling networks and their application in plants. We then describe specific models of hormonal perception and cross-talk in plants. This mathematical analysis of sub-cellular molecular mechanisms paves the way for more

  11. Table showing nutritional plant list

    African Journals Online (AJOL)

    USER

    2013-04-02

    Apr 2, 2013 ... To consider food as medicine is part of a culture and a millennial human ... propagation, and introduction of nutritionally rich, indigenous plant species in the .... some respondents also mentioned that these plants were being ...

  12. Plant status monitor system description

    International Nuclear Information System (INIS)

    Prather, W.A.; Sly, G.A.

    1987-01-01

    In today's regulatory and financial environment, improving plant efficiency and safety are necessary elements of plant operations. Public utility commissions are making rate rulings based, in part, on plant availability performance; and the NRC is putting more emphasis on plant operational aspects. This comes at a time when operating, maintaining, and managing a plant are becoming increasingly complex; moreover, the desired number of experienced plant personnel are becoming more difficult to find. This situation can be partially resolved by using computer software tools to assist operations, maintenance, engineering, and management personnel. These software tools provide information and interpretations based on plant and equipment status. They support improved plant availability, technical specification compliance, and administrative functions. A key element or computerization is the ability to operate on integrated information

  13. Accommodating for plant modifications

    International Nuclear Information System (INIS)

    Weirich, P.H.

    1977-01-01

    Modification to a nuclear power plant may have different causes: 1) new instructions by the authorities; 2) changes of the marginal conditions on the construction site; 3) progress in the technological development. - Examples from different plants are supposed to demonstrate how such changes influence the planning or the construction and how they are integrated in the process of preparation. A distinction can be made between modifications before the completion of the submission of the order, during the phase of preparatory planning and during the construction phase. Of great importance are especially modifications made after the beginning of the construction works, since, in general, there is little scope for technical modifications and since consequences for the time schedule are to be expected. (orig.) [de

  14. Integrated turbomachine oxygen plant

    Science.gov (United States)

    Anand, Ashok Kumar; DePuy, Richard Anthony; Muthaiah, Veerappan

    2014-06-17

    An integrated turbomachine oxygen plant includes a turbomachine and an air separation unit. One or more compressor pathways flow compressed air from a compressor through one or more of a combustor and a turbine expander to cool the combustor and/or the turbine expander. An air separation unit is operably connected to the one or more compressor pathways and is configured to separate the compressed air into oxygen and oxygen-depleted air. A method of air separation in an integrated turbomachine oxygen plant includes compressing a flow of air in a compressor of a turbomachine. The compressed flow of air is flowed through one or more of a combustor and a turbine expander of the turbomachine to cool the combustor and/or the turbine expander. The compressed flow of air is directed to an air separation unit and is separated into oxygen and oxygen-depleted air.

  15. Nuclear plant license renewal

    International Nuclear Information System (INIS)

    Gazda, P.A.; Bhatt, P.C.

    1991-01-01

    During the next 10 years, nuclear plant license renewal is expected to become a significant issue. Recent Electric Power Research Institute (EPRI) studies have shown license renewal to be technically and economically feasible. Filing an application for license renewal with the Nuclear Regulatory Commission (NRC) entails verifying that the systems, structures, and components essential for safety will continue to perform their safety functions throughout the license renewal period. This paper discusses the current proposed requirements for this verification and the current industry knowledge regarding age-related degradation of structures. Elements of a license renewal program incorporating NRC requirements and industry knowledge including a schedule are presented. Degradation mechanisms for structural components, their significance to nuclear plant structures, and industry-suggested age-related degradation management options are also reviewed

  16. The Chernobyl plant shutdown

    International Nuclear Information System (INIS)

    2000-12-01

    The Chernobylsk-1 reactor, operational in september 1977 has been stopped in november 1996; the Chernobylsk-2 reactor started in november 1978 is out of order since 1991 following a fire. The Chernobylsk-3 reactor began in 1981. During the last three years it occurs several maintenance operations that stop it. In june 2000, the Ukrainian authorities decided to stop it definitively on the 15. of december (2000). This file handles the subject. it is divided in four chapters: the first one gives the general context of the plant shutdown, the second chapter studies the supporting projects to stop definitively the nuclear plant, the third chapter treats the question of the sarcophagus, and the fourth and final chapter studies the consequences of the accident and the contaminated territories. (N.C.)

  17. Power plant simulation

    Energy Technology Data Exchange (ETDEWEB)

    Hacking, D [Marconi Simulation (United Kingdom)

    1992-09-01

    Over many years in the field of simulation Marconi has developed and adopted a number of procedures and methodologies for the management, design and development of an extensive range of training equipment. This equipment encompasses desktop computer-based training systems, generic training devices. The procurement of a training simulator is clearly dictated by the perceived training requirement or problem. Also, it should preferably involve or follow a detailed training needs analysis. Although the cost benefits of training are often difficult to quantify, a simulator is frequently easier to justify if plant familiarisation and training can be provided in advance of on-the-job experience. This is particularly true if the target operators have little hands-on experience of similar plant either in terms of processes or the operator interface. (author).

  18. Radiosensitivity of higher plants

    International Nuclear Information System (INIS)

    Feng Zhijie

    1992-11-01

    The general views on radiosensitivity of higher plants have been introduced from published references. The radiosensitivity varies with species, varieties and organs or tissues. The main factors of determining the radiosensitivity in different species are nucleus volume, chromosome volume, DNA content and endogenous compounds. The self-repair ability of DNA damage and chemical group of biological molecules, such as -SH thiohydroxy of proteins, are main factors to determine the radiosensitivity in different varieties. The moisture, oxygen, temperature radiosensitizer and protector are important external factors for radiosensitivity. Both the multiple target model and Chadwick-Leenhouts model are ideal mathematical models for describing the radiosensitivity of higher plants and the latter has more clear significance in biology

  19. Nuclear power plant

    International Nuclear Information System (INIS)

    Aisaka, Tatsuyoshi; Kamahara, Hisato; Yanagisawa, Ko.

    1982-01-01

    Purpose: To prevent corrosion stress cracks in structural materials in a BWR type nuclear power plant by decreasing the oxygen concentration in the reactor coolants. Constitution: A hydrogen injector is connected between the condensator and a condensate clean up system of a nuclear power plant. The injector is incorporated with hydrogenated compounds formed from metal hydrides, for example, of alloys such as lanthanum-nickel alloy, iron titanium alloy, vanadium, palladium, magnesium-copper alloy, magnesium-nickel alloy and the like. Even if the pressure of hydrogen obtained from a hydrogen bomb or by way of water electrolysis is changed, the hydrogen can always be injected into a reactor coolant at a pressure equal to the equilibrium dissociation pressure for metal hydride by introducing the hydrogen into the hydrogen injector. (Seki, T.)

  20. Mobile power plant units

    Energy Technology Data Exchange (ETDEWEB)

    Radtke, R

    1979-10-05

    Diesel engines of the MaK line 282 AK/332 with a cylinder power up to 160 kW are used, either as 6-cylinder or 8-cylinder in-line engine or as 12-cylinder V engine. Fuel consumption is between 207 and 212 g/kW. The engine is mounted on a frame, together with a generator. The fuel reserve in the tank will last for 8 hours. The lubricating system, the cooling water and starting air system, the switchboard system, and the frame are described. The switchboard plant is mounted either on a skid undercarriage or on the undercarriage. The plant can be operated independently or parallel to the network. The unit can be remote-controlled via push buttons or control knobs. A picture is presented of a mobile diesel aggregate which is in service in Libya.

  1. Dry alcohol production plant

    Directory of Open Access Journals (Sweden)

    Stanković Mirjana S.

    2003-01-01

    Full Text Available The IGPC Engineering Department designed basic projects for dry alcohol production plant, using technology developed in the IGPC laboratories. Several projects were completed: technological, machine, electrical, automation. On the basis of these projects a production plant with a capacity of 40 m3/y was manufactured, at "Zorka Pharma", Šabac in 1995-1996. The product meets all quality demands, as well as environmental regulations. The dry alcohol production process is fully automatized. There is no waste in the process, neither gaseous, nor liquid. The chosen process provides safe operation according to temperature regime and resistance in the pipes, air purification columns and filters. Working at increased pressure is suitable for evaporation and condensation at increased temperatures. The production process can be controlled manually, which is necessary during start-up, and repairs.

  2. Tritium in plants

    International Nuclear Information System (INIS)

    Vichot, L.; Losset, Y.

    2009-01-01

    The presence of tritium in the environment stems from its natural production by cosmic rays, from the fallout of the nuclear weapon tests between 1953 and 1964, and locally from nuclear industry activities. A part of the tritiated water contained in the foliage of plants is turned into organically bound tritium (OBT) by photosynthesis. The tritium of OBT, that is not exchangeable and then piles up in the plant, can be used as a marker of the past. It has been shown that the quantity of OBT contained in the age-rings of an oak that grew near the CEA center of Valduc was directly correlated with the tritium releases of the center. (A.C.)

  3. Third generation nuclear plants

    Science.gov (United States)

    Barré, Bertrand

    2012-05-01

    After the Chernobyl accident, a new generation of Light Water Reactors has been designed and is being built. Third generation nuclear plants are equipped with dedicated systems to insure that if the worst accident were to occur, i.e. total core meltdown, no matter how low the probability of such occurrence, radioactive releases in the environment would be minimal. This article describes the EPR, representative of this "Generation III" and a few of its competitors on the world market.

  4. The intelligent plant

    Energy Technology Data Exchange (ETDEWEB)

    Bruce Firth [CSIRO Energy Technology (Australia)

    2009-06-15

    The current advances in electronics and smart sensors, coupled with the large amount of information that modern distributed control systems can create, provide opportunities but posses some significant problems. The potential suite of data measurements could provide plant operators, maintenance staff and supervisors with a comprehensive understanding of the current health of a coal preparation plant. Analysis of this issue would also provide a tool for the recognition of where important data is not or poorly (timeframe and/or quality) currently available. A suitable system for categorisation of the information associated with the description of the 'Health of a Plant' has been developed. A relational data base model for these categories was derived. The process and performance information relationships were established via the use of models derived from the wide body of literature available. Given the availability of the above model relationships and measurements, the best way to utilise this information in a simple intelligent manner was addressed. It involved the construction of a high level fuzzy set diagnosis chart and an underlying set of unit operation diagnostic charts. These charts provided the basis for the implementation of a generic diagnosis system. This was deliberately developed in EXCEL so that it can be used and/or modified to suit a particular plant. A sensing system which combines a limited set of measurements with an algorithm or logic system for optimisation of a process can be termed a smart sensor. These are vey useful in the optimisation of difficult process situations, and can be used to supplement expert systems. It is believed that the models developed in this project can also provide the basis for appropriate smart sensors when access to appropriate measurements is available.

  5. Nuclear power plant

    International Nuclear Information System (INIS)

    Schabert, H.P.; Laurer, E.

    1976-01-01

    The invention concerns a quick-acting valve on the main-steam pipe of a nuclear power plant. The engineering design of the valve is to be improved. To the main valve disc, a piston-operated auxiliary valve disc is to be assigned closing a section of the area of the main valve disc. This way it is avoided that the drive of the main valve disc has to carry out different movements. 15 sub-claims. (UWI) [de

  6. Fusion power plant economics

    International Nuclear Information System (INIS)

    Miller, R.L.

    1996-01-01

    The rationale, methodology, and updated comparative results of cost projections for magnetic-fusion-energy central-station electric power plants are considered. Changing market and regulatory conditions, particularly in the U.S., prompt fundamental reconsideration of what constitutes a competitive future energy-source technology and has implications for the direction and emphasis of appropriate near-term research and development programs, for fusion and other advanced generation systems. 36 refs., 2 figs., 2 tabs

  7. Parasites, Plants, and People.

    Science.gov (United States)

    Johnson, Marion; Moore, Tony

    2016-06-01

    Anthelminthic resistance is acknowledged worldwide and is a major problem in Aotearoa New Zealand, thus alternative parasite management strategies are imperative. One Health is an initiative linking animal, human, and environmental health. Parasites, plants, and people illustrate the possibilities of providing diverse diets for stock thereby lowering parasite burdens, improving the cultural wellbeing of a local community, and protecting the environment. Copyright © 2016 Elsevier Ltd. All rights reserved.

  8. Power plant emissions reduction

    Science.gov (United States)

    Anand, Ashok Kumar; Nagarjuna Reddy, Thirumala Reddy

    2015-10-20

    A system for improved emissions performance of a power plant generally includes an exhaust gas recirculation system having an exhaust gas compressor disposed downstream from the combustor, a condensation collection system at least partially disposed upstream from the exhaust gas compressor, and a mixing chamber in fluid communication with the exhaust gas compressor and the condensation collection system, where the mixing chamber is in fluid communication with the combustor.

  9. Automation of solar plants

    Energy Technology Data Exchange (ETDEWEB)

    Yebra, L.J.; Romero, M.; Martinez, D.; Valverde, A. [CIEMAT - Plataforma Solar de Almeria, Tabernas (Spain); Berenguel, M. [Almeria Univ. (Spain). Departamento de Lenguajes y Computacion

    2004-07-01

    This work overviews some of the main activities and research lines that are being carried out within the scope of the specific collaboration agreement between the Plataforma Solar de Almeria-CIEMAT (PSA-CIEMAT) and the Automatic Control, Electronics and Robotics research group of the Universidad de Almeria (TEP197) titled ''Development of control systems and tools for thermosolar plants'' and the projects financed by the MCYT DPI2001-2380-C02-02 and DPI2002-04375-C03. The research is directed by the need of improving the efficiency of the process through which the energy provided by the sun is totally or partially used as energy source, as far as diminishing the costs associated to the operation and maintenance of the installations that use this energy source. The final objective is to develop different automatic control systems and techniques aimed at improving the competitiveness of solar plants. The paper summarizes different objectives and automatic control approaches that are being implemented in different facilities at the PSA-CIEMAT: central receiver systems and solar furnace. For each one of these facilities, a systematic procedure is being followed, composed of several steps: (i) development of dynamic models using the newest modeling technologies (both for simulation and control purposes), (ii) development of fully automated data acquisition and control systems including software tools facilitating the analysis of data and the application of knowledge to the controlled plants and (iii) synthesis of advanced controllers using techniques successfully used in the process industry and development of new and optimized control algorithms for solar plants. These aspects are summarized in this work. (orig.)

  10. Antibodies from plants for bionanomaterials

    OpenAIRE

    Edgue, G.; Twyman, R.M.; Beiss, V.; Fischer, R.; Sack, M.

    2017-01-01

    Antibodies are produced as part of the vertebrate adaptive immune response and are not naturally made by plants. However, antibody DNA sequences can be introduced into plants, and together with laboratory technologies that allow the design of antibodies recognizing any conceivable molecular structure, plants can be used as green factories' to produce any antibody at all. The advent of plant-based transient expression systems in particular allows the rapid, convenient, and safe production of a...

  11. Plant Pathogenicity in Spaceflight Environments

    OpenAIRE

    Bishop, Deborah L.; Levine, Howard G.; Anderson, Anne J.

    1996-01-01

    Plants grown in microgravity are subject to many environmental stresses, which may promote microbial growth and result in pathogenicity to the plant. Recent plant experiments with super dwarf wheat aboard the NASA Space Shuttle and NASA/Russian Mir Space Station returned from the mission with severe degrees of fungal contamination. Understanding the cause of such microbial contamination and methods to eliminate it are necessary prerequisites for continued plant growth and development studies ...

  12. On nuclear power plant uprating

    International Nuclear Information System (INIS)

    Ho, S. Allen; Bailey, James V.; Maginnis, Stephen T.

    2004-01-01

    Power uprating for commercial nuclear power plants has become increasingly attractive because of pragmatic reasons. It provides quick return on investment and competitive financial benefits, while involving low risks regarding plant safety and public objection. This paper briefly discussed nuclear plant uprating guidelines, scope for design basis analysis and engineering evaluation, and presented the Salem nuclear power plant uprating study for illustration purposes. A cost and benefit evaluation of the Salem power uprating was also included. (author)

  13. From plant genomes to phenotypes

    OpenAIRE

    Bolger, Marie; Gundlach, Heidrun; Scholz, Uwe; Mayer, Klaus; Usadel, Björn; Schwacke, Rainer; Schmutzer, Thomas; Chen, Jinbo; Arend, Daniel; Oppermann, Markus; Weise, Stephan; Lange, Matthias; Fiorani, Fabio; Spannagl, Manuel

    2017-01-01

    Recent advances in sequencing technologies have greatly accelerated the rate of plant genome and applied breeding research. Despite this advancing trend, plant genomes continue to present numerous difficulties to the standard tools and pipelines not only for genome assembly but also gene annotation and downstream analysis.Here we give a perspective on tools, resources and services necessary to assemble and analyze plant genomes and link them to plant phenotypes.

  14. Deep Learning for Plant Phenotyping

    OpenAIRE

    Mori, Matteo

    2016-01-01

    Plant Phenotyping is an emerging science which provides us the knowledge to better understand plants. Indeed, the study of the link between genetic background and environment in which plants develop can help us to determine cures for plants’ sicknesses and new ways to improve yields using limited resources. In this regard, one of the main aspects of Plant Phenotyping that were studied in the past, was Root Phenotyping, which is based on the study of the root architectures. In particular, toda...

  15. Process Experimental Pilot Plant

    International Nuclear Information System (INIS)

    Henze, H.

    1986-01-01

    The Process Experimental Pilot Plant (PREPP) at the Idaho National Engineering Laboratory (INEL) was built to convert transuranic contaminated solid waste into a form acceptable for disposal at the Waste Isolation Pilot Plant (WIPP), located near Carlsbad, New Mexico. There are about 2.0 million cubic ft of transuranic waste stored at the Transuranic Storage Area of the INEL's Radioactive Waste Management Complex (RWMC). The Stored Waste Examination Pilot Plant (SWEPP) located at the RWMC will examine this stored transuranic waste to determine if the waste is acceptable for direct shipment to and storage at WIPP, or if it requires shipment to PREPP for processing before shipment to WIPP. The PREPP process shreds the waste, incinerates the shredded waste, and cements (grouts) the shredded incinerated waste in new 55-gal drums. Unshreddable items are repackaged and returned to SWEPP. The process off-gas is cleaned prior to its discharge to the atmosphere, and complies with the effluent standards of the State of Idaho, EPA, and DOE. Waste liquid generated is used in the grouting operation

  16. Waste incinerating plant

    Energy Technology Data Exchange (ETDEWEB)

    1972-12-01

    This plant is provided with a NKK-Ferunst type reciprocating stage fire lattice which has a good ventilating effect and a proper stirring and loosening effect, achieving a high combustion rate, and has also a gas flow system by which gas can flow in the reverse direction to adjust its flow for seasonal variations in the quality of waste. Also, a room in which the exhaust gas is mixed is provided in this plant as a help for the complete neutralization and combustion of acid gas such as hydrogen chloride and imperfect combustion gas from plastic waste contained in wastes. In this system, waste can accept a sufficient radiant heat from the combustion gas, the furnace wall, and the ceiling; even on the post combustion fire lattice the ashes are given heat enough to complete the post combustion, so that it can be completely reduced to ashes. For these reasons, this type of incinerator is suitable for the combustion of low-calorie wastes such as city wastes. The harmful gases resulting from the combustion of wastes are treated completely by desulfurization equipment which can remove the oxides of sulfur. This type of plant also can dispose of a wide variety of wastes, and is available in several capacities from 30 tons per 8 hr to 1,200 tons per 24 hr.

  17. Genetics and plant development.

    Science.gov (United States)

    Prunet, Nathanaël; Meyerowitz, Elliot M

    2016-01-01

    There are only three grand theories in biology: the theory of the cell, the theory of the gene, and the theory of evolution. Two of these, the cell and gene theories, originated in the study of plants, with the third resulting in part from botanical considerations as well. Mendel's elucidation of the rules of inheritance was a result of his experiments on peas. The rediscovery of Mendel's work in 1900 was by the botanists de Vries, Correns, and Tschermak. It was only in subsequent years that animals were also shown to have segregation of genetic elements in the exact same manner as had been shown in plants. The story of developmental biology is different - while the development of plants has long been studied, the experimental and genetic approaches to developmental mechanism were developed via experiments on animals, and the importance of genes in development (e.g., Waddington, 1940) and their use for understanding developmental mechanisms came to botanical science much later - as late as the 1980s. Copyright © 2016 Académie des sciences. Published by Elsevier SAS. All rights reserved.

  18. Beloyarsk Nuclear Power Plant

    International Nuclear Information System (INIS)

    1997-01-01

    The Beloyarsk Nuclear Power Plant (BNPP) is located in Zarechny, approximately 60 km east of Ekaterinberg along the Trans-Siberian Highway. Zarechny, a small city of approximately 30,000 residents, was built to support BNPP operations. It is a closed city to unescorted visitors. Residents must show identification for entry. BNPP is one of the first and oldest commercial nuclear power plants in Russia and began operations in 1964. As for most nuclear power plants in the Russian Federation, BNPP is operated by Rosenergoatom, which is subordinated to the Ministry of Atomic Energy of the Russian Federation (Minatom). BNPP is the site of three nuclear reactors, Units 1, 2, and 3. Units 1 and 2, which have been shut-down and defueled, were graphite moderated reactors. The units were shut-down in 1981 and 1989. Unit 3, a BN-600 reactor, is a 600 MW(electric) sodium-cooled fast breeder reactor. Unit 3 went on-line in April 1980 and produces electric power which is fed into a distribution grid and thermal power which provides heat to Zarechny. The paper also discusses the SF NIKIET, the Sverdiovsk Branch of NIKIET, Moscow, which is the research and development branch of the parent NIKEIT and is primarily a design institute responsible for reactor design. Central to its operations is a 15 megawatt IVV research reactor. The paper discusses general security and fissile material control and accountability at these two facilities

  19. Profitability of irradiation plants

    International Nuclear Information System (INIS)

    Bustos R, M.E.; Gonzalez F, C.; Liceaga C, G.; Ortiz A, G.

    1997-01-01

    In any industrial process it is seek an attractive profit from the contractor and the social points of view. The use of the irradiation technology in foods allows keep their hygienically, which aid to food supply without risks for health, an increment of new markets and a losses reduction. In other products -cosmetics or disposable for medical use- which are sterilized by irradiation, this process allows their secure use by the consumers. The investment cost of an irradiation plant depends mainly of the plant size and the radioactive material reload that principally is Cobalt 60, these two parameters are in function of the type of products for irradiation and the selected doses. In this work it is presented the economic calculus and the financial costs for different products and capacities of plants. In general terms is determined an adequate utility that indicates that this process is profitable. According to the economic and commercial conditions in the country were considered two types of credits for the financing of this projects. One utilizing International credit resources and other with national sources. (Author)

  20. Communal biomass conversion plants

    International Nuclear Information System (INIS)

    1991-06-01

    The Coordinating Committee set up by the Danish government in 1986 were given the responsibility of investigating the potentials for biomass conversion plants in Denmark, especially in relation to agricultural, environmental and energy aspects. The results of the Committee's plan of management for this project are presented. This main report covers 13 background reports which deal with special aspects in detail. The report describes the overall plan of management, the demonstration and follow-up programme and the individual biogas demonstration plants. Information gained from these investigations is presented. The current general status, (with emphasis on the technical and economical aspects) and the prospects for the future are discussed. The interest other countries have shown in Danish activities within the field of biogas production is described, and the possibilities for Danish export of technology and know-how in this relation are discussed. It is claimed that Denmark is the first country that has instigated a coordinated development programme for biomass conversion plants. (AB) 24 refs