Directory of Open Access Journals (Sweden)
Nederbragt Alexander J
2009-08-01
Full Text Available Abstract Background Cyanobacteria often produce several different oligopeptides, with unknown biological functions, by nonribosomal peptide synthetases (NRPS. Although some cyanobacterial NRPS gene cluster types are well described, the entire NRPS genomic content within a single cyanobacterial strain has never been investigated. Here we have combined a genome-wide analysis using massive parallel pyrosequencing ("454" and mass spectrometry screening of oligopeptides produced in the strain Planktothrix rubescens NIVA CYA 98 in order to identify all putative gene clusters for oligopeptides. Results Thirteen types of oligopeptides were uncovered by mass spectrometry (MS analyses. Microcystin, cyanopeptolin and aeruginosin synthetases, highly similar to already characterized NRPS, were present in the genome. Two novel NRPS gene clusters were associated with production of anabaenopeptins and microginins, respectively. Sequence-depth of the genome and real-time PCR data revealed three copies of the microginin gene cluster. Since NRPS gene cluster candidates for microviridin and oscillatorin synthesis could not be found, putative (gene encoded precursor peptide sequences to microviridin and oscillatorin were found in the genes mdnA and oscA, respectively. The genes flanking the microviridin and oscillatorin precursor genes encode putative modifying enzymes of the precursor oligopeptides. We therefore propose ribosomal pathways involving modifications and cyclisation for microviridin and oscillatorin. The microviridin, anabaenopeptin and cyanopeptolin gene clusters are situated in close proximity to each other, constituting an oligopeptide island. Conclusion Altogether seven nonribosomal peptide synthetase (NRPS gene clusters and two gene clusters putatively encoding ribosomal oligopeptide biosynthetic pathways were revealed. Our results demonstrate that whole genome shotgun sequencing combined with MS-directed determination of oligopeptides successfully
Manganelli, Maura; Scardala, Simona; Stefanelli, Mara; Vichi, Susanna; Mattei, Daniela; Bogialli, Sara; Ceccarelli, Piegiorgio; Corradetti, Ernesto; Petrucci, Ines; Gemma, Simonetta; Testai, Emanuela; Funari, Enzo
2010-03-01
Increasing concern for human health related to cyanotoxin exposure imposes the identification of pattern and level of exposure; however, current monitoring programs, based on cyanobacteria cell counts, could be inadequate. An integrated approach has been applied to a small lake in Italy, affected by Planktothrix rubescens blooms, to provide a scientific basis for appropriate monitoring program design. The cyanobacterium dynamic, the lake physicochemical and trophic status, expressed as nutrients concentration and recycling rates due to bacterial activity, the identification/quantification of toxic genotype and cyanotoxin concentration have been studied. Our results indicate that low levels of nutrients are not a marker for low risk of P. rubescens proliferation and confirm that cyanobacterial density solely is not a reliable parameter to assess human exposure. The ratio between toxic/non-toxic cells, and toxin concentrations, which can be better explained by toxic population dynamic, are much more diagnostic, although varying with time and environmental conditions. The toxic fraction within P. rubescens population is generally high (30-100%) and increases with water depth. The ratio toxic/non-toxic cells is lowest during the bloom, suggesting a competitive advantage for non-toxic cells. Therefore, when P. rubescens is the dominant species, it is important to analyze samples below the thermocline, and quantitatively estimate toxic genotype abundance. In addition, the identification of cyanotoxin content and congeners profile, with different toxic potential, are crucial for risk assessment. Copyright 2009 Elsevier Ltd. All rights reserved.
Bogialli, Sara; Nigro di Gregorio, Federica; Lucentini, Luca; Ferretti, Emanuele; Ottaviani, Massimo; Ungaro, Nicola; Abis, Pier Paolo; Cannarozzi de Grazia, Matteo
2013-01-02
An extraordinary bloom of Planktothrix rubescens, which can produce microcystins (MCs), was observed in early 2009 in the Occhito basin, used even as a source of drinking water in Southern Italy. Several activities, coordinated by a task force, were implemented to assess and manage the risk associated to drinking water contaminated by cyanobacteria. Main actions were: evaluation of analytical protocols for screening and confirmatory purpose, monitoring the drinking water supply chain, training of operators, a dedicated web site for risk communication. ELISA assay was considered suitable for health authorities as screening method for MCs and to optimize frequency of sampling according to alert levels, and as internal control for the water supplier. A liquid chromatography-tandem mass spectrometric method able to quantify 9 MCs was optimized with the aim of supporting health authorities in a comprehensive risk evaluation based on the relative toxicity of different congeners. Short, medium, and long-term corrective actions were implemented to mitigate the health risk. Preoxidation with chlorine dioxide followed by flocculation and settling have been shown to be effective in removing MCs in the water treatment plant. Over two years, despite the high levels of cyanobacteria (up to 160 × 10(6) cells/L) and MCs (28.4 μg/L) initially reached in surface waters, the drinking water distribution was never limited.
DEFF Research Database (Denmark)
Rohrlack, T.; Christoffersen, K.; Friberg-Jensen, U.
2005-01-01
on the frequency of such compounds in the widely distributed cyanobacterial genus Planktothrix. Of the 89 Planktothrix strains analysed, about 70% produced inhibitors of daphnid trypsin. The strains tested positive represented three common Planktothrix species and were isolated from diverse localities...
Directory of Open Access Journals (Sweden)
Penali L.
2007-06-01
Full Text Available The stem bark of Zanthoxylum rubescens (syn. Fagara rubescens is used for treating fevers associated with malaria in the Ivory Coast. Three alkaloids: N-nornitidine, 7,9-dimethoxy-2,3- methylenedioxybenzophenanthridine, and bis[6-(5,6- dihydrochelerythrinyl] ether; and two amides: zanthomamide and lemairamide, were isolated from the stem bark of this plant. These compounds were screened in vitro against the chloroquine-sensitive 3D7 strain and the chloroquine-resistant FCM29 strain of P. falciparum. N-nornitidine was found to be inactive. 7,9- dimethoxy-2,3-methylenedioxybenzophenanthridine, lemairamide and zanthomamide showed weak activity with average IC50 values ranging from 45.6 μM to 149.9 μM. Bis[6-(5,6- dihydrochelerythrinyl] ether was the most active of the tested compounds with mean IC50s of 14.9 ± 1.4 μM in FCM29 strain and 15.3 ± 3.4 μM in 3D7 strain (~ 58 to ~ 1130 times less active than chloroquine respectively. The anti-Plasmodium activities of the tested alkaloids of Z. rubescens were low; and do not encourage the use of this plant as antimalarial.
Protein (Cyanobacteria): 652391838 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available family transcriptional regulator Planktothrix rubescens MLTQDQPLTETVFLAKLNEIIESNHLLKHPFYQMWTEGKLTLTMLQEYAQE...YYLHVHNFPTYVSATHAACDDINIRKMLLENLIEEERGSAHHPELWLRFAEGLGVERSAVLDRQRLNKTQESVQILKKLSRSEEAEKGLAALYAYESQFPEVSTTKISGLEEFYGINEESALSFFKVHEKADEIHSQMTRKALLQLCQTTEQQRAALDSVQTAVDAFNLLLDGVYEEYCQN
DEFF Research Database (Denmark)
Laub, J.; Henriksen, P.; Brittain, S.M.
2002-01-01
Two major and two minor microcystins (MCYST) were isolated from a hepatotoxic Danish strain of Planktothrix agardhii (Gomont) Anagnostidis et Komárek by reversed-phase high-performance liquid chromatography. The microcystins were characterized by UV spectroscopy, amino acid analysis, fast atom bo...... in Wiley InterScience (www.interscience.wiley.com). DOI 10.1002/tox.10042...
Protein (Cyanobacteria): 652390766 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available gellar biosynthesis anti-sigma factor FlgM Planktothrix rubescens MDFNFFLQSFLNGLSIGSVYAIFALGYTLVFSILGVINFAHG...INFGTATKPIMIRSVQVIIFTVCMVIVALLTYLVNKTKIGKALQAVAEDEITASLLGINPEQFIILTFFVSGFLAGLAGTL
Antibacterial Activities and Mechanism of Action of Acetone Extracts from Rabdosia rubescens
Directory of Open Access Journals (Sweden)
Li Ping Cheng
2014-12-01
Full Text Available The antibacterial activities and mechanism of action of acetone extracts from R. rubescens were reported in this paper. The results showed that 80% acetone extracts had both the highest contents of total phenolics and flavonoids. Acetone extracts showed better antibacterial activities against Gram-positive bacterial strains and there were no inhibitory effects found on tested Gram-negative bacteria. In addition, 80% acetone extracts from R. rubescens had relatively higher antibacterial activities with the lowest values of MIC and MBC at 2.5 mg/mL and 5 mg/mL against B. subtilis. The antibacterial mechanism of 80% acetone extracts against Bacillus subtilis might be described as disrupting cell wall, increasing cell membrane permeability, and finally leading to the leakage of cell constituents
Protein (Cyanobacteria): 652389878 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_026785726.1 ... 1117:3298 ... 1150:52043 1301283:73215 ... 54304:1908 59512:262 ... hypothetical protein Plankt...othrix rubescens MPTFFPEGKTININGEVELLAFQCQDTVVQLAAIAPGAIFPLHQHTESQIGMIFNGNLEMNLNGNKT
Protein (Cyanobacteria): 652391756 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_026787603.1 ... 1117:6086 ... 1150:52096 1301283:73273 ... 54304:1956 59512:755 ... hypothetical protein Plankt...othrix rubescens MKNAMLEAADIKILEAAAAEDLARDRQFILEEDSNKTLAQQSYKAQQRDQRLVKAALIPRTGEAASP
Protein (Cyanobacteria): 652390640 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_026786488.1 ... 1117:44775 ... 1150:52433 1301283:73648 ... 54304:2259 59512:501 ... hypothetical protein Plankt...othrix rubescens MKIIQGYNPSKTISPMKIRKVKGVTIVEKYGDNLYVLPDENNNKTVPEFNKTDSFDINNWAEQATDLDGFYFINAITMTGNYLGSEWNDIILGLKFRGLATYISNH
Protein (Cyanobacteria): 652392751 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_026788598.1 ... 1117:7257 ... 1150:51123 1301283:72193 ... 54304:108 59512:73 ... hypothetical protein Plankt...othrix rubescens MNSVEELARLQKRFQEAAKVIDDLSRIKQELDQLSKSYKDKLSNNSFELSQTKQEIESLSINHKEYKKYWHETFNAIHNKT
Protein (Cyanobacteria): 652390540 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_026786388.1 ... 1117:7027 ... 1150:51287 1301283:72374 ... 54304:1227 59512:475 ... carbonate dehydratase Plankt...othrix rubescens MNKTQQNLTISRRNLLKFGAGVAGTAVLTVGLGTKVSLFKAQPAVAQNGITPDEALNQLLEGNKRF
Protein (Cyanobacteria): 652392000 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_026787847.1 ... 1117:3748 ... 1150:52103 1301283:73282 ... 54304:1962 59512:816 ... NUDIX hydrolase Plankt...othrix rubescens MNKTLILEDFKVGVDNVIFSVDTEQNRLLVLLVKRKEEPFINTWSLPGTLVQKGESLENAAYRILAEKILVE
Protein (Cyanobacteria): 652391725 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_026787573.1 ... 1117:6169 ... 1150:52274 1301283:73471 ... 54304:2115 59512:749 ... hypothetical protein Plankt...othrix rubescens MGNVSFASENKTLAQSSNISGWVDSFGFASTKQGAGQAGIDQGEKLGILFDGNFDNVINSLKANQLK
Protein (Cyanobacteria): 652390481 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_026786329.1 ... 1117:7618 ... 1150:52216 1301283:73407 ... 54304:2063 59512:458 ... hypothetical protein Plankt...othrix rubescens MIPFQDSRLLLRALTYRSYMFENPNKTQGDNEQLEFLGDSVLQFLAGDYVYEKYFGEQEGQLTQKRE
Protein (Cyanobacteria): 652393259 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available RLSQDTPRCEWVSPEVLEAMATTVHPDGVIALAPRIPSKPQTLEGLGIALETLQDPGNLGTIIRTAAATGVEGLWLSADSVDLDHPKVLRASAGAWFGLNKTVSPNLA... WP_026789106.1 ... 1117:7814 ... 1150:52263 1301283:73459 ... 54304:2105 59512:1069 ... rR...NA methyltransferase Planktothrix rubescens MLTSLQNPLVKQIRKLHQAKGRKEQQLFLLEGTHLVEAACEVGYPLTTVCYTSSWQGRHQPLLE
Study on the Application of Chinese Patent Drug and Chinese Formula of Rabdosia Rubescens
Peng, Mengfan; Liu, Baosong; Mao, Mingsan
2018-01-01
Rabdosia rubescens contais many active ingredients such as terpenoids, flavonoids, polysaccharides and organic acids. Modern research has proved that Rabdosia rubescens has the effect of heat-clearing and detoxicating, antibacterial and anticancer, promoting blood circulation to arrest pain and anti-tumor. It is used in the treatment of sore throat, rheumatoid arthritis and various kinds of cancer. The clinical application of Rabdosia rubescens is restricted in the fat-soluble components, and the solubility of water solubility is ignored. The application of prescriptions, Chinese patent drug and food therapy of Rabdosia rubescens are less and fragmented. This paper inquires relevant literature, the application of Rabdosia rubescens in prescription, Chinese patent medicine and food therapy was reviewed, in order to make Rabdosiae rubescens play a greater role in the relevant area. On the basis of make the best use of everything, to promote the innovation and development of Chinese medicine and services to the people in our country.
Su, Ming; Yu, Jianwei; Zhang, Junzhi; Chen, Hui; An, Wei; Vogt, Rolf D; Andersen, Tom; Jia, Dongmin; Wang, Jingshi; Yang, Min
2015-01-01
The production of odorant 2-methylisoborneol (MIB) in water bodies by Planktothrix sp. have not been understood very well. Through a four-year investigation in Miyun Reservoir, a huge mesotrophic drinking water reservoir known to have the MIB episodes, we found that the Planktothrix sp. bloomed during September and October causing the high levels of MIB in the reservoir. The concentration of MIB and the biomass of MIB-producing cyanobacteria Planktothrix were measured (n = 887) at different sites and depths during different seasons. The results indicated that the shallow region of the reservoir is the major habitat for Planktothrix sp. due to that the light is able to penetrate down to the relatively high concentrations of nutrients close to the sediments. Quantile regression analysis between Planktothrix biomass and MIB concentration shows that the risk of MIB exceeding the odor threshold (15 ng L⁻¹) in water was as high as 90% when the Planktothrix density was more than 4.0 × 10⁵ cells L⁻¹, while the risk was reduced to 10% when the Planktothrix density remained below 1.6 × 10⁴ cells L⁻¹. This study will improve the understanding of the environmental behaviors of Planktothrix sp., and can provide useful information for better management of drinking water lakes/reservoirs experiencing the taste and odor (T&O) problems caused by deep living cyanobacterial species.
Cheng, Pengfei; Wang, Yan; Osei-Wusu, David; Wang, Yuanzhu; Liu, Tianzhong
2018-03-01
In this study, the microalgae Scenedesmus rubescens were cultivated under the following nitrogen sources, nitrogen concentrations, and nitrogen feeding times (NFTs). This was to help assess biomass and lipid productivity. Scenedesmus rubescens can grow well by adhering to the cellulose acetate membrane in five kinds of nitrogen medium: KNO 3 , urea, NaNO 3 , (NH 4 ) 2 CO 3 , and NH 4 NO 3 . Under the criteria of bio-productivity and lipid productivity, urea was the optimal nitrogen source. Among different urea concentrates, biomass productivity and lipid content of S. rubescens cultivated in 0.27 g/L urea medium were optimized at 8.8 g/(m 2 day) and 31.1%, respectively. With attached cultivation, the highest biomass of 9.4 g/m 2 was obtained at NFTs of 4 days. These results showed that culturing S. rubescens using urea as sole nitrogen source by improving nitrogen uptake with attached cultivation is more efficient.
Directory of Open Access Journals (Sweden)
Hilmar Hofmann
Full Text Available Optical (fluorescence and acoustic in-situ techniques were tested in their ability to measure the spatial and temporal distribution of plankton in freshwater ecosystems with special emphasis on the harmful and buoyant cyanobacterium P. rubescens. Fluorescence was measured with the multi-spectral FluoroProbe (Moldaenke FluoroProbe, MFP and a Seapoint Chlorophyll Fluorometer (SCF. In-situ measurements of the acoustic backscatter strength (ABS were conducted with three different acoustic devices covering multiple acoustic frequencies (614 kHz ADCP, 2 MHz ADP, and 6 MHz ADV. The MFP provides a fast and reliable technique to measure fluorescence at different wavelengths in situ, which allows discriminating between P. rubescens and other phytoplankton species. All three acoustic devices are sensitive to P. rubescens even if other scatterers, e.g., zooplankton or suspended sediment, are present in the water column, because P. rubescens containing gas vesicles has a strong density difference and hence acoustic contrast to the ambient water and other scatterers. After calibration, the combination of optical and acoustical measurements not only allows qualitative and quantitative observation of P. rubescens, but also distinction between P. rubescens, other phytoplankton, and zooplankton. As the measuring devices can sample in situ at high rates they enable assessment of plankton distributions at high temporal (minutes and spatial (decimeters resolution or covering large temporal (seasonal and spatial (basin scale scales.
Ciraolo, Giuseppe; La Loggia, Goffredo; Maltese, Antonino
2010-10-01
In December 2006 blooms of Oscillatoria rubescens were found in the reservoir Prizzi in Sicily. Oscillatoria is a genus of filamentous alga comprising approximately 6 species, between these the O. rubescens is sadly famous since this organism produces microcystins which are powerful hepatotoxins. Firstly found in Europe in 1825 on Geneva lake, recently (2006) those algae has been find out in Pozzillo, Nicoletti e Ancipa reservoirs (Enna Province), as well as in Prizzi (Palermo Province) and Garcia reservoirs (Trapani Province). Toxins produced by those bacteria (usually called microcystine LR-1 and LR-2) are highly toxic since they can activate oncogenes cells causing cancer pathologies on liver and gastrointestinal tract. Even if water treatment plants should ensure the provision of safe drinking water from surface waters contaminated with those toxic algae blooms, the contamination of reservoirs used for civil and agricultural supply highlights human health risks. International literature suggests a threshold value of 0.01 μgl-1 to avoid liver cancer using water coming from contaminated water bodies for a long period. Since O. rubescens activities is strongly related to phosphate and nitrogen compounds as well as to temperature and light transmission within water, the paper presents the comparison between optical properties of the water of an infested reservoir and those of a reservoir characterized by clear water. Field campaigns were carried out in February-March 2008 in order to quantify the spectral transparencies of two water bodies through the calculation of the diffuse attenuation coefficient, measuring underwater downwelling irradiance at different depths as well as water spectral reflectance. Results show that diffuse attenuation coefficient is reduced by approximately 15% reducing light penetration in the water column; coherently reflectance spectral signature generally decreases, exhibiting a characteristic peak around 703 nm not present in
Analysis of the transcriptome of Isodon rubescens and key enzymes involved in terpenoid biosynthesis
Directory of Open Access Journals (Sweden)
Xiuhong Su
2016-05-01
Full Text Available Isodon rubescens is an important medicinal plant in China that has been shown to reduce tumour growth due to the presence of the compound oridonin. In an effort to facilitate molecular research on oridonin biosynthesis, we reported the use of next generation massively parallel sequencing technologies and de novo transcriptome assembly to gain a comprehensive overview of I. rubescens transcriptome. In our study, a total of 50,934,276 clean reads, 101,640 transcripts and 44,626 unigenes were generated through de novo transcriptome assembly. A number of unigenes – 23,987, 10,263, 7359, 18,245, 17,683, 19,485, 9361 – were annotated in the National Center for Biotechnology Information (NCBI non-redundant protein (Nr, NCBI nucleotide sequences (Nt, Kyoto Encyclopedia of Genes and Genomes (KEGG Orthology (KO, Swiss-Prot, protein family (Pfam, gene ontology (GO, eukaryotic ortholog groups (KOG databases, respectively. Furthermore, the annotated unigenes were functionally classified according to the GO, KOG and KEGG. Based on these results, candidate genes encoding enzymes involved in terpenoids backbone biosynthesis were detected. Our data provided the most comprehensive sequence resource available for the study on I. rubescens, as well as demonstrated the effective use of Illumina sequencing and de novo transcriptome assembly on a species lacking genomic information.
Directory of Open Access Journals (Sweden)
Kyle A Pelot
Full Text Available Plants produce an immense diversity of natural products (i.e. secondary or specialized metabolites that offer a rich source of known and potentially new pharmaceuticals and other desirable bioproducts. The Traditional Chinese Medicinal plant Isodon rubescens (Lamiaceae contains an array of bioactive labdane-related diterpenoid natural products. Of these, the ent-kauranoid oridonin is the most prominent specialized metabolite that has been extensively studied for its potent antimicrobial and anticancer efficacy. Mining of a previously established transcriptome of I. rubescens leaf tissue identified seven diterpene synthase (diTPSs candidates. Here we report the functional characterization of four I. rubescens diTPSs. IrTPS5 and IrTPS3 were identified as an ent-copalyl diphosphate (CPP synthase and a (+-CPP synthase, respectively. Distinct transcript abundance of IrTPS5 and the predicted ent-CPP synthase IrTPS1 suggested a role of IrTPS5 in specialized ent-kaurene metabolism possibly en route to oridonin. Nicotiana benthamiana co-expression assays demonstrated that IrTPS4 functions sequentially with IrTPS3 to form miltiradiene. In addition, IrTPS2 converted the IrTPS3 product (+-CPP into the hydroxylated tricyclic diterpene nezukol not previously identified in I. rubescens. Metabolite profiling verified the presence of nezukol in I. rubescens leaf tissue. The proposed IrTPS2-catalyzed reaction mechanism proceeds via the common ionization of the diphosphate group of (+-CPP, followed by formation of an intermediary pimar-15-en-8-yl+ carbocation and neutralization of the carbocation by water capture at C-8 to yield nezukol, as confirmed by nuclear magnetic resonance (NMR analysis. Oxygenation activity is rare for the family of class I diTPSs and offers new catalysts for developing metabolic engineering platforms to produce a broader spectrum of bioactive diterpenoid natural products.
Directory of Open Access Journals (Sweden)
Sen Guo
2017-04-01
Full Text Available Rabdosia rubescens is a healthy herbal tea and well-known Chinese medicinal herb. To evaluate the quality of R. rubescens from China, a high performance liquid chromatography method with dual-wavelength detection was developed and validated. The method was successfully applied for the simultaneous characterization and quantification of 17 main constituents from four different cultivation regions in China. Under optimal conditions, analysis was performed on a Luna C-18 column and gradient elution with a solvent system of acetonitrile and 0.5% (v/v acetic acid–water at a flow rate of 1.0 mL/min and wavelength of 220 nm and 280 nm. All standard calibration curves exhibited good linearity (r2 > 0.9992 within the test ranges. The precision was evaluated by intraday and interday tests, which revealed relative standard deviation values within the ranges of 0.57–2.35% and 0.52–3.40%, respectively. The recoveries were in the range of 96.37–101.66%. The relative standard deviation values for stability and repeatability were < 5%. The contents of some compounds were low and varied with different cultivars. The proposed method could serve as a prerequisite for quality control of R. rubescens materials and products.
Directory of Open Access Journals (Sweden)
Mingsan Miao
2017-05-01
Full Text Available The effect of the Rabdosia rubescens total flavonoids on focal cerebral ischemia reperfusion model in rats was observed. The model group, nimodipine group, cerebral collateral group, and large, medium and small dose group of the Rabdosia rubescens total flavonoids were administered with corresponding drugs but sham operation group and model group were administered the same volume of 0.5%CMC, 1 times a day, continuous administration of 7 d. After 1 h at 7 d to medicine, left incision in the middle of the neck of rats after anesthesia, we can firstly expose and isolate the left common carotid artery (CCA, and then expose external carotid artery (ECA and internal carotid artery (ICA. The common carotid artery and the external carotid artery are ligated. Then internal carotid artery with arterial clamp is temporarily clipped. Besides, cut the incision of 0.2 mm from 5 cm of the bifurcation of the common carotid artery. A thread Line bolt is inserted with more than 18–20 mm from bifurcation of CCA into the internal carotid artery until there is resistance. Then the entrance of the middle cerebral artery is blocked and internal carotid artery is ligated (the blank group only exposed the left blood vessel without Plugging wire. Finally it is gently pulled out the plug line after 2 h. Results: Compared with the model mice, Rabdosia rubescens total flavonoids can significantly relieve the injury of brain in hippocampus and cortex nerve cells; experimental rat focal cerebral ischemia was to improve again perfusion model of nerve function defect score mortality; significantly reduce brain homogenate NOS activity and no content, MDA, IL-1, TNF-a, ICAM-1 content; increase in brain homogenate SOD and ATPase activity (P < 0.05, P < 0.01; and reduce the serum S-100β protein content. Each dose group of the Rabdosia rubescens total flavonoids has a better Improvement effect on focal cerebral ischemia reperfusion model in rats.
Directory of Open Access Journals (Sweden)
ChunYue Yu
2011-09-01
Full Text Available Semi-preparative high-speed counter-current chromatography (HSCCC was successfully used for isolation and purification of oridonin from Isodon rubescens by using a two-phase-solvent system composed of n-hexane-ethyl acetate-methanol-water (2.8:5:2.8:5, v/v/v/v. The targeted compound isolated, collected and purified by HSCCC was analyzed by high performance liquid chromatography (HPLC. A total of 40.6 mg of oridonin with the purity of 73.5% was obtained in less than 100 min from 100 mg of crude Isodon rubescens extract. The chemical structure of the compound was identified by IR, 1H-NMR and 13C-NMR.
Antinociceptive effect of critoniella acuminata, physalis peruviana and salvia rubescens
Munóz, Carol; Vergel, Nadezdha E.; Aragón, Diana Marcela; Ospina, Luis Fernando
2010-01-01
Se evaluó el efecto antinociceptivo de extractos, fracciones y compuestos de Critoniella acuminata, Physalis peruviana y Salvia rubescens mediante los métodos de placa caliente, contorsiones abdominales inducidas por ácido acético y ensayo de la formalina. La fracción de Critoniella acuminata en dosis de 100 mg/kg p.o. presentó actividad antinociceptiva al aumentar el tiempo de reacción del animal ante la aplicación de un estímulo térmico (método de la placa caliente), mient...
A New Asymmetric ent-Kauranoid Dimer from Rabdosia rubescens
Institute of Scientific and Technical Information of China (English)
LU Hai-ying; LIANG Jing-yu
2012-01-01
Objective To study the ent-kaurane diterpenoids from Rabdosia rubescens.Methods The compounds were isolated by chromatographies and their structures were identified by spectral analyses.Results Four compounds were isolated,and they were identified as bisrubescensin E (1),2α,3α,24-trihydroxyurs-12-en-28-oic acid (2),2α,3α,24-trihydroxyurs-12,20-(30)-dien-28-oic acid (3),and 6,7-dihydroxycoumarin (4).Conclusion Compound 1 is a new asymmetric ent-kauranoid dimer.Compound 2 is isolated from the plant for the first time.Compounds 3 and 4 are isolated from the plants ofRabdosia (B1.) Hassk for the first time.
Directory of Open Access Journals (Sweden)
Wang Y
2015-11-01
Full Text Available Yuji Wang,1 Jingcheng Tang,1 Haimei Zhu,1 Xueyun Jiang,1 Jiawang Liu,1 Wenyun Xu,1 Haiping Ma,1 Qiqi Feng,1 Jianhui Wu,1 Ming Zhao,1,2 Shiqi Peng1 1Beijing Area Major Laboratory of Peptide and Small Molecular Drugs, Engineering Research Center of Endogenous Prophylactic of Ministry of Education of China, Beijing Laboratory of Biomedical Materials, College of Pharmaceutical Sciences, Capital Medical University, Beijing, People’s Republic of China; 2Faculty of Biomedical Science and Environmental Biology, Kaohsiung Medical University, Kaohsiung, Taiwan Abstract: The hot water extract of Rabdosia rubescens was traditionally used as an antithrombotic medicine. To explore its antithrombotic utility and mechanism, we carried out a series of in vitro and in vivo assays in this study. In vitro platelet aggregation assay showed that the half maximal inhibitory concentration values of aqueous extract of R. rubescens leaves (AERL inhibiting platelet aggregation induced by thrombin, arachidonic acid, adenosine diphosphate, and platelet-activating factor ranged from 0.12 mg/mL to 1.43 mg/mL. The minimal effective oral dose of AERL inhibiting the rats from forming thrombus was 25 mg/kg. Both in vitro and in vivo actions were correlated with AERL concentration-dependently inhibiting sP-selectin release. In water, AERL formed nanoparticles, and their size depended on the concentration. Docking the five nucleotides, 21 phenolic acids, and four diterpenoids identified by high-performance liquid chromatography–photodiode array detector/(-electrospray ionization-tandem mass spectrometry analysis into the active site of P-selectin, rosmarinic acid was predicted to be the antithrombotic ingredient of AERL. In flow cytometry analysis, 1 µM of rosmarinic acid effectively inhibited sP-selectin release in arachidonic acid-activated platelets. In a rat model, 5 mg/kg of oral rosmarinic acid effectively inhibited thrombosis. Keywords: R. rubescens, s
Effect of total flavonoid in rabdosia rubescens on tolerant mice models under cerebral anoxia
Directory of Open Access Journals (Sweden)
Le Kang
2017-12-01
Conclusion: The total flavonoid in rabdosia rubescens can stimulate an endogenous protective mechanism by inducing the release of low levels of cytokines NO and NOS, which reduces the release of serum NSE, relieves the brain tissue ischemia-reperfusion injury, and further improves the protection effect of ischemic preconditioning on brain injury. The damage of brain tissue ischemia and reperfusion, and further improve the ischemia Protective effect of preconditioning on brain injury.
Barnard, Sandra; Conradie, Karin Ronel
2012-01-01
The South African impoundments of Hartbeespoort and Roodeplaat experience excessive blooms of Microcystis species each year. Microcystins, produced primarily by strains of cyanobacteria belonging to the genera Microcystis, Anabaena and Planktothrix, are harmful cyanobacterial hepatotoxins. These bloom-forming cyanobacteria form toxic and non-toxic strains that co-occur and are visually indistinguishable, but can be identified and quantified molecularly. We described the relationships between ...
Van de Waal, D.B.; Ferreruela, G.; Tonk, L.; Van Donk, E.; Huisman, J.; Visser, P.M.; Matthijs, H.C.P.
2010-01-01
Planktothrix agardhii is a widespread harmful cyanobacterium of eutrophic waters, and can produce the hepatotoxins [Asp3]microcystin-LR and [Asp3]microcystin-RR. These two microcystin variants differ in their first variable amino acid position, which is occupied by either leucine (L) or arginine
van de Waal, D.B.; Ferreruela, G.; Tonk, L.; van Donk, E.; Huisman, J.; Visser, P.M.; Matthijs, H.C.P.
2010-01-01
Planktothrix agardhii is a widespread harmful cyanobacterium of eutrophic waters, and can produce the hepatotoxins [Asp3]microcystin-LR and [Asp3]microcystin-RR. These two microcystin variants differ in their first variable amino acid position, which is occupied by either leucine (L) or arginine
International Nuclear Information System (INIS)
Triana Gomez, Max Alejandro; Gonzalez Roso, Gladis; Paspur Posso, Segundo Demetrio
2008-01-01
The technical recommendations of the Pan-American Committee of Technical Norms COPANT were applied for carrying out technological tests of tangential static flexion, parallel compression, tangential parallel shear, radial parallel shear, tangential impact, and radial impact in the wood of Brosimum rubescens Taub. (Moraceae) coming from Leticia, state of Amazonas, Colombia. The statistical analysis was made based on the arithmetic mean, the standard deviation and the variation coefficient to obtain representativeness. Results were adjusted to 12% of content of humidity. The mechanical properties of the wood were also classified, and its possible uses determined. The wood of B. rubescens exhibited the best response to the static flexion effort. According to the ASTM classification, the elasticity module (MOE) and the Maximum Unitary Effort corresponded to the Very High range, while the Proportional Limit Effort to the Middle range. The Maximum Unitary Effort and Proportional Limit Effort obtained for the parallel compression were assigned to the High and Medium ranges, respectively, while the tangential shear matched the High range. The less favorable response was found for the radial shear effort and the impact in the tangential and radial planes that corresponded to the Medium range. It was found that the most appropriate uses of the wood were: interior finishes, external finishes, athletic and sport articles, hand crafts, ends for tools, joinery, furniture, chassis, piles, musical instruments, construction, arches for violin and similar musical instruments, breeches for weapons, structures, mischievous, keels, floors and beams.
Manganelli, Maura; Stefanelli, Mara; Vichi, Susanna; Andreani, Paolo; Nascetti, Giuseppe; Scialanca, Fabrizio; Scardala, Simona; Testai, Emanuela; Funari, Enzo
2016-06-01
Vico Lake, a volcanic meso-eutrophic lake in Central Italy, whose water is used for drinking and recreational activities, experienced the presence of the microcystins (MC) producing cyanobacterium Planktothrix rubescens. In order to assess the human health risks and to provide the local health authorities with a scientific basis for planning tailored monitoring activities, we studied P. rubescens ecology and toxicity for two years. P. rubescens generally dominated the phytoplankton community, alternating with Limnothrix redekei, potentially toxic. P. rubescens was distributed throughout the water column during winter; in summer it produced intense blooms where drinking water is collected (-20 m); here MC were detected all year round (0.5-5 μg/L), with implications for drinking water quality. In surface waters, MC posed no risk for recreational activities in summer, while in winter surface blooms and foams (containing up to 56 μg MC/L) can represent a risk for people and children practicing water sports and for animals consuming raw water. Total phosphorus, phosphate and inorganic nitrogen were not relevant to predict densities nor toxicity; however, a strong correlation between P. rubescens density and aminopeptidase ectoenzymatic activity, an enzyme involved in protein degradation, suggested a role of organic nitrogen for this species. The fraction of potentially toxic population, determined both as mcyB(+)/16SrDNA (10-100%) and as the MC/mcyB(+) cells (0.03-0.79 pg MC/cell), was much more variable than usually observed for P. rubescens. Differently from other Italian and European lakes, the correlation between cell density or the mcyB(+) cells and MC explained only ∼50 and 30% of MC variability, respectively: for Vico Lake, monitoring only cell or the mcyB(+) cell density is not sufficient to predict MC concentrations, and consequently to protect population health. Finally, during a winter bloom one site has been sampled weekly, showing that
Detection of a Planktothrix agardhii Bloom in Portuguese Marine Coastal Waters
Directory of Open Access Journals (Sweden)
Catarina Churro
2017-12-01
Full Text Available Cyanobacteria blooms are frequent in freshwaters and are responsible for water quality deterioration and human intoxication. Although, not a new phenomenon, concern exists on the increasing persistence, scale, and toxicity of these blooms. There is evidence, in recent years, of the transfer of these toxins from inland to marine waters through freshwater outflow. However, the true impact of these blooms in marine habitats has been overlooked. In the present work, we describe the detection of Planktothrix agardhii, which is a common microcystin producer, in the Portuguese marine coastal waters nearby a river outfall in an area used for shellfish harvesting and recreational activities. P. agardhii was first observed in November of 2016 in seawater samples that are in the scope of the national shellfish monitoring system. This occurrence was followed closely between November and December of 2016 by a weekly sampling of mussels and water from the sea pier and adjacent river mouth with salinity ranging from 35 to 3. High cell densities were found in the water from both sea pier and river outfall, reaching concentrations of 4,960,608 cells·L−1 and 6810.3 × 106 cells·L−1 respectively. Cultures were also established with success from the environment and microplate salinity growth assays showed that the isolates grew at salinity 10. HPLC-PDA analysis of total microcystin content in mussel tissue, water biomass, and P. agardhii cultures did not retrieve a positive result. In addition, microcystin related genes were not detected in the water nor cultures. So, the P. agardhii present in the environment was probably a non-toxic strain. This is, to our knowledge, the first report on a P. agardhii bloom reaching the sea and points to the relevance to also monitoring freshwater harmful phytoplankton and related toxins in seafood harvesting and recreational coastal areas, particularly under the influence of river plumes.
Morpho-physiological effects of ibuprofen on Scenedesmus rubescens.
Moro, Isabella; Matozzo, Valerio; Piovan, Anna; Moschin, Emanuela; Vecchia, Francesca Dalla
2014-09-01
The pollution of aquatic bodies by drugs is an emerging environmental problem, because of their extensive use in animal and human context. Ibuprofen, 2-[4-(2-methylpropyl)phenyl]propanoic acid, is the non-steroidal anti-inflammatory drug mainly present both in wastewater and in rivers and lakes in Europe. Since in literature there is little information about the effects of ibuprofen on microalgae, in this paper we presented the results on the effects of this molecule at different concentrations (62.5μgL(-1), 250μgL(-1) and 1000μgL(-1)) on cultures of the freshwater microalga Scenedesmus rubescens (P.J.L. Dangeard) E. Kesslet et al. Ibuprofen effects on the alga were assayed at first through analyses of the growth curve. Moreover, analyses of cell morphology, ultrastructure, and photosynthetic pigments were additionally performed. The first negative effect of the drug was on the microalga growth, suggesting a drug action dose-dependent mechanism type, more evident at the concentration of 1000μgL(-1) ibuprofen and in the last phase of the growth curve. In support of this, following ibuprofen exposure, the cells exhibited morphological and ultrastructural alterations, mainly consisting in large cytoplasmic inclusions, probably of lipids and/or carotenoids. The decrease of chlorophyll amounts and, on the contrary, the increase of carotenoids were correlated with a stressful condition induced by drug. Copyright © 2014 Elsevier B.V. All rights reserved.
Li, Ping; Lin, Junda
2012-05-01
The effects of ultraviolet radiation (UVR) and nitrogen (NaNO(3)) concentration on photosynthesis, biomass, and fatty acid content and profile of a Scenedesmus rubescens-like microalga were measured in an outdoor 8-day culture study. UV-induced photoinhibition decreased from 42.6% to 3.5%, in the presence of 75 mg/L NaNO(3) (HN) and from 52.9% to 22.6% in the presence of 7.5mg/L NaNO(3) (LN) nitrogen concentration, respectively. The concentrations of UV-absorbing compounds increased 4.3 and 4.9 times under HN and LN, respectively. Biomass accumulation was suppressed (10.7%) by UVR under HN, but not under LN conditions. Carotenoid content decreased from 1.05 ± 0.06 to 0.96 ± 0.15 (with UV radiation) and to 0.91 ± 0.07 (without UV radiation), respectively, under HN, while it decreased to 0.05 ± 0.04 (with UV radiation) and to 0.11 ± 0.08 (without UV radiation), respectively, under LN. The content of C18:1n9 fatty acids increased by about 430%, whereas that of C18:3n3 decreased by about 65% in both radiation treatments during nitrogen starvation. The results showed that the absence of UVR screening does not change the fatty acid content and profile of S. rubescens-like algae cultivated outdoors under HN and LN conditions. Copyright © 2012 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Lei Xi
2018-07-01
Full Text Available Objective: To study the effects of Rabdosia rubescens combined with neoadjuvant chemotherapy on serum CA199, CEA, CA15-3 levels and T lymphocyte subsets in patients with breast cancer. Methods: A total of 70 patients with breast cancer in our hospital were enrolled as the subjects of this study. The subjects were divided into control group (n=35 and treatment group (n=35 randomly. Patients in the control group were treated with new assistant chemotherapy, while those who were in the treatment group were treated with rabdosia rubescens combined with new assistant chemotherapy. The two groups of patients were treated for 3 periods. The serum CA199, CEA, CA15-3 levels and peripheral blood CD4+, CD8+, CD4+/CD8+ cells of the two groups before and after treatment were compared. Results: There were no significantly differences among the serum CA199, CEA, CA15-3 levels and peripheral blood CD4+, CD8+, CD4+/CD8+ cells of the two groups before treatment. The serum CA199, CEA and CA15-3 levels of the two groups after treatment were significantly lower than those before treatment, besides, the serum CA199, CEA and CA15-3 levels of the treatment group were significantly lower than those of the control group. The peripheral blood CD4+, CD4+/ CD8+ cells of the control group after treatment were significantly lower than before treatment, and the peripheral blood CD4+, CD4+/CD8+ cells of the treatment group after treatment were significantly higher than those of the control group. Conclusion: Rabdosia rubescens combined with new assistant chemotherapycan can significantly reduce the serum CA199, CEA and CA15-3 levels, and improve peripheral blood CD4+, CD8+, CD4+/CD8+ levels of patients with breast cancer. It is worthy of clinical application.
Directory of Open Access Journals (Sweden)
Willian Hayasida
2011-01-01
Full Text Available Estudos fitoquímicos prévios com resíduos do cerne de pau-rainha (Brosimum rubescens, identificaram um alto teor de xantiletina, uma cumarina com potencial biológico. Dando prosseguimento aos estudos com serragens desta espécie, este estudo relata a densidade básica bem como o isolamento e identificação do triterpeno 3β-acetoxi-olean-12-eno-28-al e do β- sitosterol nos extratos hexânico e metanólico do alburno da planta. A estrutura do triterpeno foi determinada com base nos espectros de RMN em 1D (¹H e 13C e 2D (HSQC e HMBC além de comparação com dados da literatura. A densidade básica encontrada para o alburno foi de 0,58 g cm-3 que, embora seja inferior a do cerne, poderá ser utilizada na confecção de vários produtos, inclusive em técnicas de marchetaria.Previous phytochemical studies on residues of pau-rainha’s heartwood (Brosimum rubescens showed a high content of xanthyletin, a coumarin with biological potential. Continuing our studies with sawdust of this species, this work relates the basic density, isolation and identification of the triterpene 3β-acetoxy-olean-12-ene-28-al and β-sitosterol in n-hexane and MeOH extracts of the plant´s sapwood. The structure of the triterpene was determined on the basis of NMR spectra in 1D (¹H and 13C and 2D (HSQC and HMBC and comparison with literature data. The basic density found for sapwood was 0.58 g cm-3, that even so is inferior the one of heartwood, could be used in the confection of some products, also in marquetry techniques.
Directory of Open Access Journals (Sweden)
Alessandro OGGIONI
2006-02-01
Full Text Available This study reports the first preliminary results of the DYRESM-CAEDYM model application to a mid size sub-alpine lake (Lake Pusiano North Italy. The in-lake modelling is a part of a more general project called Pusiano Integrated Lake/Catchment project (PILE whose final goal is to understand the hydrological and trophic relationship between lake and catchment, supporting the restoration plan of the lake through field data analysis and numerical models. DYRESM is a 1D-3D hydrodynamics model for predicting the vertical profile of temperature, salinity and density. CAEDYM is multi-component ecological model, used here as a phytoplankton-zooplankton processes based model, which includes algorithms to simulate the nutrient cycles within the water column as well as the air-water gas exchanges and the water-sediments fluxes. The first results of the hydrodynamics simulations underline the capability of the model to accurately simulate the surface temperature seasonal trend and the thermal gradient whereas, during summer stratification, the model underestimates the bottom temperature of around 2 °C. The ecological model describes the epilimnetic reactive phosphorus (PO4 depletion (due to the phytoplankton uptake and the increase in PO4 concentrations in the deepest layers of the lake (due to the mineralization processes and the sediments release. In terms of phytoplankton dynamics the model accounts for the Planktothrix rubescens dominance during the whole season, whereas it seems to underestimate the peak in primary production related to both the simulated algal groups (P. rubescens and the rest of the other species aggregated in a single class. The future aims of the project are to complete the model parameterization and to connect the in-lake and the catchment modelling in order to gain an integrated view of the lake-catchment ecosystem as well as to develop a three dimensional model of the lake.
Medvedeva, Nadezda; Zaytseva, Tatyana; Kuzikova, Irina
2017-07-01
Nonylphenol (NP) is extensively used in agricultural, industrial and household applications. Moreover, NP is the major breakdown product of the nonionic surfactants, nonylphenol ethoxylates (NPEOs), the most widely used group of surfactants. Nonylphenol is persistent in the environment, highly toxic to aquatic organisms and is a potential endocrine disruptor. NP and NPEOs have been identified as priority hazardous substances under the Environmental Quality Standards Directive 2013/39/EU and are referred to in the list of substances of particular risk to the Baltic Sea. The toxicity of NP to the bloom-forming cyanobacterium Planktothrix agardhii 1113 isolated from the eastern Gulf of Finland, Baltic Sea and the bioremoval of NP by P. agardhii were studied. NP in concentrations > 0.4 mg L- 1 suppressed cyanobacterial growth. The median effective concentration of NP for P. agardhii after 4 days of treatment (EC50) was 1.5 mg L- 1. The removal of NP from the culture medium was primarily due to abiotic processes and biodegradation by the cyanobacterium rather than sorption by the cells. NP significantly increased the photosynthetic pigments, extracellular proteins and soluble exopolysaccharides content. The cyanobacterial growth inhibition was accompanied by the increased synthesis of microcystin dm-RR and of the odorous metabolites, geosmin and 2-methylisoborneol (MIB), by P. agardhii 1113. NP also notably increased the microcystin released into the environment. Increased levels of extracellular proteins, soluble exopolysaccharides, microcystins and odorous metabolites may affect the microbial loop in aquatic ecosystems. An increased level of malondialdehyde (MDA) was indicative of the formation of free radicals in P. agardhii under NP stress, whereas increased levels of superoxide dismutase (SOD), catalase (CAT), reduced glutathione (GSH) and proline indicated the occurrence of a scavenging mechanism.
Directory of Open Access Journals (Sweden)
Zorica Svirčev
2017-05-01
Full Text Available The presence of toxic cyanobacteria in aquatic ecosystems in the territory of the Republic of Serbia was surveyed over a period of several decades. Increasing attention is being paid to some negative consequences that may be caused by these microorganisms. Information from available literary sources regarding the distribution and frequency of cyanobacteria and their toxins over a period of 130 years, together with the effects on humans and wildlife in aquatic ecosystems, were gathered and incorporated into a Serbian Cyanobacterial Database created for the CYANOCOST Action. This database encompasses information on 65 aquatic ecosystems, including rivers, lakes, ponds, canals, irrigation reservoirs, reservoirs used for drinking water supply and reservoirs used for other purposes. Cyanobacterial blooms were found in almost 80% of the investigated aquatic ecosystems. The analysis of the research showed the presence of more than 70 species, including blooms of 24 species from 13 genera. Five species of cyanobacteria: Microcystis aeruginosa, Aphanizomenon flos-aquae, Planktothrix agardhii, Microcystis flos-aquae and Planktothrix rubescens frequently formed blooms in the investigated waterbodies and cyanotoxins were also detected in some of them, which had certain negative effects. Here, we present an overview of data contained in the Serbian Cyanobacterial Database, concerning cyanobacterial distribution, cyanotoxin production and associated biological effects in different types of water bodies from the Republic of Serbia. Also, recent important and major cases of cyanobacterial blooming in reservoirs used for drinking water supply: at Vrutci and Ćelije, the Aleksandrovac irrigation reservoir, the Ponjavica River and Lake Palić, including systematic research on the Lake Ludoš and few fishponds are further described. It can be concluded that cyanobacteria and cyanotoxins are omnipresent in different water bodies throughout the Republic of Serbia
Directory of Open Access Journals (Sweden)
Cristine da Silva Autran
2006-09-01
Full Text Available Ainda que recente, a técnica para a determinação da cor da madeira por meio da colorimetria quantitativa mostra-se precisa e eficaz. O sistema CIELAB 1976, que determina os parâmetros colorimétricos L*, a*, b*, C e h*, mostrou-se eficiente para a determinação da cor das madeiras de muirapiranga (Brosimum rubescens e de seringueira (Hevea brasiliensis, clone Tjir 16. A madeira de muirapiranga é de cor vermelha-amarronzada (L* de 42,39, tendo o pigmento vermelho (a* de 22,02 como determinante, apesar de o pigmento amarelo (b* ter influência significativa na definição de sua cor. A madeira de seringueira apresenta cor amarela (L* de 77,55, fortemente influenciada pelo pigmento amarelo (b* de 19,61. Considerando o parâmetro cor, ambas as madeiras apresentam potenciais para serem utilizadas em interiores.
Directory of Open Access Journals (Sweden)
Pierisa PANZANI
2002-02-01
Full Text Available The main goal of the study presented here is to identify a repeatable pattern in the seasonal succession of phytoplankton assemblages in Lago Maggiore. In order to fulfil this objective we analysed the phytoplaktonic succession during a five years period (1995-1999, through the calculation of the Bray-Curtis similarity index applied to biovolume data. A cluster analysis has been then applied to the distance matrix, allowing the identification of sample clusters possessing a similar species composition. The comparison, through the whole period considered, of the phytoplankton assemblages characterising each cluster allowed to recognise six seasonal periods (Winter, Early Spring, Late Spring, Early Summer, Late Summer, Autumn, each of them characterised by a peculiar and repeatable species assemblage. Among the most interesting findings we would mention the existence of a Late Spring/Early Summer association, dominated by Planktothrix rubescens and Fragilaria crotonensis, probably peculiar of the deep subalpine lakes, where these species can better take advantage of the physical and chemical environment of the metalimnetic niche. The identification of a pool of dominant and sub-dominant species common to other southern subalpine lakes and the existence of a similar time periodicity in the development and decline of most of them across this lake district seem to be promising in order to give our results a wider application.
Lance, Emilie; Paty, Chrystelle; Bormans, Myriam; Brient, Luc; Gérard, Claudia
2007-03-30
Hepatotoxins are frequently produced by many cyanobacterial species. Microcystins (MCs) are the most frequent and widely studied hepatotoxins, with potentially hazardous repercussions on aquatic organisms. As a ubiquitous herbivore living in eutrophic freshwaters, the snail Lymnaea stagnalis (Gastropoda: Pulmonata) is particularly exposed to cyanobacteria. The toxic filamentous Planktothrix agardhii is common in temperate lakes and is therefore, a potential food resource for gastropods. In the first part of this study, we demonstrated the ingestion of toxic P. agardhii by L. stagnalis during a 5 weeks exposure, with concomitant accumulation of, on average, 60% of total MCs ingested. After 3 weeks of non-toxic food (lettuce), approximately 90% of MCs were eliminated from tissues. Here, we investigate the impact of toxic P. agardhii consumption on the life-history traits (survival, growth and fecundity), locomotion and the structure of digestive and genital glands of juvenile and adult L. stagnalis. We observed a decrease of growth regardless of age, although this was more marked in juveniles, and a reduction of fecundity in adults. Survival and locomotion were not affected. Reduction of growth and fecundity continued to be observed even after feeding of non-toxic food for 3 weeks. The structure of the digestive gland was altered during the intoxication period but not irreversibly as cells tended to recover a normal status after the 3-week detoxification period. No histopathological changes occurred in the genital gland and oocytes, and spermatozoids were present in the gonadic acini. The density of cyanobacterial suspensions used in this study was comparable to those regularly observed in lakes, particularly in eutrophic waters. These results are discussed in terms of the negative impact of toxic cyanobacteria on natural communities of freshwater gastropods, and potential cascading effects on the equilibrium and functioning of the ecosystem.
Phylogenetic insights into the diversity of homocytous cyanobacteria from Amazonian rivers.
Genuário, Diego Bonaldo; Vaz, Marcelo Gomes Marçal Vieira; Melo, Itamar Soares de
2017-11-01
The Amazon Rainforest holds great tropical biodiversity, mainly because of its favourable climatic conditions. The high temperatures, luminosity and humidity coupled with the nutritional simplicity of cyanobacteria allow undiscovered diversity to flourish within this group of microorganisms. Some efforts to reveal this diversity have been attempted; however, most were focused on the microscopic observation of environmental samples without any genetic information. Very few studies focusing on morphological, ecological and molecular criteria have been conducted, and none have been devoted to homocytous cyanobacteria forms in Amazonia region. Therefore, the genetic relationships amongst strains retrieved from this ecosystem with regard to other environments from Brazil and the world have not been tested and, consequently, the Amazonian strains would naturally be assumed as novel to science. To examine these relationships, cultured homocytous cyanobacteria isolated from two Amazonian rivers (Amazonas and Solimões) were evaluated using a phylogenetic perspective, considering the 16S rRNA gene sequence. A total of eleven homocytous cyanobacterial strains were isolated. Morphologically, they were identified as Pseudanabaena, Leptolyngbya, Planktothrix and Phormidium, but genetically they were included in the typical clusters of Planktothrix, Pseudanabaena, Cephalothrix, Pantanalinema and Alkalinema. These three latter genera have been detected in other Brazilian ecosystems only (Pantanal, Atlantic Rainforest and Pampa), while those remaining have been extensively found in many parts of the world. The data provided here indicate that Amazonian rivers support a homocytous cyanobacterial diversity previously reported from other geographical and ecological environments. Copyright © 2017 Elsevier Inc. All rights reserved.
ВПЛИВ ДЖЕРЕЛА НІТРОГЕНУ НА ХIМIЧНЕ ЗВ’ЯЗУВАННЯ КУПРУМУ ЕКТОМIКОРИЗНИМ ГРИБОМ RHIZOPOGON RUBESCENS
Фомiна, М. О.
2013-01-01
Aim. The aim of this work was to study the effects of nitrogen source on the speciation of copper accumulated by fungi and ectomycorrhizas grown in the presence of copper phosphate. Materials and Methods. Ectomycorrhizal fungus Rhizopogon rubescens and its symbiotic ectomycorrhizal association with Scots Pine were grown in the presence of copper phosphate at different nitrogen sources: either ammonium or nitrate. The coordination of copper released from copper phosphate and bioaccumulated by ...
Stelzer, Erin A.; Loftin, Keith A.; Struffolino, Pamela
2013-01-01
Water samples were collected from Maumee Bay State Park Lakeside Beach, Oregon, Ohio, during the 2012 recreational season and analyzed for selected cyanobacteria gene sequences by DNA-based quantitative polymerase chain reaction (qPCR) and RNA-based quantitative reverse-transcription polymerase chain reaction (qRT-PCR). Results from the four DNA assays (for quantifying total cyanobacteria, total Microcystis, and Microcystis and Planktothrix strains that possess the microcystin synthetase E (mcyE) gene) and two RNA assays (for quantifying Microcystis and Planktothrix genera that are expressing the microcystin synthetase E (mcyE) gene) were compared to microcystin concentration results determined by an enzyme-linked immunosorbent assay (ELISA). Concentrations of the target in replicate analyses were log10 transformed. The average value of differences in log10 concentrations for the replicates that had at least one detection were found to range from 0.05 to >0.37 copy per 100 milliliters (copy/100 mL) for DNA-based methods and from >0.04 to >0.17 copy/100 mL for RNA-based methods. RNA has a shorter half-life than DNA; consequently, a 24-hour holding-time study was done to determine the effects of holding time on RNA concentrations. Holding-time comparisons for the RNA-based Microcystis toxin mcyE assay showed reductions in the number of copies per 100 milliliters over 24 hours. The log difference between time 2 hours and time 24 hours was >0.37 copy/100 mL, which was higher than the analytical variability (log difference of >0.17 copy/100 mL). Spearman’s correlation analysis indicated that microcystin toxin concentrations were moderately to highly related to DNA-based assay results for total cyanobacteria (rho=0.69), total Microcystis (rho=0.74), and Microcystis strains that possess the mcyE gene (rho=0.81). Microcystin toxin concentrations were strongly related with RNA-based assay results for Microcystis mcyE gene expression (rho=0.95). Correlation analysis could
Studies on the phytoplankton of the deep subalpine Lake Iseo
Directory of Open Access Journals (Sweden)
Rosario MOSELLO
2003-08-01
Full Text Available This paper reports the results of investigations carried out on the chemical characteristics and phytoplankton community of Lake Iseo. Samplings were performed on a monthly basis from 1998 to 2000. At least three main algal groups dominated the community throughout the study period. The large Bacillariophyceae were dominant mainly during late winter and early spring (Aulacoseira spp., Melosira varians, Asterionella formosa, with few species able to maintain occasional positive growth also during mid summer and/or autumn (Fragilaria crotonensis and Diatoma elongatum. The thermal stability of the water column and silica depletion were the main factors responsible for the decline of the large spring diatoms. The subsequent growth of Mougeotia sp. (Conjugatophyceae was favoured by its lower sinking rate and resistance to increasing grazing pressure by the dominant copepods (Copidodiaptomus steueri and cladocerans (Daphnia hyalina × galeata. Among the cyanobacteria, the greater development of Planktothrix rubescens in the autumn months, with conditions of vertical homogenisation and decreasing Zeu/Zmix ratios, was favoured by its ability to survive at low light irradiances. The temporal replacement of these three groups constitutes the main sequence of the annual phytoplankton succession in Lake Iseo. A large development of other algal groups was recorded only in one or two of the three study years (e.g. Dinophyceae and Chlorococcales. The changes observed in the annual phytoplankton development are discussed in the light of differences in the spring fertilisation of the waters, caused by differences in the depth of the layer involved in the late winter and spring vertical mixing.
Directory of Open Access Journals (Sweden)
Ostermaier Veronika
2012-12-01
Full Text Available Abstract Background Harmful algal blooms deteriorate the services of aquatic ecosystems. They are often formed by cyanobacteria composed of genotypes able to produce a certain toxin, for example, the hepatotoxin microcystin (MC, but also of nontoxic genotypes that either carry mutations in the genes encoding toxin synthesis or that lost those genes during evolution. In general, cyanobacterial blooms are favored by eutrophication. Very little is known about the stability of the toxic/nontoxic genotype composition during trophic change. Results Archived samples of preserved phytoplankton on filters from aquatic ecosystems that underwent changes in the trophic state provide a so far unrealized possibility to analyze the response of toxic/nontoxic genotype composition to the environment. During a period of 29 years of re-oligotrophication of the deep, physically stratified Lake Zürich (1980 to 2008, the population of the stratifying cyanobacterium Planktothrix was at a minimum during the most eutrophic years (1980 to 1984, but increased and dominated the phytoplankton during the past two decades. Quantitative polymerase chain reaction revealed that during the whole observation period the proportion of the toxic genotype was strikingly stable, that is, close to 100%. Inactive MC genotypes carrying mutations within the MC synthesis genes never became abundant. Unexpectedly, a nontoxic genotype, which lost its MC genes during evolution, and which could be shown to be dominant under eutrophic conditions in shallow polymictic lakes, also co-occurred in Lake Zürich but was never abundant. As it is most likely that this nontoxic genotype contains relatively weak gas vesicles unable to withstand the high water pressure in deep lakes, it is concluded that regular deep mixing selectively reduced its abundance through the destruction of gas vesicles. Conclusions The stability in toxic genotype dominance gives evidence for the adaptation to deep mixing of a
Directory of Open Access Journals (Sweden)
Eric S J Harris
Full Text Available Oridonin is a diterpenoid with anti-cancer activity that occurs in the Chinese medicinal plant Isodon rubescens and some related species. While the bioactivity of oridonin has been well studied, the extent of natural variation in the production of this compound is poorly known. This study characterizes natural variation in oridonin production in order to guide selection of populations of Isodon with highest oridonin yield. Different populations of I. rubescens and related species were collected in China, and their offspring were grown in a greenhouse. Samples were examined for oridonin content, genotyped using 11 microsatellites, and representatives were sequenced for three phylogenetic markers (ITS, rps16, trnL-trnF. Oridonin production was mapped on a molecular phylogeny of the genus Isodon using samples from each population as well as previously published Genbank sequences. Oridonin has been reported in 12 out of 74 species of Isodon examined for diterpenoids, and the phylogeny indicates that oridonin production has arisen at least three times in the genus. Oridonin production was surprisingly consistent between wild-collected parents and greenhouse-grown offspring, despite evidence of gene flow between oridonin-producing and non-producing populations of Isodon. Additionally, microsatellite genetic distance between individuals was significantly correlated with chemical distance in both parents and offspring. Neither heritability nor correlation with genetic distance were significant when the comparison was restricted to only populations of I. rubescens, but this result should be corroborated using additional samples. Based on these results, future screening of Isodon populations for oridonin yield should initially prioritize a broad survey of all species known to produce oridonin, rather than focusing on multiple populations of one species, such as I. rubescens. Of the samples examined here, I. rubescens or I. japonicus from Henan province
Directory of Open Access Journals (Sweden)
Everton Nei Lopes Rodrigues
2005-03-01
Full Text Available A fêmea de Sphecozone tincta Millidge, 1991 é descrita e ilustrada pela primeira vez. O macho também é ilustrado. Novos registros são fornecidos para Sphecozone cristata Millidge, 1991, S. rostrata Millidge, 1991 e S. rubescens O. P.-Cambridge, 1870.The female of Sphecozone tincta Millidge, 1991 is described and illustrated for the first time. The male also is illustrated. News records are given for Sphecozone cristata Millidge, 1991, S. rostrata Millidge, 1991 and S. rubescens O. P.-Cambridge, 1870.
Protein (Cyanobacteria): 653002134 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available thetical protein, partial Planktothrix agardhii MKFINPKTDYAFKKIFGSDQSQDILISFLNAIVYQGETFITYLEIIDPYAPGRISGLKTT...YFDVKAQLNNGENVLIEMQAFNVPAFGKRILYNTAKMYVNQLKLGEVYPELRAAIGVAVTDFIMFNEHNKVISQFTLKEDELQVNYQHSPLKLVFVELPKFNKTLEELTTITDKWLYFLRKAPDLEVVPESMLIVPEIEKAFTIADRVNLSLEEVDDLEKREQFERERIGAIELG
Protein (Cyanobacteria): 653002282 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available family transcriptional regulator Planktothrix agardhii MALYTTVSFKSELNDKGWRLTPQRETILQVFQNLPKGNHLSAEDLYTLLKSRG...EAISLSTIYRTLKLMARMGILRELELAEGHKHYEINQPYPHHHHHLVCVQCNKTLEFKNDSISKTSMKQAEKSGFHLLDCQLTIHTICHEALRMGWPSLISTNWSCSKVIADGLSEIDEIECQ
Protein (Cyanobacteria): 652997615 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available family transcriptional regulator Planktothrix agardhii MLTQDQPLTETVFLAKLNEIIESNHLLKHPFYQMWTEGKLTLTMLQEYAQEY...YLHVHNFPTYVSATHAACDDINIRKMLLENLIEEERGSAHHPELWLRFAEGLGVERSAVLDRQRLNKTQESVQILKKLSRSEEAEKGLAALYAYESQFPEVSTTKISGLEEFYGINEESALSFFKVHEKADEIHSQMTRKALLQLCQTTEQQQAALDSVQTAVDAFNLLLDGVYEEYCQN
Protein (Cyanobacteria): 652997307 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available family transcriptional regulator Planktothrix agardhii MALYTTVSFKSELNDKGWRLTPQRETILQVFQNLPKGNHLSAEDLYTLLKSRG...EVISLSTIYRTLKLMARMGILRELELAEGHKHYEINQPYPHHHHHLVCVQCNKTLEFKNDSISKTSMKQAEKSGFHLLDCQLTIHTICHEALRMGWPSLISTNWSCSKVIADGPSEIDEIECR
Protein (Cyanobacteria): 652996914 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available mine monophosphate kinase Planktothrix agardhii MLIKDIGEQGLLEIVKGFCPSEIVGDDAAILAVSGDESLVITTDMLVDEVHFSDRTTSPF...DVGWRGAAVNLSDLAAMGAFPIGITVALGITDNKTVSWVEQLYQGLTTCLNQYQTPIVGGDICRSAVTCISITAFGRVNPKLAIRRSVARPGDKIIVTGDHGDSRAGL
Protein (Cyanobacteria): 652998063 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available thetical protein, partial Planktothrix agardhii STPQGSTEDGPVAVPTQVQVQTEDGDVWQDVASPTSDNTDEKGRYYTTLSEYLERNKERH...ENRVFYCTDETTQATYIQLHTSQGLEVLFFDSFIDSHFISFLEREHTDVKFARVDAELDDNLIAKDNSPEIVDPKTNKTRSEIIKDLFTAALNKPKLTIRTESLKSEN
Protein (Cyanobacteria): 652402344 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available alamin biosynthesis protein CobW Planktothrix prolifica MANLDVETPDFVLNIPKRGMPVTIITGFLGSGKTTLLNQILKNKQDLKIAVL...VNEFGDINIDSQLLISTDDDMVELSNGCICCTINDGLLDAVYRVLEREDRIDYMVIETTGVADPLPIILTFVGTELRELTNLDSVLTVIDAEAFTPEHFDSEAAFKQIVFGDIILLNKT
Protein (Cyanobacteria): 652400470 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available rug ABC transporter ATP-binding protein Planktothrix prolifica MNWAIEVKDSASMSSLNPVVATQNLGKFYRTGFWMNQKIESLKSC...QMRQYSKGMLQRVGMAQALINNPEVVFLDEPMSGLDPMGRYQIREIILSLKAQNKTVFFNSHVLSDVEKICDRIAILAEGE
Protein (Cyanobacteria): 652402000 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available agellar biosynthesis anti-sigma factor FlgM Planktothrix prolifica MDFNFFLQSFLNGLSIGSVYAIFALGYTLVFSILGVINFAH...AINFGTATKPIMIRSVQVIIFTVCMVIVALLTYLVNKTKIGKALQAVAEDEITASLLGINPEQFIILTFFVSGFLAGLAGT
Protein (Cyanobacteria): 653003198 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available phosphoribosyl)-5-amino-4-imidazole-carboxylate carboxylase Planktothrix agardhii MNPEALQQLLESVASGQITPTDALDK...IKYFDFEPVGDFARIDHHRKLRTGFPEVIWGLNKTPEQIIKIIEVMRQRNPVVMATRIEPHVYQQLQAQIPDLRYYEIAKICAIHPDEIPRSNSTGIITILTAGTADL
Protein (Cyanobacteria): 652996447 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available phosphoribosyl)-5-amino-4-imidazole-carboxylate carboxylase Planktothrix agardhii MNPEALQQLLESVASGQITPTDALDK...IKYFDFEPVGDFARIDHHRKLRTGFPEVIWGLNKTPEQIIKIIEVMRQRNPVVMATRIEPHVYQQLQAQIPDLRYYEIAKICAIHPDEIPRSNSTGIITILTAGTADL
Protein (Cyanobacteria): 652402338 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 5-phosphoribosyl)-5-amino-4-imidazole-carboxylate carboxylase Planktothrix prolifica MNPEALQQLLESVASGQITPTDA...LDKIKYFDFEPVGDFARIDHHRKLRTGFPEVIWGLNKTPEQIIKIIEVMRQRNPVVMATRIEPHVYQQLQAQIPDLRYYEIAKICAIHPDEIPRSNSTGIITILTAGT
Protein (Cyanobacteria): 652401104 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_026796900.1 ... 1117:3511 ... 1150:51681 1301283:72812 ... 54304:1582 54307:631 ... exosortase Plankt...othrix prolifica MATSLKKLLIGTSVAVGMSAVGITPALAGSLTNATIGGTASTDYLIYGKEGNKTVVIPNSVANLQSVLDGNAVSPTG
Protein (Cyanobacteria): 652402487 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_026798282.1 ... 1117:5648 ... 1150:51942 1301283:73102 ... 54304:1817 54307:1346 ... hypothetical protein Plankt...othrix prolifica MNKTKLKFSTELRKLTTVQNPEALRAYCQSLKSQLVADPSNYAKGRYRLWLFHEVDFRDGTLSKGY
Protein (Cyanobacteria): 652402508 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_026798303.1 ... 1117:6692 ... 1150:51953 1301283:73114 ... 54304:1827 54307:1360 ... hypothetical protein Plankt...othrix prolifica MKRWKILSFQIILAALESCFLPAYSDLITNPAYINKMCQRQQDLPQIERFTVFYQQEFSSQNKTYW
Protein (Cyanobacteria): 652400769 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_026796565.1 ... 1117:6622 ... 1150:52114 1301283:73294 ... 54304:1972 54307:411 ... hypothetical protein Plankt...othrix prolifica MFPLKSYLISKRISSQAFLISVLAVFTVILTVTLDSVSLAMTHPDAARNQTVYGQELIAQSRIPTSDQPSPSSLSDIPTADTASLFQNNRYAVRVFRQENKAYVNIYDKENKTLTLNNE
Protein (Cyanobacteria): 653002693 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_027254883.1 ... 1117:2965 ... 1150:52982 1301283:74257 ... 54304:633 1160:1456 ... hypothetical protein Plankt...othrix agardhii MKTSLLILCQNRLKQKSLLQHQKTSGFTMIELLIGMIMAAVIITPILAFVVDVLQSDRKEGVKAATDQELEAATDFIKRDLSQAIYIYNKT
Protein (Cyanobacteria): 652996689 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_027249156.1 ... 1117:7027 ... 1150:51287 1301283:72374 ... 54304:1227 1160:523 ... carbonate dehydratase Plankt...othrix agardhii MNKTQQNLTISRRNLLKFGAGVAGTAVLTVGLGTKVSLFKAQPAVAQNNITPEEALKQLLEGNQRFIE
Protein (Cyanobacteria): 653003511 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_027255690.1 ... 1117:21960 ... 1150:53273 1301283:74581 ... 54304:896 1160:1705 ... hypothetical protein Plankt...othrix agardhii MIPNKTQFLSELQVDSELDLELSTDPNQSIRKFVEHKQVIKFLSEQLSEIEPDAIVEALAIHQDNMNN
Protein (Cyanobacteria): 652400912 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_026796708.1 ... 1117:53359 ... 1150:52148 1301283:73331 ... 54304:2001 54307:507 ... hypothetical protein Plankt...othrix prolifica MKTTFSWLSSYFLLTGLAISGITFLGEVRPASACTGFWGRMDPTCDHGGITNPVHMTTQDFKICNKTENSISFTLNGSLEAPLRVGYCRTYTNVILPGNVAFDASYADGYQESSYGLDDEKNYSFKLNNQGSGIDLFAD
Protein (Cyanobacteria): 652400898 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_026796694.1 ... 1117:5991 ... 1150:52142 1301283:73325 ... 54304:1998 54307:498 ... hypothetical protein Plankt...othrix prolifica MLKITLTPEQEQFLQAQLKTGKYNNPQEVISKAFKLLEKENKTELLANIPASASAKKILTEKIKEFRDNLENTQNQPLNPEREKLSREVKELFDKTQSIPGIGDITEEEIAAEIEA
Protein (Cyanobacteria): 653002319 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_027254510.1 ... 1117:7257 ... 1150:51123 1301283:72193 ... 54304:108 1160:168 ... hypothetical protein Plankt...othrix agardhii MNSVEELARLQKRFQEAAKVIDDLSRIKQELDQLSKSYKDKLSNNSFELSQTKQEIDSLSINHKEYKKYWHETFNAIHNKTENILTQISQIENKT
Protein (Cyanobacteria): 652998182 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_027250437.1 ... 1117:53495 ... 1150:52763 1301283:74014 ... 54304:436 1160:1265 ... hypothetical protein Plankt...othrix agardhii MIVMPPPPPAIVSQVPHQAIFRDDFSRGCPGYSQAENQQIGNTAANHLAGITKNKTDSLVIFFTREFT
Protein (Cyanobacteria): 653002604 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_027254794.1 ... 1117:7880 ... 1150:53167 1301283:74463 ... 54304:80 1160:53 ... hypothetical protein Plankt...othrix agardhii MEFEQALEVVNNAIAPKIARTLTEVEVALLFGAWNNLTYDRIAERSGYSINYLQRDIGPKFWKFLSEALGRKVNKT
Protein (Cyanobacteria): 652401088 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_026796884.1 ... 1117:41752 ... 1150:52182 1301283:73369 ... 54304:2032 54307:622 ... hypothetical protein Plankt...othrix prolifica MNTNDEDQSISNIKRKLLEQINTLKCEDERMYNILAIDVWALAKTMDEFQPGFWGAFMKNREKALKRFLAESAKNKTDTDSKRPPFLR
Protein (Cyanobacteria): 652402883 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_026798668.1 ... 1117:7321 ... 1150:52735 1301283:73983 ... 54304:410 54307:1082 ... hypothetical protein Plankt...othrix prolifica MHGGFYCTDETTQATYIQLHTSQGLEVLFFDSFIDSHFISFLEREHTDVKFARVDAELDDNLIAKDNSPEIVDPKTNKT
Protein (Cyanobacteria): 653003418 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_027255601.1 ... 1117:6743 ... 1150:53326 1301283:74640 ... 54304:943 1160:195 ... hypothetical protein Plankt...othrix agardhii MVQILNKTLSLEDFLNLPETKPANEYINGQIIQKPMPQGKHSKLQGKLVTVINNMAEEQAIALALPELRC
Protein (Cyanobacteria): 652400421 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_026796217.1 ... 1117:3298 ... 1150:52043 1301283:73215 ... 54304:1908 54307:20 ... hypothetical protein Plankt...othrix prolifica MPTFFPEGKTININGEVELLAFQCQDTVVQLAAIAPGAIFPLHQHTESQIGMIFNGNLEMNLNGNKTV
Protein (Cyanobacteria): 652400810 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_026796606.1 ... 1117:6743 ... 1150:53326 1301283:74640 ... 54304:943 54307:170 ... hypothetical protein Plankt...othrix prolifica MVQILNKTLSLEDFLNLPETKPANEYINGQIIQKPMPQGKHSKLQGKLVTVINNMAEEQAIALALPEL
Protein (Cyanobacteria): 652997295 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_027249761.1 ... 1117:7024 ... 1150:51478 1301283:72586 ... 54304:14 1160:19 ... alpha/beta hydrolase Plankt...othrix agardhii MTVATNPNKTVISVNGVDHYCEWVTTANSTPGSKPVMVFIHGWGGSGRYWESTAQALSQEFDCLIYDLRGFG
Protein (Cyanobacteria): 652400975 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_026796771.1 ... 1117:6176 ... 1150:52159 1301283:73343 ... 54304:2011 54307:550 ... cytochrome C6 Plankt...othrix prolifica MKKLLSVLILSFLLLTVLLPKSALAEGVLSGSTIFSNSCAACHINGNNVIVANKTLKKKALTKYLKGYEENPLAAIINQVTNGKNAMPNFKSRLTAREITTVAAYVAEQAEKAWSPLQ
Protein (Cyanobacteria): 652997312 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_027249778.1 ... 1117:3511 ... 1150:51681 1301283:72812 ... 54304:1582 1160:909 ... hypothetical protein Plankt...othrix agardhii MATSLKKLLIGTSVAVGISAVGITPALAGSLTNATIGGTASTDYLIYGKEGNKTVVIPNSVANLQSVLD...ATKWFGETLSKYGMTSSQTLFSNFLLAGGFQRFSDPNISYVNQDNKTGKITIGLAGHYDAASLLGLPSNPNNPIPNPNNPI
Protein (Cyanobacteria): 653002292 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_027254483.1 ... 1117:7024 ... 1150:51478 1301283:72586 ... 54304:14 1160:19 ... alpha/beta hydrolase Plankt...othrix agardhii MTVATNPNKTVISVNGVDHYCEWVTTANSTPGTKPVMVFIHGWGGSGRYWESTAQALSQEFDCLIYDLRGFG
Protein (Cyanobacteria): 653003010 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available ltransferase type 11 Planktothrix agardhii MAPVSYWDAQLYDSHHSFVSNLAVDLLELLDPRIGEHILDLGCGTGNLSYKITNTGAEVIGIDKASTMIKKANKT...YPGLNFLVIDGANLVWKEQFDAVFSNAVLHWIKQPEKVISGVCQALKPGGRFVAEFGGKGNIDTIITAIDQALDAAGYPKNKTLNPWYFPSISEYGML... WP_027255198.1 ... 1117:7185 ... 1150:53327 1301283:74641 ... 54304:944 1160:203 ... methy
Protein (Cyanobacteria): 652997457 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_027249923.1 ... 1117:7063 ... 1150:51701 1301283:72835 ... 54304:160 1160:1002 ... chem...otaxis protein MotB Planktothrix agardhii MSDLSELELETELQEEQDSGVYLSIGDLMSGLLMFFALLFITVMVQLNKTQDIIKRIPDEMFTTMQ
Chitosan as coagulant on cyanobacteria in lake restoration management may cause rapid cell lysis.
Mucci, Maíra; Noyma, Natalia Pessoa; de Magalhães, Leonardo; Miranda, Marcela; van Oosterhout, Frank; Guedes, Iamê Alves; Huszar, Vera L M; Marinho, Marcelo Manzi; Lürling, Miquel
2017-07-01
Combining coagulant and ballast to remove cyanobacteria from the water column is a promising restoration technique to mitigate cyanobacterial nuisance in surface waters. The organic, biodegradable polymer chitosan has been promoted as a coagulant and is viewed as non-toxic. In this study, we show that chitosan may rapidly compromise membrane integrity and kill certain cyanobacteria leading to release of cell contents in the water. A strain of Cylindrospermopsis raciborskii and one strain of Planktothrix agardhii were most sensitive. A 1.3 h exposure to a low dose of 0.5 mg l -1 chitosan already almost completely killed these cultures resulting in release of cell contents. After 24 h, reductions in PSII efficiencies of all cyanobacteria tested were observed. EC50 values varied from around 0.5 mg l -1 chitosan for the two sensitive strains, via about 5 mg l -1 chitosan for an Aphanizomenon flos-aquae strain, a toxic P. agardhii strain and two Anabaena cylindrica cultures, to more than 8 mg l -1 chitosan for a Microcystis aeruginosa strain and another A. flos-aquae strain. Differences in sensitivity to chitosan might be related to polymeric substances that surround cyanobacteria. Rapid lysis of toxic strains is likely and when chitosan flocking and sinking of cyanobacteria is considered in lake restoration, flocculation efficacy studies should be complemented with investigation on the effects of chitosan on the cyanobacteria assemblage being targeted. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.
Directory of Open Access Journals (Sweden)
Iuri Goulart Baseia
2002-01-01
Full Text Available A survey on the genus Rhizopogon, associated with roots of exotic trees in State of São Paulo (Brazil, was undertaken from January /1999 to September/2000. Three species were identified: R. luteolus Fr., R. roseolus Corda sensu A. H. Smith and R. rubescens Tul. This is the first report of R. luteolus and R. roseolus from Brazil.Um estudo sobre o gênero Rhizopogon, associado com raízes de árvores exóticas no Estado de São Paulo (Brasil, foi realizado de Janeiro/1999 até Setembro/2000. Três espécies foram identificadas: R. luteolus Fr., R. roseolus Corda sensu A. H. Smith e R. rubescens Tul. Este é o primeiro registro de R.. luteolus e R.. roseolus para o Brasil.
DEFF Research Database (Denmark)
2016-01-01
The invention relates to a strain gauge of a carrier layer and a meandering measurement grid positioned on the carrier layer, wherein the strain gauge comprises two reinforcement members positioned on the carrier layer at opposite ends of the measurement grid in the axial direction....... The reinforcement members are each placed within a certain axial distance to the measurement grid with the axial distance being equal to or smaller than a factor times the grid spacing. The invention further relates to a multi-axial strain gauge such as a bi-axial strain gauge or a strain gauge rosette where each...... of the strain gauges comprises reinforcement members. The invention further relates to a method for manufacturing a strain gauge as mentioned above....
Development of intra-strain self-cloning procedure for breeding baker's yeast strains.
Nakagawa, Youji; Ogihara, Hiroyuki; Mochizuki, Chisato; Yamamura, Hideki; Iimura, Yuzuru; Hayakawa, Masayuki
2017-03-01
Previously reported self-cloning procedures for breeding of industrial yeast strains require DNA from other strains, plasmid DNA, or mutagenesis. Therefore, we aimed to construct a self-cloning baker's yeast strain that exhibits freeze tolerance via an improved self-cloning procedure. We first disrupted the URA3 gene of a prototrophic baker's yeast strain without the use of any marker gene, resulting in a Δura3 homozygous disruptant. Then, the URA3 gene of the parental baker's yeast strain was used as a selection marker to introduce the constitutive TDH3 promoter upstream of the PDE2 gene encoding high-affinity cyclic AMP phosphodiesterase. This self-cloning procedure was performed without using DNA from other Saccharomyces cerevisiae strains, plasmid DNA, or mutagenesis and was therefore designated an intra-strain self-cloning procedure. Using this self-cloning procedure, we succeeded in producing self-cloning baker's yeast strains that harbor the TDH3p-PDE2 gene heterozygously and homozygously, designated TDH3p-PDE2 hetero and TDH3p-PDE2 homo strains, respectively. These self-cloning strains expressed much higher levels of PDE2 mRNA than the parental strain and exhibited higher viability after freeze stress, as well as higher fermentation ability in frozen dough, when compared with the parental strain. The TDH3p-PDE2 homo strain was genetically more stable than the TDH3p-PDE2 hetero strain. These results indicate that both heterozygous and homozygous strains of self-cloning PDE2-overexpressing freeze-tolerant strains of industrial baker's yeast can be prepared using the intra-strain self-cloning procedure, and, from a practical viewpoint, the TDH3p-PDE2 homo strain constructed in this study is preferable to the TDH3p-PDE2 hetero strain for frozen dough baking. Copyright © 2016 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Mosello, R.; Brizzio, M.C. [Consiglio Nazionale delle Ricerche, Verbania (Italy). Ist. Italiano di Idrobiologia; Garibaldi, L. [Milan Univ. La Bicocca, Milan (Italy). Dipt. di Scienze dell' Ambiente; Buzzi, P. [Azienda Sanitaria Locale, Lecco (Italy). Unita' Operativa Fisica e Tutela Ambiente; Colzani, L.; Pizzotti, E. [Azienda Sanitaria Locale, Como (Italy). Unita' Operativa Chimica; Mocellin, D. [Azienda Sanitaria Locale, Sondrio (Italy). Unita' Operativa Chimica
1999-12-01
Monthly measurements of temperature, water chemistry and phytoplankton performed from september 1997 to August 1998 in lake basins close the towns of Como and Lecco (Italy) are presented and discussed. Chemical variables show a high trophic level in both stations, more pronounced in the Como station due to unfavourable hydrological conditions and to urban and industrial sources of pollution, which show the predominance of Oscillatoria rubescens. [Italian] Il presente lavoro riporta i risultati di un'indagine condotta con campionamenti mensili dal settembre 1997 all'agosto 1998 nei bacini di Como e Lecco. Le variabili chimiche analizzate evidenziano, per entrambe le stazioni considerate, un elevato livello di trofia piu' pronunciato nella stazione di Come a causa di sfavorevoli condizioni idrologiche e per la presenza di sorgenti di inquinamento urbano e industriale, confermato dalla predominanza di Oscillatoria rubescens.
Contribution to a macromycete survey of the states of Rio Grande do Sul and Santa Catarina in Brazil
Directory of Open Access Journals (Sweden)
Georg Sobestiansky
2005-05-01
Full Text Available Collections of macromycetes made in seven municipalities in southern Brazil, viz. six in Rio Grande do Sul and one in Santa Catarina, are listed. They belonged to the Myxomycota (6 spp., Ascomycota (54 spp. and Basidiomycota (189 spp.. First records for Brazil could be Battarrea phalloides, Amanita rubescens, Boletus edulis and Mycena filopes, the last three found under exotic Pinus.São listadas as coletas executadas pelo autor em sete municípios no sul do Brasil, sendo seis no estado de Rio Grande do Sul e um no estado de Santa Catarina. Pertencem à Myxomycota (6 espécies, Ascomycota (54 espécies e Basidiomycota (189 espécies. Primeiros registros para o Brasil são aparentemente: Battarrea phalloides, Amanita rubescens, Boletus edulis e Mycena filopes, as últimas três encontradas sob espécies de Pinus.
Strain hardening rate sensitivity and strain rate sensitivity in TWIP steels
Energy Technology Data Exchange (ETDEWEB)
Bintu, Alexandra [TEMA, Department of Mechanical Engineering, University of Aveiro, Campus Universitário de Santiago, 3810-193 (Portugal); Vincze, Gabriela, E-mail: gvincze@ua.pt [TEMA, Department of Mechanical Engineering, University of Aveiro, Campus Universitário de Santiago, 3810-193 (Portugal); Picu, Catalin R. [Department of Mechanical, Aerospace and Nuclear Engineering, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States); Lopes, Augusto B. [CICECO, Department of Materials and Ceramic Engineering, University of Aveiro, Campus Universitário de Santiago, 3810-193 (Portugal); Grácio, Jose J. [TEMA, Department of Mechanical Engineering, University of Aveiro, Campus Universitário de Santiago, 3810-193 (Portugal); Barlat, Frederic [Materials Mechanics Laboratory, Graduate Institute of Ferrous Technology, Pohang University of Science and Technology, Pohang 790-784 (Korea, Republic of)
2015-04-01
TWIP steels are materials with very high strength and exceptional strain hardening capability, parameters leading to large energy absorption before failure. However, TWIP steels also exhibit reduced (often negative) strain rate sensitivity (SRS) which limits the post-necking deformation. In this study we demonstrate for an austenitic TWIP steel with 18% Mn a strong dependence of the twinning rate on the strain rate, which results in negative strain hardening rate sensitivity (SHRS). The instantaneous component of SHRS is large and negative, while its transient is close to zero. The SRS is observed to decrease with strain, becoming negative for larger strains. Direct observations of the strain rate dependence of the twinning rate are made using electron microscopy and electron backscatter diffraction, which substantiate the proposed mechanism for the observed negative SHRS.
Strain hardening rate sensitivity and strain rate sensitivity in TWIP steels
International Nuclear Information System (INIS)
Bintu, Alexandra; Vincze, Gabriela; Picu, Catalin R.; Lopes, Augusto B.; Grácio, Jose J.; Barlat, Frederic
2015-01-01
TWIP steels are materials with very high strength and exceptional strain hardening capability, parameters leading to large energy absorption before failure. However, TWIP steels also exhibit reduced (often negative) strain rate sensitivity (SRS) which limits the post-necking deformation. In this study we demonstrate for an austenitic TWIP steel with 18% Mn a strong dependence of the twinning rate on the strain rate, which results in negative strain hardening rate sensitivity (SHRS). The instantaneous component of SHRS is large and negative, while its transient is close to zero. The SRS is observed to decrease with strain, becoming negative for larger strains. Direct observations of the strain rate dependence of the twinning rate are made using electron microscopy and electron backscatter diffraction, which substantiate the proposed mechanism for the observed negative SHRS
Variation in the strain anisotropy of Zircaloy with temperature and strain
International Nuclear Information System (INIS)
Hindle, E.D.; Worswick, D.
1984-04-01
Strain anisotropy was investigated at temperatures in the range 293 to 1117K in circular tensile specimens prepared from rolled Zircaloy-2 plate so that their tensile axes were parallel to and transverse to the rolling direction. The strain anisotropy factor for both types of specimen increased markedly in the high alpha phase region above 923K reaching a maximum at circa 1070K. Above this temperature in the alpha-plus-beta phase region the strain anisotropy decreased rapidly as the proportion of beta phase increased and was almost non-existent at 1173K. The strain anisotropy was markedly strain dependent, particularly in the high alpha phase region. The study was extended to Zircaloy-4 pressurized water reactor (PWR) 17 x 17 type fuel rod tubing specimens which were strained under biaxial conditions using cooling conditions which promoted uniform diametral strain over most of their lengths (circa 250 mm). In these circumstances the strain anisotropy is manifest by a reduction in length. Measurement of this change along with that in diameter and wall thickness produced data from which the strain anisotropy factor was calculated. The results, although influenced by additional factors discussed in the paper, were similar to those observed in the uniaxial Zircaloy-2 tensile tests. (author)
Directory of Open Access Journals (Sweden)
Addolorata Marasco
Full Text Available The potential impact of cyanobacteria and microalgae on the weathering of calcareous tesserae from a Roman mosaic of the II Century CE has been followed through in vitro experiments. Laboratory tests were carried out by inoculating mosaic tiles with single strains of Cyanobacteria or Chlorophyta to evaluate the roles of pioneer phototrophic microrganism on the resulting architecture of biofilms. The interaction between tesserae and strains was assessed at the whole substratum and micrometer scales, by image analysis and Confocal Laser Scanning (CLS microscopy, respectively. The biofilm surface coverage on each tessera varied from 19% (Fischerella ambigua to 97% (Microcoleus autumnalis. Cyanobacteria showed a better growth on calcareous tesserae, whereas the only green alga attaining a superficial coverage higher than 50% was Coelastrella rubescens. CLS microscopy evidenced two different types of spatial arrangement of the phototrophic organisms on the tesserae, that were defined as compact or porous, respectively. In the first one was measured a reduced number of empty spaces between cells or filaments, whereas in the second type, a reticulate texture allowed the presence of numerous empty volumes. The colonization processes observed are an intrinsic characteristic of each strain. We have proposed a colonization index IC as a sensible tool to describe, in a quantitative way, the pioneering attitude of each photosynthetic microorganism to colonize lithic substrates under laboratory conditions.
Haemophilus ducreyi Cutaneous Ulcer Strains Are Nearly Identical to Class I Genital Ulcer Strains.
Directory of Open Access Journals (Sweden)
Dharanesh Gangaiah
Full Text Available Although cutaneous ulcers (CU in the tropics is frequently attributed to Treponema pallidum subspecies pertenue, the causative agent of yaws, Haemophilus ducreyi has emerged as a major cause of CU in yaws-endemic regions of the South Pacific islands and Africa. H. ducreyi is generally susceptible to macrolides, but CU strains persist after mass drug administration of azithromycin for yaws or trachoma. H. ducreyi also causes genital ulcers (GU and was thought to be exclusively transmitted by microabrasions that occur during sex. In human volunteers, the GU strain 35000HP does not infect intact skin; wounds are required to initiate infection. These data led to several questions: Are CU strains a new variant of H. ducreyi or did they evolve from GU strains? Do CU strains contain additional genes that could allow them to infect intact skin? Are CU strains susceptible to azithromycin?To address these questions, we performed whole-genome sequencing and antibiotic susceptibility testing of 5 CU strains obtained from Samoa and Vanuatu and 9 archived class I and class II GU strains. Except for single nucleotide polymorphisms, the CU strains were genetically almost identical to the class I strain 35000HP and had no additional genetic content. Phylogenetic analysis showed that class I and class II strains formed two separate clusters and CU strains evolved from class I strains. Class I strains diverged from class II strains ~1.95 million years ago (mya and CU strains diverged from the class I strain 35000HP ~0.18 mya. CU and GU strains evolved under similar selection pressures. Like 35000HP, the CU strains were highly susceptible to antibiotics, including azithromycin.These data suggest that CU strains are derivatives of class I strains that were not recognized until recently. These findings require confirmation by analysis of CU strains from other regions.
Factors affecting finite strain estimation in low-grade, low-strain clastic rocks
Pastor-Galán, Daniel; Gutiérrez-Alonso, Gabriel; Meere, Patrick A.; Mulchrone, Kieran F.
2009-12-01
The computer strain analysis methods SAPE, MRL and DTNNM have permitted the characterization of finite strain in two different regions with contrasting geodynamic scenarios; (1) the Talas Ala Tau (Tien Shan, Kyrgyzs Republic) and (2) the Somiedo Nappe and Narcea Antiform (Cantabrian to West Asturian-Leonese Zone boundary, Variscan Belt, NW of Iberia). The performed analyses have revealed low-strain values and the regional strain trend in both studied areas. This study also investigates the relationship between lithology (grain size and percentage of matrix) and strain estimates the two methodologies used. The results show that these methods are comparable and the absence of significant finite strain lithological control in rocks deformed under low metamorphic and low-strain conditions.
Ribeiro, Barbara; Rangel, Joana; Valentão, Patrícia; Baptista, Paula; Seabra, Rosa M; Andrade, Paula B
2006-11-01
The organic acids and phenolics compositions of nine wild edible mushrooms species (Suillus bellini, Tricholomopsis rutilans, Hygrophorus agathosmus, Amanita rubescens, Russula cyanoxantha, Boletus edulis, Tricholoma equestre, Suillus luteus, and Suillus granulatus) were determined by HPLC-UV and HPLC-DAD, respectively. The antioxidant potential of these species was also assessed by using the DPPH* scavenging assay. The results showed that all of the species presented a profile composed of at least five organic acids: oxalic, citric, malic, quinic, and fumaric acids. In a general way, the pair of malic plus quinic acids were the major compounds. Only very small amounts of two phenolic compounds were found in some of the analyzed species: p-hydroxybenzoic acid (in A. rubescens, R. cyanoxantha, and T. equestre) and quercetin (in S. luteus and S. granulatus). All of the species exhibited a concentration-dependent scavenging ability against DPPH*. T. rutilans revealed the highest antioxidant capacity.
Directory of Open Access Journals (Sweden)
Lynn S. Adams
2006-01-01
Full Text Available Herbal medicines are often combinations of botanical extracts that are assumed to have additive or synergistic effects. The purpose of this investigation was to compare the effect of individual botanical extracts with combinations of extracts on prostate cell viability. We then modeled the interactions between botanical extracts in combination isobolographically. Scutellaria baicalensis, Rabdosia rubescens, Panax-pseudo ginseng, Dendranthema morifolium, Glycyrrhiza uralensis and Serenoa repens were collected, taxonomically identified and extracts prepared. Effects of the extracts on cell viability were quantitated in prostate cell lines using a luminescent ATP cell viability assay. Combinations of two botanical extracts of the four most active extracts were tested in the 22Rv1 cell line and their interactions assessed using isobolographic analysis. Each extract significantly inhibited the proliferation of prostate cell lines in a time- and dose-dependent manner except repens. The most active extracts, baicalensis, D. morifolium, G. uralensis and R. rubescens were tested as two-extract combinations. baicalensis and D. morifolium when combined were additive with a trend toward synergy, whereas D. morifolium and R. rubescens together were additive. The remaining two-extract combinations showed antagonism. The four extracts together were significantly more effective than the two-by-two combinations and the individual extracts alone. Combining the four herbal extracts significantly enhanced their activity in the cell lines tested compared with extracts alone. The less predictable nature of the two-way combinations suggests a need for careful characterization of the effects of each individual herb based on their intended use.
Stress-strain properties of railway steel at strain rates of upto 105 per second
International Nuclear Information System (INIS)
Hashmi, M.S.J.; Islam, M.N.
1985-01-01
This paper presents the stress-strain characteristics of railway steel at strain rates of up to 10 5 /s at room temperature determined by a new technique. In determining the results, account has been taken of the strain-rate variation, the total strain and the strain rate history. The effect of friction, material inertia and temperature rise is also assessed and an empirical constitutive equation describing the strain-rate and strain sensitive flow stress for this type of steel is proposed. (orig.)
International Nuclear Information System (INIS)
Kim, Junehyung; Cheon, Jinsik; Lee, Byoungoon; Lee, Chanbock
2014-01-01
One of the design criteria for the fuel rod in PGSFR is the thermal creep strain of the cladding, because the cladding is exposed to a high temperature for a long time during reactor operation period. In general, there are two kind of calculation scheme for thermal creep strain: time hardening and strain hardening rules. In this work, thermal creep strain calculation results for HT9 cladding by using time hardening and strain hardening rules are compared by employing KAERI's current metallic fuel performance analysis code, MACSIS. Also, thermal creep strain calculation results by using ANL's metallic fuel performance analysis code, LIFE-METAL which adopts strain hardening rule are compared with those by using MACSIS. Thermal creep strain calculation results for HT9 cladding by using time hardening and strain hardening rules were compared by employing KAERI's current metallic fuel performance analysis code, MACSIS. Also, thermal creep strain calculation results by using ANL's metallic fuel performance analysis code, LIFE-METAL which adopts strain hardening rule were compared with those by using MACSIS. Tertiary creep started earlier in time hardening rule than in strain hardening rule. Also, calculation results by MACSIS with strain hardening and those obtained by using LIFE-METAL were almost identical to each other
International Nuclear Information System (INIS)
Samuel, K G
2006-01-01
It is shown that the deviation from the ideal Hollomon relation in describing the stress-strain behaviour is characteristic of all materials at low strains. The Ludwigson relation describing the deviation from the Hollomon relation at low strains is critically analysed and it is shown that the deviation at low strains is a consequence of some unknown 'plastic strain equivalent' present in the material. Stress strain curves obeying an ideal Hollomon relation as well as that of a structurally modified (prior cold worked) material were simulated and compared. The results show that the yield strength and the flow strength of a material at constant strain rate and temperature are dictated by the magnitude of the 'plastic strain equivalent' term. It is shown that this component need not necessarily mean a prior plastic strain present in the material due to prior cold work alone and that prior cold work strain will add to this. If this component is identified, the stress-strain behaviour can be adequately described by the Swift relation. It is shown that in both formalisms, the strain hardening index is a function of the yield strength of the material
Directory of Open Access Journals (Sweden)
Ralf B. Wehrspohn
2012-05-01
Full Text Available A review of recent progress in the field of strained silicon photonics is presented. The application of strain to waveguide and photonic crystal structures can be used to alter the linear and nonlinear optical properties of these devices. Here, methods for the fabrication of strained devices are summarized and recent examples of linear and nonlinear optical devices are discussed. Furthermore, the relation between strain and the enhancement of the second order nonlinear susceptibility is investigated, which may enable the construction of optically active photonic devices made of silicon.
Amerindian Helicobacter pylori strains go extinct, as european strains expand their host range.
Directory of Open Access Journals (Sweden)
Maria G Domínguez-Bello
Full Text Available We studied the diversity of bacteria and host in the H. pylori-human model. The human indigenous bacterium H. pylori diverged along with humans, into African, European, Asian and Amerindian groups. Of these, Amerindians have the least genetic diversity. Since niche diversity widens the sets of resources for colonizing species, we predicted that the Amerindian H. pylori strains would be the least diverse. We analyzed the multilocus sequence (7 housekeeping genes of 131 strains: 19 cultured from Africans, 36 from Spanish, 11 from Koreans, 43 from Amerindians and 22 from South American Mestizos. We found that all strains that had been cultured from Africans were African strains (hpAfrica1, all from Spanish were European (hpEurope and all from Koreans were hspEAsia but that Amerindians and Mestizos carried mixed strains: hspAmerind and hpEurope strains had been cultured from Amerindians and hpEurope and hpAfrica1 were cultured from Mestizos. The least genetically diverse H. pylori strains were hspAmerind. Strains hpEurope were the most diverse and showed remarkable multilocus sequence mosaicism (indicating recombination. The lower genetic structure in hpEurope strains is consistent with colonization of a diversity of hosts. If diversity is important for the success of H. pylori, then the low diversity of Amerindian strains might be linked to their apparent tendency to disappear. This suggests that Amerindian strains may lack the needed diversity to survive the diversity brought by non-Amerindian hosts.
Hydrothermal Disintegration and Extraction of Different Microalgae Species
Directory of Open Access Journals (Sweden)
Michael Kröger
2018-02-01
Full Text Available For the disintegration and extraction of microalgae to produce lipids and biofuels, a novel processing technology was investigated. The utilization of a hydrothermal treatment was tested on four different microalgae species (Scenedesmus rubescens, Chlorella vulgaris, Nannochloropsis oculata and Arthorspira platensis (Spirulina to determine whether it has an advantage in comparison to other disintegration methods for lipid extraction. It was shown, that hydrothermal treatment is a reasonable opportunity to utilize microalgae without drying and increase the lipid yield of an algae extraction process. For three of the four microalgae species, the extraction yield with a prior hydrothermal treatment elevated the lipid yield up to six times in comparison to direct extraction. Only Scenedesmus rubescens showed a different behaviour. Reason can be found in the different cell wall of the species. The investigation of the differences in cell wall composition of the used species indicate that the existence of algaenan as a cell wall compound plays a major role in stability.
Antitumor and Antibacterial Derivatives of Oridonin: A Main Composition of Dong-Ling-Cao
Directory of Open Access Journals (Sweden)
Dahong Li
2016-04-01
Full Text Available Isodon rubescens has been used as a traditional green tea for more than 1000 years and many medicinal functions of I. rubescens are also very useful, such as its well-known antitumor and antibacterial activities. Oridonin, a bioactive ent-kaurane diterpenoid, is the major ingredient of this medicinal tea. Herein, 22 novel oridonin derivatives were designed and synthesized. The antibacterial activity was evaluated for the first time. Compound 12 was the most promising one with MIC of 2.0 μg/mL against B. subtilis, which was nearly 3-fold stronger than positive control chloromycetin. The antiproliferative property was also assayed and compound 19 showed stronger activity than taxol. The apoptosis-inducing ability, cell cycle arrest effect at S phase and influence of mitochondrial membrane potential by 19 in CaEs-17 cancer cells were first disclosed. Based on the above results, the cell apoptosis induced by compound 19 in CaEs-17 cells was most probably involved in the intrinsic apoptotic pathway.
Measurement of Strain and Strain Rate during the Impact of Tennis Ball Cores
Directory of Open Access Journals (Sweden)
Ben Lane
2018-03-01
Full Text Available The aim of this investigation was to establish the strains and strain rates experienced by tennis ball cores during impact to inform material characterisation testing and finite element modelling. Three-dimensional surface strains and strain rates were measured using two high-speed video cameras and corresponding digital image correlation software (GOM Correlate Professional. The results suggest that material characterisation testing to a maximum strain of 0.4 and a maximum rate of 500 s−1 in tension and to a maximum strain of −0.4 and a maximum rate of −800 s−1 in compression would encapsulate the demands placed on the material during impact and, in turn, define the range of properties required to encapsulate the behavior of the material during impact, enabling testing to be application-specific and strain-rate-dependent properties to be established and incorporated in finite element models.
Further improvements in water quality of the Dutch Borderlakes
Noordhuis, Ruurd; Zuidam, van B.G.; Peeters, E.T.H.M.; Geest, van G.J.
2016-01-01
The Borderlakes are a chain of ten shallow, largely artificial, interconnected lakes in the Netherlands. The ecological recovery of the central Borderlakes (viz. lake Veluwe and Wolderwijd) has been well documented. These lakes shifted from a eutrophic, Planktothrix dominated state in the 1970s
Strain measurement based battery testing
Xu, Jeff Qiang; Steiber, Joe; Wall, Craig M.; Smith, Robert; Ng, Cheuk
2017-05-23
A method and system for strain-based estimation of the state of health of a battery, from an initial state to an aged state, is provided. A strain gauge is applied to the battery. A first strain measurement is performed on the battery, using the strain gauge, at a selected charge capacity of the battery and at the initial state of the battery. A second strain measurement is performed on the battery, using the strain gauge, at the selected charge capacity of the battery and at the aged state of the battery. The capacity degradation of the battery is estimated as the difference between the first and second strain measurements divided by the first strain measurement.
International Nuclear Information System (INIS)
1987-01-01
The 10 contributions are concerned with selected areas of application, such as strain measurements in wood, rubber/metal compounds, sets of strain measurements on buildings, reinforced concrete structures without gaps, pipes buried in the ground and measurements of pressure fluctuations. To increase the availability and safety of plant, stress analyses were made on gas turbine rotors with HT-DMS or capacitive HT-DMS (high temperature strain measurements). (DG) [de
Strain expansion-reduction approach
Baqersad, Javad; Bharadwaj, Kedar
2018-02-01
Validating numerical models are one of the main aspects of engineering design. However, correlating million degrees of freedom of numerical models to the few degrees of freedom of test models is challenging. Reduction/expansion approaches have been traditionally used to match these degrees of freedom. However, the conventional reduction/expansion approaches are only limited to displacement, velocity or acceleration data. While in many cases only strain data are accessible (e.g. when a structure is monitored using strain-gages), the conventional approaches are not capable of expanding strain data. To bridge this gap, the current paper outlines a reduction/expansion technique to reduce/expand strain data. In the proposed approach, strain mode shapes of a structure are extracted using the finite element method or the digital image correlation technique. The strain mode shapes are used to generate a transformation matrix that can expand the limited set of measurement data. The proposed approach can be used to correlate experimental and analytical strain data. Furthermore, the proposed technique can be used to expand real-time operating data for structural health monitoring (SHM). In order to verify the accuracy of the approach, the proposed technique was used to expand the limited set of real-time operating data in a numerical model of a cantilever beam subjected to various types of excitations. The proposed technique was also applied to expand real-time operating data measured using a few strain gages mounted to an aluminum beam. It was shown that the proposed approach can effectively expand the strain data at limited locations to accurately predict the strain at locations where no sensors were placed.
Nigam, Rajni; Munzenmaier, Diane H; Worthey, Elizabeth A; Dwinell, Melinda R; Shimoyama, Mary; Jacob, Howard J
2013-11-22
The Rat Genome Database (RGD) ( http://rgd.mcw.edu/) is the premier site for comprehensive data on the different strains of the laboratory rat (Rattus norvegicus). The strain data are collected from various publications, direct submissions from individual researchers, and rat providers worldwide. Rat strain, substrain designation and nomenclature follow the Guidelines for Nomenclature of Mouse and Rat Strains, instituted by the International Committee on Standardized Genetic Nomenclature for Mice. While symbols and names aid in identifying strains correctly, the flat nature of this information prohibits easy search and retrieval, as well as other data mining functions. In order to improve these functionalities, particularly in ontology-based tools, the Rat Strain Ontology (RS) was developed. The Rat Strain Ontology (RS) reflects the breeding history, parental background, and genetic manipulation of rat strains. This controlled vocabulary organizes strains by type: inbred, outbred, chromosome altered, congenic, mutant and so on. In addition, under the chromosome altered category, strains are organized by chromosome, and further by type of manipulations, such as mutant or congenic. This allows users to easily retrieve strains of interest with modifications in specific genomic regions. The ontology was developed using the Open Biological and Biomedical Ontology (OBO) file format, and is organized on the Directed Acyclic Graph (DAG) structure. Rat Strain Ontology IDs are included as part of the strain report (RS: ######). As rat researchers are often unaware of the number of substrains or altered strains within a breeding line, this vocabulary now provides an easy way to retrieve all substrains and accompanying information. Its usefulness is particularly evident in tools such as the PhenoMiner at RGD, where users can now easily retrieve phenotype measurement data for related strains, strains with similar backgrounds or those with similar introgressed regions. This
Variation in the strain anisotropy of Zircaloy with temperature and strain
International Nuclear Information System (INIS)
Hindle, E.D.; Worswick, D.
1984-01-01
The strong crystallographic texture which is developed during the fabrication of zirconium-based alloys causes pronounced anisotropy in their mechanical properties, particularly deformation. The tendency for circular-section tension specimens with a high concentration of basal poles in one direction to become elliptical when deformed in tension has been used in this study to provide quantitative data on the effects of both strain and temperature on strain anisotropy. Tension tests were carried out over a temperature range of 293 to 1193 K on specimens machined from Zircaloy-2 plate. The strain anisotropy was found to increase markedly at temperatures over 923 K, reaching a maximum in the region of 1070 K. The strain anisotropy increased with increasing strain in this temperature region. The study was extended to Zircaloy-4 pressurized-water reactor fuel cladding by carrying out tube swelling tests and evaluating the axial deformation produced. Although scatter in the test results was higher than that exhibited in the tension tests, the general trend in the data was similar. The effects of the strain anisotropy observed are discussed in relation to the effects of temperature on the ductility of Zircaloy fuel cladding tubes during postulated largebreak loss-of-coolant accidents
Directory of Open Access Journals (Sweden)
Yoko Miyasaki
Full Text Available The number of fully active antibiotic options that treat nosocomial infections due to multidrug-resistant Acinetobacter baumannii (A. baumannii is extremely limited. Magnolia officinalis, Mahonia bealei, Rabdosia rubescens, Rosa rugosa, Rubus chingii, Scutellaria baicalensis, and Terminalia chebula plant extracts were previously shown to have growth inhibitory activity against a multidrug-resistant clinical strain of A. baumannii. In this study, the compounds responsible for their antimicrobial activity were identified by fractionating each plant extract using high performance liquid chromatography, and determining the antimicrobial activity of each fraction against A. baumannii. The chemical structures of the fractions inhibiting >40% of the bacterial growth were elucidated by liquid chromatography/mass spectrometry analysis and nuclear magnetic resonance spectroscopy. The six most active compounds were identified as: ellagic acid in Rosa rugosa; norwogonin in Scutellaria baicalensis; and chebulagic acid, chebulinic acid, corilagin, and terchebulin in Terminalia chebula. The most potent compound was identified as norwogonin with a minimum inhibitory concentration of 128 µg/mL, and minimum bactericidal concentration of 256 µg/mL against clinically relevant strains of A. baumannii. Combination studies of norwogonin with ten anti-Gram negative bacterial agents demonstrated that norwogonin did not enhance the antimicrobial activity of the synthetic antibiotics chosen for this study. In conclusion, of all identified antimicrobial compounds, norwogonin was the most potent against multidrug-resistant A. baumannii strains. Further studies are warranted to ascertain the prophylactic and therapeutic potential of norwogonin for infections due to multidrug-resistant A. baumannii.
Three dimensional strained semiconductors
Voss, Lars; Conway, Adam; Nikolic, Rebecca J.; Leao, Cedric Rocha; Shao, Qinghui
2016-11-08
In one embodiment, an apparatus includes a three dimensional structure comprising a semiconductor material, and at least one thin film in contact with at least one exterior surface of the three dimensional structure for inducing a strain in the structure, the thin film being characterized as providing at least one of: an induced strain of at least 0.05%, and an induced strain in at least 5% of a volume of the three dimensional structure. In another embodiment, a method includes forming a three dimensional structure comprising a semiconductor material, and depositing at least one thin film on at least one surface of the three dimensional structure for inducing a strain in the structure, the thin film being characterized as providing at least one of: an induced strain of at least 0.05%, and an induced strain in at least 5% of a volume of the structure.
Pulled hamstring muscle; Sprain - hamstring ... There are 3 levels of hamstring strains: Grade 1 -- mild muscle strain or pull Grade 2 -- partial muscle tear Grade 3 -- complete muscle tear Recovery time depends ...
National Research Council Canada - National Science Library
Brown, April
1999-01-01
Strain-Modulated Epitaxy (SME) is a novel approach, invented at Georgia Tech, to utilize subsurface stressors to control strain and therefore material properties and growth kinetics in the material above the stressors...
International Nuclear Information System (INIS)
Atanazio Filho, Nelson N.; Gomes, Paulo T. Vida; Scaldaferri, Denis H.B.; Silva, Luiz L. da; Rabello, Emerson G.; Mansur, Tanius R.
2013-01-01
An experimental methodology used for strains measuring at high temperatures is show in this work. In order to do the measurements, it was used electric strain gages with loose filaments attached to a stainless steel 304 beam with specific cements. The beam has triangular shape and a constant thickness, so the strain is the same along its length. Unless the beam surface be carefully prepared, the strain gage attachment is not efficient. The showed results are for temperatures ranging from 20 deg C to 300 deg C, but the experimental methodology could be used to measure strains at a temperature up to 900 deg C. Analytical calculations based on solid mechanics were used to verify the strain gage electrical installation and the measured strains. At a first moment, beam deformations as a temperature function were plotted. After that, beam deformations with different weighs were plotted as a temperature function. The results shown allowed concluding that the experimental methodology is trustable to measure strains at temperatures up to 300 deg C. (author)
Strain mapping near a triple junction in strained Ni-based alloy using EBSD and biaxial nanogauges
Energy Technology Data Exchange (ETDEWEB)
Clair, A. [Laboratoire Interdisciplinaire Carnot de Bourgogne, UMR 5209 CNRS, Universite de Bourgogne, 9 Avenue Alain Savary, BP 47870, 21078 Dijon Cedex (France); Foucault, M.; Calonne, O. [Areva ANP, Centre Technique Departement Corrosion-Chimie, 30 Bd de l' industrie, BP 181, 71205 Le Creusot (France); Lacroute, Y.; Markey, L.; Salazar, M.; Vignal, V. [Laboratoire Interdisciplinaire Carnot de Bourgogne, UMR 5209 CNRS, Universite de Bourgogne, 9 Avenue Alain Savary, BP 47870, 21078 Dijon Cedex (France); Finot, E., E-mail: Eric.Finot@u-bourgogne.fr [Laboratoire Interdisciplinaire Carnot de Bourgogne, UMR 5209 CNRS, Universite de Bourgogne, 9 Avenue Alain Savary, BP 47870, 21078 Dijon Cedex (France)
2011-05-15
Research highlights: > Surface strains measured using nanogauge were compared to the texture obtained by EBSD. > Statistics of the principal strain discern the grains according to the Schmid factor. > Strain hotspots were localized near a triple junction of alloy 600 under tensile loading. > Asymetrical profile of the GB strains is a criterion for surface cracking initiation. - Abstract: A key element for analyzing the crack initiation in strained polycrystalline alloys is the local quantification of the surface strain distribution according to the grain texture. Using electron backscattered diffraction, the local microstructure was determined to both localize a triple junction and deduce the local Schmid factors. Kernel average misorientation (KAM) was also used to map the areas of defect concentration. The maximum principal strain and the in-plane shear strain were quantified using the biaxial nanogauge. Distortions of the array of nanodots used as spot markers were analyzed near the triple junction. The crystallographic orientation and the surface strain were then investigated both statistically for each grain and locally at the grain boundaries. The superimposition of microstructure and strain maps allows the high strain gradient (reaching 3-fold the applied strain) to be localized at preferential grain boundaries near the triple junction. The Schmid factors and the KAM were compared to the maximum principal strain and the in-plane shear strain respectively. The polycrystalline deformation was attributable first to the rotation of some grains, followed by the elongation of all grains along their preferential activated slip systems.
Cox, Brian N.; Landis, Chad M.
2018-02-01
We present a simple theory of a strain pulse propagating as a solitary wave through a continuous two-dimensional population of cells. A critical strain is assumed to trigger a strain transformation, while, simultaneously, cells move as automata to tend to restore a preferred cell density. We consider systems in which the strain transformation is a shape change, a burst of proliferation, or the commencement of growth (which changes the shape of the population sheet), and demonstrate isomorphism among these cases. Numerical and analytical solutions describe a strain pulse whose height does not depend on how the strain disturbance was first launched, or the rate at which the strain transformation is achieved, or the rate constant in the rule for the restorative cell motion. The strain pulse is therefore very stable, surviving the imposition of strong perturbations: it would serve well as a timing signal in development. The automatous wave formulation is simple, with few model parameters. A strong case exists for the presence of a strain pulse during amelogenesis. Quantitative analysis reveals a simple relationship between the velocity of the leading edge of the pulse in amelogenesis and the known speed of migration of ameloblast cells. This result and energy arguments support the depiction of wave motion as an automatous cell response to strain, rather than as a response to an elastic energy gradient. The theory may also contribute to understanding the determination front in somitogenesis, moving fronts of convergent-extension transformation, and mitotic wavefronts in the syncytial drosophila embryo.
Mvubu, Nontobeko Eunice; Pillay, Balakrishna; Gamieldien, Junaid; Bishai, William; Pillay, Manormoney
2016-12-01
Although pulmonary epithelial cells are integral to innate and adaptive immune responses during Mycobacterium tuberculosis infection, global transcriptomic changes in these cells remain largely unknown. Changes in gene expression induced in pulmonary epithelial cells infected with M. tuberculosis F15/LAM4/KZN, F11, F28, Beijing and Unique genotypes were investigated by RNA sequencing (RNA-Seq). The Illumina HiSeq 2000 platform generated 50 bp reads that were mapped to the human genome (Hg19) using Tophat (2.0.10). Differential gene expression induced by the different strains in infected relative to the uninfected cells was quantified and compared using Cufflinks (2.1.0) and MeV (4.0.9), respectively. Gene expression varied among the strains with the total number of genes as follows: F15/LAM4/KZN (1187), Beijing (1252), F11 (1639), F28 (870), Unique (886) and H37Rv (1179). A subset of 292 genes was commonly induced by all strains, where 52 genes were down-regulated while 240 genes were up-regulated. Differentially expressed genes were compared among the strains and the number of induced strain-specific gene signatures were as follows: F15/LAM4/KZN (138), Beijing (52), F11 (255), F28 (55), Unique (186) and H37Rv (125). Strain-specific molecular gene signatures associated with functional pathways were observed only for the Unique and H37Rv strains while certain biological functions may be associated with other strain signatures. This study demonstrated that strains of M. tuberculosis induce differential gene expression and strain-specific molecular signatures in pulmonary epithelial cells. Specific signatures induced by clinical strains of M. tuberculosis can be further explored for novel host-associated biomarkers and adjunctive immunotherapies. Copyright © 2016 Elsevier Ltd. All rights reserved.
Flexible piezotronic strain sensor.
Zhou, Jun; Gu, Yudong; Fei, Peng; Mai, Wenjie; Gao, Yifan; Yang, Rusen; Bao, Gang; Wang, Zhong Lin
2008-09-01
Strain sensors based on individual ZnO piezoelectric fine-wires (PFWs; nanowires, microwires) have been fabricated by a simple, reliable, and cost-effective technique. The electromechanical sensor device consists of a single electrically connected PFW that is placed on the outer surface of a flexible polystyrene (PS) substrate and bonded at its two ends. The entire device is fully packaged by a polydimethylsiloxane (PDMS) thin layer. The PFW has Schottky contacts at its two ends but with distinctly different barrier heights. The I- V characteristic is highly sensitive to strain mainly due to the change in Schottky barrier height (SBH), which scales linear with strain. The change in SBH is suggested owing to the strain induced band structure change and piezoelectric effect. The experimental data can be well-described by the thermionic emission-diffusion model. A gauge factor of as high as 1250 has been demonstrated, which is 25% higher than the best gauge factor demonstrated for carbon nanotubes. The strain sensor developed here has applications in strain and stress measurements in cell biology, biomedical sciences, MEMS devices, structure monitoring, and more.
Noutsios, Georgios T; Papi, Rigini M; Ekateriniadou, Loukia V; Minas, Anastasios; Kyriakidis, Dimitrios A
2012-03-01
In the present study forty-four Greek endemic strains of Br. melitensis and three reference strains were genotyped by Multi locus Variable Number Tandem Repeat (ML-VNTR) analysis based on an eight-base pair tandem repeat sequence that was revealed in eight loci of Br. melitensis genome. The forty-four strains were discriminated from the vaccine strain Rev-1 by Restriction Fragment Length Polymorphism (RFLP) and Denaturant Gradient Gel Electrophoresis (DGGE). The ML-VNTR analysis revealed that endemic, reference and vaccine strains are genetically closely related, while most of the loci tested (1, 2, 4, 5 and 7) are highly polymorphic with Hunter-Gaston Genetic Diversity Index (HGDI) values in the range of 0.939 to 0.775. Analysis of ML-VNTRs loci stability through in vitro passages proved that loci 1 and 5 are non stable. Therefore, vaccine strain can be discriminated from endemic strains by allele's clusters of loci 2, 4, 6 and 7. RFLP and DGGE were also employed to analyse omp2 gene and reveled different patterns among Rev-1 and endemic strains. In RFLP, Rev-1 revealed three fragments (282, 238 and 44 bp), while endemic strains two fragments (238 and 44 bp). As for DGGE, the electrophoretic mobility of Rev-1 is different from the endemic strains due to heterologous binding of DNA chains of omp2a and omp2b gene. Overall, our data show clearly that it is feasible to genotype endemic strains of Br. melitensis and differentiate them from vaccine strain Rev-1 with ML-VNTR, RFLP and DGGE techniques. These tools can be used for conventional investigations in brucellosis outbreaks.
Effects of the Strain Rate Sensitivity and Strain Hardening on the Saturated Impulse of Plates
Directory of Open Access Journals (Sweden)
Ling Zhu
Full Text Available Abstract This paper studies the stiffening effects of the material strain rate sensitivity and strain hardening on the saturated impulse of elastic, perfectly plastic plates. Finite element (FE code ABAQUS is employed to simulate the elastoplastic response of square plates under rectangular pressure pulse. Rigid-plastic analyses for saturated impulse, which consider strain rate sensitivity and strain hardening, are conducted. Satisfactory agreement between the finite element models (FEM and predictions of the rigid-plastic analysis is obtained, which verifies that the proposed rigid-plastic methods are effective to solve the problem including strain rate sensitivity and strain hardening. The quantitative results for the scale effect of the strain rate sensitivity are given. The results for the stiffening effects suggest that two general stiffening factors n 1 and n 2, which characterizes the strain rate sensitivity and strain hardening effect, respectively can be defined. The saturated displacement is inversely proportional to the stiffening factors (i.e. n 1 and n 2 and saturated impulse is inversely proportional to the square roots of the stiffening factors (i.e. n 1 and n 2. Formulae for displacement and saturated impulse are proposed based on the empirical analysis.
Effect of strain rate and temperature at high strains on fatigue behavior of SAP alloys
DEFF Research Database (Denmark)
Blucher, J.T.; Knudsen, Per; Grant, N.J.
1968-01-01
Fatigue behavior of three SAP alloys of two nominal compositions (7 and 13% Al2O3) was studied in terms of strain rate and temperature at high strains; strain rate had no effect on life at 80 F, but had increasingly greater effect with increasing temperature above 500 F; life decreased with decre......Fatigue behavior of three SAP alloys of two nominal compositions (7 and 13% Al2O3) was studied in terms of strain rate and temperature at high strains; strain rate had no effect on life at 80 F, but had increasingly greater effect with increasing temperature above 500 F; life decreased...
Directory of Open Access Journals (Sweden)
Elaheh Movahed
Full Text Available The infection of Cryptococcus neoformans is acquired through the inhalation of desiccated yeast cells and basidiospores originated from the environment, particularly from bird's droppings and decaying wood. Three environmental strains of C. neoformans originated from bird droppings (H4, S48B and S68B and C. neoformans reference clinical strain (H99 were used for intranasal infection in C57BL/6 mice. We showed that the H99 strain demonstrated higher virulence compared to H4, S48B and S68B strains. To examine if gene expression contributed to the different degree of virulence among these strains, a genome-wide microarray study was performed to inspect the transcriptomic profiles of all four strains. Our results revealed that out of 7,419 genes (22,257 probes examined, 65 genes were significantly up-or down-regulated in H99 versus H4, S48B and S68B strains. The up-regulated genes in H99 strain include Hydroxymethylglutaryl-CoA synthase (MVA1, Mitochondrial matrix factor 1 (MMF1, Bud-site-selection protein 8 (BUD8, High affinity glucose transporter 3 (SNF3 and Rho GTPase-activating protein 2 (RGA2. Pathway annotation using DAVID bioinformatics resource showed that metal ion binding and sugar transmembrane transporter activity pathways were highly expressed in the H99 strain. We suggest that the genes and pathways identified may possibly play crucial roles in the fungal pathogenesis.
Zhang, Jinwu; Liu, Jianhong; Wang, Xin; Zou, Anquan
2017-08-01
General Strain Theory delineates different types of strain and intervening processes from strain to deviance and crime. In addition to explaining individual strain-crime relationship, a contextualized version of general strain theory, which is called the Macro General Strain Theory, has been used to analyze how aggregate variables influence aggregate and individual deviance and crime. Using a sample of 1,852 students (Level 1) nested in 52 schools (Level 2), the current study tests the Macro General Strain Theory using Chinese data. The results revealed that aggregate life stress and strain have influences on aggregate and individual deviance, and reinforce the individual stress-deviance association. The current study contributes by providing the first Macro General Strain Theory test based on Chinese data and offering empirical evidence for the multilevel intervening processes from strain to deviance. Limitations and future research directions are discussed.
Strain Pattern in Supercooled Liquids
Illing, Bernd; Fritschi, Sebastian; Hajnal, David; Klix, Christian; Keim, Peter; Fuchs, Matthias
2016-11-01
Investigations of strain correlations at the glass transition reveal unexpected phenomena. The shear strain fluctuations show an Eshelby-strain pattern [˜cos (4 θ ) /r2 ], characteristic of elastic response, even in liquids, at long times. We address this using a mode-coupling theory for the strain fluctuations in supercooled liquids and data from both video microscopy of a two-dimensional colloidal glass former and simulations of Brownian hard disks. We show that the long-ranged and long-lived strain signatures follow a scaling law valid close to the glass transition. For large enough viscosities, the Eshelby-strain pattern is visible even on time scales longer than the structural relaxation time τ and after the shear modulus has relaxed to zero.
Biological assay of attenuated strain NADL-2 and virulent strain NADL-8 of porcine parvovirus.
Mengeling, W L; Pejsak, Z; Paul, P S
1984-11-01
Attenuated strain NADL-2 and virulent strain NADL-8 of porcine parvovirus (PPV) were titrated in vivo and in vitro under similar conditions to provide a better understanding of some of the factors involved in virulence of PPV in causing maternal reproductive failure of swine. Both strains cause fetal death when they are injected directly into fetal fluids, but only strain NADL-8 does so when administered to pregnant swine. The strains were tested for their hemagglutinating activity (HA), median cell culture infective dose (CCID50), median fetal infective dose (FID50), and median fetal lethal dose (FLD50). The FID50 and FLD50 were determined by injecting virus directly into the amniotic fluid of fetuses in utero at 44 +/- 2 days of gestation and collecting the fetuses 15 +/- 1 days later. Both strains had an HA titer of 64, suggesting that there is a similar number of virions in stock preparations. However, other measurements differed markedly. The CCID50, FID50, and FLD50 were 10(5.5), 10(3.5), and 10(0.5), respectively, for strain NADL-2, and 10(4.5), 10(7.7), and 10(6.3), respectively, for strain NADL-8. Collectively, the values indicate that more than 10,000 times as much strain NADL-2 would need to reach the conceptus transplacentally to establish infection. These observations may help to explain the different consequences of oronasal exposure of pregnant swine to these strains of PPV.
Haldane model under nonuniform strain
Ho, Yen-Hung; Castro, Eduardo V.; Cazalilla, Miguel A.
2017-10-01
We study the Haldane model under strain using a tight-binding approach, and compare the obtained results with the continuum-limit approximation. As in graphene, nonuniform strain leads to a time-reversal preserving pseudomagnetic field that induces (pseudo-)Landau levels. Unlike a real magnetic field, strain lifts the degeneracy of the zeroth pseudo-Landau levels at different valleys. Moreover, for the zigzag edge under uniaxial strain, strain removes the degeneracy within the pseudo-Landau levels by inducing a tilt in their energy dispersion. The latter arises from next-to-leading order corrections to the continuum-limit Hamiltonian, which are absent for a real magnetic field. We show that, for the lowest pseudo-Landau levels in the Haldane model, the dominant contribution to the tilt is different from graphene. In addition, although strain does not strongly modify the dispersion of the edge states, their interplay with the pseudo-Landau levels is different for the armchair and zigzag ribbons. Finally, we study the effect of strain in the band structure of the Haldane model at the critical point of the topological transition, thus shedding light on the interplay between nontrivial topology and strain in quantum anomalous Hall systems.
Eto, Tomoo; Takahashi, Riichi; Kamisako, Tsutomu
2015-04-01
Strain preservation of experimental animals is crucial for experimental reproducibility. Maintaining complete animal strains, however, is costly and there is a risk for genetic mutations as well as complete loss due to disasters or illness. Therefore, the development of effective vitrification techniques for cryopreservation of multiple experimental animal strains is important. We examined whether a vitrification method using cryoprotectant solutions, P10 and PEPeS, is suitable for preservation of multiple inbred and outbred mouse strains. First, we investigated whether our vitrification method using cryoprotectant solutions was suitable for two-cell stage mouse embryos. In vitro development of embryos exposed to the cryoprotectant solutions was similar to that of fresh controls. Further, the survival rate of the vitrified embryos was extremely high (98.1%). Next, we collected and vitrified two-cell stage embryos of 14 mouse strains. The average number of embryos obtained from one female was 7.3-33.3. The survival rate of vitrified embryos ranged from 92.8% to 99.1%, with no significant differences among mouse strains. In vivo development did not differ significantly between fresh controls and vitrified embryos of each strain. For strain preservation using cryopreserved embryos, two offspring for inbred lines and one offspring for outbred lines must be produced from two-cell stage embryos collected from one female. The expected number of surviving fetuses obtained from embryos collected from one female of either the inbred or outbred strains ranged from 2.9 to 19.5. The findings of the present study indicated that this vitrification method is suitable for strain preservation of multiple mouse strains. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.
Colony Dimorphism in Bradyrhizobium Strains
Sylvester-Bradley, Rosemary; Thornton, Philip; Jones, Peter
1988-01-01
Ten isolates of Bradyrhizobium spp. which form two colony types were studied; the isolates originated from a range of legume species. The two colony types differed in the amount of gum formed or size or both, depending on the strain. Whole 7-day-old colonies of each type were subcultured to determine the proportion of cells which had changed to the other type. An iterative computerized procedure was used to determine the rate of switching per generation between the two types and to predict proportions reached at equilibrium for each strain. The predicted proportions of the wetter (more gummy) or larger colony type at equilibrium differed significantly between strains, ranging from 0.9999 (strain CIAT 2383) to 0.0216 (strain CIAT 2469), because some strains switched faster from dry to wet (or small to large) and others switched faster from wet to dry (or large to small). Predicted equilibrium was reached after about 140 generations in strain USDA 76. In all but one strain (CIAT 3030) the growth rate of the wetter colony type was greater than or similar to that of the drier type. The mean difference in generation time between the two colony types was 0.37 h. Doubling times calculated for either colony type after 7 days of growth on the agar surface ranged from 6.0 to 7.3 h. The formation of two persistent colony types by one strain (clonal or colony dimorphism) may be a common phenomenon among Bradyrhizobium strains. Images PMID:16347599
Energy Technology Data Exchange (ETDEWEB)
Chen Feng [Xi' an Jiaotong University, Xi' an, Shaanxi 710049 (China); Euaruksakul, Chanan; Himpsel, F J; Lagally, Max G [University of Wisconsin-Madison, Madison, WI 53706 (United States); Liu Zheng; Liu Feng, E-mail: lagally@engr.wisc.edu [University of Utah, Salt Lake City, UT 84112 (United States)
2011-08-17
Strain changes the band structure of semiconductors. We use x-ray absorption spectroscopy to study the change in the density of conduction band (CB) states when silicon is uniaxially strained along the [1 0 0] and [1 1 0] directions. High stress can be applied to silicon nanomembranes, because their thinness allows high levels of strain without fracture. Strain-induced changes in both the sixfold degenerate {Delta} valleys and the eightfold degenerate L valleys are determined quantitatively. The uniaxial deformation potentials of both {Delta} and L valleys are directly extracted using a strain tensor appropriate to the boundary conditions, i.e., confinement in the plane in the direction orthogonal to the straining direction, which correspond to those of strained CMOS in commercial applications. The experimentally determined deformation potentials match the theoretical predictions well. We predict electron mobility enhancement created by strain-induced CB modifications.
Studies on Drosophila radiosensitive strains
International Nuclear Information System (INIS)
Varentsova, E.P.; Zakharov, I.A.
1976-01-01
45 of radiosensitive strains of Drosophila melanogaster were isolated by Curly/Lobe technique after EMS treatment of Livadia population males. The lethality of non-Curly late larvae after gamma-irradiation (4000r) characterized radiosensitivity strains. Most of them exhibited higher frequency of the spontaneous dominant lethals (up to 69%). The males of 6 strains were semi-sterile. 5 of these strains exhibited higher frequency of X-chromosome non-disjunction
Segregation of genes from donor strain during the production of recombinant congenic strains.
van Zutphen, L F; Den Bieman, M; Lankhorst, A; Demant, P
1991-07-01
Recombinant congenic strains (RCS) constitute a set of inbred strains which are designed to dissect the genetic control of multigenic traits, such as tumour susceptibility or disease resistance. Each RCS contains a small fraction of the genome of a common donor strain, while the majority of genes stem from a common background strain. We tested at two stages of the inbreeding process in 20 RCS, derived from BALB/cHeA and STS/A, to see whether alleles from the STS/A donor strain are distributed over the RCS in a ratio as would theoretically be expected. Four marker genes (Pep-3; Pgm-1; Gpi-1 and Es-3) located at 4 different chromosomes were selected and the allelic distribution was tested after 3-4 and after 12 generations of inbreeding. The data obtained do not significantly deviate from the expected pattern, thus supporting the validity of the concept of RCS.
A new strain gage method for measuring the contractile strain ratio of Zircaloy tubing
International Nuclear Information System (INIS)
Hwang, S.K.; Sabol, G.P.
1988-01-01
An improved strain gage method for determining the contractile strain ratio (CSR) of Zircaloy tubing was developed. The new method consists of a number of load-unload cyclings at approximately 0.2% plastic strain interval. With this method the CSR of Zircaloy-4 tubing could be determined accurately because it was possible to separate the plastic strains from the elastic strain involvement. The CSR values determined by use of the new method were in good agreement with those calculated from conventional post-test manual measurements. The CSR of the tubing was found to decrease with the amount of deformation during testing because of uneven plastic flow in the gage section. A new technique of inscribing gage marks by use of a YAG laser is discussed. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Guelorget, Bruno [Institut Charles Delaunay-LASMIS, Universite de technologie de Troyes, FRE CNRS 2848, 12 rue Marie Curie, B.P. 2060, 10010 Troyes Cedex (France)], E-mail: bruno.guelorget@utt.fr; Francois, Manuel; Montay, Guillaume [Institut Charles Delaunay-LASMIS, Universite de technologie de Troyes, FRE CNRS 2848, 12 rue Marie Curie, B.P. 2060, 10010 Troyes Cedex (France)
2009-04-15
In this paper, electronic speckle pattern interferometry strain rate measurements are used to quantify the width of the strain localization band, which occurs when a sheet specimen is submitted to tension. It is shown that the width of this band decreases with increasing strain. Just before fracture, this measured width is about five times wider than the shear band and the initial sheet thickness.
Thermal strain measurement of EAST W/Cu divertor structure using electric resistance strain gauges
Energy Technology Data Exchange (ETDEWEB)
Wang, Xingli [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Science Island Branch of Graduate School, University of Science & Technology of China, Hefei, 230031 (China); Wang, Wanjing, E-mail: wjwang@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Wang, Jichao [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Wei, Ran; Sun, Zhaoxuan [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Science Island Branch of Graduate School, University of Science & Technology of China, Hefei, 230031 (China); Li, Qiang; Xie, Chunyi [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Chen, Hong-En; Wang, Kaiqiang; Wu, Lei; Chen, Zhenmao [State Key Lab for Strength and Vibration of Mechanical Structures, Xi’an Jiaotong University (China); Luo, Guang-Nan [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Science Island Branch of Graduate School, University of Science & Technology of China, Hefei, 230031 (China); Hefei Center for Physical Science and Technology, Hefei, 230022 (China); Hefei Science Center of Chinese Academy of Sciences, Hefei, 230027 (China)
2016-12-15
Highlights: • To understand the service behavior of W/Cu divertor, an electrical resistance strain gauge system had been introduced in a thermal strain measurement experiment. • The measurement system successfully finished the experiment and obtained valued thermal strain data. • Two thermomechanical analyses had also been carried out and compared with the measurement results. • Experiment results corresponded well to simulations and threw a light upon the failure of W/Cu divertor in the previous baking tests. - Abstract: W/Cu divertor has complex structure and faces extreme work environment in EAST Tokamak device. To measure its thermal strain shall be a valued way to understand its service behavior and then optimize its design and manufacturing process. This work presents a preliminary study on measuring thermal strain of EAST W/Cu divertor structure using electric resistance strain gauges. Eight gauges had been used in the experiment and the heating temperature had been set to 230 °C with respect to the work temperature. To realize the measuring experiment, an appropriate fixing method of gauges in divertor narrow spaces had been taken and tested, which could not only withstand high temperature but also had no damage to the divertor sample. The measurement results were that three gauges showed positive strain while other three showed negative strain after having been compensated, which corresponded to tensile stress and compressed stress respectively. Two thermomechanical simulations had also been carried out and used for comparing with the experiment.
Noninvasive characterization of carotid plaque strain.
Khan, Amir A; Sikdar, Siddhartha; Hatsukami, Thomas; Cebral, Juan; Jones, Michael; Huston, John; Howard, George; Lal, Brajesh K
2017-06-01
Current risk stratification of internal carotid artery plaques based on diameter-reducing percentage stenosis may be unreliable because ischemic stroke results from plaque disruption with atheroembolization. Biomechanical forces acting on the plaque may render it vulnerable to rupture. The feasibility of ultrasound-based quantification of plaque displacement and strain induced by hemodynamic forces and their relationship to high-risk plaques have not been determined. We studied the feasibility and reliability of carotid plaque strain measurement from clinical B-mode ultrasound images and the relationship of strain to high-risk plaque morphology. We analyzed carotid ultrasound B-mode cine loops obtained in patients with asymptomatic ≥50% stenosis during routine clinical scanning. Optical flow methods were used to quantify plaque motion and shear strain during the cardiac cycle. The magnitude (maximum absolute shear strain rate [MASSR]) and variability (entropy of shear strain rate [ESSR] and variance of shear strain rate [VSSR]) of strain were combined into a composite shear strain index (SSI), which was assessed for interscan repeatability and correlated with plaque echolucency. Nineteen patients (mean age, 70 years) constituting 36 plaques underwent imaging; 37% of patients (n = 7) showed high strain (SSI ≥0.5; MASSR, 2.2; ESSR, 39.7; VSSR, 0.03) in their plaques; the remaining clustered into a low-strain group (SSI routine B-mode imaging using clinical ultrasound machines. High plaque strain correlates with known high-risk echolucent morphology. Strain measurement can complement identification of patients at high risk for plaque disruption and stroke. Copyright © 2017 Society for Vascular Surgery. Published by Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Cheng Zhong
Full Text Available A better understanding of metabolic fluxes is important for manipulating microbial metabolism toward desired end products, or away from undesirable by-products. A mutant strain, Gluconacetobacter xylinus AX2-16, was obtained by combined chemical mutation of the parent strain (G. xylinus CGMCC 2955 using DEC (diethyl sulfate and LiCl. The highest bacterial cellulose production for this mutant was obtained at about 11.75 g/L, which was an increase of 62% compared with that by the parent strain. In contrast, gluconic acid (the main byproduct concentration was only 5.71 g/L for mutant strain, which was 55.7% lower than that of parent strain. Metabolic flux analysis indicated that 40.1% of the carbon source was transformed to bacterial cellulose in mutant strain, compared with 24.2% for parent strain. Only 32.7% and 4.0% of the carbon source were converted into gluconic acid and acetic acid in mutant strain, compared with 58.5% and 9.5% of that in parent strain. In addition, a higher flux of tricarboxylic acid (TCA cycle was obtained in mutant strain (57.0% compared with parent strain (17.0%. It was also indicated from the flux analysis that more ATP was produced in mutant strain from pentose phosphate pathway (PPP and TCA cycle. The enzymatic activity of succinate dehydrogenase (SDH, which is one of the key enzymes in TCA cycle, was 1.65-fold higher in mutant strain than that in parent strain at the end of culture. It was further validated by the measurement of ATPase that 3.53-6.41 fold higher enzymatic activity was obtained from mutant strain compared with parent strain.
Mumps Hoshino and Torii vaccine strains were distinguished from circulating wild strains.
Sawada, Akihito; Yamaji, Yoshiaki; Nakayama, Tetsuo
2013-06-01
Aseptic meningitis and acute parotitis have been observed after mumps vaccination. Mumps outbreaks have been reported in Japan because of low vaccine coverage, and molecular differentiation is required to determine whether these cases are vaccine associated. RT-nested PCR was performed in the small hydrophobic gene region, and viruses were differentiated by restriction fragment length polymorphism assay. A total of 584 nucleotides were amplified. The PCR product of the Hoshino strain was cut into two fragments (313 and 271 nucleotides) by MfeI; that of the Torii strain was digested with EcoT22I, resulting in 332- and 252-nucleotide fragments. Both strains were genotype B and had an XbaI site, resulting in two fragments: 299 and 285 nucleotides. Current circulating wild types were cut only by XbaI or MfeI. However, the MfeI site of the wild types was different from that of the Hoshino strain, resulting in 451- and 133-nucleotide fragments. Using three restriction enzymes, two mumps vaccine strains were distinguished from wild types, and this separation was applied to the identification of vaccine-related adverse events.
An Embeddable Strain Sensor with 30 Nano-Strain Resolution Based on Optical Interferometry
Directory of Open Access Journals (Sweden)
Chen Zhu
2018-04-01
Full Text Available A cost-effective, robust and embeddable optical interferometric strain sensor with nanoscale strain resolution is presented in this paper. The sensor consists of an optical fiber, a quartz rod with one end coated with a thin gold layer, and two metal shells employed to transfer the strain and orient and protect the optical fiber and the quartz rod. The optical fiber endface, combining with the gold-coated surface, forms an extrinsic Fabry–Perot interferometer. The sensor was firstly calibrated, and the result showed that our prototype sensor could provide a measurement resolution of 30 nano-strain (nε and a sensitivity of 10.01 µε/µm over a range of 1000 µε. After calibration of the sensor, the shrinkage strain of a cubic brick of mortar in real time during the drying process was monitored. The strain sensor was compared with a commercial linear variable displacement transducer, and the comparison results in four weeks demonstrated that our sensor had much higher measurement resolution and gained more detailed and useful information. Due to the advantages of the extremely simple, robust and cost-effective configuration, it is believed that the sensor is significantly beneficial to practical applications, especially for structural health monitoring.
An ultrasensitive strain sensor with a wide strain range based on graphene armour scales.
Yang, Yi-Fan; Tao, Lu-Qi; Pang, Yu; Tian, He; Ju, Zhen-Yi; Wu, Xiao-Ming; Yang, Yi; Ren, Tian-Ling
2018-06-12
An ultrasensitive strain sensor with a wide strain range based on graphene armour scales is demonstrated in this paper. The sensor shows an ultra-high gauge factor (GF, up to 1054) and a wide strain range (ε = 26%), both of which present an advantage compared to most other flexible sensors. Moreover, the sensor is developed by a simple fabrication process. Due to the excellent performance, this strain sensor can meet the demands of subtle, large and complex human motion monitoring, which indicates its tremendous application potential in health monitoring, mechanical control, real-time motion monitoring and so on.
International Nuclear Information System (INIS)
Guelorget, Bruno; Francois, Manuel; Vial-Edwards, Cristian; Montay, Guillaume; Daniel, Laurent; Lu, Jian
2006-01-01
In-plane Electronic Speckle Pattern Interferometry has been successfully used during tensile testing of semi-hard copper sheets in order to measure the strain rate. On one hand, heterogeneity in strain rate field has been found before the maximum of the tensile force (ε t ≅ 19.4 and 25.4%, respectively). Thus, a localization phenomenon occurs before the classic Considere's criterion (dF = 0) for the diffuse neck initiation. On the other hand, strain rate measurement before fracture shows the moment where one of the two slip band systems becomes predominant, then strain concentrates in a small area, the shear band. Uncertainty evaluation has been carried out, which shows a very good accuracy of the total strain and the strain rate measurements
Energy Technology Data Exchange (ETDEWEB)
Guelorget, Bruno [Universite de Technologie de Troyes (UTT), Laboratoire des Systemes Mecaniques et d' ingenierie Simultanee (LASMIS, CNRS FRE 2719), 12 rue Marie Curie, B.P. 2060, 10010 Troyes Cedex (France)]. E-mail: bruno.guelorget@utt.fr; Francois, Manuel [Universite de Technologie de Troyes (UTT), Laboratoire des Systemes Mecaniques et d' ingenierie Simultanee (LASMIS, CNRS FRE 2719), 12 rue Marie Curie, B.P. 2060, 10010 Troyes Cedex (France); Vial-Edwards, Cristian [Departemento de Ingenieria Mecanica y Metalurgica, Pontificia Universidad Catolica de Chile, Vicuna Mackenna 4860, 6904411 Santiago (Chile); Montay, Guillaume [Universite de Technologie de Troyes (UTT), Laboratoire des Systemes Mecaniques et d' ingenierie Simultanee (LASMIS, CNRS FRE 2719), 12 rue Marie Curie, B.P. 2060, 10010 Troyes Cedex (France); Daniel, Laurent [Universite de Technologie de Troyes (UTT), Laboratoire des Systemes Mecaniques et d' ingenierie Simultanee (LASMIS, CNRS FRE 2719), 12 rue Marie Curie, B.P. 2060, 10010 Troyes Cedex (France); Lu, Jian [Universite de Technologie de Troyes (UTT), Laboratoire des Systemes Mecaniques et d' ingenierie Simultanee (LASMIS, CNRS FRE 2719), 12 rue Marie Curie, B.P. 2060, 10010 Troyes Cedex (France)
2006-01-15
In-plane Electronic Speckle Pattern Interferometry has been successfully used during tensile testing of semi-hard copper sheets in order to measure the strain rate. On one hand, heterogeneity in strain rate field has been found before the maximum of the tensile force ({epsilon} {sup t} {approx_equal} 19.4 and 25.4%, respectively). Thus, a localization phenomenon occurs before the classic Considere's criterion (dF = 0) for the diffuse neck initiation. On the other hand, strain rate measurement before fracture shows the moment where one of the two slip band systems becomes predominant, then strain concentrates in a small area, the shear band. Uncertainty evaluation has been carried out, which shows a very good accuracy of the total strain and the strain rate measurements.
International Nuclear Information System (INIS)
Browning, R.V.; Scammon, R.J.
1998-01-01
Modeling impact events on systems containing plastic bonded explosive materials requires accurate models for stress evolution at high strain rates out to large strains. For example, in the Steven test geometry reactions occur after strains of 0.5 or more are reached for PBX-9501. The morphology of this class of materials and properties of the constituents are briefly described. We then review the viscoelastic behavior observed at small strains for this class of material, and evaluate large strain models used for granular materials such as cap models. Dilatation under shearing deformations of the PBX is experimentally observed and is one of the key features modeled in cap style plasticity theories, together with bulk plastic flow at high pressures. We propose a model that combines viscoelastic behavior at small strains but adds intergranular stresses at larger strains. A procedure using numerical simulations and comparisons with results from flyer plate tests and low rate uniaxial stress tests is used to develop a rough set of constants for PBX-9501. Comparisons with the high rate flyer plate tests demonstrate that the observed characteristic behavior is captured by this viscoelastic based model. copyright 1998 American Institute of Physics
DEFF Research Database (Denmark)
2017-01-01
The invention relates to a strain gauge of a carrier layer and a meandering measurement grid (101) positioned on the carrier layer, wherein the measurement grid comprises a number of measurement grid sections placed side by side with gaps in between, and a number of end loops (106) interconnecting...... relates to a method for manufacturing a strain gauge as mentioned above....
Origin of the Strain Sensitivity for an Organic Heptazole Thin-Film and Its Strain Gauge Application
Bae, Heesun; Jeon, Pyo Jin; Park, Ji Hoon; Lee, Kimoon
2018-04-01
The authors report on the origin of the strain sensitivity for an organic C26H16N2 (heptazole) thinfilm and its application for the detection of tensile strain. From the electrical characterization on the thin-film transistor adopting a heptazole channel, heptazole film exhibits p-channel conduction with a relatively low value of field-effect mobility (0.05 cm2/Vs), suggesting a hopping conduction behavior via hole carriers. By analyzing the strain and temperature dependences of the electrical conductivity, we reveal that the electrical conduction for a heptazole thin-film is dominated by the variable range hopping process with quite a large energy separation (224.9 meV) between the localized states under a relatively long attenuation length (10.46 Å). This indicates that a change in the inter-grain spacing that is much larger than the attenuation length is responsible for the reversible modification of electrical conductivity depending on strain for the heptazole film. By utilizing our heptazole thin-film both as a strain sensitive passive resistor and an active semiconducting channel layer, we can achieve a strain gauge device exhibiting reversible endurance for tensile strains up to 2.12%. Consequently, this study advances the understanding of the fundamental strain sensing mechanism in a heptazole thin-film toward finding a promise material with a strain gauge for applications as potential flexible devices and/or wearable electronics.
Asymptomatic bacteriuria Escherichia coli strains
DEFF Research Database (Denmark)
Hancock, Viktoria; Nielsen, E.M.; Klemm, Per
2006-01-01
Urinary tract infections (UTIs) affect millions of people each year. Escherichia coli is the most common organism associated with asymptomatic bacteriuria (ABU) in humans. Persons affected by ABU may carry a particular E. coli strain for extended periods of time without any symptoms. In contrast...... to uropathogenic E. coli (UPEC) that cause symptomatic UTI, very little is known about the mechanisms by which these strains colonize the urinary tract. Here, we have investigated the growth characteristics in human urine as well as adhesin repertoire of nine ABU strains; the ability of ABU strains to compete...
Strain-controlled nonvolatile magnetization switching
Geprägs, S.; Brandlmaier, A.; Brandt, M. S.; Gross, R.; Goennenwein, S. T. B.
2014-11-01
We investigate different approaches towards a nonvolatile switching of the remanent magnetization in single-crystalline ferromagnets at room temperature via elastic strain using ferromagnetic thin film/piezoelectric actuator hybrids. The piezoelectric actuator induces a voltage-controllable strain along different crystalline directions of the ferromagnetic thin film, resulting in modifications of its magnetization by converse magnetoelastic effects. We quantify the magnetization changes in the hybrids via ferromagnetic resonance spectroscopy and superconducting quantum interference device magnetometry. These measurements demonstrate a significant strain-induced change of the magnetization, limited by an inefficient strain transfer and domain formation in the particular system studied. To overcome these obstacles, we address practicable engineering concepts and use a model to demonstrate that a strain-controlled, nonvolatile magnetization switching should be possible in appropriately engineered ferromagnetic/piezoelectric actuator hybrids.
Directory of Open Access Journals (Sweden)
Matheus M. Mantovani
2012-12-01
Full Text Available The measurement of cardiovascular features of wild animals is important, as is the measurement in pets, for the assessment of myocardial function and the early detection of cardiac abnormalities, which could progress to heart failure. Speckle tracking echocardiography (2D STE is a new tool that has been used in veterinary medicine, which demonstrates several advantages, such as angle independence and the possibility to provide the early diagnosis of myocardial alterations. The aim of this study was to evaluate the left myocardial function in a maned wolf by 2D STE. Thus, the longitudinal, circumferential and radial strain and strain rate were obtained, as well as, the radial and longitudinal velocity and displacement values, from the right parasternal long axis four-chamber view, the left parasternal apical four chamber view and the parasternal short axis at the level of the papillary muscles. The results of the longitudinal variables were -13.52±7.88, -1.60±1.05, 4.34±2.52 and 3.86±3.04 for strain (%, strain rate (1/s, displacement (mm and velocity (cm/s, respectively. In addition, the radial and circumferential Strain and Strain rate were 24.39±14.23, 1.86±0.95 and -13.69±6.53, -1.01±0.48, respectively. Thus, the present study provides the first data regarding the use of this tool in maned wolves, allowing a more complete quantification of myocardial function in this species.A obtenção de parâmetros cardiovasculares em animais selvagens são importantes de serem avaliados, assim como em animais de companhia, para a obtenção da função miocárdica e determinação precoce de alterações cardíacas que poderiam evoluir para insuficiência cardíaca . A ecocardiografia speckle tracking (2D STE é uma ferramenta nova que tem sido utilizada em medicina veterinária, a qual tem demonstrado várias vantagens quanto ao seu uso, como a independência do ângulo de insonação e a possibilidade de se obter o diagnóstico precoce de altera
International Nuclear Information System (INIS)
Krieg, R.
2005-01-01
The local failure strains of essential design elements of a reactor vessel are investigated. The size influence of the structure is of special interest. Typical severe accident conditions including elevated temperatures and dynamic loads are considered. The main part of work consists of test families with specimens under uniaxial and biaxial load. Within one test family the specimen geometry and the load conditions are similar, but the size is varied up to reactor dimensions. Special attention is given to geometries with a hole or a notch causing non-uniform stress and strain distributions typical for the reactor vessel. A key problem is to determine the local failure strain. Here suitable methods had to be developed including the so-called 'vanishing gap method', and the 'forging die method'. They are based on post-test geometrical measurements of the fracture surfaces and reconstructions of the related strain fields using finite element models. The results indicate that stresses versus dimensionless deformations are approximately size independent up to failure for specimens of similar geometry under similar load conditions. Local failure strains could be determined. The values are rather high and size dependent. Statistical evaluation allow the proposal of limit strains which are also size dependent. If these limit strains are not exceeded, the structures will not fracture
Moon, Byongook; Blurton, David; McCluskey, John D.
2008-01-01
The study examines the effects of recent, older, and chronic strains and of perceived injustice of strain on delinquency, sampling 777 Korean youth. Seven key strains most likely leading to delinquency, some of which were often overlooked in previous research, were included, and these are family conflict, parental punishment, teachers' punishment,…
Enzyme markers in inbred rat strains: genetics of new markers and strain profiles.
Adams, M; Baverstock, P R; Watts, C H; Gutman, G A
1984-08-01
Twenty-six inbred strains of the laboratory rat (Rattus norvegicus) were examined for electrophoretic variation at an estimated 97 genetic loci. In addition to previously documented markers, variation was observed for the enzymes aconitase, aldehyde dehydrogenase, and alkaline phosphatase. The genetic basis of these markers (Acon-1, Ahd-2, and Akp-1) was confirmed. Linkage analysis between 35 pairwise comparisons revealed that the markers Fh-1 and Pep-3 are linked. The strain profiles of the 25 inbred strains at 11 electrophoretic markers are given.
International Nuclear Information System (INIS)
Suzuki, Hiroshi; Harjo, Stefanus; Abe, Jun; Xu, Pingguang; Aizawa, Kazuya; Akita, Koichi
2013-01-01
Spurious or pseudo-strains observed in time-of-flight (TOF) neutron diffraction due to neutron attenuation, surface-effects and a strain distribution within the gauge volume were investigated. Experiments were carried out on annealed and bent ferritic steel bars to test these effects. The most representative position in the gauge volume corresponds to the neutron-weighted center of gravity (ncog), which takes into account variations in intensity within the gauge volume due to neutron attenuation and/or absence of material in the gauge volume. The average strain in the gauge volume was observed to be weighted towards the ncog position but following an increase in the size of the gauge volume the weighted average strain was changed because of the change in the ncog position when a strain gradient appeared within the gauge volume. On the other hand, typical pseudo-strains, which are well known, did appear in through-surface strain measurements when the gauge volume was incompletely filled by the sample. Tensile pseudo-strains due to the surface-effect increased near the sample surface and exhibited a similar trend regardless of the size of the gauge volume, while the pseudo-strains increased faster for the smaller gauge volume. Furthermore, a pseudo-strain due to a change in the ncog position was observed even when the gauge volume was perfectly filled in the sample, and it increased with an increase in the size of the gauge volume. These pseudo-strains measured were much larger than those simulated by the conventional modeling, whereas they were simulated by taking into account an incident neutron beam divergence additionally in the model. Therefore, the incident divergence of the incident neutron beam must be carefully designed to avoid pseudo-strains in time-of-flight neutron diffractometry
A wide extent of inter-strain diversity in virulent and vaccine strains of alphaherpesviruses.
Szpara, Moriah L; Tafuri, Yolanda R; Parsons, Lance; Shamim, S Rafi; Verstrepen, Kevin J; Legendre, Matthieu; Enquist, L W
2011-10-01
Alphaherpesviruses are widespread in the human population, and include herpes simplex virus 1 (HSV-1) and 2, and varicella zoster virus (VZV). These viral pathogens cause epithelial lesions, and then infect the nervous system to cause lifelong latency, reactivation, and spread. A related veterinary herpesvirus, pseudorabies (PRV), causes similar disease in livestock that result in significant economic losses. Vaccines developed for VZV and PRV serve as useful models for the development of an HSV-1 vaccine. We present full genome sequence comparisons of the PRV vaccine strain Bartha, and two virulent PRV isolates, Kaplan and Becker. These genome sequences were determined by high-throughput sequencing and assembly, and present new insights into the attenuation of a mammalian alphaherpesvirus vaccine strain. We find many previously unknown coding differences between PRV Bartha and the virulent strains, including changes to the fusion proteins gH and gB, and over forty other viral proteins. Inter-strain variation in PRV protein sequences is much closer to levels previously observed for HSV-1 than for the highly stable VZV proteome. Almost 20% of the PRV genome contains tandem short sequence repeats (SSRs), a class of nucleic acids motifs whose length-variation has been associated with changes in DNA binding site efficiency, transcriptional regulation, and protein interactions. We find SSRs throughout the herpesvirus family, and provide the first global characterization of SSRs in viruses, both within and between strains. We find SSR length variation between different isolates of PRV and HSV-1, which may provide a new mechanism for phenotypic variation between strains. Finally, we detected a small number of polymorphic bases within each plaque-purified PRV strain, and we characterize the effect of passage and plaque-purification on these polymorphisms. These data add to growing evidence that even plaque-purified stocks of stable DNA viruses exhibit limited sequence
ACTIVIDAD ANTIFUNGICA DEL EXTRACTO DE Brosimum rubescens (Palisangre
Directory of Open Access Journals (Sweden)
María Fachín-Espinar
2012-12-01
Full Text Available El extracto etanólico y sus fracciones cromatográficas del tallo de Brosimum rubencens Taubert fueron evaluados para determinar la actividad antifúngica in vitro mediante el método de macrodilución para hongos filamentosos. El tamizaje fitoquímico del extracto etanólico del tallo de B. rubencens evidenció la presencia de cumarinas, quinonas y taninos, además de flavonoides y triterpenos; para el estudio de la actividad antifúngica se utilizó cepas de Trichosporum rubrum ATCC 28188 y Trichosporum mentagrophytes ATCC 24953. En ambos casos la fracción insoluble en dilución ácida evidenció mayor actividad antifúngica que el extracto etanólico contra dermatofitos. El fraccionamiento del extracto etanólico permitió inferir que el responsables de la actividad se debe a los fitocomplejos, no así a las fracciones frente a T. rubrum ATCC 28188.
Hydrogen production from microbial strains
Harwood, Caroline S; Rey, Federico E
2012-09-18
The present invention is directed to a method of screening microbe strains capable of generating hydrogen. This method involves inoculating one or more microbes in a sample containing cell culture medium to form an inoculated culture medium. The inoculated culture medium is then incubated under hydrogen producing conditions. Once incubating causes the inoculated culture medium to produce hydrogen, microbes in the culture medium are identified as candidate microbe strains capable of generating hydrogen. Methods of producing hydrogen using one or more of the microbial strains identified as well as the hydrogen producing strains themselves are also disclosed.
Boyanova, L; Gergova, G; Markovska, R; Yordanov, D; Mitov, I
2017-12-01
The aim of the study was to detect anti-Helicobacter pylori activity of seven Lactobacillus delbrueckii subsp. bulgaricus (GLB) strains by four cell-free supernatant (CFS) types. Activity of non-neutralized and non-heat-treated (CFSs1), non-neutralized and heat-treated (CFSs2), pH neutralized, catalase-treated and non-heat-treated (CFSs3), or neutralized, catalase- and heat-treated (CFSs4) CFSs against 18 H. pylori strains (11 of which with antibiotic resistance) was evaluated. All GLB strains produced bacteriocin-like inhibitory substances (BLISs), the neutralized CFSs of two GLB strains inhibited >81% of test strains and those of four GLB strains were active against >71% of antibiotic resistant strains. Two H. pylori strains were BLIS resistant. The heating did not reduce the CFS activity. Briefly, all GLB strains evaluated produced heat-stable BLISs, although GLB and H. pylori strain susceptibility patterns exhibited differences. Bacteriocin-like inhibitory substance activity can be an advantage for the probiotic choice for H. pylori infection control. In this study, anti-Helicobacter pylori activity of seven Lactobacillus delbrueckii subsp. bulgaricus (GLB) strains was evaluated by four cell-free supernatant (CFS) types. The GLB strains produced heat-stable bacteriocin-like inhibitory substances (BLISs) with a strong anti-H. pylori activity and some neutralized, catalase- and heat-treated CFSs inhibited >83% of the test strains. Bacteriocin-like inhibitory substance production of GLB strains can render them valuable probiotics in the control of H. pylori infection. © 2017 The Society for Applied Microbiology.
International Nuclear Information System (INIS)
Languille, A.
1979-07-01
The Phenix reactor has operated for 4 years in a satisfactory manner. The first 2 sub-assembly loadings contained pins clad in solution treated 316. The principal pin strains are: diametral strain (swelling and irradiation creep), ovality and spiral bending of the pin (interaction of wire and pin cluster and wrapper). A pin cluster irradiated to a dose of 80 dpa F reached a pin diameter strain of 5%. This strain is principally due to swelling (low fission gas pressure). The principal parameters governing the swelling are instantaneous dose, time and temperature for a given type of pin cladding. Other types of steel are or will be irradiated in Phenix. In particular, cold-worked titanium stabilised 316 steel should contribute towards a reduction in the pin clad strains and increase the target burn-up in this reactor. (author)
Strain screen and haplotype association mapping of wheel running in inbred mouse strains.
Lightfoot, J Timothy; Leamy, Larry; Pomp, Daniel; Turner, Michael J; Fodor, Anthony A; Knab, Amy; Bowen, Robert S; Ferguson, David; Moore-Harrison, Trudy; Hamilton, Alicia
2010-09-01
Previous genetic association studies of physical activity, in both animal and human models, have been limited in number of subjects and genetically homozygous strains used as well as number of genomic markers available for analysis. Expansion of the available mouse physical activity strain screens and the recently published dense single-nucleotide polymorphism (SNP) map of the mouse genome (approximately 8.3 million SNPs) and associated statistical methods allowed us to construct a more generalizable map of the quantitative trait loci (QTL) associated with physical activity. Specifically, we measured wheel running activity in male and female mice (average age 9 wk) in 41 inbred strains and used activity data from 38 of these strains in a haplotype association mapping analysis to determine QTL associated with activity. As seen previously, there was a large range of activity patterns among the strains, with the highest and lowest strains differing significantly in daily distance run (27.4-fold), duration of activity (23.6-fold), and speed (2.9-fold). On a daily basis, female mice ran further (24%), longer (13%), and faster (11%). Twelve QTL were identified, with three (on Chr. 12, 18, and 19) in both male and female mice, five specific to males, and four specific to females. Eight of the 12 QTL, including the 3 general QTL found for both sexes, fell into intergenic areas. The results of this study further support the findings of a moderate to high heritability of physical activity and add general genomic areas applicable to a large number of mouse strains that can be further mined for candidate genes associated with regulation of physical activity. Additionally, results suggest that potential genetic mechanisms arising from traditional noncoding regions of the genome may be involved in regulation of physical activity.
Matveenko; Kosheleva; Shardakov; Voronkov
2018-04-01
The presence of process-induced strains induced by various manufacturing and operational factors is one of the characteristics of polymer composite materials (PCM). Conventional methods of registration and evaluation of process-induced strains can be laborious, time-consuming and demanding in terms of technical applications. The employment of embedded fibre-optic strain sensors (FOSS) offers a real prospect of measuring residual strains. This paper demonstrates the potential for using embedded FOSS for recording technological strains in a PCM plate. The PCM plate is manufactured from prepreg, using the direct compression-moulding method. In this method, the prepared reinforcing package is placed inside a mould, heated, and then exposed to compaction pressure. The examined technology can be used for positioning FOSS between the layers of the composite material. Fibre-optic sensors, interacting with the material of the examined object, make it possible to register the evolution of the strain process during all stages of polymer-composite formation. FOSS data were recorded with interrogator ASTRO X 327. The obtained data were processed using specially developed algorithms.
Sensitivity Enhancement of FBG-Based Strain Sensor.
Li, Ruiya; Chen, Yiyang; Tan, Yuegang; Zhou, Zude; Li, Tianliang; Mao, Jian
2018-05-17
A novel fiber Bragg grating (FBG)-based strain sensor with a high-sensitivity is presented in this paper. The proposed FBG-based strain sensor enhances sensitivity by pasting the FBG on a substrate with a lever structure. This typical mechanical configuration mechanically amplifies the strain of the FBG to enhance overall sensitivity. As this mechanical configuration has a high stiffness, the proposed sensor can achieve a high resonant frequency and a wide dynamic working range. The sensing principle is presented, and the corresponding theoretical model is derived and validated. Experimental results demonstrate that the developed FBG-based strain sensor achieves an enhanced strain sensitivity of 6.2 pm/με, which is consistent with the theoretical analysis result. The strain sensitivity of the developed sensor is 5.2 times of the strain sensitivity of a bare fiber Bragg grating strain sensor. The dynamic characteristics of this sensor are investigated through the finite element method (FEM) and experimental tests. The developed sensor exhibits an excellent strain-sensitivity-enhancing property in a wide frequency range. The proposed high-sensitivity FBG-based strain sensor can be used for small-amplitude micro-strain measurement in harsh industrial environments.
Directory of Open Access Journals (Sweden)
Dharanesh Gangaiah
2016-12-01
Full Text Available Haemophilus ducreyi has emerged as a major cause of cutaneous ulcers (CU in yaws-endemic regions of the tropics in the South Pacific, South East Asia and Africa. H. ducreyi was once thought only to cause the genital ulcer (GU disease chancroid; GU strains belong to 2 distinct classes, class I and class II. Using whole-genome sequencing of 4 CU strains from Samoa, 1 from Vanuatu and 1 from Papua New Guinea, we showed that CU strains diverged from the class I strain 35000HP and that one CU strain expressed β-lactamase. Recently, the Center for Disease Control and Prevention released the genomes of 11 additional CU strains from Vanuatu and Ghana; however, the evolutionary relationship of these CU strains to previously-characterized CU and GU strains is unknown.We performed phylogenetic analysis of 17 CU and 10 GU strains. Class I and class II GU strains formed two distinct clades. The class I strains formed two subclades, one containing 35000HP and HD183 and the other containing the remainder of the class I strains. Twelve of the CU strains formed a subclone under the class I 35000HP subclade, while 2 CU strains formed a subclone under the other class I subclade. Unexpectedly, 3 of the CU strains formed a subclone under the class II clade. Phylogenetic analysis of dsrA-hgbA-ncaA sequences yielded a tree similar to that of whole-genome phylogenetic tree.CU strains diverged from multiple lineages within both class I and class II GU strains. Multilocus sequence typing of dsrA-hgbA-ncaA could be reliably used for epidemiological investigation of CU and GU strains. As class II strains grow relatively poorly and are relatively more susceptible to vancomycin than class I strains, these findings have implications for methods to recover CU strains. Comparison of contemporary CU and GU isolates would help clarify the relationship between these entities.
Gangaiah, Dharanesh; Spinola, Stanley M
2016-12-01
Haemophilus ducreyi has emerged as a major cause of cutaneous ulcers (CU) in yaws-endemic regions of the tropics in the South Pacific, South East Asia and Africa. H. ducreyi was once thought only to cause the genital ulcer (GU) disease chancroid; GU strains belong to 2 distinct classes, class I and class II. Using whole-genome sequencing of 4 CU strains from Samoa, 1 from Vanuatu and 1 from Papua New Guinea, we showed that CU strains diverged from the class I strain 35000HP and that one CU strain expressed β-lactamase. Recently, the Center for Disease Control and Prevention released the genomes of 11 additional CU strains from Vanuatu and Ghana; however, the evolutionary relationship of these CU strains to previously-characterized CU and GU strains is unknown. We performed phylogenetic analysis of 17 CU and 10 GU strains. Class I and class II GU strains formed two distinct clades. The class I strains formed two subclades, one containing 35000HP and HD183 and the other containing the remainder of the class I strains. Twelve of the CU strains formed a subclone under the class I 35000HP subclade, while 2 CU strains formed a subclone under the other class I subclade. Unexpectedly, 3 of the CU strains formed a subclone under the class II clade. Phylogenetic analysis of dsrA-hgbA-ncaA sequences yielded a tree similar to that of whole-genome phylogenetic tree. CU strains diverged from multiple lineages within both class I and class II GU strains. Multilocus sequence typing of dsrA-hgbA-ncaA could be reliably used for epidemiological investigation of CU and GU strains. As class II strains grow relatively poorly and are relatively more susceptible to vancomycin than class I strains, these findings have implications for methods to recover CU strains. Comparison of contemporary CU and GU isolates would help clarify the relationship between these entities.
Strain quantification in epitaxial thin films
International Nuclear Information System (INIS)
Cushley, M
2008-01-01
Strain arising in epitaxial thin films can be beneficial in some cases but devastating in others. By altering the lattice parameters, strain may give a thin film properties hitherto unseen in the bulk material. On the other hand, heavily strained systems are prone to develop lattice defects in order to relieve the strain, which can cause device failure or, at least, a decrease in functionality. Using convergent beam electron diffraction (CBED) and high-resolution transmission electron microscopy (HRTEM), it is possible to determine local strains within a material. By comparing the results from CBED and HRTEM experiments, it is possible to gain a complete view of a material, including the strain and any lattice defects present. As well as looking at how the two experimental techniques differ from each other, I will also look at how results from different image analysis algorithms compare. Strain in Si/SiGe samples and BST/SRO/MgO capacitor structures will be discussed.
Brucella abortus strain 2308 Wisconsin genome: importance of the definition of reference strains
Directory of Open Access Journals (Sweden)
Marcela Suárez-Esquivel
2016-09-01
Full Text Available Brucellosis is a bacterial infectious disease affecting a wide range of mammals and a neglected zoonosis caused by species of the genetically homogenous genus Brucella. As in most studies on bacterial diseases, research in brucellosis is carried out by using reference strains as canonical models to understand the mechanisms underlying host pathogen interactions. We performed whole genome sequencing (WGS analysis of the reference strain Brucella abortus 2308 routinely used in our laboratory, including manual curated annotation accessible as an editable version at www.wikipedia.Comparison of this genome with two publically available 2308 genomes showed significant differences, particularly indels related to insertional elements, suggesting variability related to the transposition of these elements within the same strain. Considering the outcome of high resolution genomic techniques in the bacteriology field, the conventional concept of strain definition needs to be revised.
Klein, Günter
2011-07-01
Bacillus cereus var. toyoi strain NCIMB 40112 (Toyocerin), a probiotic authorized in the European Union as feed additive for swine, bovines, poultry, and rabbits, was characterized by DNA fingerprinting applying pulsed-field gel electrophoresis and multilocus sequence typing and was compared with reference strains (of clinical and environmental origins). The probiotic strain was clearly characterized by pulsed-field gel electrophoresis using the restriction enzymes Apa I and Sma I resulting in unique DNA patterns. The comparison to the clinical reference strain B. cereus DSM 4312 was done with the same restriction enzymes, and again a clear differentiation of the two strains was possible by the resulting DNA patterns. The use of the restriction enzymes Apa I and Sma I is recommended for further studies. Furthermore, multilocus sequence typing analysis revealed a sequence type (ST 111) that was different from all known STs of B. cereus strains from food poisoning incidents. Thus, a strain characterization and differentiation from food poisoning strains for the probiotic strain was possible. Copyright ©, International Association for Food Protection
Energy Technology Data Exchange (ETDEWEB)
Gao Hongye, E-mail: qgaohongye@msn.com [Faculty of Engineering Sciences, Kyushu University, 6-1 Kasuga-koen, Kasuga, Fukuoka 816-8580 (Japan); Ikeda, Ken-ichi; Hata, Satoshi; Nakashima, Hideharu [Faculty of Engineering Sciences, Kyushu University, 6-1 Kasuga-koen, Kasuga, Fukuoka 816-8580 (Japan); Wang Dong; Nakashima, Hiroshi [Art, Science and Technology Center for Cooperative Research, Kyushu University, 6-1 Kasuga-koen, Kasuga, Fukuoka 816-8580 (Japan)
2010-09-25
Research highlights: {yields} Strain is introduced by deposition of amorphous Si{sub x}N{sub y} to improve the carrier mobility for a relatively large-size freestanding semiconductor film, which can be used for the fabrication of relatively large devices such like a bipolar junction transistor. However, standard Raman spectroscopy and X-ray diffraction cannot provide sufficient lateral resolution to the strain in a relatively long (x {mu}m in length) and thin (x nm in thickness) freestanding semiconductor film. {yields} In present research, strain in a bridge-shaped freestanding Si membrane (FSSM) was measured by convergent-beam electron diffraction (CBED) and finite element method (FEM). Compressive strain distribution was shown in three dimensions (3D) in FSSM, where no threading dislocation or stacking fault was found. Relaxation of the strain in FSSM in 3D was discussed based on a comparison of the strain magnitudes in FSSM as measured by CBED and FEM. - Abstract: Strain in a bridge-shaped freestanding Si membrane (FSSM) induced by depositing an amorphous Si{sub x}N{sub y} layer was measured by convergent-beam electron diffraction (CBED). CBED results show that the strain magnitude depends negatively on the FSSM thickness. FEM is a supplement of the result of CBED due to the relaxation of TEM samples during fabricating. The FEM analysis results ascertain the strain property in three dimensions, and show that the strain magnitude depends negatively on the length of FSSM, and the magnitude of the compressive strain in FSSM increases as the position is closer to the upper Si/Si{sub x}N{sub y} interface.
DEFF Research Database (Denmark)
Hancock, Viktoria; Ulett, G.C.; Schembri, M.A.
2006-01-01
Escherichia coli is the most common organism associated with asymptomatic bacteriuria (ABU). In contrast to uropathogenic E. coli (UPEC), which causes symptomatic urinary tract infections (UTI), very little is known about the mechanisms by which these strains colonize the human urinary tract....... The prototype ABU E. coli strain 83972 was originally isolated from a girl who had carried it asymptomatically for 3 years. Deliberate colonization of UTI-susceptible individuals with E. coli 83972 has been used successfully as an alternative approach for the treatment of patients who are refractory...... to conventional therapy. Colonization with strain 83972 appears to prevent infection with UPEC strains in such patients despite the fact that this strain is unable to express the primary adhesins involved in UTI, viz. P and type 1 fimbriae. Here we investigated the growth characteristics of E. coli 83972 in human...
International Nuclear Information System (INIS)
Lee, Kyoung Yoon; Kim, Tae Hyung; Lee, Hyung Yil
2009-01-01
In this work, we predict a true fracture strain using load-displacement curves from tensile test and Finite Element Analysis (FEA), and suggest a method for acquiring true Stress-Strain (SS) curves by predicted fracture strain. We first derived the true SS curve up to necking point from load-displacement curve. As the beginning, the posterior necking part of true SS curve is linearly extrapolated with the slope at necking point. The whole SS curve is then adopted for FE simulation of tensile test. The Bridgman factor or suitable plate correction factors are applied to pre and post FEA. In the load-true strain curve from FEA, the true fracture strain is determined as the matching point to test fracture load. The determined true strain is validated by comparing with test fracture strain. Finally, we complete the true SS curve by combining the prior necking part and linear part, the latter of which connects necking and predicted fracture points.
Energy Technology Data Exchange (ETDEWEB)
Lee, Kyoung Yoon; Kim, Tae Hyung; Lee, Hyung Yil [Sogang University, Seoul (Korea, Republic of)
2009-07-01
In this work, we predict a true fracture strain using load-displacement curves from tensile test and Finite Element Analysis (FEA), and suggest a method for acquiring true Stress-Strain (SS) curves by predicted fracture strain. We first derived the true SS curve up to necking point from load-displacement curve. As the beginning, the posterior necking part of true SS curve is linearly extrapolated with the slope at necking point. The whole SS curve is then adopted for FE simulation of tensile test. The Bridgman factor or suitable plate correction factors are applied to pre and post FEA. In the load-true strain curve from FEA, the true fracture strain is determined as the matching point to test fracture load. The determined true strain is validated by comparing with test fracture strain. Finally, we complete the true SS curve by combining the prior necking part and linear part, the latter of which connects necking and predicted fracture points.
Energy Technology Data Exchange (ETDEWEB)
Lee, Kyoung Yoon; Lee, Hyung Yil [Sogang University, Seoul (Korea, Republic of); Kim, Tae Hyung [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2009-10-15
In this work, we predict a true fracture strain using load-displacement curves from tensile test and finite element analysis (FEA), and suggest a method for acquiring true stress-strain (SS) curves by predicted fracture strain. We first derived the true SS curve up to necking point from load-displacement curve. As the beginning, the posterior necking part of true SS curve is linearly extrapolated with the slope at necking point. The whole SS curve is then adopted for FE simulation of tensile test. The Bridgman factor or suitable plate correction factors are applied to pre and post FEA. In the load-true strain curve from FEA, the true fracture strain is determined as the matching point to test fracture load. The determined true strain is validated by comparing with test fracture strain. Finally, we complete the true SS curve by combining the prior necking part and linear part, the latter of which connects necking and predicted fracture points.
2002-01-01
The Atlas of Stress-Strain Curves, Second Edition is substantially bigger in page dimensions, number of pages, and total number of curves than the previous edition. It contains over 1,400 curves, almost three times as many as in the 1987 edition. The curves are normalized in appearance to aid making comparisons among materials. All diagrams include metric (SI) units, and many also include U.S. customary units. All curves are captioned in a consistent format with valuable information including (as available) standard designation, the primary source of the curve, mechanical properties (including hardening exponent and strength coefficient), condition of sample, strain rate, test temperature, and alloy composition. Curve types include monotonic and cyclic stress-strain, isochronous stress-strain, and tangent modulus. Curves are logically arranged and indexed for fast retrieval of information. The book also includes an introduction that provides background information on methods of stress-strain determination, on...
Graphene spin diode: Strain-modulated spin rectification
Energy Technology Data Exchange (ETDEWEB)
Wang, Yunhua; Wang, B., E-mail: stslyl@mail.sysu.edu.cn, E-mail: wangbiao@mail.sysu.edu.cn [Sino-French Institute of Nuclear Engineering and Technology, School of Physics and Engineering, State Key Laboratory of Optoelectronic Materials and Technologies, Sun Yat-sen University, Guangzhou 510275 (China); Liu, Yulan, E-mail: stslyl@mail.sysu.edu.cn, E-mail: wangbiao@mail.sysu.edu.cn [School of Engineering, Sun Yat-sen University, Guangzhou 510275 (China)
2014-08-04
Strain effects on spin transport in a ferromagnetic/strained/normal graphene junction are explored theoretically. It is shown that the spin-resolved Fermi energy range can be controlled by the armchair direction strain because the strain-induced pseudomagnetic field suppresses the current. The spin rectification effect for the bias reversal occurs because of a combination of ferromagnetic exchange splitting and the broken spatial symmetry of the junction. In addition, the spin rectification performance can be tuned remarkably by manipulation of the strains. In view of this strain-modulated spin rectification effect, we propose that the graphene-based ferromagnetic/strained/normal junction can be used as a tunable spin diode.
Development of Industrial Yeast Platform Strains
DEFF Research Database (Denmark)
Bergdahl, Basti; Dato, Laura; Förster, Jochen
2014-01-01
Most of the current metabolic engineering projects are carried out using laboratory strains as the starting host. Although such strains are easily manipulated genetically, their robustness does not always meet the requirements set by industrial fermentation conditions. In such conditions, the cells...... screening of the 36 industrial and laboratory yeast strains. In addition, progress in the development of molecular biology methods for generating the new strains will be presented....
Coudeyras, Sophie; Marchandin, Hélène; Fajon, Céline; Forestier, Christiane
2008-01-01
Lactobacilli are lactic acid bacteria that are widespread in the environment, including the human diet and gastrointestinal tract. Some Lactobacillus strains are regarded as probiotics because they exhibit beneficial health effects on their host. In this study, the long-used probiotic strain Lactobacillus rhamnosus 35 was characterized at a molecular level and compared with seven reference strains from the Lactobacillus casei group. Analysis of rrn operon sequences confirmed that L. rhamnosus 35 indeed belongs to the L. rhamnosus species, and both temporal temperature gradient gel electrophoresis and ribotyping showed that it is closer to the probiotic strain L. rhamnosus ATCC 53103 (also known as L. rhamnosus GG) than to the species type strain. In addition, L. casei ATCC 334 gathered in a coherent cluster with L. paracasei type strains, unlike L. casei ATCC 393, which was closer to L. zeae; this is evidence of the lack of relatedness between the two L. casei strains. Further characterization of the eight strains by pulsed-field gel electrophoresis repetitive DNA element-based PCR identified distinct patterns for each strain, whereas two isolates of L. rhamnosus 35 sampled 40 years apart could not be distinguished. By subtractive hybridization using the L. rhamnosus GG genome as a driver, we were able to isolate five L. rhamnosus 35-specific sequences, including two phage-related ones. The primer pairs designed to amplify these five regions allowed us to develop rapid and highly specific PCR-based identification methods for the probiotic strain L. rhamnosus 35. PMID:18326671
Brucella abortus Strain 2308 Wisconsin Genome: Importance of the Definition of Reference Strains
Suárez-Esquivel, Marcela; Ruiz-Villalobos, Nazareth; Castillo-Zeledón, Amanda; Jiménez-Rojas, César; Roop II, R. Martin; Comerci, Diego J.; Barquero-Calvo, Elías; Chacón-Díaz, Carlos; Caswell, Clayton C.; Baker, Kate S.; Chaves-Olarte, Esteban; Thomson, Nicholas R.; Moreno, Edgardo; Letesson, Jean J.; De Bolle, Xavier; Guzmán-Verri, Caterina
2016-01-01
Brucellosis is a bacterial infectious disease affecting a wide range of mammals and a neglected zoonosis caused by species of the genetically homogenous genus Brucella. As in most studies on bacterial diseases, research in brucellosis is carried out by using reference strains as canonical models to understand the mechanisms underlying host pathogen interactions. We performed whole genome sequencing analysis of the reference strain B. abortus 2308 routinely used in our laboratory, including manual curated annotation accessible as an editable version through a link at https://en.wikipedia.org/wiki/Brucella#Genomics. Comparison of this genome with two publically available 2308 genomes showed significant differences, particularly indels related to insertional elements, suggesting variability related to the transposition of these elements within the same strain. Considering the outcome of high resolution genomic techniques in the bacteriology field, the conventional concept of strain definition needs to be revised. PMID:27746773
Zhan, Xiao-Yong; Hu, Chao-Hui; Zhu, Qing-Yi
2016-04-01
Virulence genes are distinct regions of DNA which are present in the genome of pathogenic bacteria and absent in nonpathogenic strains of the same or related species. Virulence genes are frequently associated with bacterial pathogenicity in genus Legionella. In the present study, an assay was performed to detect ten virulence genes, including iraA, iraB, lvrA, lvrB, lvhD, cpxR, cpxA, dotA, icmC and icmD in different pathogenicity islands of 47 Legionella reference strains, 235 environmental strains isolated from water, and 4 clinical strains isolated from the lung tissue of pneumonia patients. The distribution frequencies of these genes in reference or/and environmental L. pneumophila strains were much higher than those in reference non-L. pneumophila or/and environmental non-L. pneumophila strains, respectively. L. pneumophila clinical strains also maintained higher frequencies of these genes compared to four other types of Legionella strains. Distribution frequencies of these genes in reference L. pneumophila strains were similar to those in environmental L. pneumophila strains. In contrast, environmental non-L. pneumophila maintained higher frequencies of these genes compared to those found in reference non-L. pneumophila strains. This study illustrates the association of virulence genes with Legionella pathogenicity and reveals the possible virulence evolution of non-L. pneumophia strains isolated from environmental water.
Development of high temperature strain gage, (5)
International Nuclear Information System (INIS)
Yuuki, Hiroshi; Kobayashi, Yukio; Kanai, Kenji; Yamaura, Yoshio
1976-01-01
Development and improvement of resistance wire type strain gages usable for experimental measurement of thermal strains generated at high temperature in various structures and equipments that consist of a Fast Breeder Reactor have been carried out, and various characteristics of the strain gages have been investigated. Based on the results obtained up to now, development and research of this time mainly aim to improve strain and fatigue characteristics. As the results, characteristics of strain gages with sensing elements of nichrome V are improved, specifically mechanical hysteresis is decreased, strain limit is increased, etc. Also, improvement is recognized in thermal output, and it becomes clear that dummy gages work effectively. However, a filling method of MgO and an inserting method of active-dummy elements are selected as primary objects to improve strain characteristics, and many hours are taken for these objects, so confirmations of characteristics of platinum-tungsten strain gages, strain sensing elements of which are troublesome to produce, have not been completely done, though the performance of the gages has been improved in several points. As to nichrome V strain gages, there is a fair prospect of obtaining ones, specifications of which are quite close to the goal, though problems in manufacturing technics remain for future. As to platinum-tungsten strain gages, it is expected that similar strain gages to nichrome V are obtainable by improvement in manufacturing of sensing elements. (auth.)
DEFF Research Database (Denmark)
Kusk, M.; Kabell, Susanne; Jørgensen, Poul Henrik
2005-01-01
and histopathology. Since these methods are laborious and have low specificity alternatives are needed. In the present study, we report the development of a strain-specific multiplex RT-PCR technique, which can detect and differentiate between field strains of IBDV and vaccine virus strains including a so-called hot...
MM98.57 Quantification of Combined Strain Paths
DEFF Research Database (Denmark)
Nielsen, Morten Sturgård; Wanheim, Tarras
1998-01-01
this curve into useful scalar relations from experimental data.The strain history for plane strain when assuming volume constancy may be plotted in a shear strain, normal strain diagram, which has the property of showing both the rotation of principal deformation axes during the deformation and the amount...... is to describe the total strain history as a curve in the 6-dimensional shear strain, normal strain space. In order to be able to use these experimental data for calculation, the development of this strain curve must be transformed into a set of scalar relations that may be used for predicting the yield surface...... at a given point in a new strain history. A simple example of this concept is to take the length of the strain curve as describing scalar relation: E.g. to use the equivalent strain as parameter for describing the yield stress. This paper focuses on the strain curve concept and the possibilities to convert...
Job strain and male fertility.
Hjollund, Niels Henrik I; Bonde, Jens Peter E; Henriksen, Tine Brink; Giwercman, Aleksander; Olsen, Jørn
2004-01-01
Job strain, defined as high job demands and low job control, has not previously been explored as a possible determinant of male fertility. We collected prospective data on job strain among men, and describe the associations with semen quality and probability of conceiving a clinical pregnancy during a menstrual cycle. Danish couples (N = 399) who were trying to become pregnant for the first time were followed for up to 6 menstrual periods. All men collected semen samples, and a blood sample was drawn from both partners. Job demand and job control were measured by a self-administered questionnaire at entry, and in each cycle the participants recorded changes in job control or job demand during the previous 30 days. In adjusted analyses, no associations were found between any semen characteristic or sexual hormones and any job strain variable. The odds for pregnancy were not associated with job strain. Psychologic job strain encountered in normal jobs in Denmark does not seem to affect male reproductive function.
International Nuclear Information System (INIS)
Gupta, Saurabh; Lee, Minjoo L.; Isaacson, David M.; Fitzgerald, Eugene A.
2005-01-01
A dual channel heterostructure consisting of strained-Si/strained-Si 1-y Ge y on relaxed Si 1-x Ge x (y > x), provides a platform for fabricating metal-oxide-semiconductor field-effect transistors (MOSFETs) with high hole mobilities (μ eff ) which depend directly on Ge concentration and strain in the strained-Si 1-y Ge y layer. Ge out-diffuses from the strained-Si 1-y Ge y layer into relaxed Si 1-x Ge x during high temperature processing, reducing peak Ge concentration and strain in the strained-Si 1-y Ge y layer and degrades hole μ eff in these dual channel heterostructures. A heterostructure consisting of strained-Si/strained-Si 1-y Ge y /strained-Si, referred to as a trilayer heterostructure, grown on relaxed Si 1-x Ge x has much reduced Ge out-flux from the strained-Si 1-y Ge y layer and retains higher μ eff after thermal processing. Improved hole μ eff over similar dual channel heterostructures is also observed in this heterostructure. This could be a result of preventing the hole wavefunction tunneling into the low μ eff relaxed Si 1-x Ge x layer due to the additional valence band offset provided by the underlying strained-Si layer. A diffusion coefficient has been formulated and implemented in a finite difference scheme for predicting the thermal budget of the strained SiGe heterostructures. It shows that the trilayer heterostructures have superior thermal budgets at higher Ge concentrations. Ring-shaped MOSFETs were fabricated on both platforms and subjected to various processing temperatures in order to compare the extent of μ eff reduction with thermal budget. Hole μ eff enhancements are retained to a much higher extent in a trilayer heterostructure after high temperature processing as compared to a dual channel heterostructure. The improved thermal stability and hole μ eff of a trilayer heterostructure makes it an ideal platform for fabricating high μ eff MOSFETs that can be processed over higher temperatures without significant losses in hole
Predicting creep rupture from early strain data
International Nuclear Information System (INIS)
Holmstroem, Stefan; Auerkari, Pertti
2009-01-01
To extend creep life modelling from classical rupture modelling, a robust and effective parametric strain model has been developed. The model can reproduce with good accuracy all parts of the creep curve, economically utilising the available rupture models. The resulting combined model can also be used to predict rupture from the available strain data, and to further improve the rupture models. The methodology can utilise unfailed specimen data for life assessment at lower stress levels than what is possible from rupture data alone. Master curves for creep strain and rupture have been produced for oxygen-free phosphorus-doped (OFP) copper with a maximum testing time of 51,000 h. Values of time to specific strain at given stress (40-165 MPa) and temperature (125-350 deg. C) were fitted to the models in the strain range of 0.1-38%. With typical inhomogeneous multi-batch creep data, the combined strain and rupture modelling involves the steps of investigation of the data quality, extraction of elastic and creep strain response, rupture modelling, data set balancing and creep strain modelling. Finally, the master curves for strain and rupture are tested and validated for overall fitting efficiency. With the Wilshire equation as the basis for the rupture model, the strain model applies classical parametric principles with an Arrhenius type of thermal activation and a power law type of stress dependence for the strain rate. The strain model also assumes that the processes of primary and secondary creep can be reasonably correlated. The rupture model represents a clear improvement over previous models in the range of the test data. The creep strain information from interrupted and running tests were assessed together with the rupture data investigating the possibility of rupture model improvement towards lower stress levels by inverse utilisation of the combined rupture based strain model. The developed creep strain model together with the improved rupture model is
A wide extent of inter-strain diversity in virulent and vaccine strains of alphaherpesviruses.
Directory of Open Access Journals (Sweden)
Moriah L Szpara
2011-10-01
Full Text Available Alphaherpesviruses are widespread in the human population, and include herpes simplex virus 1 (HSV-1 and 2, and varicella zoster virus (VZV. These viral pathogens cause epithelial lesions, and then infect the nervous system to cause lifelong latency, reactivation, and spread. A related veterinary herpesvirus, pseudorabies (PRV, causes similar disease in livestock that result in significant economic losses. Vaccines developed for VZV and PRV serve as useful models for the development of an HSV-1 vaccine. We present full genome sequence comparisons of the PRV vaccine strain Bartha, and two virulent PRV isolates, Kaplan and Becker. These genome sequences were determined by high-throughput sequencing and assembly, and present new insights into the attenuation of a mammalian alphaherpesvirus vaccine strain. We find many previously unknown coding differences between PRV Bartha and the virulent strains, including changes to the fusion proteins gH and gB, and over forty other viral proteins. Inter-strain variation in PRV protein sequences is much closer to levels previously observed for HSV-1 than for the highly stable VZV proteome. Almost 20% of the PRV genome contains tandem short sequence repeats (SSRs, a class of nucleic acids motifs whose length-variation has been associated with changes in DNA binding site efficiency, transcriptional regulation, and protein interactions. We find SSRs throughout the herpesvirus family, and provide the first global characterization of SSRs in viruses, both within and between strains. We find SSR length variation between different isolates of PRV and HSV-1, which may provide a new mechanism for phenotypic variation between strains. Finally, we detected a small number of polymorphic bases within each plaque-purified PRV strain, and we characterize the effect of passage and plaque-purification on these polymorphisms. These data add to growing evidence that even plaque-purified stocks of stable DNA viruses exhibit
[Characteristics of Lactobacillus strains contained in pharmaceuticals].
Banach, W; Bucholc, B; Wójcik, B
2001-01-01
The aim of the study was to characterize lactic acid bacteria (LAB) which are components of drugs administered orally in cases of intestinal disturbances, or antibiotic--related diarrhea. Biochemical properties, growth behavior, bile tolerance, and survival at low pH of six LAB strains (four strains L. rhamnosus and two L. acidophilus) were studied. The survival at low pH was determined in MRS broth (Difco) acidified to pH 1; 2; 3; and 4. Bile tolerance was tested on MRS broth with 0.3% oxgall (Difco). Between tested strains differences in ability to grow at low pH and survival in bile were observed. Only 0.01% inoculum of all examined strains survived at pH 1. Differences between strains in survival at low pH (pH 2 and pH 3) and tolerance of bile were observed. However, after 2 h incubation at pH 4, 100% of strains stayed alive. Examined strains demonstrated good 3% bile tolerance. All strains met the criteria for probiotic strains: ability to survive at pH 3 and in the presence of bile.
Strain histograms are equal to strain ratios in predicting malignancy in breast tumours
DEFF Research Database (Denmark)
Carlsen, Jonathan Frederik; Ewertsen, Caroline; Sletting, Susanne
2017-01-01
Objectives: To assess whether strain histograms are equal to strain ratios in predicting breast tumour malignancy and to see if either could be used to upgrade Breast Imaging Reporting and Data System (BI-RADS) 3 tumours for immediate biopsy. Methods: Ninety-nine breast tumours were examined using...
Strains and Stressors: An Analysis of Touchscreen Learning in Genetically Diverse Mouse Strains
Graybeal, Carolyn; Bachu, Munisa; Mozhui, Khyobeni; Saksida, Lisa M.; Bussey, Timothy J.; Sagalyn, Erica; Williams, Robert W.; Holmes, Andrew
2014-01-01
Touchscreen-based systems are growing in popularity as a tractable, translational approach for studying learning and cognition in rodents. However, while mouse strains are well known to differ in learning across various settings, performance variation between strains in touchscreen learning has not been well described. The selection of appropriate genetic strains and backgrounds is critical to the design of touchscreen-based studies and provides a basis for elucidating genetic factors moderating behavior. Here we provide a quantitative foundation for visual discrimination and reversal learning using touchscreen assays across a total of 35 genotypes. We found significant differences in operant performance and learning, including faster reversal learning in DBA/2J compared to C57BL/6J mice. We then assessed DBA/2J and C57BL/6J for differential sensitivity to an environmental insult by testing for alterations in reversal learning following exposure to repeated swim stress. Stress facilitated reversal learning (selectively during the late stage of reversal) in C57BL/6J, but did not affect learning in DBA/2J. To dissect genetic factors underlying these differences, we phenotyped a family of 27 BXD strains generated by crossing C57BL/6J and DBA/2J. There was marked variation in discrimination, reversal and extinction learning across the BXD strains, suggesting this task may be useful for identifying underlying genetic differences. Moreover, different measures of touchscreen learning were only modestly correlated in the BXD strains, indicating that these processes are comparatively independent at both genetic and phenotypic levels. Finally, we examined the behavioral structure of learning via principal component analysis of the current data, plus an archival dataset, totaling 765 mice. This revealed 5 independent factors suggestive of “reversal learning,” “motivation-related late reversal learning,” “discrimination learning,” “speed to respond,” and
Relating high-temperature flow stress of AISI 316 stainless steel to strain and strain rate
International Nuclear Information System (INIS)
Matteazzi, S.; Paitti, G.; Boerman, D.
1982-01-01
The authors have performed an experimental determination of tensile stress-strain curves for different strain rates (4.67 x 10 - 5 , 4.67 x 10 - 2 s - 1 ) and for a variety of temperature conditions (773-1073 K) of AISI 316H stainless steel (annealed conditions) and also a computer analysis of the experimental curves using a fitting program which takes into consideration different constitutive relations describing the plastic flow behaviour of the metals. The results show that the materials tested are clearly affected by strain rate only at the highest temperature investigated (1073 K) and that the plastic strain is the more significant variable. Of the constitutive equations considered, Voce's relation gives the best fit for the true stress-time-strain curves. However, the Ludwik and Ludwigson equations also provide a description of the experimental data, whereas Hollomon's equation does not suitably characterize AISI 316H stainless steel and can be applied with some accuracy only at 1073 K. (author)
Directory of Open Access Journals (Sweden)
Javed Akram
2018-04-01
Full Text Available A microstructural simulation method is adopted to predict the location specific strain rates, temperatures, grain evolution, and accumulated strains in the Inconel 718 friction welds. Cellular automata based 2D microstructure model was developed for Inconel 718 alloy using theoretical aspects of dynamic recrystallization. Flow curves were simulated and compared with experimental results using hot deformation parameter obtained from literature work. Using validated model, simulations were performed for friction welds of Inconel 718 alloy generated at three rotational speed i.e., 1200, 1500, and 1500 RPM. Results showed the increase in strain rates with increasing rotational speed. These simulated strain rates were found to match with the analytical results. Temperature difference of 150 K was noticed from center to edge of the weld. At all the rotational speeds, the temperature was identical implying steady state temperature (0.89Tm attainment. Keywords: Microstructure modeling, Dynamic recrystallization, Friction welding, Inconel 718, EBSD, Hot deformation, Strain map
Guilbaud, Morgan; Zagorec, Monique; Chaillou, Stéphane; Champomier-Vergès, Marie-Christine
2012-04-01
Lactobacillus sakei is a meat-borne lactic acid bacterium species exhibiting a wide genomic diversity. We have investigated the diversity of response to various oxidative compounds, between L. sakei strains, among a collection representing the genomic diversity. We observed various responses to the different compounds as well as a diversity of response depending on the aeration conditions used for cell growth. A principal component analysis revealed two main phenotypic groups, partially correlating with previously described genomic clusters. We designed strains mixes composed of three different strains, in order to examine the behavior of each strain, when cultured alone or in the presence of other strains. The strains composing the mixtures were chosen as diverse as possible, i.e. exhibiting diverse responses to oxidative stress and belonging to different genomic clusters. Growth and survival rates of each strain were monitored under various aeration conditions, with or without heme supplementation. The results obtained suggest that some strains may act as "helper" or "burden" strains depending on the oxidative conditions encountered during incubation. This study confirms that resistance to oxidative stress is extremely variable within the L. sakei species and that this property should be considered when investigating starter performance in the complex meat bacterial ecosystems. Copyright © 2011 Elsevier Ltd. All rights reserved.
Ezeronye, O U; Legras, J-L
2009-05-01
To study the yeast diversity of Nigerian palm wines by comparison with other African strains. Twenty-three Saccharomyces cerevisiae strains were obtained from palm wine samples collected at four locations in eastern Nigeria, and characterized using different molecular techniques: internal transcribed spacer restriction fragment length polymorphism and sequence analysis, pulsed field gel electrophoresis, inter delta typing and microsatellite multilocus analysis. These techniques revealed that palm wine yeasts represent a group of closely related strains that includes other West African isolates (CBS400, NCYC110, DVPG6044). Population analysis revealed an excess of homozygote strains and an allelic richness similar to wine suggestive of local domestication. Several other African yeast strains were not connected to this group. Ghana sorghum beer strains and other African strains (DBVPG1853 and MUCL28071) displayed strikingly high relatedness with European bread, beer or wine strains, and the genome of strain MUCL30909 contained African and wine-type alleles, indicating its hybrid origin. Nigerian palm wine yeast represents a local specific yeast flora, whereas a European origin or hybrid was suspected for several other Africa isolates. This study presents the first genetic characterization of an autochthonous African palm wine yeast population and confirms the idea that human intervention has favoured yeast migration.
International Nuclear Information System (INIS)
Sakaida, Yoshihisa; Serizawa, Takanobu; Manzanka, Michiya
2011-01-01
A hollow circular cylinder specimen with an annular U-notch of chrome molybdenum steel with 0.20 mass% C (SCM420) was carburized in carrier gas and quenched in oil bath. In order to determine the case depth, the specimen was cut off and carbon content and Vickers hardness gradients were measured experimentally near the carburized surface. The residual strain mapping in the interior of carburized cylinder was conducted nondestructively by neutron strain scanning. In this study, the neutron diffraction from Fe-211 plane was used for strain scanning. The neutron wavelength was tuned to 0.1654nm so that diffraction angle became about 90deg. Radial, hoop and axial residual strains were measured by scanning diffracting volume along the axial direction of cylinder specimen. Each residual strain was calculated from lattice spacing change. Unstressed lattice spacing was determined experimentally using reference coupon specimens that were cut from the interior of same carburized cylinder. As a result, the diffraction peak width at half height, FWHM, near the carburized surface was about 3.7 times wider than that of coupon specimens. On the other hand, the most peak widths in the interior equaled to that of coupon specimens. Peak width broadened slightly as the diffracting volume approached the carburized case layer. From the center to the quarter of cylinder specimen, the hoop and axial strains were tensile, and the radial one was compressive in the interior. From the quarter to the edge of the cylinder specimen, the hoop tensile strain increased, radial and axial strains changed to tensile and compressive, respectively. Therefore, the interior of the cylinder specimen was found to be deformed elastically to balance the existence of compressive residual stresses in the carburized case layer. (author)
Strain gradient effects in surface roughening
DEFF Research Database (Denmark)
Borg, Ulrik; Fleck, N.A.
2007-01-01
evidence for strain gradient effects. Numerical analyses of a bicrystal undergoing in-plane tensile deformation are also studied using a strain gradient crystal plasticity theory and also by using a strain gradient plasticity theory for an isotropic solid. Both theories include an internal material length...
Nanocomposite Strain Gauges Having Small TCRs
Gregory, Otto; Chen, Ximing
2009-01-01
Ceramic strain gauges in which the strain-sensitive electrically conductive strips made from nanocomposites of noble metal and indium tin oxide (ITO) are being developed for use in gas turbine engines and other power-generation systems in which gas temperatures can exceed 1,500 F (about 816 C). In general, strain gauges exhibit spurious thermally induced components of response denoted apparent strain. When temperature varies, a strain-gauge material that has a nonzero temperature coefficient of resistance (TCR) exhibits an undesired change in electrical resistance that can be mistaken for the change in resistance caused by a change in strain. It would be desirable to formulate straingauge materials having TCRs as small as possible so as to minimize apparent strain. Most metals exhibit positive TCRs, while most semiconductors, including ITO, exhibit negative TCRs. The present development is based on the idea of using the negative TCR of ITO to counter the positive TCRs of noble metals and of obtaining the benefit of the ability of both ITO and noble metals to endure high temperatures. The noble metal used in this development thus far has been platinum. Combinatorial libraries of many ceramic strain gauges containing nanocomposites of various proportions of ITO and platinum were fabricated by reactive co-sputtering from ITO and platinum targets onto alumina- and zirconia-based substrates mounted at various positions between the targets.
Strain-dependent diffusion behavior of H within tungsten
International Nuclear Information System (INIS)
Ding, Wenyi; He, Haiyan; Liu, Changsong; Ding, Rui; Chen, Junling; Pan, Bicai
2014-01-01
The diffusion behaviors of H in tungsten, a promising material serving as the first wall facing the plasma in nuclear reactors, under either biaxial strain or isotropic strain are theoretically studied. We find that under the isotropic strain, an individual H atom may diffuse along all pathways, and under the biaxial strain, it preferably migrates along the direction perpendicular to the loaded strain. Moreover, in the case of either the isotropic or the biaxial strain, the loaded compressive strain weakens the diffusion of H, while the loaded tensile strain enhances the diffusion of H in bulk W.
Strain-dependent diffusion behavior of H within tungsten
Energy Technology Data Exchange (ETDEWEB)
Ding, Wenyi; He, Haiyan [Department of Physics, University of Science and Technology of China, Hefei, Anhui 230026 (China); Liu, Changsong [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, P.O. Box 1129, Hefei 230031 (China); Ding, Rui; Chen, Junling [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); Pan, Bicai, E-mail: bcpan@ustc.edu.cn [Department of Physics, University of Science and Technology of China, Hefei, Anhui 230026 (China); Hefei National Laboratory for Physical Science at Microscale, University of Science and Technology of China, Hefei, Anhui 230026 (China)
2014-06-15
The diffusion behaviors of H in tungsten, a promising material serving as the first wall facing the plasma in nuclear reactors, under either biaxial strain or isotropic strain are theoretically studied. We find that under the isotropic strain, an individual H atom may diffuse along all pathways, and under the biaxial strain, it preferably migrates along the direction perpendicular to the loaded strain. Moreover, in the case of either the isotropic or the biaxial strain, the loaded compressive strain weakens the diffusion of H, while the loaded tensile strain enhances the diffusion of H in bulk W.
Directory of Open Access Journals (Sweden)
Drevinek Pavel
2009-12-01
Full Text Available Abstract Background The Lactic Acid Bacteria (LAB are important components of the healthy gut flora and have been used extensively as probiotics. Understanding the cultivable diversity of LAB before and after probiotic administration, and being able to track the fate of administered probiotic isolates during feeding are important parameters to consider in the design of clinical trials to assess probiotic efficacy. Several methods may be used to identify bacteria at the strain level, however, PCR-based methods such as Random Amplified Polymorphic DNA (RAPD are particularly suited to rapid analysis. We examined the cultivable diversity of LAB in the human gut before and after feeding with two Lactobacillus strains, and also tracked the fate of these two administered strains using a RAPD technique. Results A RAPD typing scheme was developed to genetically type LAB isolates from a wide range of species, and optimised for direct application to bacterial colony growth. A high-throughput strategy for fingerprinting the cultivable diversity of human faeces was developed and used to determine: (i the initial cultivable LAB strain diversity in the human gut, and (ii the fate of two Lactobacillus strains (Lactobacillus salivarius NCIMB 30211 and Lactobacillus acidophilus NCIMB 30156 contained within a capsule that was administered in a small-scale human feeding study. The L. salivarius strain was not cultivated from the faeces of any of the 12 volunteers prior to capsule administration, but appeared post-feeding in four. Strains matching the L. acidophilus NCIMB 30156 feeding strain were found in the faeces of three volunteers prior to consumption; after taking the Lactobacillus capsule, 10 of the 12 volunteers were culture positive for this strain. The appearance of both Lactobacillus strains during capsule consumption was statistically significant (p Conclusion We have shown that genetic strain typing of the cultivable human gut microbiota can be
Strain and strain rate by two-dimensional speckle tracking echocardiography in a maned wolf
Directory of Open Access Journals (Sweden)
Matheus M. Mantovani
2012-12-01
Full Text Available The measurement of cardiovascular features of wild animals is important, as is the measurement in pets, for the assessment of myocardial function and the early detection of cardiac abnormalities, which could progress to heart failure. Speckle tracking echocardiography (2D STE is a new tool that has been used in veterinary medicine, which demonstrates several advantages, such as angle independence and the possibility to provide the early diagnosis of myocardial alterations. The aim of this study was to evaluate the left myocardial function in a maned wolf by 2D STE. Thus, the longitudinal, circumferential and radial strain and strain rate were obtained, as well as, the radial and longitudinal velocity and displacement values, from the right parasternal long axis four-chamber view, the left parasternal apical four chamber view and the parasternal short axis at the level of the papillary muscles. The results of the longitudinal variables were -13.52±7.88, -1.60±1.05, 4.34±2.52 and 3.86±3.04 for strain (%, strain rate (1/s, displacement (mm and velocity (cm/s, respectively. In addition, the radial and circumferential Strain and Strain rate were 24.39±14.23, 1.86±0.95 and -13.69±6.53, -1.01±0.48, respectively. Thus, the present study provides the first data regarding the use of this tool in maned wolves, allowing a more complete quantification of myocardial function in this species.
Engineering piezoresistivity using biaxially strained silicon
DEFF Research Database (Denmark)
Pedersen, Jesper Goor; Richter, Jacob; Brandbyge, Mads
2008-01-01
of the piezocoefficient on temperature and dopant density is altered qualitatively for strained silicon. In particular, we find that a vanishing temperature coefficient may result for silicon with grown-in biaxial tensile strain. These results suggest that strained silicon may be used to engineer the iezoresistivity...
Strain path dependency in metal plasticity
Viatkina, E.M.; Brekelmans, W.A.M.; Geers, M.G.D.
2003-01-01
A change in strain path has a significant effect on the mechanical response of metals. Strain path change effects physically originate from a complex microstructure evolution. This paper deals with the contribution of cell structure evolution to the strain path change effect. The material with cells
Su, Yanyan; Mennerich, Artur; Urban, Brigitte
2012-11-01
Four common used microalgae species were compared in terms of settleability, nutrient removal capacity and biomass productivity. After 1 month training, except cyanobacteria Phormidium sp., three green microalgae species, Chlamydomonas reinhardtii, Chlorella vulgaris and Scenedesmus rubescens, showed good settleability. The N and P removal efficiency was all above 99% within 7, 4, 6 and 6 days for N and 4, 2, 3 and 4 days for P, resulting in the N removal rates of 3.66±0.17, 6.39±0.20, 4.39±0.06 and 4.31±0.18 mg N/l/d and P removal rates of 0.56±0.07, 0.89±0.05, 0.76±0.09 and 0.60±0.05 mg P/l/d for Phormidium sp., C. reinhardtii, C. vulgaris and S. rubescens, respectively. Phormidium sp. had the lowest algal biomass productivity (2.71±0.7 g/m(2)/d) and the other three green microalgae showed higher algal biomass productivity (around 6 g/m(2)/d). Assimilation into biomass was the main removal mechanism for N and P. Copyright © 2012 Elsevier Ltd. All rights reserved.
Jin, Yue; Yang, Cheng-Min; Wei, Jian-He
2016-05-01
In order to evaluate seed viability of Platycodon grandiflorum, Schizonepeta tenuifolia, Andrographis paniculat, Codonopsis pilosula, Scutellaria baicalensis, Leonurus japonicus, Rabdosia rubescens, stored in the medium-term gene bank of the National Medicinal Plant Gene Bank for 4 years, we tested seed germination rate of 7 species of medicinal plant and analyzed the change of significance of levels of the germination rate in pre and post store. Seed germination rates of 7 species of medicinal plants were all decreased after 4 years, and the decrease of S. tenuifolia and S. baicalensis germination rates were much smaller than other species. The higher initial germination rate of P. grandiflorum, C. pilosula, R. rubescens seed has the smaller decline of germination rate, but the data of A. paniculata showed the opposite trend. The rate decline of the germination of S. tenuifolia and S. baicalensis was roughly the same in different germination rate interval. The results showed that low temperature storage could effectively prolong the seed longevity, and maintain the seed vigor. Moreover, it is necessary to study on the storage characteristics of the main medicinal plant seeds, and establish the monitoring plan and regeneration standard. Copyright© by the Chinese Pharmaceutical Association.
Sensibility of different wheat varieties (strains) to Ar+ implantation
International Nuclear Information System (INIS)
Cui Huanhu; Jing Hua; Ma Aiping; Kang Xiuli; Yang Liping; Huang Mingjing; Ma Buzhou; Shanxi Academy of Agricultural Sciences, Taiyuan
2005-01-01
The sensibility of different wheat varieties (strains) to Ar + implantation was studied. The results showed that the survival rate of 21 wheat varieties (strains) at the dose of 6 x 10 16 Ar + /cm 2 could be divided into five groups: surplus sensitive varieties (strains), sensitive varieties (strains), transitional varieties (strains), obtuse varieties (strains) and surplus obtuse varieties (strains). The sensibility of wheat varieties (strains) to Ar + injection is high-moisture-fertility wheat varieties (strains) > medium-moisture-fertility wheat varieties (strains) > dry land wheat varieties (strains). The study has provided theoretical basis in induced mutation medial lethal dose of different wheat varieties (strains) to Ar + implantation. (authors)
drug resistant strains of Salmonella enterica
African Journals Online (AJOL)
Conclusions: The aqueous extract of Thonningia sanguinea can provide an alternative therapy for the treatment of salmonellosis, mainly for typhoid fever caused by MDR strains of S. Typhi.The extract also inhibits S.Hadar a MDR emerging strain in Ivory Coast. Keywords: Thonningia sanguinea; Salmonella, MDR strains, ...
Validation of perceptual strain index to evaluate the thermal strain in experimental hot conditions
Directory of Open Access Journals (Sweden)
Habibollah Dehghan
2015-01-01
Conclusions: The research findings showed when there is no access to other forms of methods to evaluate the heat stress, it can be used the PeSI in evaluating the strain because of its favorable correlation with the thermal strain.
DEFF Research Database (Denmark)
Løvdal, Alexandra Liv Vest; Andreasen, Jens Wenzel; Mikkelsen, Lars Pilgaard
2017-01-01
Poly(l-lactide) (PLLA) is a bioabsorbable polymer with high stiffness and strength compared to the other commercially available bioabsorbable polymers. The properties of PLLA can be improved by straining, causing deformation-mediated molecular orientation. PLLA tubes were biaxially strained above...
Roosaare, Märt; Vaher, Mihkel; Kaplinski, Lauris; Möls, Märt; Andreson, Reidar; Lepamets, Maarja; Kõressaar, Triinu; Naaber, Paul; Kõljalg, Siiri; Remm, Maido
2017-01-01
Fast, accurate and high-throughput identification of bacterial isolates is in great demand. The present work was conducted to investigate the possibility of identifying isolates from unassembled next-generation sequencing reads using custom-made guide trees. A tool named StrainSeeker was developed that constructs a list of specific k -mers for each node of any given Newick-format tree and enables the identification of bacterial isolates in 1-2 min. It uses a novel algorithm, which analyses the observed and expected fractions of node-specific k -mers to test the presence of each node in the sample. This allows StrainSeeker to determine where the isolate branches off the guide tree and assign it to a clade whereas other tools assign each read to a reference genome. Using a dataset of 100 Escherichia coli isolates, we demonstrate that StrainSeeker can predict the clades of E. coli with 92% accuracy and correct tree branch assignment with 98% accuracy. Twenty-five thousand Illumina HiSeq reads are sufficient for identification of the strain. StrainSeeker is a software program that identifies bacterial isolates by assigning them to nodes or leaves of a custom-made guide tree. StrainSeeker's web interface and pre-computed guide trees are available at http://bioinfo.ut.ee/strainseeker. Source code is stored at GitHub: https://github.com/bioinfo-ut/StrainSeeker.
Ditu, Lia-Mara; Chifiriuc, Mariana Carmen; Bezirtzoglou, Eugenia; Voltsi, Chrysa; Bleotu, Coralia; Pelinescu, Diana; Mihaescu, Grigore; Lazar, Veronica
2011-12-01
The increasing rate of antimicrobial resistance drastically reduced the efficiency of conventional antibiotics and led to the reconsideration of the interspecies interactions in influencing bacterial virulence and response to therapy. The aim of the study was the investigation of the influence of the soluble and cellular fractions of Enterococcus (E.) faecium CMGB16 probiotic culture on the virulence and antibiotic resistance markers expression in clinical enteropathogenic Escherichia (E.) coli strains. The 7 clinical enteropathogenic E. coli strains, one standard E. coli ATCC 25,922 and one Bacillus (B.) cereus strains were cultivated in nutrient broth, aerobically at 37 °C, for 24 h. The E. faecium CMGB16 probiotic strain was cultivated in anaerobic conditions, at 37 °C in MRS (Man Rogosa Sharpe) broth, and co-cultivated with two pathogenic strains (B. cereus and E. coli O28) culture fractions (supernatant, washed sediment and heat-inactivated culture) for 6 h, at 37 °C. After co-cultivation, the soluble and cellular fractions of the probiotic strain cultivated in the presence of two pathogenic strains were separated by centrifugation (6000 rpm, 10 min), heat-inactivated (15 min, 100 °C) and co-cultivated with the clinical enteropathogenic E. coli strains in McConkey broth, for 24 h, at 37 °C, in order to investigate the influence of the probiotic fractions on the adherence capacity and antibiotic susceptibility. All tested probiotic combinations influenced the adherence pattern of E. coli tested strains. The enteropathogenic E. coli strains susceptibility to aminoglycosides, beta-lactams and quinolones was increased by all probiotic combinations and decreased for amoxicillin-clavulanic acid. This study demonstrates that the plurifactorial anti-infective action of probiotics is also due to the modulation of virulence factors and antibiotic susceptibility expression in E. coli pathogenic strains. Copyright © 2011 Elsevier Ltd. All rights reserved.
Zhang, Chendong; Li, Ming-Yang; Tersoff, Jerry; Han, Yimo; Su, Yushan; Li, Lain-Jong; Muller, David A.; Shih, Chih-Kang
2018-02-01
Monolayer transition metal dichalcogenide heterojunctions, including vertical and lateral p-n junctions, have attracted considerable attention due to their potential applications in electronics and optoelectronics. Lattice-misfit strain in atomically abrupt lateral heterojunctions, such as WSe2-MoS2, offers a new band-engineering strategy for tailoring their electronic properties. However, this approach requires an understanding of the strain distribution and its effect on band alignment. Here, we study a WSe2-MoS2 lateral heterojunction using scanning tunnelling microscopy and image its moiré pattern to map the full two-dimensional strain tensor with high spatial resolution. Using scanning tunnelling spectroscopy, we measure both the strain and the band alignment of the WSe2-MoS2 lateral heterojunction. We find that the misfit strain induces type II to type I band alignment transformation. Scanning transmission electron microscopy reveals the dislocations at the interface that partially relieve the strain. Finally, we observe a distinctive electronic structure at the interface due to hetero-bonding.
Energy Technology Data Exchange (ETDEWEB)
K.R. Arpin; T.F. Trimble
2003-04-01
This testing was undertaken to develop material true stress-true strain curves for elastic-plastic material behavior for use in performing transient analysis. Based on the conclusions of this test, the true stress-true strain curves derived herein are valid for use in elastic-plastic finite element analysis for structures fabricated from these materials. In addition, for the materials tested herein, the ultimate strain values are greater than those values cited as the limits for the elastic-plastic strain acceptance criteria for transient analysis.
Chemical Profile of Monascus ruber Strains
Directory of Open Access Journals (Sweden)
Ahamed M. Moharram
2012-01-01
Full Text Available Chemical profile of Monascus ruber strains has been studied using gas chromatography-mass spectrometry (GC/MS analysis. The colour intensity of the red pigment and secondary metabolic products of two M. ruber strains (AUMC 4066 and AUMC 5705 cultivated on ten different media were also studied. Metabolic products can be classified into four categories: anticholesterol, anticancer, food colouring, and essential fatty acids necessary for human health. Using GC/MS, the following 88 metabolic products were detected: butyric acid and its derivatives (25 products, other fatty acids and their derivatives (19 products, pyran and its derivatives (22 products and other metabolites (22 products. Among these, 32 metabolites were specific for AUMC 4066 strain and 34 for AUMC 5705 strain, whereas 22 metabolites were produced by both strains on different tested substrates. Production of some metabolites depended on the substrate used. High number of metabolites was recorded in the red pigment extract obtained by both strains grown on malt broth and malt agar. Also, 42 aroma compounds were recorded (4 alcohols, 2 benzaldehydes, 27 esters, 3 lactones, 1 phenol, 1 terpenoid, 3 thiol compounds and acetate-3-mercapto butyric acid. Thin layer chromatography and GC/MS analyses revealed no mycotoxin citrinin in any media used for the growth of the two M. ruber strains.
Effects of C and Si on strain aging of strain-based API X60 pipeline steels
Sung, Hyo Kyung; Lee, Dong Ho; Lee, Sunghak; Lee, Byeong-Joo; Hong, Seung-Pyo; Kim, Young-Woon; Yoo, Jang Yong; Hwang, Byoungchul; Shin, Sang Yong
2017-05-01
Four types of strain-based API X60 pipeline steels were fabricated by varying the C and Si contents, and the effects of C and Si on strain aging were investigated. The 0.05 wt% C steels consisted mainly of polygonal ferrite (PF), whereas the 0.08 wt% C steels consisted of acicular ferrite (AF). The volume fraction of AF increased with increasing C content because C is an austenite stabilizer element. The volume fractions of bainitic ferrite (BF) of the 0.15 wt% Si steels were higher than those of the 0.25 wt% Si steels, whereas the volume fractions of the secondary phases were lower. From the tensile properties before and after the aging process of the strainbased API X60 pipeline steels, the yield strength increased and the uniform and total elongation decreased, which is the strain aging effect. The strain aging effect in the strain-based API X60 pipeline steels was minimized when the volume fraction of AF was increased and secondary phases were distributed uniformly. On the other hand, an excessively high C content formed fine precipitates, and the strain aging effect occurred because of the interactions among dislocations and fine precipitates.
Energy Technology Data Exchange (ETDEWEB)
Kasada, Ryuta, E-mail: r-kasada@iae.kyoto-u.ac.jp [Institute of Advanced Energy, Kyoto University Gokasho, Uji 611-0011, Kyoto (Japan); Konishi, Satoshi [Institute of Advanced Energy, Kyoto University Gokasho, Uji 611-0011, Kyoto (Japan); Hamaguchi, Dai; Ando, Masami; Tanigawa, Hiroyasu [Japan Atomic Energy Agency, Rokkasho, Aomori (Japan)
2016-11-01
Highlights: • We examined strain-rate jump nanoindentation on ion-irradiated stainless steel. • We observed irradiation hardening of the ion-irradiated stainless steel. • We found that strain-rate sensitivity parameter was slightly decreased after the ion-irradiation. - Abstract: The present study investigated strain-rate sensitivity (SRS) of a single crystal Fe–15Cr–20Ni austenitic steel before and after 10.5 MeV Fe{sup 3+} ion-irradiation up to 10 dpa at 300 °C using a strain-rate jump (SRJ) nanoindentation test. It was found that the SRJ nanoindentation test is suitable for evaluating the SRS at strain-rates from 0.001 to 0.2 s{sup −1}. Indentation size effect was observed for depth dependence of nanoindentation hardness but not the SRS. The ion-irradiation increased the hardness at the shallow depth region but decreased the SRS slightly.
5-Fluorouracil-resistant strain of Methanobacterium thermoautortrophicum
International Nuclear Information System (INIS)
Nagle, D.P. Jr.; Teal, R.; Eisenbraun, A.
1987-01-01
Growth of Methanobacterium thermoautotrophicum Marburg is inhibited by the pyrimidine, 5-fluorouracil (FU). It was shown previously that methanogenesis is not inhibited to the same extent as growth. A spontaneously occurring FU-resistant strain (RTAE-1) was isolated from a culture of strain Marburg. The growth of both strains was inhibited by 5-fluorodeoxyuridine but not 5-fluorocytosine, and the wild type was more susceptible to inhibition by 5-azauracil and 6-azauracil than was strain RTAE-1. The cellular targets for the pyrimidine analogs are not known. When the accumulation of 14 C-labeled uracil or FU by the two strains was compared, the wilt type took up 15-fold more radiolabel per cell than did the FU-resistant strain. In the wild type, radiolabel from uracil was incorporated into the soluble pool, RNA, and DNA. The metabolism of uracil appeared to involve a uracil phosphoribosyltransferase activity. Strain Marburg extracts contained this enzyme, whereas FU-resistant strain RTAE-1 extracts had less than 1/10 as much activity. Although it is possible that a change in permeability to the compounds plays a role in the stable resistance of strain RTAE-1, the fact that it lacks the ability to metabolize pyrimidines to nucleotides is sufficient to account for its phenotype
5-Fluorouracil-resistant strain of Methanobacterium thermoautotrophicum.
Nagle, D P; Teal, R; Eisenbraun, A
1987-09-01
Growth of Methanobacterium thermoautotrophicum Marburg is inhibited by the pyrimidine, 5-fluorouracil (FU). It was shown previously that methanogenesis is not inhibited to the same extent as growth. A spontaneously occurring FU-resistant strain (RTAE-1) was isolated from a culture of strain Marburg. The growth of both strains was inhibited by 5-fluorodeoxyuridine but not 5-fluorocytosine, and the wild type was more susceptible to inhibition by 5-azauracil and 6-azauracil than was strain RTAE-1. The cellular targets for the pyrimidine analogs are not known. When the accumulation of 14C-labeled uracil or FU by the two strains was compared, the wild type took up 15-fold more radiolabel per cell than did the FU-resistant strain. In the wild type, radiolabel from uracil was incorporated into the soluble pool, RNA, and DNA. The metabolism of uracil appeared to involve a uracil phosphoribosyltransferase activity. Strain Marburg extracts contained this enzyme, whereas FU-resistant strain RTAE-1 extracts had less than 1/10 as much activity. Although it is possible that a change in permeability to the compounds plays a role in the stable resistance of strain RTAE-1, the fact that it lacks the ability to metabolize pyrimidines to nucleotides is sufficient to account for its phenotype.
Complete Genomic Sequences of H3N8 Equine Influenza Virus Strains Used as Vaccine Strains in Japan.
Nemoto, Manabu; Yamanaka, Takashi; Bannai, Hiroshi; Tsujimura, Koji; Kokado, Hiroshi
2018-03-22
We sequenced the eight segments of influenza A virus strains A/equine/Ibaraki/1/2007 and A/equine/Yokohama/aq13/2010, which are strains of the Florida sublineage clades 1 and 2 of the H3N8 subtype equine influenza virus. These strains have been used as vaccine strains in Japan since 2016 in accordance with World Organization for Animal Health (OIE) recommendations. Copyright © 2018 Nemoto et al.
Directory of Open Access Journals (Sweden)
Liermann Jakob
2017-11-01
Full Text Available Chemoradiation of locally advanced non-metastatic pancreatic cancer can lead to secondary operability by tumor mass reduction. Here, we analyzed radiomodulating effects of oridonin and ponicidin in pancreatic cancer in vitro. Both agents are ent-kaurane diterpenoids, extracted from Isodon rubescens, a plant that is well known in Traditional Chinese Medicine. Cytotoxic effects have recently been shown in different tumor entities for both agents.
Strain accumulation in quasicrystalline solids
International Nuclear Information System (INIS)
Nori, F.; Ronchetti, M.; Elser, V.
1988-01-01
We study the relaxation of 2D quasicrystalline elastic networks when their constituent bonds are perturbed homogeneously. Whereas ideal, quasiperiodic networks are stable against such perturbations, we find significant accumulations of strain in a class of disordered networks generated by a growth process. The grown networks are characterized by root mean square phason fluctuations which grow linearly with system size. The strain accumulation we observe in these networks also grows linearly with system size. Finally, we find a dependence of strain accumulation on cooling rate
Khalili, N.; Asif, H.; Naguib, H. E.
2018-05-01
Electrospun polymeric fibers can be used as strain sensors due to their large surface to weight/volume ratio, high porosity and pore interconnectivity. Large strain flexible strain sensors are used in numerous applications including rehabilitation, health monitoring, and sports performance monitoring where large strain detection should be accommodated by the sensor. This has boosted the demand for a stretchable, flexible and highly sensitive sensor able to detect a wide range of mechanically induced deformations. Herein, a physically cross-linked polylactic acid (PLA) and thermoplastic polyurethane (TPU) blend is made into nanofiber networks via electrospinning. The PLA/TPU weight ratio is optimized to obtain a maximum attainable strain of 100% while maintaining its mechanical integrity. The TPU/PLA fibers also allowed for their thermally activated recovery due to shape memory properties of the substrate. This novel feature enhances the sensor’s performance as it is no longer limited by its plastic deformation. Using spray coating method, a homogeneous layer of single-walled carbon nanotube is deposited onto the as-spun fiber mat to induce electrical conductivity to the surface of the fibers. It is shown that stretching and bending the sensor result in a highly sensitive and linear response with a maximum gauge factor of 33.
A closer look at prion strains
Solforosi, Laura; Milani, Michela; Mancini, Nicasio; Clementi, Massimo; Burioni, Roberto
2013-01-01
Prions are infectious proteins that are responsible for transmissible spongiform encephalopathies (TSEs) and consist primarily of scrapie prion protein (PrPSc), a pathogenic isoform of the host-encoded cellular prion protein (PrPC). The absence of nucleic acids as essential components of the infectious prions is the most striking feature associated to these diseases. Additionally, different prion strains have been isolated from animal diseases despite the lack of DNA or RNA molecules. Mounting evidence suggests that prion-strain-specific features segregate with different PrPSc conformational and aggregation states. Strains are of practical relevance in prion diseases as they can drastically differ in many aspects, such as incubation period, PrPSc biochemical profile (e.g., electrophoretic mobility and glycoform ratio) and distribution of brain lesions. Importantly, such different features are maintained after inoculation of a prion strain into genetically identical hosts and are relatively stable across serial passages. This review focuses on the characterization of prion strains and on the wide range of important implications that the study of prion strains involves. PMID:23357828
Local strains in waste tank deflagration analysis
International Nuclear Information System (INIS)
Bryan, B.J.; Flanders, H.E. Jr.
1993-01-01
In recent years extensive effort has been expended to qualify buried nuclear waste storage tanks under accident conditions. One of these conditions is deflagration of the combustible gases which may build up over time. While much work has been done to calculate the general strain state, less effort has been made to address the local strains at structural discontinuities. An analytical method is presented for calculating these local strains and combining them with the general strain state. A closed form solution of the local strains is compared to a finite element solution
Spontaneous abortion and physical strain around implantation
DEFF Research Database (Denmark)
Hjøllund, Niels Henrik Ingvar; Jensen, T.K.; Bonde, J.P.
2000-01-01
Existing studies of physical strain and spontaneous abortion are mainly retrospective or based only on pregnancies that have survived the first trimester. Furthermore, almost all studies have relied on averaged measures of physical strain, which tend to blur an effect if peak values during short...... pregnancy the women recorded physical strain prospectively in a structured diary. Physical strain around the time of implantation was associated with later spontaneous abortion. The adjusted risk ratio for women who reported physical strain higher than average at day 6 to 9 after the estimated date...
Strain characterization of FinFETs using Raman spectroscopy
International Nuclear Information System (INIS)
Kaleli, B.; Hemert, T. van; Hueting, R.J.E.; Wolters, R.A.M.
2013-01-01
Metal induced strain in the channel region of silicon (Si) fin-field effect transistor (FinFET) devices has been characterized using Raman spectroscopy. The strain originates from the difference in thermal expansion coefficient of Si and titanium-nitride. The Raman map of the device region is used to determine strain in the channel after preparing the device with the focused ion beam milling. Using the Raman peak shift relative to that of relaxed Si, compressive strain values up to – 0.88% have been obtained for a 5 nm wide silicon fin. The strain is found to increase with reducing fin width though it scales less than previously reported results from holographic interferometry. In addition, finite-element method (FEM) simulations have been utilized to analyze the amount of strain generated after thermal processing. It is shown that obtained FEM simulated strain values are in good agreement with the calculated strain values obtained from Raman spectroscopy. - Highlights: ► Strain is characterized in nanoscale devices with Raman spectroscopy. ► There is a fin width dependence of the originated strain. ► Strain levels obtained from this technique is in correlation with device simulations
Strain bidimensional na cardiopatia de Takotsubo Two-dimensional strain in Takotsubo cardiomyopathy
Directory of Open Access Journals (Sweden)
Carlos Bellini G. Gomes
2010-08-01
Full Text Available Este relato apresenta o seguimento tardio de um caso de cardiomiopatia de Takotsubo com boa evolução clínica e melhora da função sistólica global ventricular esquerda. Contudo, observou-se persistência de significativa disfunção sistólica regional longitudinal que foi avaliada por meio de nova técnica ecocardiográfica (speckle tracking, com as medidas do strain (S e strain rate (SR correspondentes. Ressaltamos a importância desse novo método para o acompanhamento dessa cardiopatia, pois permite identificar os pacientes que persistem com disfunção sistólica e que possivelmente serão beneficiados com a manutenção da terapêutica clínica.This report presents the late follow-up of a case of Takotsubo cardiomyopathy with good clinical outcome and improved left ventricular global systolic function. However, there was persistence of significant regional longitudinal systolic dysfunction evaluated using a new echocardiographic technique (speckle tracking, with corresponding measures of strain (S and strain rate (SR. We emphasize the importance of this new method to monitoring this cardiomyopathy, since it identifies patients with persistent systolic dysfunction who will possibly benefit from maintenance of clinical therapy
Resonant tunneling measurements of size-induced strain relaxation
Akyuz, Can Deniz
Lattice mismatch strain available in such semiconductor heterostructures as Si/SiGe or GaAs/AlGaAs can be employed to alter the electronic and optoelectronic properties of semiconductor structures and devices. When deep submicron structures are fabricated from strained material, strained layers relax by sidewall expansion giving rise to size- and geometry-dependent strain gradients throughout the structure. This thesis describes a novel experimental technique to probe the size-induced strain relaxation by studying the tunneling current characteristics of strained p-type Si/SiGe resonant tunneling diodes. Our current-voltage measurements on submicron strained p-Si/SiGe double- and triple-barrier resonant tunneling structures as a function of device diameter, D, provide experimental access to both the average strain relaxation (which leads to relative shifts in the tunneling current peak positions) and strain gradients (which give rise to a fine structure in the current peaks due to inhomogeneous strain-induced lateral quantization). We find that strain relaxation is significant, with a large fraction of the strain energy relaxed on average in D ≤ 0.25 m m devices. Further, the in-plane potentials that arise from inhomogeneous strain gradients are large. In the D ˜ 0.2 m m devices, the corresponding lateral potentials are approximately parabolic exceeding ˜ 25 meV near the perimeter. These potentials create discrete hole states in double-barrier structures (single well), and coupled hole states in triple-barrier structures (two wells). Our results are in excellent agreement with finite-element strain calculations in which the strained layers are permitted to relax to a state of minimum energy by sidewall expansion. Size-induced strain relaxation will undoubtedly become a serious technological issue once strained devices are scaled down to the deep submicron regime. Interestingly, our calculations predict and our measurements are consistent with the appearance of
Directory of Open Access Journals (Sweden)
Wei Wang
2017-12-01
Full Text Available The strain rate effect on the tensile behaviors of a high specific strength steel (HSSS with dual-phase microstructure has been investigated. The yield strength, the ultimate strength and the tensile toughness were all observed to increase with increasing strain rates at the range of 0.0006 to 56/s, rendering this HSSS as an excellent candidate for an energy absorber in the automobile industry, since vehicle crushing often happens at intermediate strain rates. Back stress hardening has been found to play an important role for this HSSS due to load transfer and strain partitioning between two phases, and a higher strain rate could cause even higher strain partitioning in the softer austenite grains, delaying the deformation instability. Deformation twins are observed in the austenite grains at all strain rates to facilitate the uniform tensile deformation. The B2 phase (FeAl intermetallic compound is less deformable at higher strain rates, resulting in easier brittle fracture in B2 particles, smaller dimple size and a higher density of phase interfaces in final fracture surfaces. Thus, more energy need be consumed during the final fracture for the experiments conducted at higher strain rates, resulting in better tensile toughness.
Stress and strain measurements in solids
International Nuclear Information System (INIS)
Askegaard, V.
1978-01-01
A design basis is given for stress- and strain cells to be used in a solid either externally loaded or with a stressfree strain field (for example shrinkage). A stress- and a strain cell has been designed for use in granular materials. Calibration tests show either good or reasonably good correspondance with calculated values. (orig.) [de
Directory of Open Access Journals (Sweden)
Frederico Guilherme Coutinho Abath
1990-03-01
Full Text Available Three Yersinia pestis strains isolated from humans and one laboratory strain (EV76 were grown in rich media at 28§C and 37§C and their outer membrane protein composition compared by sodium dodecyl sulphate polyacrylamide gel electrophoresis (SDS-Page. Several proteins with molecular weights ranging from 34 kDa to 7 kDa were observed to change in relative abundance in samples grown at different temperatures. At least seven Y. pestis outer membrane proteins showed a temperature-dependent and strain-specific behaviour. Some differences between the outer membrane proteins of full-pathogenic wild isolates and the EV76 strain could aldso be detected and the relevance of this finding on the use of laboratory strains as a reference to the study of Y. pestis biological properties is discuted.
Properties of strain gages at cryogenic temperature
International Nuclear Information System (INIS)
Shibata, Nobuo; Fujiyoshi, Toshimitsu.
1978-01-01
At the time of developing superconduction generators, the stress measurement for rotor parts is required to grasp the safety and performance of the rotor at cryogenic temperature, which is cooled with liquid helium. In case of carrying out the stress measurement with strain gages, the problems are as follows. The strain gages and lead wires are exposed to cryogenic temperature from 4 to 10 K and strong magnetic field of about 3T, and subjected to high centrifugal acceleration of about 500G. In order to establish the techniques of the stress measurement under such conditions, the adhesives and damp-proof coatings for strain gages and strain gages themselves in Japan and foreign countries were examined on the properties at cryogenic temperature. As for the properties of strain gages, mainly the apparent strain owing to temperature change was investigated, and the change of the gage factors was studies only at liquid nitrogen temperature. The stress measurement with strain gages at low temperature had been studied in detail down to liquid nitrogen temperature concerning LNG tanks. The experimental apparatus, the samples, the testing methods and the test results of cooling tests on adhesives and damp-proof coatings, and the temperature characteristics of strain gages are reported. The usable adhesives and coatings were found, and correction by accurate temperature measurement is required for apparent strain. (Kako, I.)
Resolution of axial shear strain elastography
International Nuclear Information System (INIS)
Thitaikumar, Arun; Righetti, Raffaella; Krouskop, Thomas A; Ophir, Jonathan
2006-01-01
The technique of mapping the local axial component of the shear strain due to quasi-static axial compression is defined as axial shear strain elastography. In this paper, the spatial resolution of axial shear strain elastography is investigated through simulations, using an elastically stiff cylindrical lesion embedded in a homogeneously softer background. Resolution was defined as the smallest size of the inclusion for which the strain value at the inclusion/background interface was greater than the average of the axial shear strain values at the interface and inside the inclusion. The resolution was measured from the axial shear strain profile oriented at 45 0 to the axis of beam propagation, due to the absence of axial shear strain along the normal directions. The effects of the ultrasound system parameters such as bandwidth, beamwidth and transducer element pitch along with signal processing parameters such as correlation window length (W) and axial shift (ΔW) on the estimated resolution were investigated. The results show that the resolution (at 45 0 orientation) is determined by the bandwidth and the beamwidth. However, the upper bound on the resolution is limited by the larger of the beamwidth and the window length, which is scaled inversely to the bandwidth. The results also show that the resolution is proportional to the pitch and not significantly affected by the axial window shift
International Nuclear Information System (INIS)
Isaac Samuel, B.; Choudhary, B.K.; Bhanu Sankara Rao, K.
2010-01-01
Tensile tests were conducted on type 316 L(N) stainless steel over a wide temperature range of 300-1123 K employing strain rates ranging from 3.16 X 10 -5 to 3.16 X 10 -3/s . The variation of strain energy in terms of modulus of resilience and modulus of toughness over the wide range of temperatures and strain rates were examined. The variation in modulus of resilience with temperature and strain rate did not show the signatures of dynamic strain ageing (DSA). However, the modulus of toughness exhibited a plateau at the intermediate temperatures of 523-1023 K. Further, the distribution of energy absorbed till necking and energy absorbed from necking till fracture were found to characterise the deformation and damage processes, respectively, and exhibited anomalous variations in the temperature range 523-823 K and 823-1023 K, respectively. In addition to the observed manifestations of DSA such as serrated load-elongation curve, peaks/plateaus in flow stress, ultimate tensile strength and work hardening rate, negative strain rate sensitivity and ductility minima, the observed anomalous variations in modulus of toughness at intermediate temperatures (523-1023 K) can be regarded as yet another key manifestation of DSA. At temperatures above 1023 K, a sharp decrease in the modulus of toughness and also in the strain energies up to necking and from necking to fracture observed, with increasing temperature and decreasing strain rate, reveal the onset of dynamic recovery leading to early cross slip and climb processes. (author)
International Nuclear Information System (INIS)
Noban, Mohammad; Jahed, Hamid
2007-01-01
A time-efficient method for predicting ratchetting strain is proposed. The ratchetting strain at any cycle is determined by finding the ratchetting rate at only a few cycles. This determination is done by first defining the trajectory of the origin of stress in the deviatoric stress space and then incorporating this moving origin into a cyclic plasticity model. It is shown that at the beginning of the loading, the starting point of this trajectory coincides with the initial stress origin and approaches the mean stress, displaying a power-law relationship with the number of loading cycles. The method of obtaining this trajectory from a standard uniaxial asymmetric cyclic loading is presented. Ratchetting rates are calculated with the help of this trajectory and through the use of a constitutive cyclic plasticity model which incorporates deviatoric stresses and back stresses that are measured with respect to this moving frame. The proposed model is used to predict the ratchetting strain of two types of steels under single- and multi-step loadings. Results obtained agree well with the available experimental measurements
Strain engineering on transmission carriers of monolayer phosphorene.
Zhang, Wei; Li, Feng; Hu, Junsong; Zhang, Ping; Yin, Jiuren; Tang, Xianqiong; Jiang, Yong; Wu, Bozhao; Ding, Yanhuai
2017-11-22
The effects of uniaxial strain on the structure, band gap and transmission carriers of monolayer phosphorene were investigated by first-principles calculations. The strain induced semiconductor-metal as well as direct-indirect transitions were studied in monolayer phosphorene. The position of CBM which belonged to indirect gap shifts along the direction of the applied strain. We have concluded the change rules of the carrier effective mass when plane strains are applied. In band structure, the sudden decrease of band gap or the new formation of CBM (VBM) causes the unexpected change in carrier effective mass. The effects of zigzag and armchair strain on the effective electron mass in phosphorene are different. The strain along zigzag direction has effects on the electrons effective mass along both zigzag and armchair direction. By contrast, armchair-direction strain seems to affect only on the free electron mass along zigzag direction. For the holes, the effective masses along zigzag direction are largely affected by plane strains while the effective mass along armchair direction exhibits independence in strain processing. The carrier density of monolayer phosphorene at 300 K is calculated about [Formula: see text] cm -2 , which is greatly influenced by the temperature and strain. Strain engineering is an efficient method to improve the carrier density in phosphorene.
Chen, Fangzhou; Knutson, Todd P; Porter, Robert E; Ciarlet, Max; Mor, Sunil Kumar; Marthaler, Douglas G
2017-12-01
Rotavirus G (RVG) strains have been detected in a variety of avian species, but RVG genomes have been published from only a single pigeon and two chicken strains. Two turkey RVG strains were identified and characterized, one in a hatchery with no reported health issues and the other in a hatchery with high embryo/poult mortality. The two turkey RVG strains shared only an 85.3 % nucleotide sequence identity in the VP7 gene while the other genes possessed high nucleotide identity among them (96.3-99.9 %). Low nucleotide percentage identities (31.6-87.3 %) occurred among the pigeon and chicken RVG strains. Interestingly, potential recombination events were detected between our RVG strains and a human RVB strain, in the VP6 and NSP3 segments. The epidemiology of RVG in avian flocks and the pathogenicity of the two different RVG strains should be further investigated to understand the ecology and impact of RVG in commercial poultry flocks.
International Nuclear Information System (INIS)
Liu Fang; Wu Yu; Long Feng
2010-01-01
Based on Pacman device which is widely used to investigate the axial strain dependence of the critical current in superconductors, the finite element analysis method is employed to carry out the force analysis of the spring and the superconducting strand, thereby the axial and lateral strain distributions of the superconducting strand are obtained. According to the two extreme assumptions(low inter-filament resistance and high inter-filament resistance), the effects of the strain homogeneity at the cross section of the superconductor on the critical current is analyzed combined with the Nb 3 Sn deviatoric strain-critical current scaling law. (authors)
Recent advances in echocardiography: strain and strain rate imaging [version 1; referees: 3 approved
Directory of Open Access Journals (Sweden)
Oana Mirea
2016-04-01
Full Text Available Deformation imaging by echocardiography is a well-established research tool which has been gaining interest from clinical cardiologists since the introduction of speckle tracking. Post-processing of echo images to analyze deformation has become readily available at the fingertips of the user. New parameters such as global longitudinal strain have been shown to provide added diagnostic value, and ongoing efforts of the imaging societies and industry aimed at harmonizing methods will improve the technique further. This review focuses on recent advances in the field of echocardiographic strain and strain rate imaging, and provides an overview on its current and potential future clinical applications.
Yeast strains and methods of use thereof
Goddard, Matthew Robert; Gardner, Richard Clague; Anfang, Nicole
2013-01-01
The present invention relates to yeast strains and, in particular, to yeast stains for use in fermentation processes. The invention also relates to methods of fermentation using the yeast strains of the invention either alone or in combination with other yeast strains. The invention thither relates to methods for the selection of yeast strains suitable for fermentation cultures by screening for various metabolic products and the use of specific nutrient sources.
Influence of strain on dislocation core in silicon
Pizzagalli, L.; Godet, J.; Brochard, S.
2018-05-01
First principles, density functional-based tight binding and semi-empirical interatomic potentials calculations are performed to analyse the influence of large strains on the structure and stability of a 60? dislocation in silicon. Such strains typically arise during the mechanical testing of nanostructures like nanopillars or nanoparticles. We focus on bi-axial strains in the plane normal to the dislocation line. Our calculations surprisingly reveal that the dislocation core structure largely depends on the applied strain, for strain levels of about 5%. In the particular case of bi-axial compression, the transformation of the dislocation to a locally disordered configuration occurs for similar strain magnitudes. The formation of an opening, however, requires larger strains, of about 7.5%. Furthermore, our results suggest that electronic structure methods should be favoured to model dislocation cores in case of large strains whenever possible.
Taxonomy of oxalotrophic Methylobacterium strains
Sahin, Nurettin; Kato, Yuko; Yilmaz, Ferah
2008-10-01
Most of the oxalotrophic bacteria are facultative methylotrophs and play important ecological roles in soil fertility and cycling of elements. This study gives a detailed picture of the taxonomy and diversity of these bacteria and provides new information about the taxonomical variability within the genus Methylobacterium. Twelve mesophilic, pink-pigmented, and facultatively methylotrophic oxalate-oxidizing strains were included in this work that had been previously isolated from the soil and some plant tissues by the potassium oxalate enrichment method. The isolates were characterized using biochemical tests, cellular lipid profiles, spectral characteristics of carotenoid pigments, G+C content of the DNA, and 16S rDNA sequencing. The taxonomic similarities among the strains were analyzed using the simple matching ( S SM) and Jaccard ( S J) coefficients, and the UPGMA clustering algorithm. The phylogenetic position of the strains was inferred by the neighbor-joining method on the basis of the 16S rDNA sequences. All isolates were Gram-negative, facultatively methylotrophic, oxidase and catalase positive, and required no growth factors. Based on the results of numerical taxonomy, the strains formed four closely related clusters sharing ≥85% similarity. Analysis of the 16S rDNA sequences demonstrated that oxalotrophic, pink-pigmented, and facultatively methylotrophic strains could be identified as members of the genus Methylobacterium. Except for M. variabile and M. aquaticum, all of the Methylobacterium type strains tested had the ability of oxalate utilization. Our results indicate that the capability of oxalate utilization seems to be an uncommon trait and could be used as a valuable taxonomic criterion for differentiation of Methylobacterium species.
Stress strain flow curves for Cu-OFP
International Nuclear Information System (INIS)
Sandstroem, Rolf; Hallgren, Josefin
2009-04-01
Stress strain curves of oxygen free copper alloyed with phosphorus Cu-OFP have been determined in compression and tension. The compression tests were performed at room temperature for strain rates between 10 -5 and 10 -3 1/s. The tests in tension covered the temperature range 20 to 175 deg C for strain rates between 10 -7 and 5x10 -3 1/s. The results in compression and tension were close for similar strain rates. A model for stress strain curves has been formulated using basic dislocation mechanisms. The model has been set up in such a way that fitting of parameters to the curves is avoided. By using a fundamental creep model as a basis a direct relation to creep data has been established. The maximum engineering flow stress in tension is related to the creep stress giving the same strain rate. The model reproduces the measured flow curves as function of temperature and strain rate in the investigated interval. The model is suitable to use in finite-element computations of structures in Cu-OFP
The many shades of prion strain adaptation.
Baskakov, Ilia V
2014-01-01
In several recent studies transmissible prion disease was induced in animals by inoculation with recombinant prion protein amyloid fibrils produced in vitro. Serial transmission of amyloid fibrils gave rise to a new class of prion strains of synthetic origin. Gradual transformation of disease phenotypes and PrP(Sc) properties was observed during serial transmission of synthetic prions, a process that resembled the phenomenon of prion strain adaptation. The current article discusses the remarkable parallels between phenomena of prion strain adaptation that accompanies cross-species transmission and the evolution of synthetic prions occurring within the same host. Two alternative mechanisms underlying prion strain adaptation and synthetic strain evolution are discussed. The current article highlights the complexity of the prion transmission barrier and strain adaptation and proposes that the phenomenon of prion adaptation is more common than previously thought.
On lower order strain gradient plasticity theories
DEFF Research Database (Denmark)
Niordson, Christian Frithiof; Hutchinson, J. W.
2003-01-01
By way of numerical examples, this paper explores the nature of solutions to a class of strain gradient plasticity theories that employ conventional stresses, equilibrium equations and boundary conditions. Strain gradients come into play in these modified conventional theories only to alter...... the tangent moduli governing increments of stress and strain. It is shown that the modification is far from benign from a mathematical standpoint, changing the qualitative character of solutions and leading to a new type of localization that is at odds with what is expected from a strain gradient theory....... The findings raise questions about the physical acceptability of this class of strain gradient theories....
Roll bonding of strained aluminium
DEFF Research Database (Denmark)
Staun, Jakob M.
2003-01-01
This report investigates roll bonding of pre-strained (å ~ 4) aluminium sheets to produce high strain material from high purity aluminium (99.996%) and commercial pure aluminium (99.6%). The degree of bonding is investigated by optical microscopy and ultrasonic scanning. Under the right...... of the cross rolled volume fraction is found. To further asses this effect, and the anisotropy, it is necessary to acquire knowledge about both texture and microstructure, e.g. by TEM. Roll bonding of pre-strained aluminium is found to be a possible alternative to ARB in the quest for ultra-fine grained...
Wei, Shiyin; Zhang, Zhaohui; Li, Shunlong; Li, Hui
2017-10-01
Strain is a direct indicator of structural safety. Therefore, strain sensors have been used in most structural health monitoring systems for bridges. However, until now, the investigation of strain response has been insufficient. This paper conducts a comprehensive study of the strain features of the U ribs and transverse diaphragm on an orthotropic steel deck and proposes a statistical paradigm for crack detection based on the features of vehicle-induced strain response by using the densely distributed optic fibre Bragg grating (FBG) strain sensors. The local feature of strain under vehicle load is highlighted, which enables the use of measurement data to determine the vehicle loading event and to make a decision regarding the health status of a girder near the strain sensors via technical elimination of the load information. Time-frequency analysis shows that the strain contains three features: the long-term trend item, the short-term trend item, and the instantaneous vehicle-induced item (IVII). The IVII is the wheel-induced strain with a remarkable local feature, and the measured wheel-induced strain is only influenced by the vehicle near the FBG sensor, while other vehicles slightly farther away have no effect on the wheel-induced strain. This causes the local strain series, among the FBG strain sensors in the same transverse locations of different cross-sections, to present similarities in shape to some extent and presents a time delay in successive order along the driving direction. Therefore, the strain series induced by an identical vehicle can be easily tracked and compared by extracting the amplitude and calculating the mutual ratio to eliminate vehicle loading information, leaving the girder information alone. The statistical paradigm for crack detection is finally proposed, and the detection accuracy is then validated by using dense FBG strain sensors on a long-span suspension bridge in China.
Pheromonal divergence between two strains of Spodoptera frugiperda
Unbehend, M.; Hänniger, S.; Meagher, R.L.; Heckel, D.G.; Groot, A.T.
2013-01-01
Spodoptera frugiperda consists of two genetically and behaviorally different strains, the corn- and the rice-strain, which seem to be in the process of sympatric speciation. We investigated the role of strain-specific sexual communication as a prezygotic mating barrier between both strains by
MM98.83 Quantification of Combined Strain Paths
DEFF Research Database (Denmark)
Nielsen, Morten Sturgård; Lindegren, Maria; Wanheim, Tarras
1998-01-01
When working with processes where large plastic deformation occurs, a way of desribing the deformation process is to view the whole deformation history as a curve in the 6-dimensional shear strain normal strain space, henceforth called a strain history curve (SHC). This paper focuses on the SHC...... 3D-plasticity. Adirect use of the SHC, is to measure the yield surface at different points at a SHC, thus establishing data describing the importance of strain rotations or even strain reversals within a process. Two subcases for displaying SHC will be mentioned:The plane strain case and the single...
Development of piping strain sensor for stress evaluation
International Nuclear Information System (INIS)
Takahama, Tsunemichi; Nishimura, Kazuma; Ninomiya, Seiichiro; Matsumoto, Yoshihiro; Harada, Yutaka
2014-01-01
In a small diameter piping, stresses are generated due to internal fluid or pump vibrations especially around the welding parts. Authors have successfully developed a pipe strain sensor which is able to measure such stresses. Unlike conventional methods using strain gages and adhesive bond, the sensor can measure the strain without putting adhesive bond on the piping surface. However, the strain sensor can provide measurements with a level of accuracy equivalent to that of conventional method using strain gages and adhesive bond. Accordingly, the strain sensor can significantly reduce the working time without any loss of the measurement accuracy. (author)
DEFF Research Database (Denmark)
Broholm, Rikke; Wiinberg, Niels; Simonsen, Lene
2014-01-01
BACKGROUND: Measurement of the ankle and toe pressures are often performed using a plethysmograph, compression cuffs and a strain gauge. Usually, the strain gauge contains mercury but other alternatives exist. From 2014, the mercury-containing strain gauge will no longer be available in the Europ......BACKGROUND: Measurement of the ankle and toe pressures are often performed using a plethysmograph, compression cuffs and a strain gauge. Usually, the strain gauge contains mercury but other alternatives exist. From 2014, the mercury-containing strain gauge will no longer be available...... in the European Union. The aim of this study was to compare an indium-gallium strain gauge to the established mercury-containing strain gauge. METHODS: Consecutive patients referred to the Department of Clinical Physiology and Nuclear Medicine at Bispebjerg and Frederiksberg Hospitals for measurements of systolic...... ankle and toe pressures volunteered for the study. Ankle and toe pressures were measured twice with the mercury and the indium-gallium strain gauge in random order. Comparison of the correlation between the mean pressure using the mercury and the indium-gallium device and the difference between the two...
STRAINED OFF BREAST MILK: PRO AND CONTRA
Directory of Open Access Journals (Sweden)
O.L. Lukoyanova
2010-01-01
Full Text Available The questions of feeding of children with strained off breast milk are discussed in this article. Author presents medical indications to such type of feeding, peculiarities and rules of storage of strained off milk. There is a brief literature review on the influence of different factors on the composition of strained off breast milk.Key words: strained milk, breast feeding, pasteurization, freezing.(Voprosy sovremennoi pediatrii — Current Pediatrics. 2010;9(2:70-73
ANISOTROPIC STRAIN-HARDENING IN POLYCRYSTALLINE COPPER AND ALUMINUM
HESS, F
1993-01-01
A new viscoplastic model for the plastic stress-strain behaviour of f.c.c. metals is presented. In this model the strain hardening results from increasing dislocation densities. The observed stagnation of strain hardening after strain reversals is explained by a lowering of the increase in
Conduction gap in graphene strain junctions: direction dependence
International Nuclear Information System (INIS)
Nguyen, M Chung; Nguyen, V Hung; Dollfus, P; Nguyen, Huy-Viet
2014-01-01
It has been shown in a recent study (Nguyen et al 2014 Nanotechnology 25 165201) that unstrained/strained graphene junctions are promising candidates to improve the performance of graphene transistors which is usually hindered by the gapless nature of graphene. Although the energy bandgap of strained graphene still remains zero, the shift of Dirac points in the k-space due to strain-induced deformation of graphene lattice can lead to the appearance of a finite conduction gap of several hundred meV in strained junctions with a strain of only a few per cent. However, since it depends essentially on the magnitude of the Dirac point shift, this conduction gap strongly depends on the direction of applied strain and the transport direction. In this work, a systematic study of conduction-gap properties with respect to these quantities is presented and the results are carefully analyzed. Our study provides useful information for further investigations to exploit graphene-strained junctions in electronic applications and strain sensors. (paper)
Evaluation of Lactobacillus strains for selected probiotic properties.
Turková, Kristýna; Mavrič, Anja; Narat, Mojca; Rittich, Bohuslav; Spanová, Alena; Rogelj, Irena; Matijašić, Bojana Bogovič
2013-07-01
Eleven strains of Lactobacillus collected in the Culture Collection of Dairy Microorganisms (CCDM) were evaluated for selected probiotic properties such as survival in gastrointestinal fluids, antimicrobial activity, and competition with non-toxigenic Escherichia coli O157:H7 for adhesion on Caco-2 cells. The viable count of lactobacilli was reduced during 3-h incubation in gastric fluid followed by 3-h incubation in intestinal fluid. All strains showed antimicrobial activity and the three most effective strains inhibited the growth of at least 16 indicator strains. Antimicrobial metabolites of seven strains active against Lactobacillus and Clostridium indicator strains were found to be sensitive to proteinase K and trypsin, which indicates their proteinaceous nature. The degree of competitive inhibition of non-toxigenic E. coli O157:H7 adhesion on the surface of Caco-2 cells was strain-dependent. A significant decrease (P strains were selected for additional studies of antimicrobial activity, i.e., Lactobacillus gasseri CCDM 215, Lactobacillus acidophilus CCDM 149, and Lactobacillus helveticus CCDM 82.
Strain path and work-hardening behavior of brass
International Nuclear Information System (INIS)
Sakharova, N.A.; Fernandes, J.V.; Vieira, M.F.
2009-01-01
Plastic straining in metal forming usually includes changes of strain path, which are frequently not taken into account in the analysis of forming processes. Moreover, strain path change can significantly affect the mechanical behavior and microstructural evolution of the material. For this reason, a combination of several simple loading test sequences is an effective way to investigate the dislocation microstructure of sheet metals under such forming conditions. Pure tension and rolling strain paths and rolling-tension strain path sequences were performed on brass sheets. A study of mechanical behavior and microstructural evolution during the simple and the complex strain paths was carried out, within a wide range of strain values. The appearance and development of deformation twinning was evident. It was shown that strain path change promotes the onset of premature twinning. The work-hardening behavior is discussed in terms of the twinning and dislocation microstructure evolution, as revealed by transmission electron microscopy
MODERNIZATION OF GENEOTIPING OF STRAINS B. PERTUSSIS
Directory of Open Access Journals (Sweden)
G. A. Ivashinnikova
2013-01-01
Full Text Available The new rapid molecular genotyping method was developed for studying the structure of ptxP promoter of pertussis toxin. Method is based on PCR-RFLP analysis, which allows studying the specific restriction profiles of the B. pertussis strains and allows differentiation of the strains with the ptxP structural particularities. The developed method for genotyping of strains of B. pertussis can be hhelpful when monitoring strains of the causative agent of whooping cough in system of an epidemiological surveillance over pertussis infections, allowing observation over circulating population of B.pertussis, revealing strains of the causative agent of whooping cough with high production of pertussis toxin and to watch their distribution.
Laser-induced photo-thermal strain imaging
Choi, Changhoon; Ahn, Joongho; Jeon, Seungwan; Kim, Chulhong
2018-02-01
Vulnerable plaque is the one of the leading causes of cardiovascular disease occurrence. However, conventional intravascular imaging techniques suffer from difficulty in finding vulnerable plaque due to limitation such as lack of physiological information, imaging depth, and depth sensitivity. Therefore, new techniques are needed to help determine the vulnerability of plaque, Thermal strain imaging (TSI) is an imaging technique based on ultrasound (US) wave propagation speed that varies with temperature of medium. During temperature increase, strain occurs in the medium and its variation tendency is depending on the type of tissue, which makes it possible to use for tissue differentiation. Here, we demonstrate laser-induced photo-thermal strain imaging (pTSI) to differentiate tissue using an intravascular ultrasound (IVUS) catheter and a 1210-nm continuous-wave laser for heating lipids intensively. During heating, consecutive US images were obtained from a custom-made phantom made of porcine fat and gelatin. A cross correlation-based speckle-tracking algorithm was then applied to calculate the strain of US images. In the strain images, the positive strain produced in lipids (porcine fat) was clearly differentiated from water-bearing tissue (gelatin). This result shows that laser-induced pTSI could be a new method to distinguish lipids in the plaque and can help to differentiate vulnerability of plaque.
Strain-controlled electrocatalysis on multimetallic nanomaterials
Luo, Mingchuan; Guo, Shaojun
2017-11-01
Electrocatalysis is crucial for the development of clean and renewable energy technologies, which may reduce our reliance on fossil fuels. Multimetallic nanomaterials serve as state-of-the-art electrocatalysts as a consequence of their unique physico-chemical properties. One method of enhancing the electrocatalytic performance of multimetallic nanomaterials is to tune or control the surface strain of the nanomaterials, and tremendous progress has been made in this area in the past decade. In this Review, we summarize advances in the introduction, tuning and quantification of strain in multimetallic nanocrystals to achieve more efficient energy conversion by electrocatalysis. First, we introduce the concept of strain and its correlation with other key physico-chemical properties. Then, using the electrocatalytic reduction of oxygen as a model reaction, we discuss the underlying mechanisms behind the strain-adsorption-reactivity relationship based on combined classical theories and models. We describe how this knowledge can be harnessed to design multimetallic nanocrystals with optimized strain to increase the efficiency of oxygen reduction. In particular, we highlight the unexpectedly beneficial (and previously overlooked) role of tensile strain from multimetallic nanocrystals in improving electrocatalysis. We conclude by outlining the challenges and offering our perspectives on the research directions in this burgeoning field.
Zhang, Chendong
2018-01-12
Monolayer transition metal dichalcogenide heterojunctions, including vertical and lateral p–n junctions, have attracted considerable attention due to their potential applications in electronics and optoelectronics. Lattice-misfit strain in atomically abrupt lateral heterojunctions, such as WSe2–MoS2, offers a new band-engineering strategy for tailoring their electronic properties. However, this approach requires an understanding of the strain distribution and its effect on band alignment. Here, we study a WSe2–MoS2 lateral heterojunction using scanning tunnelling microscopy and image its moiré pattern to map the full two-dimensional strain tensor with high spatial resolution. Using scanning tunnelling spectroscopy, we measure both the strain and the band alignment of the WSe2–MoS2 lateral heterojunction. We find that the misfit strain induces type II to type I band alignment transformation. Scanning transmission electron microscopy reveals the dislocations at the interface that partially relieve the strain. Finally, we observe a distinctive electronic structure at the interface due to hetero-bonding.
Inoue, Hiroyuki; Hashimoto, Seitaro; Matsushika, Akinori; Watanabe, Seiya; Sawayama, Shigeki
2014-12-01
The industrial Saccharomyces cerevisiae IR-2 is a promising host strain to genetically engineer xylose-utilizing yeasts for ethanol fermentation from lignocellulosic hydrolysates. Two IR-2-based haploid strains were selected based upon the rate of xylulose fermentation, and hybrids were obtained by mating recombinant haploid strains harboring heterogeneous xylose dehydrogenase (XDH) (wild-type NAD(+)-dependent XDH or engineered NADP(+)-dependent XDH, ARSdR), xylose reductase (XR) and xylulose kinase (XK) genes. ARSdR in the hybrids selected for growth rates on yeast extract-peptone-dextrose (YPD) agar and YP-xylose agar plates typically had a higher activity than NAD(+)-dependent XDH. Furthermore, the xylose-fermenting performance of the hybrid strain SE12 with the same level of heterogeneous XDH activity was similar to that of a recombinant strain of IR-2 harboring a single set of genes, XR/ARSdR/XK. These results suggest not only that the recombinant haploid strains retain the appropriate genetic background of IR-2 for ethanol production from xylose but also that ARSdR is preferable for xylose fermentation.
Zhang, Chendong; Li, Ming-yang; Tersoff, Jerry; Han, Yimo; Su, Yushan; Li, Lain-Jong; Muller, David A.; Shih, Chih-Kang
2018-01-01
Monolayer transition metal dichalcogenide heterojunctions, including vertical and lateral p–n junctions, have attracted considerable attention due to their potential applications in electronics and optoelectronics. Lattice-misfit strain in atomically abrupt lateral heterojunctions, such as WSe2–MoS2, offers a new band-engineering strategy for tailoring their electronic properties. However, this approach requires an understanding of the strain distribution and its effect on band alignment. Here, we study a WSe2–MoS2 lateral heterojunction using scanning tunnelling microscopy and image its moiré pattern to map the full two-dimensional strain tensor with high spatial resolution. Using scanning tunnelling spectroscopy, we measure both the strain and the band alignment of the WSe2–MoS2 lateral heterojunction. We find that the misfit strain induces type II to type I band alignment transformation. Scanning transmission electron microscopy reveals the dislocations at the interface that partially relieve the strain. Finally, we observe a distinctive electronic structure at the interface due to hetero-bonding.
Hofmann, Douglas C. (Inventor); Wilcox, Brian (Inventor)
2016-01-01
Bulk metallic glass-based strain wave gears and strain wave gear components. In one embodiment, a strain wave gear includes: a wave generator; a flexspline that itself includes a first set of gear teeth; and a circular spline that itself includes a second set of gear teeth; where at least one of the wave generator, the flexspline, and the circular spline, includes a bulk metallic glass-based material.
CYANOBACTERIA OF THE GENUS PROCHLOROTHRIX
Directory of Open Access Journals (Sweden)
Alexander Vasilievich Pinevich
2012-05-01
Full Text Available Green cyanobacteria are distinguished from blue-green ones by the possession of a chlorophyll-containing light harvesting antenna. Three genera of green cyanobacteria, namely Acaryochloris, Prochlorococcus and Prochloron, are unicellular and of marine habitat; Prochlorococcus marinus attracts most attention due to its outstanding role in prime productivity. The fourth genus, Prochlorothrix, is represented by filamentous freshwater strains. Unlike the rest of green cyanobacteria, Prochlorothrix is paradoxically rare: it has been isolated from two European locations only. Taking into account fluctuating blooms, morphological resemblance with Planktothrix and Pseudanabaena, and unsuccessful enrichment of Prochlorothrix, the preferred strategy of search for this cyanobacterium is based on PCR with natural DNA and specific primers. This approach already demonstrates a broader distribution of Prochlorothrix: marker genes have been found in at least two additional locations. Despite the growing evidence for naturally occurring Prochlorothrix, there are only a few cultivated strains, and only one of them (PCC 9006 is claimed to be axenic. In multixenic cultures, Prochlorothrix is accompanied by heterotrophic bacteria, indicating a consortium-type association. The genus Prochlorothrix includes two species: P. hollandica and P. scandica based on distinctions in genomic DNA, cell size, temperature optimum, and fatty acid composition of membrane lipids. In this short review, the properties of cyanobacteria of the genus Prochlorothrix are described, and the evolutionary scenario of green cyanobacteria, especially taking into account their role in the origin of simple chloroplast is given.
Dynamic strains for earthquake source characterization
Barbour, Andrew J.; Crowell, Brendan W
2017-01-01
Strainmeters measure elastodynamic deformation associated with earthquakes over a broad frequency band, with detection characteristics that complement traditional instrumentation, but they are commonly used to study slow transient deformation along active faults and at subduction zones, for example. Here, we analyze dynamic strains at Plate Boundary Observatory (PBO) borehole strainmeters (BSM) associated with 146 local and regional earthquakes from 2004–2014, with magnitudes from M 4.5 to 7.2. We find that peak values in seismic strain can be predicted from a general regression against distance and magnitude, with improvements in accuracy gained by accounting for biases associated with site–station effects and source–path effects, the latter exhibiting the strongest influence on the regression coefficients. To account for the influence of these biases in a general way, we include crustal‐type classifications from the CRUST1.0 global velocity model, which demonstrates that high‐frequency strain data from the PBO BSM network carry information on crustal structure and fault mechanics: earthquakes nucleating offshore on the Blanco fracture zone, for example, generate consistently lower dynamic strains than earthquakes around the Sierra Nevada microplate and in the Salton trough. Finally, we test our dynamic strain prediction equations on the 2011 M 9 Tohoku‐Oki earthquake, specifically continuous strain records derived from triangulation of 137 high‐rate Global Navigation Satellite System Earth Observation Network stations in Japan. Moment magnitudes inferred from these data and the strain model are in agreement when Global Positioning System subnetworks are unaffected by spatial aliasing.
DEFF Research Database (Denmark)
Jensen, Anne; Thomsen, L.E.; Jørgensen, R.L.
2008-01-01
cell line, Caco-2; time to death in a nematode model, Caenorhabditis elegans and in a fruit fly model, Drosophila melanogaster and fecal shedding in a guinea pig model. All strains adhered to and grew in Caco-2 cells in similar levels. When exposed to 10(6) CFU/ml, two strains representing......% killed C elegans worms was longer (110 h) for the RAPD type 9 strains than for the other four strains (80 h). The Scott A strain and one RAPD type 9 strain were suspended in whipping cream before being fed to guinea pigs and the persistent RAPD type 9 strain was isolated from feces in a lower level...... to contaminate food products, and it is important to determine their virulence potential to evaluate risk to consumers. We compared the behaviour of food processing persistent and clinical L. monocytogenes strains in four virulence models: Adhesion, invasion and intracellular growth was studied in an epithelial...
Spontaneous abortion and physical strain around implantation
DEFF Research Database (Denmark)
Hjollund, N H; Jensen, Tina Kold; Bonde, Jens Peter
2000-01-01
pregnancy the women recorded physical strain prospectively in a structured diary. Physical strain around the time of implantation was associated with later spontaneous abortion. The adjusted risk ratio for women who reported physical strain higher than average at day 6 to 9 after the estimated date...
Strain-rate dependent plasticity in thermo-mechanical transient analysis
International Nuclear Information System (INIS)
Rashid, Y.R.; Sharabi, M.N.
1980-01-01
The thermo-mechanical transient behavior of fuel element cladding and other reactor components is generally governed by the strain-rate properties of the material. Relevant constitutive modeling requires extensive material data in the form of strain-rate response as function of true-stress, temperature, time and environmental conditions, which can then be fitted within a theoretical framework of an inelastic constitutive model. In this paper, we present a constitutive formulation that deals continuously with the entire strain-rate range and has the desirable advantage of utilizing existing material data. The derivation makes use of strain-rate sensitive stress-strain curve and strain-rate dependent yield surface. By postulating a strain-rate dependent on Mises yield function and a strain-rate dependent kinematic hardening rule, we are able to derive incremental stress-strain relations that describe the strain-rate behavior in the entire deformation range spanning high strain-rate plasticity and creep. The model is sufficiently general as to apply to any materials and loading histories for which data is available. (orig.)
Thermoresistance in radioresistant strains of 'Drosophila nebulosa'
International Nuclear Information System (INIS)
Kratz, F.L.
1977-01-01
The detection of thermoresistance in radioresistant strains of 'D. nebulosa' is described, as well as some conclusions on the genetic nature of these differences are presented. The strains used in this experiment were MF 204, from 'Morro de Ferro', in Pocos de Caldas (MG) (one of the biggest radioactive anomalies in the world) whose radioresistance is due to its additive genetic components (Kratz, 1973 and 1975); 85(87) R, an induced radioresistant strain; and MF K a control 'pooled' strain obtained near 'Morro do Ferro'. Survival tests, 72 hours after temperature shocks, performed in the interval of 36 0 C to 39 0 C showed a decreasing gradient of thermoresistance with the following regression coefficients: MF 204 b= - 5,4; 85(87)R b= - 7,2 and MF K b= - 7,9. Bifactorial analysis (strains and sexes) performed at 38 0 C and 39 0 C confirmed differences among strains (P [pt
Bao, Wan-Ning; Haas, Ain; Chen, Xiaojin; Pi, Yijun
2014-01-01
In Agnew's general strain theory, repeated strains can generate crime and delinquency by reducing social control and fostering social learning of crime. Using a sample of 615 middle-and high-school students in China, this study examines how social control and social learning variables mediate the effect of repeated strains in school and at home on…
Park, Jae-Hyeong; Choi, Jin-Oh; Park, Seung Woo; Cho, Goo-Yeong; Oh, Jin Kyung; Lee, Jae-Hwan; Seong, In-Whan
2018-02-01
Right ventricular (RV) strain values by 2-dimensional strain echocardiography (STE) can be used as objective markers of RV systolic function. However, there is little data about normal reference RV strain values according to age and gender. We measured normal RV strain values by STE. RV strain values were analyzed from the digitally stored echocardiographic images from NORMAL (Normal echOcardiogRaphic diMensions and functions in KoreAn popuLation) study for the measurement of normal echocardiographic values performed in 23 Korean university hospitals. We enrolled total 1003 healthy persons in the NORMAL study. Of them, we analyzed 2-dimensional RV strain values in 493 subjects (261 females, mean 47 ± 15 years old) only with echocardiographic images by GE machines. Their LV systolic and diastolic functions were normal. RV fractional area change was 48 ± 6% and tricuspid annular plane systolic excursion was 23 ± 3 mm. Total RV global longitudinal peak systolic strain (RVGLS total ) was -21.5 ± 3.2%. Females had higher absolute RVGLS total (-22.3 ± 3.3 vs -20.7 ± 2.9%, p value to that of older males (age ≥50 years, -20.5 ± 2.8 vs -20.9 ± 3.1%, p = 0.224). We calculated normal RVGLS values in normal population. Females have higher absolute strain values than males, especially in younger age groups (<50 years old).
Zhu, Ling; Shahid, Muhammad A; Markham, John; Browning, Glenn F; Noormohammadi, Amir H; Marenda, Marc S
2018-02-02
The bacterial pathogen Mycoplasma synoviae can cause subclinical respiratory disease, synovitis, airsacculitis and reproductive tract disease in poultry and is a major cause of economic loss worldwide. The M. synoviae strain MS-H was developed by chemical mutagenesis of an Australian isolate and has been used as a live attenuated vaccine in many countries over the past two decades. As a result it may now be the most prevalent strain of M. synoviae globally. Differentiation of the MS-H vaccine from local field strains is important for epidemiological investigations and is often required for registration of the vaccine. The complete genomic sequence of the MS-H strain was determined using a combination of Illumina and Nanopore methods and compared to WVU-1853, the M. synoviae type strain isolated in the USA 30 years before the parent strain of MS-H, and MS53, a more recent isolate from Brazil. The vaccine strain genome had a slightly larger number of pseudogenes than the two other strains and contained a unique 55 kb chromosomal inversion partially affecting a putative genomic island. Variations in gene content were also noted, including a deoxyribose-phosphate aldolase (deoC) fragment and an ATP-dependent DNA helicase gene found only in MS-H. Some of these sequences may have been acquired horizontally from other avian mycoplasma species. MS-H was somewhat more similar to WVU-1853 than to MS53. The genome sequence of MS-H will enable identification of vaccine-specific genetic markers for use as diagnostic and epidemiological tools to better control M. synoviae.
Curvature reduces bending strains in the quokka femur
Directory of Open Access Journals (Sweden)
Kyle McCabe
2017-03-01
Full Text Available This study explores how curvature in the quokka femur may help to reduce bending strain during locomotion. The quokka is a small wallaby, but the curvature of the femur and the muscles active during stance phase are similar to most quadrupedal mammals. Our hypothesis is that the action of hip extensor and ankle plantarflexor muscles during stance phase place cranial bending strains that act to reduce the caudal curvature of the femur. Knee extensors and biarticular muscles that span the femur longitudinally create caudal bending strains in the caudally curved (concave caudal side bone. These opposing strains can balance each other and result in less strain on the bone. We test this idea by comparing the performance of a normally curved finite element model of the quokka femur to a digitally straightened version of the same bone. The normally curved model is indeed less strained than the straightened version. To further examine the relationship between curvature and the strains in the femoral models, we also tested an extra-curved and a reverse-curved version with the same loads. There appears to be a linear relationship between the curvature and the strains experienced by the models. These results demonstrate that longitudinal curvature in bones may be a manipulable mechanism whereby bone can induce a strain gradient to oppose strains induced by habitual loading.
Occupational stress and strain in the Royal Navy 2007.
Bridger, R S; Brasher, K; Dew, A; Kilminster, S
2008-12-01
Previous surveys of psychological strain in the Naval Service (NS) have shown higher than expected levels of strain when compared to the general population. To repeat the survey last carried out in 2004 and to obtain further information on the nature of the occupational stressors associated with strain. General Health Questionnaire-12 strain rates and job/life stressors were measured using a Work and Well-Being Questionnaire. Models of strain were developed for male and female personnel in the Royal Navy (RN) and males in the Royal Marines (RM). The response rate was 57%. The psychological strain rate was 31.5% overall. Personnel suffering from strain tended to be 'overcommitted' to work, had low levels of commitment to the NS and had suffered stressful life events (SLEs) in the previous 12 months. Strain rates declined with age and rank in males, but not in females. Strain was significantly positively correlated with levels of overcommitment, effort-reward imbalance (ERI), role conflict, work-family conflict, organizational commitment and exposure to SLEs. Models of strain in the males and females in the RN and in the RM accounted for between 37 and 44% of the variance in strain. The survey provides evidence for both the demand control and ERI models-components of these models contribute independently to strain. High levels of commitment to the organization were associated with lower strain and exposure to SLEs to higher strain.
Comparative developmental trajectory of four strains of chicken ...
African Journals Online (AJOL)
This study evaluated egg traits, embryonic growth, and early growth rate in four strains of chicken. A total of 1200 hatching eggs, 300 each from four strains of chicken were used for this study. The strains included Nigerian indigenous chicken (NIC), Arbor acre, Hubbard, and Marshall broiler strains. Embryonic weights, yolk ...
Cardiac biplane strain imaging: initial in vivo experience
Lopata, R. G. P.; Nillesen, M. M.; Verrijp, C. N.; Singh, S. K.; Lammens, M. M. Y.; van der Laak, J. A. W. M.; van Wetten, H. B.; Thijssen, J. M.; Kapusta, L.; de Korte, C. L.
2010-02-01
In this study, first we propose a biplane strain imaging method using a commercial ultrasound system, yielding estimation of the strain in three orthogonal directions. Secondly, an animal model of a child's heart was introduced that is suitable to simulate congenital heart disease and was used to test the method in vivo. The proposed approach can serve as a framework to monitor the development of cardiac hypertrophy and fibrosis. A 2D strain estimation technique using radio frequency (RF) ultrasound data was applied. Biplane image acquisition was performed at a relatively low frame rate (dogs with an aortic stenosis. Initial results reveal the feasibility of measuring large radial, circumferential and longitudinal cumulative strain (up to 70%) at a frame rate of 100 Hz. Mean radial strain curves of a manually segmented region-of-interest in the infero-lateral wall show excellent correlation between the measured strain curves acquired in two perpendicular planes. Furthermore, the results show the feasibility and reproducibility of assessing radial, circumferential and longitudinal strains simultaneously. In this preliminary study, three beagles developed an elevated pressure gradient over the aortic valve (Δp: 100-200 mmHg) and myocardial hypertrophy. One dog did not develop any sign of hypertrophy (Δp = 20 mmHg). Initial strain (rate) results showed that the maximum strain (rate) decreased with increasing valvular stenosis (-50%), which is in accordance with previous studies. Histological findings corroborated these results and showed an increase in fibrotic tissue for the hearts with larger pressure gradients (100, 200 mmHg), as well as lower strain and strain rate values.
Fuel-pin cladding transient failure strain criterion
International Nuclear Information System (INIS)
Bard, F.E.; Duncan, D.R.; Hunter, C.W.
1983-01-01
A criterion for cladding failure based on accumulated strain was developed for mixed uranium-plutonium oxide fuel pins and used to interpret the calculated strain results from failed transient fuel pin experiments conducted in the Transient Reactor Test (TREAT) facility. The new STRAIN criterion replaced a stress-based criterion that depends on the DORN parameter and that incorrectly predicted fuel pin failure for transient tested fuel pins. This paper describes the STRAIN criterion and compares its prediction with those of the stress-based criterion
Pseudomagnetic fields and triaxial strain in graphene
DEFF Research Database (Denmark)
Settnes, Mikkel; Power, Stephen; Jauho, Antti-Pekka
2016-01-01
Pseudomagnetic fields, which can result from nonuniform strain distributions, have received much attention in graphene systems due to the possibility of mimicking real magnetic fields with magnitudes of greater than 100 T. We examine systems with such strains confined to finite regions ("pseudoma......Pseudomagnetic fields, which can result from nonuniform strain distributions, have received much attention in graphene systems due to the possibility of mimicking real magnetic fields with magnitudes of greater than 100 T. We examine systems with such strains confined to finite regions......-binding calculations of single pseudomagnetic dots in extended graphene sheets confirm these predictions, and are also used to study the effect of rotating the strain direction with respect to the underlying graphene lattice, and varying the size of the pseudomagnetic dot....
Toyo-Oka, L; Mahasirimongkol, S; Yanai, H; Mushiroda, T; Wattanapokayakit, S; Wichukchinda, N; Yamada, N; Smittipat, N; Juthayothin, T; Palittapongarnpim, P; Nedsuwan, S; Kantipong, P; Takahashi, A; Kubo, M; Sawanpanyalert, P; Tokunaga, K
2017-09-01
Tuberculosis (TB) occurs as a result of complex interactions between the host immune system and pathogen virulence factors. Human leukocyte antigen (HLA) class II molecules play an important role in the host immune system. However, no study has assessed the association between HLA class II genes and susceptibility to TB caused by specific strains. This study investigated the possible association of HLA class II genes with TB caused by modern and ancient Mycobacterium tuberculosis (MTB). The study included 682 patients with TB and 836 control subjects who were typed for HLA-DRB1 and HLA-DQB1 alleles. MTB strains were classified using a large sequence polymorphism typing method. Association analysis was performed using common HLA alleles and haplotypes in different MTB strains. HLA association analysis of patients infected with modern MTB strains showed significant association for HLA-DRB1*09:01 (odds ratio [OR] = 1.82; P-value = 9.88 × 10 -4 ) and HLA-DQB1*03:03 alleles (OR = 1.76; P-value = 1.31 × 10 -3 ) with susceptibility to TB. Haplotype analysis confirmed that these alleles were in strong linkage disequilibrium and did not exert an interactive effect. Thus, the results of this study showed an association between HLA class II genes and susceptibility to TB caused by modern MTB strains, suggesting the importance of strain-specific analysis to determine susceptibility genes associated with TB. © 2017 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
[Screening and optimization of cholesterol conversion strain].
Fan, Dan; Xiong, Bingjian; Pang, Cuiping; Zhu, Xiangdong
2014-10-04
Bacterial strain SE-1 capable of transforming cholesterol was isolated from soil and characterized. The transformation products were identified. Fermentation conditions were optimized for conversion. Cholesterol was used as sole carbon source to isolate strain SE-1. Morphology, physiological and biochemical characteristics of strain SE-1 were studied. 16S rRNA gene was sequenced and subjected to phylogenetic analysis. Fermentation supernatants were extracted with chloroform, the transformation products were analyzed by silica gel thin layer chromatography and Sephadex LH20. Their structures were identified by 1H-NMR and 13C-NMR. Fermentation medium including carbon and nitrogen, methods of adding substrates and fermentation conditions for Strain SE-1 were optimized. Strain SE-1 was a Gram-negative bacterium, exhibiting the highest homologs to Burkholderia cepacia based on the physiological analysis. The sequence analysis of 16S rRNA gene of SE-1 strain and comparison with related Burkholderia show that SE-1 strain was very close to B. cepacia (Genbank No. U96927). The similarity was 99%. The result of silica gel thin layer chromatography shows that strain SE-1 transformed cholesterol to two products, 7beta-hydroxycholesterol and the minor product was 7-oxocholesterol. The optimum culture conditions were: molasses 5%, (NH4 )2SO4 0.3%, 4% of inoculation, pH 7.5 and 36 degrees C. Under the optimum culture condition, the conversion rate reached 34.4% when concentration of cholesterol-Tween 80 was 1 g/L. Cholesterol 7beta-hydroxylation conversion rate under optimal conditions was improved by 20.8%. Strain SE-1 isolated from soil is capable of converting cholesterol at lab-scale.
Genome sequence of herpes simplex virus 1 strain KOS.
Macdonald, Stuart J; Mostafa, Heba H; Morrison, Lynda A; Davido, David J
2012-06-01
Herpes simplex virus type 1 (HSV-1) strain KOS has been extensively used in many studies to examine HSV-1 replication, gene expression, and pathogenesis. Notably, strain KOS is known to be less pathogenic than the first sequenced genome of HSV-1, strain 17. To understand the genotypic differences between KOS and other phenotypically distinct strains of HSV-1, we sequenced the viral genome of strain KOS. When comparing strain KOS to strain 17, there are at least 1,024 small nucleotide polymorphisms (SNPs) and 172 insertions/deletions (indels). The polymorphisms observed in the KOS genome will likely provide insights into the genes, their protein products, and the cis elements that regulate the biology of this HSV-1 strain.
Health-promoting properties exhibited by Lactobacillus helveticus strains.
Skrzypczak, Katarzyna; Gustaw, Waldemar; Waśko, Adam
2015-01-01
Many strains belonging to lactobacilli exert a variety of beneficial health effects in humans and some of the bacteria are regarded as probiotic microorganisms. Adherence and capabilities of colonization by Lactobacillus strains of the intestinal tract is a prerequisite for probiotic strains to exhibit desired functional properties. The analysis conducted here aimed at screening strains of Lactobacillus helveticus possessing a health-promoting potential. The molecular analysis performed, revealed the presence of a slpA gene encoding the surface S-layer protein SlpA (contributing to the immunostimulatory activity of L. helveticus M 92 probiotic strain) in all B734, DSM, T80, and T105 strains. The product of gene amplification was also identified in a Bifidobacterium animalis ssp. lactis BB12 probiotic strain. SDS-PAGE of a surface protein extract demonstrated the presence of a protein with a mass of about 50 kDa in all strains, which refers to the mass of the S-layer proteins. These results are confirmed by observations carried with transmission electron microscopy, where a clearly visible S-layer was registered in all the strains analyzed. The in vitro study results obtained indicate that the strongest adhesion capacity to epithelial cells (HT-29) was demonstrated by L. helveticus B734, while coaggregation with pathogens was highly diverse among the tested strains. The percentage degree of coaggregation was increasing with the incubation time. After 5 h of incubation, the strongest ability to coaggregate with Escherichia coli was expressed by T104. The T80 strain demonstrated a significant ability to co-aggregate with Staphylococcus aureus, while DSM with Bacillus subtilis. For B734, the highest values of co-aggregation coefficient was noted in samples with Salmonella. The capability of autoaggregation, antibiotic susceptibility, resistance to increasing salt concentrations, and strain survival in simulated small intestinal juice were also analyzed.
Anderson, G W; Rosebrock, J A; Johnson, A J; Jennings, G B; Peters, C J
1991-05-01
A congenic rat strain (WF.LEW) was derived from the susceptible Wistar-Furth (WF) (background strain) and the resistant LEW (donor strain) inbred strains and was used to evaluate the phenotypic expression of a dominant Mendelian gene that confers resistance to fatal hepatic disease caused by the ZH501 strain of Rift Valley fever virus (RVFV). Resistance to hepatic disease developed gradually with age, with full expression at approximately 10 weeks in the WF.LEW and LEW rat strains. The ZH501 strain caused fatal hepatitis in WF rats regardless of age. However, resistance to the SA75 RVFV strain (relatively non-pathogenic for adult rats), was age- and dose-dependent in both WF and LEW rats. The resistance gene transferred to the newly derived WF.LEW congenic rat strain appears to amplify age-dependent resistance of adult rats, resulting in protection against fatal hepatic disease caused by the virulent ZH501 strain. The congenic rat strain will be a valuable asset in elucidating the mechanism of resistance to Rift Valley fever virus governed by the dominant Mendelian gene.
Nutritionally fastidious Ruminococct $ flovefociens : strains
African Journals Online (AJOL)
than those obtained in a medium containing rumen fluid. Growth of all strains was remarkably uniform. Where the same inoculum was used, differences in the qualitative com- position of the medium usually had little effect on growth. In contrast, the R. f/avefaciens strains were much more variable in their growth responses.
Clinical strains of acinetobacter classified by DNA-DNA hybridization
International Nuclear Information System (INIS)
Tjernberg, I.; Ursing, J.
1989-01-01
A collection of Acinetobacter strains consisting of 168 consecutive clinical strains and 30 type and reference strains was studied by DNA-DNA hybridization and a few phenotypic tests. The field strains could be allotted to 13 DNA groups. By means of reference strains ten of these could be identified with groups described by Bouvet and Grimont (1986), while three groups were new; they were given the numbers 13-15. The type strain of A. radioresistens- recently described by Nishimura et al. (1988) - was shown to be a member of DNA group 12, which comprised 31 clinical isolates. Of the 19 strains of A. junii, eight showed hemolytic acitivity on sheep and human blood agar and an additional four strains on human blood agar only. Strains of this species have previously been regarded as non-hemolytic. Reciprocal DNA pairing data for the reference strains of the DNA gropus were treated by UPGMA clustering. The reference strains for A. calcoaceticus, A. baumannii and DNA groups 3 and 13 formed a cluster with about 70% relatedness within the cluster. Other DNA groups joined at levels below 60%. (author)
Clinical strains of acinetobacter classified by DNA-DNA hybridization
Energy Technology Data Exchange (ETDEWEB)
Tjernberg, I; Ursing, J [Department of Medical Microbiology, University of Lund, Malmoe General Hospital, Malmoe (Sweden)
1989-01-01
A collection of Acinetobacter strains consisting of 168 consecutive clinical strains and 30 type and reference strains was studied by DNA-DNA hybridization and a few phenotypic tests. The field strains could be allotted to 13 DNA groups. By means of reference strains ten of these could be identified with groups described by Bouvet and Grimont (1986), while three groups were new; they were given the numbers 13-15. The type strain of A. radioresistens- recently described by Nishimura et al. (1988) - was shown to be a member of DNA group 12, which comprised 31 clinical isolates. Of the 19 strains of A. junii, eight showed hemolytic acitivity on sheep and human blood agar and an additional four strains on human blood agar only. Strains of this species have previously been regarded as non-hemolytic. Reciprocal DNA pairing data for the reference strains of the DNA gropus were treated by UPGMA clustering. The reference strains for A. calcoaceticus, A. baumannii and DNA groups 3 and 13 formed a cluster with about 70% relatedness within the cluster. Other DNA groups joined at levels below 60%. (author).
The Cyclic Stress-Strain Curve of Polycrystals
DEFF Research Database (Denmark)
Pedersen, Ole Bøcker; Rasmussen, K. V.; Winter, A. T.
1982-01-01
The internal stresses implied by the Sachs model are estimated for individual PSBs at low plastic strain amplitudes and for homogeneously sheared grains at higher plastic strain amplitudes. The analysis shows that the Sachs model can account semi-quantitatively for experimentally measured cyclic...... stress-strain curves for copper. A similar approximative analysis of the Taylor model cannot account for the data. An interesting feature of the Sachs model is that, although it is assumed that the flow condition is entirely controlled by the PSBs. the predicted cyclic stress-strain curve displays...
Instrument for measuring fuel cladding strain
International Nuclear Information System (INIS)
Billeter, T.R.
1976-01-01
Development work to provide instrumentation for the continuous measurement of strain of material specimens such as nuclear fuel cladding has shown that a microwave sensor and associated instrumentation hold promise. The cylindrical sensor body enclosing the specimen results in a coaxial resonator absorbing microwave energy at frequencies dependent upon the diameter of the specimen. Diametral changes of a microinch can be resolved with use of the instrumentation. Very reasonable values of elastic strain were measured at 75 0 F and 1000 0 F for an internally pressurized 20 percent C.W. 316 stainless steel specimen simulating nuclear fuel cladding. The instrument also indicated the creep strain of the same specimen pressurized at 6500 psi and at a temperature of 1000 0 F for a period of 700 hours. Although the indicated strain appears greater than actual, the sensor/specimen unit experienced considerable oxidation even though an inert gas purge persisted throughout the test duration. By monitoring at least two modes of resonance, the measured strain was shown to be nearly independent of sensor temperature. To prevent oxidation, a second test was performed in which the specimen/sensor units were contained in an evacuated enclosure. The strain of the two prepressurized specimens as indicated by the microwave instrumentation agreed very closely with pre- and post-test measurements obtained with use of a laser interferometer
Strain relaxation of germanium-tin (GeSn) fins
Kang, Yuye; Huang, Yi-Chiau; Lee, Kwang Hong; Bao, Shuyu; Wang, Wei; Lei, Dian; Masudy-Panah, Saeid; Dong, Yuan; Wu, Ying; Xu, Shengqiang; Tan, Chuan Seng; Gong, Xiao; Yeo, Yee-Chia
2018-02-01
Strain relaxation of biaxially strained Ge1-xSnx layer when it is patterned into Ge1-xSnx fin structures is studied. Ge1-xSnx-on-insulator (GeSnOI) substrate was realized using a direct wafer bonding (DWB) technique and Ge1-xSnx fin structures were formed by electron beam lithography (EBL) patterning and dry etching. The strain in the Ge1-xSnx fins having fin widths (WFin) ranging from 1 μm down to 80 nm was characterized using micro-Raman spectroscopy. Raman measurements show that the strain relaxation increases with decreasing WFin. Finite element (FE) simulation shows that the strain component in the transverse direction relaxes with decreasing WFin, while the strain component along the fin direction remains unchanged. For various Ge1-xSnx fin widths, transverse strain relaxation was further extracted using micro-Raman spectroscopy, which is consistent with the simulation results.
A Review: Carbon Nanotube-Based Piezoresistive Strain Sensors
Directory of Open Access Journals (Sweden)
Waris Obitayo
2012-01-01
Full Text Available The use of carbon nanotubes for piezoresistive strain sensors has acquired significant attention due to its unique electromechanical properties. In this comprehensive review paper, we discussed some important aspects of carbon nanotubes for strain sensing at both the nanoscale and macroscale. Carbon nanotubes undergo changes in their band structures when subjected to mechanical deformations. This phenomenon makes them applicable for strain sensing applications. This paper signifies the type of carbon nanotubes best suitable for piezoresistive strain sensors. The electrical resistivities of carbon nanotube thin film increase linearly with strain, making it an ideal material for a piezoresistive strain sensor. Carbon nanotube composite films, which are usually fabricated by mixing small amounts of single-walled or multiwalled carbon nanotubes with selected polymers, have shown promising characteristics of piezoresistive strain sensors. Studies also show that carbon nanotubes display a stable and predictable voltage response as a function of temperature.
Management of digital eye strain.
Coles-Brennan, Chantal; Sulley, Anna; Young, Graeme
2018-05-23
Digital eye strain, an emerging public health issue, is a condition characterised by visual disturbance and/or ocular discomfort related to the use of digital devices and resulting from a range of stresses on the ocular environment. This review aims to provide an overview of the extensive literature on digital eye strain research with particular reference to the clinical management of symptoms. As many as 90 per cent of digital device users experience symptoms of digital eye strain. Many studies suggest that the following factors are associated with digital eye strain: uncorrected refractive error (including presbyopia), accommodative and vergence anomalies, altered blinking pattern (reduced rate and incomplete blinking), excessive exposure to intense light, closer working distance, and smaller font size. Since a symptom may be caused by one or more factors, a holistic approach should be adopted. The following management strategies have been suggested: (i) appropriate correction of refractive error, including astigmatism and presbyopia; (ii) management of vergence anomalies, with the aim of inducing or leaving a small amount of heterophoria (~1.5 Δ Exo); (iii) blinking exercise/training to maintain normal blinking pattern; (iv) use of lubricating eye drops (artificial tears) to help alleviate dry eye-related symptoms; (v) contact lenses with enhanced comfort, particularly at end-of-day and in challenging environments; (vi) prescription of colour filters in all vision correction options, especially blue light-absorbing filters; and (vii) management of accommodative anomalies. Prevention is the main strategy for management of digital eye strain, which involves: (i) ensuring an ergonomic work environment and practice (through patient education and the implementation of ergonomic workplace policies); and (ii) visual examination and eye care to treat visual disorders. Special consideration is needed for people at a high risk of digital eye strain, such as computer
Directory of Open Access Journals (Sweden)
Joy Scaria
Full Text Available C. difficile is the most common cause of nosocomial diarrhea in North America and Europe. Genomes of individual strains of C. difficile are highly divergent. To determine how divergent strains respond to environmental changes, the transcriptomes of two historic and two recently isolated hypervirulent strains were analyzed following nutrient shift and osmotic shock. Illumina based RNA-seq was used to sequence these transcriptomes. Our results reveal that although C. difficile strains contain a large number of shared and strain specific genes, the majority of the differentially expressed genes were core genes. We also detected a number of transcriptionally active regions that were not part of the primary genome annotation. Some of these are likely to be small regulatory RNAs.
Chen, Wen-Ming; de Faria, Sergio M.; Straliotto, Rosângela; Pitard, Rosa M.; Simões-Araùjo, Jean L.; Chou, Jui-Hsing; Chou, Yi-Ju; Barrios, Edmundo; Prescott, Alan R.; Elliott, Geoffrey N.; Sprent, Janet I.; Young, J. Peter W.; James, Euan K.
2005-01-01
Twenty Mimosa-nodulating bacterial strains from Brazil and Venezuela, together with eight reference Mimosa-nodulating rhizobial strains and two other β-rhizobial strains, were examined by amplified rRNA gene restriction analysis. They fell into 16 patterns and formed a single cluster together with the known β-rhizobia, Burkholderia caribensis, Burkholderia phymatum, and Burkholderia tuberum. The 16S rRNA gene sequences of 15 of the 20 strains were determined, and all were shown to belong to the genus Burkholderia; four distinct clusters could be discerned, with strains isolated from the same host species usually clustering very closely. Five of the strains (MAP3-5, Br3407, Br3454, Br3461, and Br3469) were selected for further studies of the symbiosis-related genes nodA, the NodD-dependent regulatory consensus sequences (nod box), and nifH. The nodA and nifH sequences were very close to each other and to those of B. phymatum STM815, B. caribensis TJ182, and Cupriavidus taiwanensis LMG19424 but were relatively distant from those of B. tuberum STM678. In addition to nodulating their original hosts, all five strains could also nodulate other Mimosa spp., and all produced nodules on Mimosa pudica that had nitrogenase (acetylene reduction) activities and structures typical of effective N2-fixing symbioses. Finally, both wild-type and green fluorescent protein-expressing transconjugant strains of Br3461 and MAP3-5 produced N2-fixing nodules on their original hosts, Mimosa bimucronata (Br3461) and Mimosa pigra (MAP3-5), and hence this confirms strongly that Burkholderia strains can form effective symbioses with legumes. PMID:16269788
Strain-engineered growth of two-dimensional materials.
Ahn, Geun Ho; Amani, Matin; Rasool, Haider; Lien, Der-Hsien; Mastandrea, James P; Ager Iii, Joel W; Dubey, Madan; Chrzan, Daryl C; Minor, Andrew M; Javey, Ali
2017-09-20
The application of strain to semiconductors allows for controlled modification of their band structure. This principle is employed for the manufacturing of devices ranging from high-performance transistors to solid-state lasers. Traditionally, strain is typically achieved via growth on lattice-mismatched substrates. For two-dimensional (2D) semiconductors, this is not feasible as they typically do not interact epitaxially with the substrate. Here, we demonstrate controlled strain engineering of 2D semiconductors during synthesis by utilizing the thermal coefficient of expansion mismatch between the substrate and semiconductor. Using WSe 2 as a model system, we demonstrate stable built-in strains ranging from 1% tensile to 0.2% compressive on substrates with different thermal coefficient of expansion. Consequently, we observe a dramatic modulation of the band structure, manifested by a strain-driven indirect-to-direct bandgap transition and brightening of the dark exciton in bilayer and monolayer WSe 2 , respectively. The growth method developed here should enable flexibility in design of more sophisticated devices based on 2D materials.Strain engineering is an essential tool for modifying local electronic properties in silicon-based electronics. Here, Ahn et al. demonstrate control of biaxial strain in two-dimensional materials based on the growth substrate, enabling more complex low-dimensional electronics.
Strain engineering of van der Waals heterostructures
Vermeulen, Paul A.; Mulder, Jefta; Momand, Jamo; Kooi, Bart J.
2018-01-01
Modifying the strain state of solids allows control over a plethora of functional properties. The weak interlayer bonding in van der Waals (vdWaals) materials such as graphene, hBN, MoS2, and Bi2Te3 might seem to exclude strain engineering, since strain would immediately relax at the vdWaals
Strain effects in oxide superconductors
International Nuclear Information System (INIS)
Wada, H.; Kuroda, T.; Sekine, H.; Yuyama, M.; Itoh, K.
1991-01-01
Strain sensitivities of superconducting properties are critical to high magnetic field applications of superconductors, since critical temperature, T c , upper critical field, H c2 , and critical current (density), I c (J c ), are all degraded under strains. Oxide superconductors so far known are all very fragile, thus requiring to be fabricated in the form of composite. In the case of practical metallic superconductors, such as Nb 3 Sn and V 3 Ga, the so-called bronze method has been developed where these superconducting intermetallics are enveloped in a ductile metallic sheath. Recently, a fabrication method similar to the bronze method has been developed for the Bi 2 Sr 2 Ca 2 Cu 3 O x superconductors using Ag tubes as sheath. In the present study mono- and multicore BiPbSrCaCuO tape conductors were prepared by means of this Ag-sheath composite method, and examined in terms of strain sensitivity by measuring their T c and I c (J c ) under bending or tensile strains. (orig.)
Intramyocardial strain estimation from cardiac cine MRI.
Elnakib, Ahmed; Beache, Garth M; Gimel'farb, Georgy; El-Baz, Ayman
2015-08-01
Functional strain is one of the important clinical indicators for the quantification of heart performance and the early detection of cardiovascular diseases, and functional strain parameters are used to aid therapeutic decisions and follow-up evaluations after cardiac surgery. A comprehensive framework for deriving functional strain parameters at the endocardium, epicardium, and mid-wall of the left ventricle (LV) from conventional cine MRI data was developed and tested. Cine data were collected using short TR-/TE-balanced steady-state free precession acquisitions on a 1.5T Siemens Espree scanner. The LV wall borders are segmented using a level set-based deformable model guided by a stochastic force derived from a second-order Markov-Gibbs random field model that accounts for the object shape and appearance features. Then, the mid-wall of the segmented LV is determined based on estimating the centerline between the endocardium and epicardium of the LV. Finally, a geometrical Laplace-based method is proposed to track corresponding points on successive myocardial contours throughout the cardiac cycle in order to characterize the strain evolutions. The method was tested using simulated phantom images with predefined point locations of the LV wall throughout the cardiac cycle. The method was tested on 30 in vivo datasets to evaluate the feasibility of the proposed framework to index functional strain parameters. The cine MRI-based model agreed with the ground truth for functional metrics to within 0.30 % for indexing the peak systolic strain change and 0.29 % (per unit time) for indexing systolic and diastolic strain rates. The method was feasible for in vivo extraction of functional strain parameters. Strain indexes of the endocardium, mid-wall, and epicardium can be derived from routine cine images using automated techniques, thereby improving the utility of cine MRI data for characterization of myocardial function. Unlike traditional texture-based tracking, the
Tennant, Sharon M; Wang, Jin-Yuan; Galen, James E; Simon, Raphael; Pasetti, Marcela F; Gat, Orit; Levine, Myron M
2011-10-01
While nontyphoidal Salmonella (NTS) has long been recognized as a cause of self-limited gastroenteritis, it is becoming increasingly evident that multiple-antibiotic-resistant strains are also emerging as important causes of invasive bacteremia and focal infections, resulting in hospitalizations and deaths. We have constructed attenuated Salmonella enterica serovar Typhimurium and Salmonella enterica serovar Enteritidis strains that can serve as live oral vaccines and as "reagent strains" for subunit vaccine production in a safe and economical manner. Prototype attenuated vaccine strains CVD 1921 and CVD 1941, derived from the invasive wild-type strains S. Typhimurium I77 and S. Enteritidis R11, respectively, were constructed by deleting guaBA, encoding guanine biosynthesis, and clpP, encoding a master protease regulator. The clpP mutation resulted in a hyperflagellation phenotype. An additional deletion in fliD yielded reagent strains CVD 1923 and CVD 1943, respectively, which export flagellin monomers. Oral 50% lethal dose (LD₅₀) analyses showed that the NTS vaccine strains were all highly attenuated in mice. Oral immunization with CVD 1921 or CVD 1923 protected mice against lethal challenge with wild-type S. Typhimurium I77. Immunization with CVD 1941 but not CVD 1943 protected mice against lethal infection with S. Enteritidis R11. Immune responses induced by these strains included high levels of serum IgG anti-lipopolysaccharide (LPS) and anti-flagellum antibodies, with titers increasing progressively during the immunization schedule. Since S. Typhimurium and S. Enteritidis are the most common NTS serovars associated with invasive disease, these findings can pave the way for development of a highly effective, broad-spectrum vaccine against invasive NTS.
Strain fluctuations and elastic constants
Energy Technology Data Exchange (ETDEWEB)
Parrinello, M.; Rahman, A.
1982-03-01
It is shown that the elastic strain fluctuations are a direct measure of elastic compliances in a general anisotropic medium; depending on the ensemble in which the fluctuation is measured either the isothermal or the adiabatic compliances are obtained. These fluctuations can now be calculated in a constant enthalpy and pressure, and hence, constant entropy, ensemble due to recent develpments in the molecular dynamics techniques. A calculation for a Ni single crystal under uniform uniaxial 100 tensile or compressive load is presented as an illustration of the relationships derived between various strain fluctuations and the elastic modulii. The Born stability criteria and the behavior of strain fluctuations are shown to be related.
Huang, Huaqing; Liu, Feng
Gray tin was previously found to be a strong topological insulator under compressive uniaxial strain. Here, based on effective k . p analysis and first-principles calculations, we discover that gray tin becomes a Dirac semimetal in the other missing half of strain spectrum, under tensile uniaxial strain. In this newly found Dirac semimetal state, two Dirac points which are tunable by tensile [001] strains, lie in the kz axis and Fermi arcs appear in the (100) surface. A large negative magnetoresistance is anticipated in this half of strain spectrum, which shows as a strong signature of the chiral anomaly effect. Comparing to other Dirac semimetal materials, the proposed Dirac semimetal state in the nontoxic elemental gray tin can be more easily manipulated and accurately controlled. We envision that gray tin provides a perfect platform for strain engineering of topological phase transitions by sweeping through the strain spectrum from positive to negative and vice versa. This work was support by DOE-BES (Grant No. DE-FG02-04ER46148).
Energy Technology Data Exchange (ETDEWEB)
Inaoka, Takeshi, E-mail: inaoka@phys.u-ryukyu.ac.jp; Yanagisawa, Susumu; Kadekawa, Yukihiro [Department of Physics and Earth Sciences, Faculty of Science, University of the Ryukyus, 1 Senbaru, Nishihara, Okinawa 903-0213 (Japan)
2014-02-14
By means of the first-principles density-functional theory, we investigate the effect of relative atom displacement in the crystal unit cell, namely, internal strain on the valence-band dispersion of strained silicon, and find close correlation of this effect with variation in the specific bond angles due to internal strain. We consider the [111] ([110]) band dispersion for (111) ((110)) biaxial tensility and [111] ([110]) uniaxial compression, because remarkably small values of hole effective mass m* can be obtained in this dispersion. Under the practical condition of no normal stress, biaxial tensility (uniaxial compression) involves additional normal compression (tensility) and internal strain. With an increase in the internal-strain parameter, the energy separation between the highest and second-highest valence bands becomes strikingly larger, and the highest band with conspicuously small m* extends remarkably down to a lower energy region, until it intersects or becomes admixed with the second band. This is closely correlated with the change in the specific bond angles, and this change can reasonably explain the above enlargement of the band separation.
Flexoelectricity: strain gradient effects in ferroelectrics
Energy Technology Data Exchange (ETDEWEB)
Ma Wenhui [Department of Physics, Shantou Unversity, Shantou, Guangdong 515063 (China)
2007-12-15
Mechanical strain gradient induced polarization effect or flexoelectricity in perovskite-type ferroelectric and relaxor ferroelectric ceramics was investigated. The flexoelectric coefficients measured at room temperature ranged from about 1 {mu} C m{sup -1} for lead zirconate titanate to 100 {mu} C m{sup -1} for barium strontium titanate. Flexoelectric effects were discovered to be sensitive to chemical makeup, phase symmetry, and domain structures. Based on phenomenological discussion and experimental data on flexoelectricity, the present study proposed that mechanical strain gradient field could influence polarization responses in a way analogous to electric field. Flexoelectric coefficients were found to be nonlinearly enhanced by dielectric permittivity and strain gradient. Interfacial mismatch in epitaxial thin films can give rise to high strain gradients, enabling flexoelectric effects to make a significant impact in properly engineered ferroelectric heterostructure systems.
Interpretation of large-strain geophysical crosshole tests
International Nuclear Information System (INIS)
Drnevich, V.P.; Salgado, R.; Ashmawy, A.; Grant, W.P.; Vallenas, P.
1995-10-01
At sites in earthquake-prone areas, the nonlinear dynamic stress-strain behavior of soil with depth is essential for earthquake response analyses. A seismic crosshole test has been developed where large dynamic forces are applied in a borehole. These forces generate shear strains in the surrounding soil that are well into the nonlinear range. The shear strain amplitudes decrease with distance from the source. Velocity sensors located in three additional holes at various distances from the source hole measure the particle velocity and the travel time of the shear wave from the source. This paper provides an improved, systematic interpretation scheme for the data from these large-strain geophysical crosshole tests. Use is made of both the measured velocities at each sensor and the travel times. The measured velocity at each sensor location is shown to be a good measure of the soil particle velocity at that location. Travel times to specific features on the velocity time history, such as first crossover, are used to generate travel time curves for the waves which are nonlinear. At some distance the amplitudes reduce to where the stress-strain behavior is essentially linear and independent of strain amplitude. This fact is used together with the measurements at the three sensor locations in a rational approach for fitting curves of shear wave velocity versus distance from the source hole that allow the determination of the shear wave velocity and the shear strain amplitude at each of the sensor locations as well as the shear wave velocity associated with small-strain (linear) behavior. The method is automated using off-the-shelf PC-based software. The method is applied to large-strain crosshole tests performed as part of the studies for the design and construction of the proposed Multi-Function Waste Tank Facility planned for Hanford Site
Strain-Detecting Composite Materials
Wallace, Terryl A. (Inventor); Smith, Stephen W. (Inventor); Piascik, Robert S. (Inventor); Horne, Michael R. (Inventor); Messick, Peter L. (Inventor); Alexa, Joel A. (Inventor); Glaessgen, Edward H. (Inventor); Hailer, Benjamin T. (Inventor)
2016-01-01
A composite material includes a structural material and a shape-memory alloy embedded in the structural material. The shape-memory alloy changes crystallographic phase from austenite to martensite in response to a predefined critical macroscopic average strain of the composite material. In a second embodiment, the composite material includes a plurality of particles of a ferromagnetic shape-memory alloy embedded in the structural material. The ferromagnetic shape-memory alloy changes crystallographic phase from austenite to martensite and changes magnetic phase in response to the predefined critical macroscopic average strain of the composite material. A method of forming a composite material for sensing the predefined critical macroscopic average strain includes providing the shape-memory alloy having an austenite crystallographic phase, changing a size and shape of the shape-memory alloy to thereby form a plurality of particles, and combining the structural material and the particles at a temperature of from about 100-700.degree. C. to form the composite material.
KAJIAN KONSERVASI Pinus merkusii strain Tapanuli DI SUMATERA
Directory of Open Access Journals (Sweden)
Hendi Suhendi
2017-01-01
Full Text Available Di Indonesia, Pinus yang tumbuh secara alami hanyalah Pinus merkusii di Sumatera yang terdiri dari strain Tapanuli, strain Kerinci dan strain Aceh. Berdasarkan persebarannya, strain Tapanuli tidak banyak dijumpai karena tercampur dengan jenis-jenis kayu daun lebar. Secara alami, strain Tapanuli ditemukan di Cagar Alam Dolok Sipirok dan Cagar Alam Dolok Saut. Dalam bentuk hutan tanaman, strain Tapanuli dibuat oleh masyarakat atau rakyat dengan anakan alam dan diambil secara cabutan di Tegakan Benih Dolok Tusam, dan sekarang sudah habis ditebang karena digantikan oleh tanaman kopi. Di wilayah kerja Dinas Kehutanan Propinsi Sumatera Utara hampir tidak pernah didapatkan informasi tentang keberadaan strain Tapanuli. Konservasi in situ dalam bentuk Cagar Alam perlu dilengkapi dengan konservasi ex situ. Sebagai langkah awal konservasi, terlebih dahulu perlu dikaji permudaan alamnya. Di samping itu, analisis kebijakan berkaitan dengan pentingnya eksplorasi dengan metode sensus pada semua kawasan konservasi di Sumatera perlu dipertimbangkan, dan pertemuan formal antar pengambil kebijakan di Departemen Kehutanan perlu direkomendasikan
Mechanical control over valley magnetotransport in strained graphene
Energy Technology Data Exchange (ETDEWEB)
Ma, Ning, E-mail: maning@stu.xjtu.edu.cn [Department of Physics, MOE Key Laboratory of Advanced Transducers and Intelligent Control System, Taiyuan University of Technology, Taiyuan 030024 (China); Department of Applied Physics, MOE Key Laboratory for Nonequilibrium Synthesis and Modulation of Condensed Matter, Xi' an Jiaotong University, Xi' an 710049 (China); Zhang, Shengli, E-mail: zhangsl@mail.xjtu.edu.cn [Department of Applied Physics, MOE Key Laboratory for Nonequilibrium Synthesis and Modulation of Condensed Matter, Xi' an Jiaotong University, Xi' an 710049 (China); Liu, Daqing, E-mail: liudq@cczu.edu.cn [School of Mathematics and Physics, Changzhou University, Changzhou 213164 (China)
2016-05-06
Recent experiments report that the graphene exhibits Landau levels (LLs) that form in the presence of a uniform strain pseudomagnetic field with magnitudes up to hundreds of tesla. We further reveal that the strain removes the valley degeneracy in LLs, and leads to a significant valley polarization with inversion symmetry broken. This accordingly gives rise to the well separated valley Hall plateaus and Shubnikov–de Haas oscillations. These effects are absent in strainless graphene, and can be used to generate and detect valley polarization by mechanical means, forming the basis for the new paradigm “valleytronics” applications. - Highlights: • We explore the mechanical strain effects on the valley magnetotransport in graphene. • We analytically derive the dc collisional and Hall conductivities under strain. • The strain removes the valley degeneracy in Landau levels. • The strain causes a significant valley polarization with inversion symmetry broken. • The strain leads to the well separated valley Hall and Shubnikov–de Haas effects.
Directory of Open Access Journals (Sweden)
Satoru Tomita
Full Text Available In this study, we investigated the applicability of NMR-based metabolomics to discriminate strain-dependent fermentation characteristics of lactic acid bacteria (LAB, which are important microorganisms for fermented food production. To evaluate the discrimination capability, six type strains of Lactobacillus species and six additional L. brevis strains were used focusing on i the difference between homo- and hetero-lactic fermentative species and ii strain-dependent characteristics within L. brevis. Based on the differences in the metabolite profiles of fermented vegetable juices, non-targeted principal component analysis (PCA clearly separated the samples into those inoculated with homo- and hetero-lactic fermentative species. The separation was primarily explained by the different levels of dominant metabolites (lactic acid, acetic acid, ethanol, and mannitol. Orthogonal partial least squares discrimination analysis, based on a regions-of-interest (ROIs approach, revealed the contribution of low-abundance metabolites: acetoin, phenyllactic acid, p-hydroxyphenyllactic acid, glycerophosphocholine, and succinic acid for homolactic fermentation; and ornithine, tyramine, and γ-aminobutyric acid (GABA for heterolactic fermentation. Furthermore, ROIs-based PCA of seven L. brevis strains separated their strain-dependent fermentation characteristics primarily based on their ability to utilize sucrose and citric acid, and convert glutamic acid and tyrosine into GABA and tyramine, respectively. In conclusion, NMR metabolomics successfully discriminated the fermentation characteristics of the tested strains and provided further information on metabolites responsible for these characteristics, which may impact the taste, aroma, and functional properties of fermented foods.
International Nuclear Information System (INIS)
Lv, Jinlong; Luo, Hongyun
2014-01-01
In this paper, the effects of strain and heat treatment on strain-induced α′-martensite of AISI 304 stainless steel tubes were measured by X-ray diffraction. Moreover, the effects of strain and content of α′-martensite on passivated property on the surface of the material in borate buffer solution were evaluated by electrochemical technique. The results showed that the volume fraction of α′-martensite increased gradually with the increase of tensile strain for as-received and solid solution samples. However, α′-martensite in as-received sample was more than that in the solid solution sample. The electrochemical impedance spectroscopy results showed that the solid solution treatment improved corrosion resistance of the steel, especially for samples with small strain. Moreover, acceptor densities were always higher than donor densities for as-received and solid solution samples. With the increase of strain, the increase tendency of acceptor density was more significant than that of donor density. We also found that the total density of the acceptor and donor almost increased linearly with the increase of α′-martensite. The present results indicated that the increased acceptor density might lead to the decreased corrosion resistance of the steel. - Highlights: • The solid solution treatment improved corrosion resistance of the stainless steel. • The deteriorated passivated property after strain could be attributed to the increased acceptor density. • The α′-martensite reduced corrosion resistance of the stainless steel
Anisotropic nature of radially strained metal tubes
Strickland, Julie N.
Metal pipes are sometimes swaged by a metal cone to enlarge them, which increases the strain in the material. The amount of strain is important because it affects the burst and collapse strength. Burst strength is the amount of internal pressure that a pipe can withstand before failure, while collapse strength is the amount of external pressure that a pipe can withstand before failure. If the burst or collapse strengths are exceeded, the pipe may fracture, causing critical failure. Such an event could cost the owners and their customers millions of dollars in clean up, repair, and lost time, in addition to the potential environmental damage. Therefore, a reliable way of estimating the burst and collapse strength of strained pipe is desired and valuable. The sponsor currently rates strained pipes using the properties of raw steel, because those properties are easily measured (for example, yield strength). In the past, the engineers assumed that the metal would be work-hardened when swaged, so that yield strength would increase. However, swaging introduces anisotropic strain, which may decrease the yield strength. This study measured the yield strength of strained material in the transverse and axial direction and compared them to raw material, to determine the amount of anisotropy. This information will be used to more accurately determine burst and collapse ratings for strained pipes. More accurate ratings mean safer products, which will minimize risk for the sponsor's customers. Since the strained metal has a higher yield strength than the raw material, using the raw yield strength to calculate burst and collapse ratings is a conservative method. The metal has even higher yield strength after strain aging, which indicates that the stresses are relieved. Even with the 12% anisotropy in the strained and 9% anisotropy in the strain aged specimens, the raw yield strengths are lower and therefore more conservative. I recommend that the sponsor continue using the raw
Nutrient content of sorghum beer strainings
African Journals Online (AJOL)
Sorghum beer strainings were analysed for starch, protein, fat, crude fibre, ash, minerals and ... The importance of minerals in animal nutrition has been recognized for many ..... strainings is probably due to yeast activity during fermentation ...
Cox, Brian N.; Snead, Malcolm L.
2016-02-01
We argue in favor of representing living cells as automata and review demonstrations that autonomous cells can form patterns by responding to local variations in the strain fields that arise from their individual or collective motions. An autonomous cell's response to strain stimuli is assumed to be effected by internally-generated, internally-powered forces, which generally move the cell in directions other than those implied by external energy gradients. Evidence of cells acting as strain-cued automata have been inferred from patterns observed in nature and from experiments conducted in vitro. Simulations that mimic particular cases of pattern forming share the idealization that cells are assumed to pass information among themselves solely via mechanical boundary conditions, i.e., the tractions and displacements present at their membranes. This assumption opens three mechanisms for pattern formation in large cell populations: wavelike behavior, kinematic feedback in cell motility that can lead to sliding and rotational patterns, and directed migration during invasions. Wavelike behavior among ameloblast cells during amelogenesis (the formation of dental enamel) has been inferred from enamel microstructure, while strain waves in populations of epithelial cells have been observed in vitro. One hypothesized kinematic feedback mechanism, "enhanced shear motility", accounts successfully for the spontaneous formation of layered patterns during amelogenesis in the mouse incisor. Directed migration is exemplified by a theory of invader cells that sense and respond to the strains they themselves create in the host population as they invade it: analysis shows that the strain fields contain positional information that could aid the formation of cell network structures, stabilizing the slender geometry of branches and helping govern the frequency of branch bifurcation and branch coalescence (the formation of closed networks). In simulations of pattern formation in
Strain-energy effects on dynamic fragmentation
International Nuclear Information System (INIS)
Glenn, L.A.; Chudnovsky, A.
1986-01-01
Grady's model of the dynamic fragmentation process, in which the average fragment size is determined by balancing the local kinetic energy and the surface energy, is modified to include the stored elastic (strain) energy. The revised model predicts that the strain energy should dominate for brittle materials, with low fracture toughness and high fracture-initiation stress. This conclusion is not borne out, however, by limited experimental data on brittle steels, even when the kinetic-energy density is small compared with the strain-energy density
Cardiac biplane strain imaging: initial in vivo experience
Energy Technology Data Exchange (ETDEWEB)
Lopata, R G P; Nillesen, M M; Thijssen, J M; De Korte, C L [Clinical Physics Laboratory, Radboud University Nijmegen Medical Centre, Nijmegen (Netherlands); Verrijp, C N; Lammens, M M Y; Van der Laak, J A W M [Department of Pathology, Radboud University Nijmegen Medical Centre, Nijmegen (Netherlands); Singh, S K; Van Wetten, H B [Department of Cardiothoracic Surgery, Radboud University Nijmegen Medical Centre, Nijmegen (Netherlands); Kapusta, L [Pediatric Cardiology, Department of Pediatrics, Radboud University Nijmegen Medical Centre, Nijmegen (Netherlands)], E-mail: R.Lopata@cukz.umcn.nl
2010-02-21
In this study, first we propose a biplane strain imaging method using a commercial ultrasound system, yielding estimation of the strain in three orthogonal directions. Secondly, an animal model of a child's heart was introduced that is suitable to simulate congenital heart disease and was used to test the method in vivo. The proposed approach can serve as a framework to monitor the development of cardiac hypertrophy and fibrosis. A 2D strain estimation technique using radio frequency (RF) ultrasound data was applied. Biplane image acquisition was performed at a relatively low frame rate (<100 Hz) using a commercial platform with an RF interface. For testing the method in vivo, biplane image sequences of the heart were recorded during the cardiac cycle in four dogs with an aortic stenosis. Initial results reveal the feasibility of measuring large radial, circumferential and longitudinal cumulative strain (up to 70%) at a frame rate of 100 Hz. Mean radial strain curves of a manually segmented region-of-interest in the infero-lateral wall show excellent correlation between the measured strain curves acquired in two perpendicular planes. Furthermore, the results show the feasibility and reproducibility of assessing radial, circumferential and longitudinal strains simultaneously. In this preliminary study, three beagles developed an elevated pressure gradient over the aortic valve ({delta}p: 100-200 mmHg) and myocardial hypertrophy. One dog did not develop any sign of hypertrophy ({delta}p = 20 mmHg). Initial strain (rate) results showed that the maximum strain (rate) decreased with increasing valvular stenosis (-50%), which is in accordance with previous studies. Histological findings corroborated these results and showed an increase in fibrotic tissue for the hearts with larger pressure gradients (100, 200 mmHg), as well as lower strain and strain rate values.
Cardiac biplane strain imaging: initial in vivo experience
International Nuclear Information System (INIS)
Lopata, R G P; Nillesen, M M; Thijssen, J M; De Korte, C L; Verrijp, C N; Lammens, M M Y; Van der Laak, J A W M; Singh, S K; Van Wetten, H B; Kapusta, L
2010-01-01
In this study, first we propose a biplane strain imaging method using a commercial ultrasound system, yielding estimation of the strain in three orthogonal directions. Secondly, an animal model of a child's heart was introduced that is suitable to simulate congenital heart disease and was used to test the method in vivo. The proposed approach can serve as a framework to monitor the development of cardiac hypertrophy and fibrosis. A 2D strain estimation technique using radio frequency (RF) ultrasound data was applied. Biplane image acquisition was performed at a relatively low frame rate (<100 Hz) using a commercial platform with an RF interface. For testing the method in vivo, biplane image sequences of the heart were recorded during the cardiac cycle in four dogs with an aortic stenosis. Initial results reveal the feasibility of measuring large radial, circumferential and longitudinal cumulative strain (up to 70%) at a frame rate of 100 Hz. Mean radial strain curves of a manually segmented region-of-interest in the infero-lateral wall show excellent correlation between the measured strain curves acquired in two perpendicular planes. Furthermore, the results show the feasibility and reproducibility of assessing radial, circumferential and longitudinal strains simultaneously. In this preliminary study, three beagles developed an elevated pressure gradient over the aortic valve (Δp: 100-200 mmHg) and myocardial hypertrophy. One dog did not develop any sign of hypertrophy (Δp = 20 mmHg). Initial strain (rate) results showed that the maximum strain (rate) decreased with increasing valvular stenosis (-50%), which is in accordance with previous studies. Histological findings corroborated these results and showed an increase in fibrotic tissue for the hearts with larger pressure gradients (100, 200 mmHg), as well as lower strain and strain rate values.
Beck, Andrew; Tesh, Robert B; Wood, Thomas G; Widen, Steven G; Ryman, Kate D; Barrett, Alan D T
2014-02-01
The first comparison of a live RNA viral vaccine strain to its wild-type parental strain by deep sequencing is presented using as a model the yellow fever virus (YFV) live vaccine strain 17D-204 and its wild-type parental strain, Asibi. The YFV 17D-204 vaccine genome was compared to that of the parental strain Asibi by massively parallel methods. Variability was compared on multiple scales of the viral genomes. A modeled exploration of small-frequency variants was performed to reconstruct plausible regions of mutational plasticity. Overt quasispecies diversity is a feature of the parental strain, whereas the live vaccine strain lacks diversity according to multiple independent measurements. A lack of attenuating mutations in the Asibi population relative to that of 17D-204 was observed, demonstrating that the vaccine strain was derived by discrete mutation of Asibi and not by selection of genomes in the wild-type population. Relative quasispecies structure is a plausible correlate of attenuation for live viral vaccines. Analyses such as these of attenuated viruses improve our understanding of the molecular basis of vaccine attenuation and provide critical information on the stability of live vaccines and the risk of reversion to virulence.
High strain and strain-rate behaviour of PTFE/aluminium/tungsten mixtures
International Nuclear Information System (INIS)
Addiss, John; Walley, Stephen; Proud, William; Cai Jing; Nesterenko, Vitali
2007-01-01
Conventional drop-weight techniques were modified to accommodate low-amplitude force transducer signals from low-strength, cold isostatically pressed 'heavy' composites of polytetrafluoroethylene, aluminum and tungsten (W). The failure strength, strain and the post-critical behavior of failed samples were measured for samples of different porosity and tungsten grain size. Unusual phenomenon of significantly higher strength (55 MPa) of porous composites (density 5.9 g/cm 3 ) with small W particles ( 3 ) with larger W particles (44 μm) at the same volume content of components was observed. This is attributed to force chains created by a network of small W particles. Interrupted tests at different levels of strain revealed the mechanisms of fracture under dynamic compression
International Nuclear Information System (INIS)
Vastola, G.; Marzegalli, A.; Montalenti, F.; Miglio, Leo
2009-01-01
We report original finite element method simulations of the strain components at nanometric GeSi island on Si(0 0 1), for realistic shape, sizes and average composition, discussing the main mechanisms acting in the misfit strain relaxation. The tensile strain induced in a 30 nm Si capping layer and the one upon removing the island, after fixing the top part of the Si layer, is discussed in view of application as a field effect transistor channel, with high career mobility induced by the lattice deformation. The large shear components obtained for steeper island morphologies are predicted to be particularly performing, especially in comparison to one another strained-silicon configuration (totally top-down originated), recently developed by IBM corporation.
International Nuclear Information System (INIS)
Gao, H.; Ikeda, K.; Hata, S.; Nakashima, H.; Wang, D.; Nakashima, H.
2011-01-01
Bridge-shaped free-standing Si membranes (FSSM), strained by low-pressure (LP) Si x N y , plasma-enhanced (PE) Si x N y and Si x Ge 1-x stressors, were measured by convergent beam electron diffraction (CBED) and the finite element method (FEM). The results of CBED show that, while the strain along the length of the FSSM is compressive in an LPSi x N y /Si sample, those along the length of the FSSM are tensile in PESi x N y /Si and Si x Ge 1-x /Si samples. The average absolute values of strains are different in FSSM with LPSi x N y , PESi x N y and Si x Ge 1-x as stressors. The FEM was used to compensate the results of CBED taking into account the strain relaxation in transmission electron microscopy (TEM) sample preparation. The FEM results give the strain properties in three dimensions, and are in good agreement with the results of CBED. There is approximately no strain relaxation along the length of FSSM, and the elastic strains along the other two axes in FSSM are partially relaxed by thinning down for the preparation of TEM samples.
Directory of Open Access Journals (Sweden)
J. Matthew Goodhart
2014-03-01
Full Text Available The objective of this study was to design and validate a unique bioreactor design for applying spatially selective, linear, cyclic strain to degradable and non-degradable polymeric fabric scaffolds. This system uses a novel three-clamp design to apply cyclic strain via a computer controlled linear actuator to a specified zone of a scaffold while isolating the remainder of the scaffold from strain. Image analysis of polyethylene terephthalate (PET woven scaffolds subjected to a 3% mechanical stretch demonstrated that the stretched portion of the scaffold experienced 2.97% ± 0.13% strain (mean ± standard deviation while the unstretched portion experienced 0.02% ± 0.18% strain. NIH-3T3 fibroblast cells were cultured on the PET scaffolds and half of each scaffold was stretched 5% at 0.5 Hz for one hour per day for 14 days in the bioreactor. Cells were checked for viability and proliferation at the end of the 14 day period and levels of glycosaminoglycan (GAG and collagen (hydroxyproline were measured as indicators of extracellular matrix production. Scaffolds in the bioreactor showed a seven-fold increase in cell number over scaffolds cultured statically in tissue culture plastic petri dishes (control. Bioreactor scaffolds showed a lower concentration of GAG deposition per cell as compared to the control scaffolds largely due to the great increase in cell number. A 75% increase in hydroxyproline concentration per cell was seen in the bioreactor stretched scaffolds as compared to the control scaffolds. Surprisingly, little differences were experienced between the stretched and unstretched portions of the scaffolds for this study. This was largely attributed to the conditioned and shared media effect. Results indicate that the bioreactor system is capable of applying spatially-selective, linear, cyclic strain to cells growing on polymeric fabric scaffolds and evaluating the cellular and matrix responses to the applied strains.
Strain ageing in welds of nuclear pressure vessels
International Nuclear Information System (INIS)
Otterberg, R.; Karlsson, C.
1979-01-01
Static and dynamic strain ageing have been investigated on submerged-arc welds and repair welds from plates of the pressure vessel steel A 533B. The results permit the determination of the worst strain ageing conditions existing in a nuclear pressure vessel. Static strain ageing was investigated by means of data from tension tests, hardness measurements and Charpy-V impact properties for prestrained and aged material for ageing temperatures from room temperature to 350 deg C and ageing times up to 1000h. Dynamic strain ageing was investigated by tensile tests up to 350 deg C at different strain rates. At the most static strain ageing was found to increase the impact transition temperature from -75 deg C in the as-received condition to -55 deg C after prestraining and ageing for the plate material, from -35 to -10 deg C for the submerged arc weld and from -90 to -40 deg C for the repair weld. Approximately 10 deg C of the deleterious effect is due to the effect of ageing for the two former materials whereas the corresponding figure for the repair weld amounts to 35 deg C. The dynamic strain ageing is strongest at very low strain rates at temperatures just below 300 deg C. The effect of strain ageing can be reduced by stress relief heat treatment or by other means decreasing the content of nitrogen in solution. (author)
How strained are carbomeric-cycloalkanes?
Wodrich, Matthew D; Gonthier, Jérôme F; Steinmann, Stephan N; Corminboeuf, Clémence
2010-06-24
The ring strain energies of carbomeric-cycloalkanes (molecules with one or more acetylene spacer units placed into carbon single bonds) are assessed using a series of isodesmic, homodesmotic, and hyperhomodesmotic chemical equations. Isodesmic bond separation reactions and other equations derived from the explicitly defined hierarchy of homodesmotic equations are insufficient for accurately determining these values, since not all perturbing effects (i.e., conjugation and hyperconjugation) are fully balanced. A set of homodesmotic reactions is proposed, which succeeds in balancing all stereoelectronic effects present within the carbomeric rings, allowing for a direct assessment of the strain energies. Values calculated from chemical equations are validated using an increment/additivity approach. The ring strain energy decreases as acetylene units are added, manifesting from the net stabilization gained by opening the C-CH(2)-C angle around the methylene groups and the destabilization arising from bending the C-C identical withC angles of the spacer groups. This destabilization vanishes with increasing parent ring size (i.e., the angle distortion is less in the carbomeric-cyclobutanes than in the carbomeric-cyclopropanes), leading to strain energies near zero for carbo(n)-cyclopentanes and carbo(n)-cyclohexanes.
Fumonisin and Ochratoxin Production in Industrial Aspergillus niger Strains
DEFF Research Database (Denmark)
Frisvad, Jens Christian; Larsen, Thomas Ostenfeld; Thrane, Ulf
2011-01-01
as safe). However, A. niger has the potential to produce two groups of potentially carcinogenic mycotoxins: fumonisins and ochratoxins. In this study all available industrial and many non-industrial strains of A. niger (180 strains) as well as 228 strains from 17 related black Aspergillus species were...... examined for mycotoxin production. None of the related 17 species of black Aspergilli produced fumonisins. Fumonisins (B(2), B(4), and B(6)) were detected in 81% of A. niger, and ochratoxin A in 17%, while 10% of the strains produced both mycotoxins. Among the industrial strains the same ratios were 83......%, 33% and 26% respectively. Some of the most frequently used strains in industry NRRL 337, 3112 and 3122 produced both toxins and several strains used for citric acid production were among the best producers of fumonisins in pure agar culture. Most strains used for other biotechnological processes also...
Introducing lattice strain to graphene encapsulated in hBN
Tomori, Hikari; Hiraide, Rineka; Ootuka, Youiti; Watanabe, Kenji; Taniguchi, Takashi; Kanda, Akinobu
Due to the characteristic lattice structure, lattice strain in graphene produces an effective gauge field. Theories tell that by controlling spatial variation of lattice strain, one can tailor the electronic state and transport properties of graphene. For example, under uniaxial local strain, graphene exhibits a transport gap at low energies, which is attractive for a graphene application to field effect devices. Here, we develop a method for encapsulating a strained graphene film in hexagonal boron-nitride (hBN). It is known that the graphene carrier mobility is significantly improved by the encapsulation of graphene in hBN, which has never been applied to strained graphene. We encapsulate graphene in hBN using the van der Waals assembly method. Strain is induced by sandwiching a graphene film between patterned hBN sheets. Spatial variation of strain is confirmed with micro Raman spectroscopy. Transport measurement of encapsulated strained graphene is in progress.
Genomic and gene variation in Mycoplasma hominis strains
DEFF Research Database (Denmark)
Christiansen, Gunna; Andersen, H; Birkelund, Svend
1987-01-01
DNAs from 14 strains of Mycoplasma hominis isolated from various habitats, including strain PG21, were analyzed for genomic heterogeneity. DNA-DNA filter hybridization values were from 51 to 91%. Restriction endonuclease digestion patterns, analyzed by agarose gel electrophoresis, revealed...... no identity or cluster formation between strains. Variation within M. hominis rRNA genes was analyzed by Southern hybridization of EcoRI-cleaved DNA hybridized with a cloned fragment of the rRNA gene from the mycoplasma strain PG50. Five of the M. hominis strains showed identical hybridization patterns....... These hybridization patterns were compared with those of 12 other mycoplasma species, which showed a much more complex band pattern. Cloned nonribosomal RNA gene fragments of M. hominis PG21 DNA were analyzed, and the fragments were used to demonstrate heterogeneity among the strains. A monoclonal antibody against...
Benchmarking multi-dimensional large strain consolidation analyses
International Nuclear Information System (INIS)
Priestley, D.; Fredlund, M.D.; Van Zyl, D.
2010-01-01
Analyzing the consolidation of tailings slurries and dredged fills requires a more extensive formulation than is used for common (small strain) consolidation problems. Large strain consolidation theories have traditionally been limited to 1-D formulations. SoilVision Systems has developed the capacity to analyze large strain consolidation problems in 2 and 3-D. The benchmarking of such formulations is not a trivial task. This paper presents several examples of modeling large strain consolidation in the beta versions of the new software. These examples were taken from the literature and were used to benchmark the large strain formulation used by the new software. The benchmarks reported here are: a comparison to the consolidation software application CONDES0, Townsend's Scenario B and a multi-dimensional analysis of long-term column tests performed on oil sands tailings. All three of these benchmarks were attained using the SVOffice suite. (author)
Dark field electron holography for strain measurement
Energy Technology Data Exchange (ETDEWEB)
Beche, A., E-mail: armand.beche@fei.com [CEA-Grenoble, INAC/SP2M/LEMMA, F-38054 Grenoble (France); Rouviere, J.L. [CEA-Grenoble, INAC/SP2M/LEMMA, F-38054 Grenoble (France); Barnes, J.P.; Cooper, D. [CEA-LETI, Minatec Campus, F-38054 Grenoble (France)
2011-02-15
Dark field electron holography is a new TEM-based technique for measuring strain with nanometer scale resolution. Here we present the procedure to align a transmission electron microscope and obtain dark field holograms as well as the theoretical background necessary to reconstruct strain maps from holograms. A series of experimental parameters such as biprism voltage, sample thickness, exposure time, tilt angle and choice of diffracted beam are then investigated on a silicon-germanium layer epitaxially embedded in a silicon matrix in order to obtain optimal dark field holograms over a large field of view with good spatial resolution and strain sensitivity. -- Research Highlights: {yields} Step by step explanation of the dark field electron holography technique. {yields} Presentation of the theoretical equations to obtain quantitative strain map. {yields} Description of experimental parameters influencing dark field holography results. {yields} Quantitative strain measurement on a SiGe layer embedded in a silicon matrix.
Strain rate effects in stress corrosion cracking
Energy Technology Data Exchange (ETDEWEB)
Parkins, R.N. (Newcastle upon Tyne Univ. (UK). Dept. of Metallurgy and Engineering Materials)
1990-03-01
Slow strain rate testing (SSRT) was initially developed as a rapid, ad hoc laboratory method for assessing the propensity for metals an environments to promote stress corrosion cracking. It is now clear, however, that there are good theoretical reasons why strain rate, as opposed to stress per se, will often be the controlling parameter in determining whether or not cracks are nucleated and, if so, are propagated. The synergistic effects of the time dependence of corrosion-related reactions and microplastic strain provide the basis for mechanistic understanding of stress corrosion cracking in high-pressure pipelines and other structures. However, while this may be readily comprehended in the context of laboratory slow strain tests, its extension to service situations may be less apparent. Laboratory work involving realistic stressing conditions, including low-frequency cyclic loading, shows that strain or creep rates give good correlation with thresholds for cracking and with crack growth kinetics.
Inversion of the strain-life and strain-stress relationships for use in metal fatigue analysis
Manson, S. S.
1979-01-01
The paper presents closed-form solutions (collocation method and spline-function method) for the constants of the cyclic fatigue life equation so that they can be easily incorporated into cumulative damage analysis. The collocation method involves conformity with the experimental curve at specific life values. The spline-function method is such that the basic life relation is expressed as a two-part function, one applicable at strains above the transition strain (strain at intersection of elastic and plastic lines), the other below. An illustrative example is treated by both methods. It is shown that while the collocation representation has the advantage of simplicity of form, the spline-function representation can be made more accurate over a wider life range, and is simpler to use.
Generating strain signals under consideration of road surface profiles
Putra, T. E.; Abdullah, S.; Schramm, D.; Nuawi, M. Z.; Bruckmann, T.
2015-08-01
The current study aimed to develop the mechanism for generating strain signal utilising computer-based simulation. The strain data, caused by the acceleration, were undertaken from a fatigue data acquisition involving car movements. Using a mathematical model, the measured strain signals yielded to acceleration data used to describe the bumpiness of road surfaces. The acceleration signals were considered as an external disturbance on generating strain signals. Based on this comparison, both the actual and simulated strain data have similar pattern. The results are expected to provide new knowledge to generate a strain signal via a simulation.
Zhang, Hui; Wang, Shuang; Zhang, Xiang Xiang; Ji, Wei; Song, Fuping; Zhao, Yue; Li, Jie
2016-04-28
The filamentous fungus Aspergillus niger is widely exploited as an important expression host for industrial production. The glucoamylase high-producing strain A. niger CICC2462 has been used as a host strain for the establishment of a secretion expression system. It expresses recombinant xylanase, mannase and asparaginase at a high level, but some high secretory background proteins in these recombinant strains still remain, such as alpha-amylase and alpha-glucosidase; lead to a low-purity of fermentation products. The aim was to construct an A. niger host strain with a low background of protein secretion. The transcription factor amyR was deleted in A. niger CICC2462, and the results from enzyme activity assays and SDS-PAGE analysis showed that the glucoamylase and amylase activities of the ∆amyR strains were significantly lower than those of the wild-type strain. High-throughput RNA-sequencing and shotgun LC-MS/MS proteomic technology analysis demonstrated that the expression of amylolytic enzymes was decreased at both the transcriptional and translational levels in the ∆amyR strain. Interestingly, the ∆amyR strain growth rate better than the wild-type strain. Our findings clearly indicated that the ∆amyR strain of A. niger CICC2462 can be used as a host strain with a low background of protein secretion.
Broiler genetic strain and sex effects on meat characteristics.
López, K P; Schilling, M W; Corzo, A
2011-05-01
A randomized complete block design within a factorial arrangement of treatments was used to evaluate the effect of strain and sex on carcass characteristics, meat quality, and sensory acceptability. Two broiler strains were reared: a commercially available strain (strain A) and a strain currently in the test phase (strain B) that has been genetically selected to maximize breast yield. Broilers were harvested in a pilot scale processing plant using commercial prototype equipment at 42 d of age. Carcasses were deboned at 4 h postmortem. The left half of each breast was evaluated for pH, color, cooking loss, shear force, and proximate analysis. The right side of each breast was used for consumer acceptability testing. Thigh meat was evaluated for proximate composition. No interactions were observed throughout the study. Male broilers had a higher (P dressing percentage and breast meat yield when compared with females. Broilers from strain B presented a higher (P dressing percentage than those broilers corresponding to the commercially available broiler strain. At 24 h postmortem, female broilers presented a lower ultimate pH and higher Commission internationale de l'éclairage yellowness values (ventral side of the pectoralis major) when compared with male broilers. On average, no differences existed (P > 0.05) among treatments with respect to pH decline, cooking loss, shear values, and proximate composition. In addition, no differences (P > 0.05) existed among breast meat from the different strains with respect to consumer acceptability of appearance, texture, flavor, and overall acceptability, but breast meat from strain B was slightly preferred (P < 0.05) over that of strain A with respect to aroma. However, breast meat from both strains received scores in the range of "like slightly to like moderately." Overall data suggest that all treatments yielded high quality breast and thigh meat and strain cross did not present variability in terms of consumer acceptability.
Evaluation of local strain in Si using UV-Raman spectroscopy
Energy Technology Data Exchange (ETDEWEB)
Ogura, Atsushi [School of Science and Technology, Meiji University, 1-1-1 Higashimita, Tama-ku, Kawasaki, Kanagawa 214-8571 (Japan)], E-mail: a_ogura@isc.meiji.ac.jp; Kosemura, Daisuke; Takei, Munehisa [School of Science and Technology, Meiji University, 1-1-1 Higashimita, Tama-ku, Kawasaki, Kanagawa 214-8571 (Japan); Uchida, Hidetsugu; Hattori, Nobuyoshi [Semiconductor Technology Academic Research Center, 3-17-2 Shinyokohama, Kouhoku-ku, Yokohama 220-0033 (Japan); Yoshimaru, Masaki [Semiconductor Business Group, Sony Corporation, Atsugi Tec., 4-14-1 Asahi-cho, Atsugi-shi, Kanagawa 243-0014 (Japan); Mayuzumi, Satoru [School of Science and Technology, Meiji University, 1-1-1 Higashimita, Tama-ku, Kawasaki, Kanagawa 214-8571 (Japan); Semiconductor Business Group, Sony Corporation, Atsugi Tec., 4-14-1 Asahi-cho, Atsugi-shi, Kanagawa 243-0014 (Japan); Wakabayashi, Hitoshi [Semiconductor Business Group, Sony Corporation, Atsugi Tec., 4-14-1 Asahi-cho, Atsugi-shi, Kanagawa 243-0014 (Japan)
2009-03-15
'Strained-Si', in which intentional strain is introduced in Si crystal to improve carrier mobility by using a modulated band structure, is recognized as one of the most important technologies in post-scaling-generation LSIs. Strain-evaluation technology to probe strain in shallow surfaces that correspond to the channels of MOSFETs is crucial to achieving strained-Si technology. In this paper, we introduce the results we obtained by evaluating strain with the new UV-Raman spectroscopy we developed. Quasi-line shape illumination enabled Raman measurements with 200-nm intervals on the sample. The local-strain mechanism caused by SiN stressors covering a MOSFET was clarified by measuring one-dimensional strain profiles induced by patterned SiN film on Si. We also demonstrated that the induced strain was proportional to the inner stresses of SiN film and that it is more effective to introduce strain in SOI substrates than in bulk substrates. In the evaluation of a actual device fabricated by using the gate-last process in which strain was significantly enhanced after the dummy gate was removed, the size effect, i.e., an increase in induced strain with a decrease in gate length, was confirmed through one-dimensional strain-profile measurements with various gate lengths.
Evaluation of local strain in Si using UV-Raman spectroscopy
International Nuclear Information System (INIS)
Ogura, Atsushi; Kosemura, Daisuke; Takei, Munehisa; Uchida, Hidetsugu; Hattori, Nobuyoshi; Yoshimaru, Masaki; Mayuzumi, Satoru; Wakabayashi, Hitoshi
2009-01-01
'Strained-Si', in which intentional strain is introduced in Si crystal to improve carrier mobility by using a modulated band structure, is recognized as one of the most important technologies in post-scaling-generation LSIs. Strain-evaluation technology to probe strain in shallow surfaces that correspond to the channels of MOSFETs is crucial to achieving strained-Si technology. In this paper, we introduce the results we obtained by evaluating strain with the new UV-Raman spectroscopy we developed. Quasi-line shape illumination enabled Raman measurements with 200-nm intervals on the sample. The local-strain mechanism caused by SiN stressors covering a MOSFET was clarified by measuring one-dimensional strain profiles induced by patterned SiN film on Si. We also demonstrated that the induced strain was proportional to the inner stresses of SiN film and that it is more effective to introduce strain in SOI substrates than in bulk substrates. In the evaluation of a actual device fabricated by using the gate-last process in which strain was significantly enhanced after the dummy gate was removed, the size effect, i.e., an increase in induced strain with a decrease in gate length, was confirmed through one-dimensional strain-profile measurements with various gate lengths.
Directory of Open Access Journals (Sweden)
Rania Gaber
2014-03-01
Conclusion: Type 2 diabetes mellitus deteriorate both LV systolic and diastolic performance. Strain and strain rate by tissue Doppler Imaging is superior to conventional Doppler in early detection and evaluation of systolic and diastolic dysfunction in type 2 diabetic patients.
Strain measurement on a compact nuclear reactor steam generator
International Nuclear Information System (INIS)
Scaldaferri, Denis Henrique Bianchi; Gomes, Paulo de Tarso Vida; Mansur, Tanius Rodrigues; Pozzo, Renato del; Mola, Jairo
2011-01-01
This work presents the strain measurement procedures applied to a compact nuclear reactor steam generator, during a hydrostatic test, using strain gage technology. The test was divided in two steps: primary side test and secondary side test. In the primary side test twelve points for strain measurement using rectangular rosettes, three points (two external and one internal) for temperature measurement using special strain gages and one point for pressure measurement using a pressure transducer were monitored. In the secondary side test 18 points for strain measurement using rectangular rosettes, four points (two external and two internal) for temperature measurement using special strain gages and one point for pressure measurement using a pressure transducer were monitored. The measurement points on both internal and external pressurizer walls were established from pre-calculated stress distribution by means of numerical approach (finite elements modeling). Strain values using a quarter Wheatstone bridge circuit were obtained. Stress values, from experimental strain were determined, and to numerical calculation results were compared. (author)
International Nuclear Information System (INIS)
Usami, Takashi; Yoshida, Yutaka; Ichino, Yusuke; Sugano, Michinaka; Machiya, Shutaro; Ibi, Akira; Izumi, Teruo
2016-01-01
The strain effect of REBa_2Cu_3O_y (REBCO: RE = Y, Gd, Sm)-coated conductors (CCs) on critical current (I_c) is one of the most fundamental factors for superconducting coil applications. In this study, we aim to clarify the effect of artificial pinning center shapes on the strain effect in BHO-doped GdBCO CCs. To achieve this, we fabricated a Pure-GdBCO CC, a BHO nanorod-doped GdBCO CC and a multilayered-GdBCO (ML-GdBCO) CC, and carried out bending tests. As the result, the strain dependence of I_c for each CC showed an upward convex and the peak strain of the BHO-doped GdBCO CC shifts towards the compressive strain independent of the BHO shapes. In addition, the strain sensitivity of I_c in the GdBCO CCs including BHO becomes smaller. To clarify the difference between the strain sensitivity of I_c and the peak strain among the CCs, we evaluated the residual strain and the slopes of the internal lattice strains against the applied tensile strain (β). From this measurement, the residual strains for the Pure-GdBCO CC and the ML-GdBCO CC were almost the same. In addition, there was no change in the β value between the Pure-GdBCO and ML-GdBCO CCs. These results suggest that the changes in peak strain and strain sensitivity were not related to the internal lattice strain. (author)
International Nuclear Information System (INIS)
Francois, D.
1975-01-01
The study of potential energy variations in a loaded elastic solid containing a crack leads to determination of the crack driving force G. Generalization of this concept to cases other than linear elasticity leads to definition of the integral J. In a linear solid, the crack tip stress field is characterized by a single parameter: the stress-intensity factor K. When the crack tip plastic zone size is confined to the elastic singularity J=G, it is possible to establish relationship between these parameters and plastic strain (and in particular the crack tip opening displacement delta). The stress increases because of the triaxiality effect. This overload rises with increasing strain hardening. When the plastic zone size expands, using certain hypotheses, delta can be calculated. The plastic strain intensity is exclusively dependent on parameter J [fr
Uptake of 51Cr-SRBC in low- and high-responder mouse strains (C57BL/10ScSn/A/J mouse strains)
International Nuclear Information System (INIS)
Rihova, B.; Vetvicka, V.
1984-01-01
51 Cr-SRBC (sheep red blood cells) antigen clearance was studied in two strains of mice differing in the capacity to react with IgG antibody formation. In the B10 strain which is a poor IgG anti SRBC producer, before immunization 80.3% of the injected radioactivity was taken up by the liver, whereas after primary stimulation the uptake was only 31.1%. This value further decreases to 22.8% after secondary stimulation. The well IgG antibody producing A/J strain accumulated less antigen in the liver before immunization than the poorly responding strain (69.8%). On the 10th day after primary immunization a higher uptake of the radioactivity in the liver was shown than in the poor responder strain (53.8%) and this difference was even more pronounced after the secondary stimulation (49.6%). Interaction between peritoneal macrophages of the B10 and A/J strains before and after immunization with SRBC antigen was assessed from the formation of rosettes. Before immunization the low-responder strain B10 exhibited a three times higher level of rosette-forming macrophages (RFM), i.e. 6.1% than the high-responder strain A/J (2.0%). However, after immunization the RFM level in the A/J strain increased sevenfold (13.5%) whereas that in the low-responder strain B10 remained unaffected. These results suggested a role of macrophage population in the control of IgG antibody response. (author)
Tunable strain gauges based on two-dimensional silver nanowire networks
International Nuclear Information System (INIS)
Ho, Xinning; Cheng, Chek Kweng; Tey, Ju Nie; Wei, Jun
2015-01-01
Strain gauges are used in various applications such as wearable strain gauges and strain gauges in airplanes or structural health monitoring. Sensitivity of the strain gauge required varies, depending on the application of the strain gauge. This paper reports a tunable strain gauge based on a two-dimensional percolative network of silver nanowires. By varying the surface coverage of the nanowire network and the waviness of the nanowires in the network, the sensitivity of the strain gauge can be controlled. Hence, a tunable strain gauge can be engineered, based on demands of the application. A few applications are demonstrated. The strain gauge can be adhered to the human neck to detect throat movements and a glove integrated with such a strain gauge can detect the bending of the forefinger. Other classes of two-dimensional percolative networks of one-dimensional materials are also expected to exhibit similar tunable properties. (paper)
Energy Technology Data Exchange (ETDEWEB)
Auger, Sandrine; Galleron, Nathalie; Bidnenko, Elena; Ehrlich, S. Dusko; Lapidus, Alla; Sorokin, Alexei
2007-10-02
Bacteria of the Bacillus cereus group are known to cause food poisoning. A rare phylogenetically remote strain, NVH391-98, was recently characterized to encode a particularly efficient cytotoxin K presumably responsible for food poisoning. This pathogenic strain and its close relatives can be phenotypically distinguished from other strains of the B. cereus group by the inability to grow at temperatures below 17 degrees C and by the ability to grow at temperatures from 48 to 53 degrees C. A temperate phage, phBC391A2, residing in the genome of NVH391-98 allows us to distinguish the three known members of this thermophilic strain cluster.
Effects of strain on the Schwinger pair creation in graphene
International Nuclear Information System (INIS)
Fanbanrai, P.; Hutem, A.; Boonchui, S.
2015-01-01
The effects of strain on mechanically deformed graphene are determined by looking at how the strain affects the amplitude of the Schwinger two particle pair state. The influences of the lattice distortions, such as isotropic tensile strain ϵ is , shear strain ϵ ss , uniaxial armchair strain ϵ as , and zigzag strain ϵ zs , on the photon emission spectrum have been analyzed. We find that the intensities of the emission increases or decreases when compared to those of the unstrained graphene, depending on the type of strain applied. Thus the structure of energy band, the frequencies of the photons and the emission spectrum can be controlled by use of the different strains
Mechanism of Strain Rate Effect Based on Dislocation Theory
International Nuclear Information System (INIS)
Kun, Qin; Shi-Sheng, Hu; Li-Ming, Yang
2009-01-01
Based on dislocation theory, we investigate the mechanism of strain rate effect. Strain rate effect and dislocation motion are bridged by Orowan's relationship, and the stress dependence of dislocation velocity is considered as the dynamics relationship of dislocation motion. The mechanism of strain rate effect is then investigated qualitatively by using these two relationships although the kinematics relationship of dislocation motion is absent due to complicated styles of dislocation motion. The process of strain rate effect is interpreted and some details of strain rate effect are adequately discussed. The present analyses agree with the existing experimental results. Based on the analyses, we propose that strain rate criteria rather than stress criteria should be satisfied when a metal is fully yielded at a given strain rate. (condensed matter: structure, mechanical and thermal properties)
International Nuclear Information System (INIS)
Glasko, J.M.; Elliman, R.G.; Zou, J.; Cockayne, D.J.H.; Fitz Gerald, J.D.
1998-01-01
High energy (1 MeV), ion irradiation of GeSi/Si strained layers at elevated temperatures can cause strain relaxation. In this study, the effect of subsequent thermal annealing was investigated. Three distinct annealing stages were identified and correlated with the evolution of the defect microstructure. In the temperature range from 350 to 600 deg C, a gradual recovery of strain is observed. This is believed to result from the annealing of small defect clusters and the growth of voids. The voids are visible at annealing temperatures in excess of 600 deg C, consistent with an excess vacancy concentration in the irradiated alloy layer. The 600 to 750 deg C range is marked by pronounced maximal recovery of strain, and is correlated with the dissolution of faulted loops in the substrate. At temperatures in the range 750-1000 deg C, strain relaxation is observed and is correlated with the growth of intrinsic dislocations within the alloy layer. These dislocations nucleate at the alloy-substrate interface and grow within the alloy layer, towards the surface. (authors)
Angiogenesis is induced by airway smooth muscle strain.
Hasaneen, Nadia A; Zucker, Stanley; Lin, Richard Z; Vaday, Gayle G; Panettieri, Reynold A; Foda, Hussein D
2007-10-01
Angiogenesis is an important feature of airway remodeling in both chronic asthma and chronic obstructive pulmonary disease (COPD). Airways in those conditions are exposed to excessive mechanical strain during periods of acute exacerbations. We recently reported that mechanical strain of human airway smooth muscle (HASM) led to an increase in their proliferation and migration. Sustained growth in airway smooth muscle in vivo requires an increase in the nutritional supply to these muscles, hence angiogenesis. In this study, we examined the hypothesis that cyclic mechanical strain of HASM produces factors promoting angiogenic events in the surrounding vascular endothelial cells. Our results show: 1) a significant increase in human lung microvascular endothelial cell (HMVEC-L) proliferation, migration, and tube formation following incubation in conditioned media (CM) from HASM cells exposed to mechanical strain; 2) mechanical strain of HASM cells induced VEGF expression and release; 3) VEGF neutralizing antibodies inhibited the proliferation, migration, and tube formations of HMVEC-L induced by the strained airway smooth muscle CM; 4) mechanical strain of HASM induced a significant increase in hypoxia-inducible factor-1alpha (HIF-1alpha) mRNA and protein, a transcription factor required for VEGF gene transcription; and 5) mechanical strain of HASM induced HIF-1alpha/VEGF through dual phosphatidylinositol 3-kinase (PI3K)/Akt/mammalian target of rapamycin (mTOR) and ERK pathways. In conclusion, exposing HASM cells to mechanical strain induces signal transduction pathway through PI3K/Akt/mTOR and ERK pathways that lead to an increase in HIF-1alpha, a transcription factor required for VEGF expression. VEGF release by mechanical strain of HASM may contribute to the angiogenesis seen with repeated exacerbation of asthma and COPD.
Job strain and time to pregnancy
DEFF Research Database (Denmark)
Hjollund, N H; Kold Jensen, T; Bonde, Jens Peter
1998-01-01
The association between fertility and job strain defined as high job demands and low job control has not previously been studied. A follow-up study was conducted with prospective collection of information on job strain among women, achievement of pregnancy, and potential confounding variables....
[New antibiotics produced by Bacillus subtilis strains].
Malanicheva, I A; Kozlov, D G; Efimenko, T A; Zenkova, V A; Kastrukha, G S; Reznikova, M I; Korolev, A M; Borshchevskaia, L N; Tarasova, O D; Sineokiĭ, S P; Efremenkova, O V
2014-01-01
Two Bacillus subtilis strains isolated from the fruiting body of a basidiomycete fungus Pholiota squarrosa exhibited a broad range of antibacterial activity, including those against methicillin-resistant Staphylococcus aureus INA 00761 (MRSA) and Leuconostoc mes6nteroides VKPM B-4177 resistant to glycopep-> tide antibiotics, as well as antifungal activity. The strains were identified as belonging to the "B. subtilis" com- plex based on their morphological and physiological characteristics, as well as by sequencing of the 16S rRNA gene fragments. Both strains (INA 01085 and INA 01086) produced insignificant amounts of polyene antibiotics (hexaen and pentaen, respectively). Strain INA 01086 produced also a cyclic polypeptide antibiotic containing Asp, Gly, Leu, Pro, Tyr, Thr, Trp, and Phe, while the antibiotic of strain INA 01085 contained, apart from these, two unidentified nonproteinaceous amino acids. Both polypeptide antibiotics were new compounds efficient against gram-positive bacteria and able to override the natural bacterial antibiotic resistance.
On fracture in finite strain gradient plasticity
DEFF Research Database (Denmark)
Martínez Pañeda, Emilio; Niordson, Christian Frithiof
2016-01-01
In this work a general framework for damage and fracture assessment including the effect of strain gradients is provided. Both mechanism-based and phenomenological strain gradient plasticity (SGP) theories are implemented numerically using finite deformation theory and crack tip fields are invest......In this work a general framework for damage and fracture assessment including the effect of strain gradients is provided. Both mechanism-based and phenomenological strain gradient plasticity (SGP) theories are implemented numerically using finite deformation theory and crack tip fields...... are investigated. Differences and similarities between the two approaches within continuum SGP modeling are highlighted and discussed. Local strain hardening promoted by geometrically necessary dislocations (GNDs) in the vicinity of the crack leads to much higher stresses, relative to classical plasticity...... in the multiple parameter version of the phenomenological SGP theory. Since this also dominates the mechanics of indentation testing, results suggest that length parameters characteristic of mode I fracture should be inferred from nanoindentation....
Stability of germanene under tensile strain
Kaloni, Thaneshwor P.
2013-09-01
The stability of germanene under biaxial tensile strain and the accompanying modifications of the electronic properties are studied by density functional theory. The phonon spectrum shows that up to 16% strain the germanene lattice is stable, where the Dirac cone shifts towards higher energy and hole-doped Dirac states are achieved. The latter is due to weakening of the Ge-Ge bonds and reduction of the s-p hybridization. Our calculated Grüneisen parameter shows a similar dependence on the strain as reported for silicene (which is different from that of graphene). © 2013 Elsevier B.V. All rights reserved.
Stability of germanene under tensile strain
Kaloni, Thaneshwor P.; Schwingenschlö gl, Udo
2013-01-01
The stability of germanene under biaxial tensile strain and the accompanying modifications of the electronic properties are studied by density functional theory. The phonon spectrum shows that up to 16% strain the germanene lattice is stable, where the Dirac cone shifts towards higher energy and hole-doped Dirac states are achieved. The latter is due to weakening of the Ge-Ge bonds and reduction of the s-p hybridization. Our calculated Grüneisen parameter shows a similar dependence on the strain as reported for silicene (which is different from that of graphene). © 2013 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Rayo Morfin-Otero
2016-01-01
Conclusions: C. difficile NAP1/BI/027 strain and non-027 strains are established pathogens in our hospital. Accordingly, surveillance of C. difficile infections is now part of our nosocomial prevention program.
Johnston, M. J. S.; Borcherdt, R. D.; Linde, A. T.
1986-10-01
Measurements of dilational earth strain in the frequency band 25-10-5 Hz have been made on a deep borehole strainmeter installed near the San Andreas fault. These data are used to determine seismic radiation fields during nuclear explosions, teleseisms, local earthquakes, and ground noise during seismically quiet times. Strains of less than 10-10 on these instruments can be clearly resolved at short periods (< 10 s) and are recorded with wide dynamic range digital recorders. This permits measurement of the static and dynamic strain variations in the near field of local earthquakes. Noise spectra for earth strain referenced to 1 (strain)2/Hz show that strain resolution decreases at about 10 dB per decade of frequency from -150 dB at 10-4 Hz to -223 dB at 10 Hz. Exact expressions are derived to relate the volumetric strain and displacement field for a homogeneous P wave in a general viscoelastic solid as observed on colocated dilatometers and seismometers. A rare near-field recording of strain and seismic velocity was obtained on May 26, 1984, from an earthquake (ML 3.2) at a hypocentral distance of 3.2 km near the San Andreas fault at San Juan Bautista, California. While the data indicate no precursory strain release at the 5 × 10-11 strain level, a coseismic strain release of 1.86 nanostrain was observed. This change in strain is consistent with that calculated from a simple dislocation model of the event. Ground displacement spectra, determined from the downhole strain data and instrument-corrected surface seismic data, suggest that source parameters estimated from surface recordings may be contaminated by amplification effects in near-surface low-velocity materials.
Energy Technology Data Exchange (ETDEWEB)
Gao, H., E-mail: hongye18@mm.kyushu-u.ac.jp [Faculty of Engineering Sciences, Kyushu University, 6-1 Kasuga-koen, Kasuga, Fukuoka 816-8580 (Japan); Ikeda, K.; Hata, S.; Nakashima, H. [Faculty of Engineering Sciences, Kyushu University, 6-1 Kasuga-koen, Kasuga, Fukuoka 816-8580 (Japan); Wang, D.; Nakashima, H. [Art, Science and Technology Center for Cooperative Research, Kyushu University, 6-1 Kasuga-koen, Kasuga, Fukuoka 816-8580 (Japan)
2011-04-15
Bridge-shaped free-standing Si membranes (FSSM), strained by low-pressure (LP) Si{sub x}N{sub y}, plasma-enhanced (PE) Si{sub x}N{sub y} and Si{sub x}Ge{sub 1-x} stressors, were measured by convergent beam electron diffraction (CBED) and the finite element method (FEM). The results of CBED show that, while the strain along the length of the FSSM is compressive in an LPSi{sub x}N{sub y}/Si sample, those along the length of the FSSM are tensile in PESi{sub x}N{sub y}/Si and Si{sub x}Ge{sub 1-x}/Si samples. The average absolute values of strains are different in FSSM with LPSi{sub x}N{sub y}, PESi{sub x}N{sub y} and Si{sub x}Ge{sub 1-x} as stressors. The FEM was used to compensate the results of CBED taking into account the strain relaxation in transmission electron microscopy (TEM) sample preparation. The FEM results give the strain properties in three dimensions, and are in good agreement with the results of CBED. There is approximately no strain relaxation along the length of FSSM, and the elastic strains along the other two axes in FSSM are partially relaxed by thinning down for the preparation of TEM samples.
Zhu, Yu; Wang, Gui-Hua; Cui, Yu-Dong; Cui, Shang-Jin
2016-09-01
Porcine epidemic diarrhea virus (PEDV) can cause serious disease and even death in neonatal piglets, resulting in serious damage to the swine industry worldwide. Open reading frame 3 (ORF3) is the only accessory gene in the PEDV genome. Previous studies have indicated that PEDV vaccine strains have a partial deletion in ORF3. In this study, a nanoparticle-assisted polymerase chain reaction (nanoparticle-assisted RT-PCR) assay targeting the ORF3 of PEDV was developed to distinguish PEDV field strains from attenuated strains by using a specific pair of primers. The PCR products of field strains and attenuated strains were 264 bp and 215 bp in length, respectively. The sensitivity and specificity of this assay were also assessed. The nanoparticle-assisted RT-PCR assay was 10-100 times more sensitive than the conventional RT-PCR assay, with no cross-reactions when amplifying porcine pseudorabies virus (PRV), porcine circovirus type 2 (PCV2), classical swine fever virus (CSFV), porcine parvovirus (PPV), porcine reproductive and respiratory syndrome virus (PRRSV), porcine rotavirus (RV), and porcine transmissible gastroenteritis virus (TGEV). The nanoparticle-assisted RT-PCR assay we describe here can be used to distinguish field strains from vaccine strains of PEDV, and it shows promise for reducing economic loss due to PEDV infection.
Genome sequencing and analysis of BCG vaccine strains.
Directory of Open Access Journals (Sweden)
Wen Zhang
Full Text Available BACKGROUND: Although the Bacillus Calmette-Guérin (BCG vaccine against tuberculosis (TB has been available for more than 75 years, one third of the world's population is still infected with Mycobacterium tuberculosis and approximately 2 million people die of TB every year. To reduce this immense TB burden, a clearer understanding of the functional genes underlying the action of BCG and the development of new vaccines are urgently needed. METHODS AND FINDINGS: Comparative genomic analysis of 19 M. tuberculosis complex strains showed that BCG strains underwent repeated human manipulation, had higher region of deletion rates than those of natural M. tuberculosis strains, and lost several essential components such as T-cell epitopes. A total of 188 BCG strain T-cell epitopes were lost to various degrees. The non-virulent BCG Tokyo strain, which has the largest number of T-cell epitopes (359, lost 124. Here we propose that BCG strain protection variability results from different epitopes. This study is the first to present BCG as a model organism for genetics research. BCG strains have a very well-documented history and now detailed genome information. Genome comparison revealed the selection process of BCG strains under human manipulation (1908-1966. CONCLUSIONS: Our results revealed the cause of BCG vaccine strain protection variability at the genome level and supported the hypothesis that the restoration of lost BCG Tokyo epitopes is a useful future vaccine development strategy. Furthermore, these detailed BCG vaccine genome investigation results will be useful in microbial genetics, microbial engineering and other research fields.
Controllable spin-charge transport in strained graphene nanoribbon devices
Energy Technology Data Exchange (ETDEWEB)
Diniz, Ginetom S., E-mail: ginetom@gmail.com; Guassi, Marcos R. [Institute of Physics, University of Brasília, 70919-970, Brasília-DF (Brazil); Qu, Fanyao [Institute of Physics, University of Brasília, 70919-970, Brasília-DF (Brazil); Department of Physics, The University of Texas at Austin, Austin, Texas 78712 (United States)
2014-09-21
We theoretically investigate the spin-charge transport in two-terminal device of graphene nanoribbons in the presence of a uniform uniaxial strain, spin-orbit coupling, exchange field, and smooth staggered potential. We show that the direction of applied strain can efficiently tune strain-strength induced oscillation of band-gap of armchair graphene nanoribbon (AGNR). It is also found that electronic conductance in both AGNR and zigzag graphene nanoribbon (ZGNR) oscillates with Rashba spin-orbit coupling akin to the Datta-Das field effect transistor. Two distinct strain response regimes of electronic conductance as function of spin-orbit couplings magnitude are found. In the regime of small strain, conductance of ZGNR presents stronger strain dependence along the longitudinal direction of strain. Whereas for high values of strain shows larger effect for the transversal direction. Furthermore, the local density of states shows that depending on the smoothness of the staggered potential, the edge states of AGNR can either emerge or be suppressed. These emerging states can be determined experimentally by either spatially scanning tunneling microscope or by scanning tunneling spectroscopy. Our findings open up new paradigms of manipulation and control of strained graphene based nanostructure for application on novel topological quantum devices.
Chromosomal duplication strains of Aspergillus nidulans and their instability
International Nuclear Information System (INIS)
Azevedo, J.L. de; Almeida Okino, L.M. de
1981-01-01
Strains of Aspergillus nidulans with chromosomal duplication were obtained after gamma irradiation followed by crossing of the translocated strains with normal strains. From 20 analysed colonies, 12 have shown translocations induced by irradiation. Segregants from four of these translocation strains crossed to normal strains have shown to be unstable although presenting normal morphology. Two segregants were genetically analysed. The first one has shown a duplication of part of linkage groups VIII and the second one presented a duplication of a segment of linkage group V. These new duplication strains in A. nidulans open new perspectives of a more detailed study of the instability phenomenon in this fungus. (Author) [pt
Analysis of bacterial strains from contaminated and non ...
African Journals Online (AJOL)
Administrator
2007-05-02
May 2, 2007 ... A total 18 strains were collected from non-contaminated and contaminated environments, and were purified. All purified strains were characterized for Gram reaction and biochemical analysis. Screening for bioplastic production was done by Sudan black staining. Strains isolated from non-contaminated.
2013-01-01
Background Mycoplasma hyopneumoniae is the causative agent of porcine enzootic pneumonia (EP), a mild, chronic pneumonia of swine. Despite presenting with low direct mortality, EP is responsible for major economic losses in the pig industry. To identify the virulence-associated determinants of M. hyopneumoniae, we determined the whole genome sequence of M. hyopneumoniae strain 168 and its attenuated high-passage strain 168-L and carried out comparative genomic analyses. Results We performed the first comprehensive analysis of M. hyopneumoniae strain 168 and its attenuated strain and made a preliminary survey of coding sequences (CDSs) that may be related to virulence. The 168-L genome has a highly similar gene content and order to that of 168, but is 4,483 bp smaller because there are 60 insertions and 43 deletions in 168-L. Besides these indels, 227 single nucleotide variations (SNVs) were identified. We further investigated the variants that affected CDSs, and compared them to reported virulence determinants. Notably, almost all of the reported virulence determinants are included in these variants affected CDSs. In addition to variations previously described in mycoplasma adhesins (P97, P102, P146, P159, P216, and LppT), cell envelope proteins (P95), cell surface antigens (P36), secreted proteins and chaperone protein (DnaK), mutations in genes related to metabolism and growth may also contribute to the attenuated virulence in 168-L. Furthermore, many mutations were located in the previously described repeat motif, which may be of primary importance for virulence. Conclusions We studied the virulence attenuation mechanism of M. hyopneumoniae by comparative genomic analysis of virulent strain 168 and its attenuated high-passage strain 168-L. Our findings provide a preliminary survey of CDSs that may be related to virulence. While these include reported virulence-related genes, other novel virulence determinants were also detected. This new information will form
Deoxyribonucleic acid-deficient strains of Candida albicans.
Olaiya, A F; Steed, J R; Sogin, S J
1980-03-01
We analyzed a series of germ tube-negative variants isolated from Candida albicans 3153A for deoxyribonucleic acid content. As analyzed by flow microfluorometry, the deoxyribonucleic acid level in these variant strains was 50% of that of the parental strain and equivalent to that of haploid Saccharomyces cerevisiae. This finding was confirmed by comparison of survival rates when exposed to the mutagens ultraviolet light, ethyl methane sulfonate, and methyl methane sulfonate. The diameter of the variant cells as compared to the diameter of the parental 3153A strain showed a relationship similar to that of the diameters of haploid versus diploid S. cerevisiae. These results indicate that those strains may be representative of the imperfect stage of C. albicans.
Self-sensing concrete-filled FRP tube using FBG strain sensor
Yan, Xin; Li, Hui
2007-01-01
Concrete-filled fiber-reinforced polymer (FRP) tube is a type of newly developed structural column. It behaves brittle failure at its peak strength, and so the health monitoring on the hoop strain of the FRP tube is essential for the life cycle safety of the structure. Herein, the optic fiber Bragg grating (FBG) strain sensor was chosen as the strain measuring gauge and embedded in the inter-ply of fibers in the middle height and the hoop direction of the FRP tube. The compressive behaviors of the concrete-filled FRP tubes were experimentally studied. The hoop strain of the FRP tube was recorded in real time using the embedded FBG strain sensor as well as the embedded or surface electric resistance strain gauges. Results indicated that the FBG strain sensor can faithfully record the hoop strain ofthe concrete-filled FRP tubes in compression as compared with the embedded or surface electric resistance strain gauges, and the strain recorded can reach more than 7000μɛ.
Zekarias, B; O'Toole, D; Lehmann, J; Corbeil, L B
2011-04-21
Histophilus somni causes bovine pneumonia, septicemia, myocarditis, thrombotic meningoencephalitis and arthritis, as well as a genital or upper respiratory carrier state in normal animals. However, differences in virulence factors among strains are not well studied. The surface and secreted immunoglobulin binding protein A (IbpA) Fic motif of H. somni causes bovine alveolar type 2 (BAT2) cells to retract, allowing virulent bacteria to cross the alveolar monolayer. Because H. somni IbpA is an important virulence factor, its presence was evaluated in different strains from cattle, sheep and bison to define whether there are syndrome specific markers and whether antigenic/molecular/functional conservation occurs. A few preputial carrier strains lacked IbpA by Western blotting but all other tested disease or carrier strains were IbpA positive. These positive strains had either both IbpA DR1/Fic and IbpA DR2/Fic or only IbpA DR2/Fic by PCR. IbpA Fic mediated cytotoxicity for BAT2 cells and sequence analysis of IbpA DR2/Fic from selected strains revealed conservation of sequence and function in disease and IbpA positive carrier strains. Passive protection of mice against H. somni septicemia with antibody to IbpA DR2/Fic, along with previous data, indicates that the IbpA DR1/Fic and/or DR2/Fic domains are candidate vaccine antigens for protection against many strains of H. somni. Since IbpA DR2/Fic is conserved in most carrier strains, they may be virulent if introduced to susceptible animals at susceptible sites. Conservation of the protective IbpA antigen in all disease isolates tested is encouraging for development of protective vaccines and diagnostic assays. Copyright © 2010 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Leila Bigdelu
2016-03-01
Full Text Available Introduction: Atrial fibrillation (AF is a common dysrhythmia postoperatively after coronary artery bypass grafting (CABG. Myocardial strain and strain-rate imaging is used for the assessment of postoperative atrial fibrillation (POAF as a new echocardiographic method. Methods: PubMed and Scopus were searched thoroughly using the following search terms: (strain and strain rate AND (atrial fibrillation OR AF on March 2015 to find English articles in which the strain and strain-rate echocardiographic imaging had been used for the evaluation of AF in patients undergone CABG. Full text of the relevant papers was fully reviewed for data extraction.Result: Of overall 6 articles found in PubMed, 10 records found in Scopus and 4 articles found through reference list search, only 6 papers fully met the inclusion criteria for further assessment and data extraction. The results of strain and strain-rate assessment showed that in total of 542 patients undergoing CABG, POAF occurred in 106 patients. Studies showed that the reduction of left atrial (LA strain rate is correlated with AF. Consistently, the results of present review showed that LA strain and strain-rate in patients who developed AF postoperatively after CABG are significantly reduced, suggesting that strain and strain-rate could be a predictor of POAF.Conclusion: Based on the obtained results, strain and strain-rate is a suitable and accurate echocardiographic technique in the assessment of left atrial function , and it might be helpful to detect the patients who are at high risk of POAF.
Bai, Dong-Mei; Zhao, Xue-Ming; Li, Xin-Gang; Xu, Shi-Min
2004-12-20
The effects of initial glucose concentration and calcium lactate concentration on the lactic acid production by the parent strain, Lactobacillus lactis BME5-18, were studied. The results of the experiments indicated that glucose and lactate repressed the cell growth and the lactic acid production by Lactobacillus lactis BME5-18. A L(+)-lactic acid overproducing strain, Lactobacillus lactis BME5-18M, was screened by mutagenizing the parent strain with ultraviolet (UV) light irradiation and selecting the high glucose and lactate calcium concentration repression resistant mutant. Starting with a concentration of 100g L(-1) glucose, the mutant produced 98.6 g L(-1) lactic acid after 60 h in flasks, 73.9% higher than that of the parent strain. The L(+)-lactic acid purity was 98.1% by weight based on the amount of total lactic acid. The culture of the parent strain could not be analyzed well by conventional metabolic flux analysis techniques, since some pyruvate were accumulated intracellularly. Therefore, a revised flux analysis method was proposed by introducing intracellular pyruvate pool. Further studies demonstrate that there is a high level of NADH oxidase activity (12.11 mmol mg(-1) min(-1)) in the parent strain. The molecular mechanisms of the strain improvement were proposed, i.e., the high level of NADH oxidase activity was eliminated and the uptake rate of glucose was increased from 82.1 C-mmol (g DW h)(-1) to 98.9 C-mmol (g DW h)(-1) by mutagenizing the parent strain with UV, and therefore the mutant strain converts mostly pyruvate to lactic acid with a higher productivity (1.76 g L(-1) h(-1)) than the parent strain (0.95 g L(-1) h(-1)).
Strain rate behavior of magnetorheological materials
International Nuclear Information System (INIS)
Seminuk, Kenneth; Joshi, Vasant; Gump, Jared; Stoltz, Chad; Forbes, Jerry
2014-01-01
Strain rate response of two Hydroxyl-terminated Polybutadiene/ Iron (HTPB/Fe) compositions under electromagnetic fields has been investigated using a Split Hopkinson Pressure bar arrangement equipped with aluminum bars. Two HTPB/Fe compositions were developed, the first without plasticizer and the second containing plasticizer. Samples were tested with and without the application of a 0.01 Tesla magnetic field. Strain gauge data taken from the Split Hopkinson Pressure Bar has been used to determine the extent of change in mechanical properties by inducing a mild electromagnetic field onto each sample. Raw data from strain gages was processed using commercial software (Signo) and Excel spreadsheet. It is of particular interest to determine whether the mechanical properties of binder systems can be manipulated by adding ferrous or Magnetostrictive particulates. Data collected from the Split Hopkinson Pressure bar indicate changes in the Mechanical Stress-Strain curves and suggest that the impedance of a binder system can be altered by means of a magnetic field.
Strained Si engineering for nanoscale MOSFETs
International Nuclear Information System (INIS)
Park, Jea-Gun; Lee, Gon-Sub; Kim, Tae-Hyun; Hong, Seuck-Hoon; Kim, Seong-Je; Song, Jin-Hwan; Shim, Tae-Hun
2006-01-01
We have revealed a strain relaxation mechanism for strained Si grown on a relaxed SiGe-on-insulator structure fabricated by the bonding, dislocation sink, or condensation method. Strain relaxation for both the bonding and dislocation sink methods was achieved by grading the Ge concentration; in contrast, the relaxation for the condensation method was achieved through Ge atom condensation during oxidation. In addition, we estimated the surface roughness and threading-dislocation pit density for relaxed SiGe layer fabricated by the bonding, dislocation sink, or condensation method. The surface roughness and threading-dislocation pit density for the bonding, dislocation sink, and condensation methods were 2.45, 0.46, and 0.40 nm and 5.0 x 10 3 , 9 x 10 3 , and 0, respectively. In terms of quality and cost-effectiveness, the condensation method was superior to the bonding and dislocation sink methods for forming strained Si on a relaxed SiGe-on-insulator structure
Review of strain buckling: analysis methods
International Nuclear Information System (INIS)
Moulin, D.
1987-01-01
This report represents an attempt to review the mechanical analysis methods reported in the literature to account for the specific behaviour that we call buckling under strain. In this report, this expression covers all buckling mechanisms in which the strains imposed play a role, whether they act alone (as in simple buckling under controlled strain), or whether they act with other loadings (primary loading, such as pressure, for example). Attention is focused on the practical problems relevant to LMFBR reactors. The components concerned are distinguished by their high slenderness ratios and by rather high thermal levels, both constant and variable with time. Conventional static buckling analysis methods are not always appropriate for the consideration of buckling under strain. New methods must therefore be developed in certain cases. It is also hoped that this review will facilitate the coding of these analytical methods to aid the constructor in his design task and to identify the areas which merit further investigation
Physical nature of strain rate sensitivity of metals and alloys at high strain rates
Borodin, E. N.; Gruzdkov, A. A.; Mayer, A. E.; Selyutina, N. S.
2018-04-01
The role of instabilities of plastic flow at plastic deformation of various materials is one of the important cross-disciplinary problems which is equally important in physics, mechanics and material science. The strain rate sensitivities under slow and high strain rate conditions of loading have different physical nature. In the case of low strain rate, the sensitivity arising from the inertness of the defect structures evolution can be expressed by a single parameter characterizing the plasticity mechanism. In our approach, this is the value of the characteristic relaxation time. In the dynamic case, there are additional effects of “high-speed sensitivity” associated with the micro-localization of the plastic flow near the stress concentrators. In the frames of mechanical description, this requires to introduce additional strain rate sensitivity parameters, which is realized in numerous modifications of Johnson–Cook and Zerilli–Armstrong models. The consideration of both these factors is fundamental for an adequate description of the problems of dynamic deformation of highly inhomogeneous metallic materials such as steels and alloys. The measurement of the dispersion of particle velocities on the free surface of a shock-loaded material can be regarded as an experimental expression of the effect of micro-localization. This is also confirmed by our results of numerical simulation of the propagation of shock waves in a two-dimensional formulation and analytical estimations.
Directory of Open Access Journals (Sweden)
Waltman Thomas J
2010-09-01
Full Text Available Abstract Background Echocardiographic evaluation of left ventricular (LV strain and strain rate (SR by 2D speckle tracking may be useful tools to assess chronic thromboembolic pulmonary hypertension (CTEPH severity as well as response to successful pulmonary thromboendarterectomy (PTE. Methods We evaluated 30 patients with CTEPH before and after PTE using 2D speckle tracking measurements of LV radial and circumferential strain and SR in the short axis, and correlated the data with right heart catheterization (RHC. Results PTE resulted in a decrease in mean PA pressure (44 ± 15 to 29 ± 9 mmHg, decrease in PVR (950 ± 550 to 31 ± 160 [dyne-sec]/cm5, and an increase in cardiac output (3.9 ± 1.0 to 5.0 ± 1.0 L/min, p change in circumferential strain and change in posterior wall radial strain correlated moderately well with changes in PVR, mean PA pressure and cardiac output (r = 0.69, 0.76, and 0.51 for circumferential strain [p Conclusions LV circumferential and posterior wall radial strain change after relief of pulmonary arterial obstruction in patients with CTEPH, and these improvements occur rapidly. These changes in LV strain may reflect effects from improved LV diastolic filling, and may be useful non-invasive markers of successful PTE.
Strain comparisons in aquaculture species: a manual
Ponzoni, R.W.; James, J.W.; Nguyen, N.H.; Mekkawy, W.; Khaw, H.L.
2013-01-01
When different strains or breeds of a particular species are available, the best choice is seldom immediately obvious for producers. Scientists are also interested in the relative performance of different strains because it provides a basis for recommendations to producers and it often stimulates the conduct of work aimed at unraveling the underlying biological mechanisms involved in the expression of such differences. Hence, strain or breed comparisons of some sort are frequently conducted. ...
Genotypic comparison of Pantoea agglomerans plant and clinical strains
Directory of Open Access Journals (Sweden)
Frey Jürg E
2009-09-01
Full Text Available Abstract Background Pantoea agglomerans strains are among the most promising biocontrol agents for a variety of bacterial and fungal plant diseases, particularly fire blight of apple and pear. However, commercial registration of P. agglomerans biocontrol products is hampered because this species is currently listed as a biosafety level 2 (BL2 organism due to clinical reports as an opportunistic human pathogen. This study compares plant-origin and clinical strains in a search for discriminating genotypic/phenotypic markers using multi-locus phylogenetic analysis and fluorescent amplified fragment length polymorphisms (fAFLP fingerprinting. Results Majority of the clinical isolates from culture collections were found to be improperly designated as P. agglomerans after sequence analysis. The frequent taxonomic rearrangements underwent by the Enterobacter agglomerans/Erwinia herbicola complex may be a major problem in assessing clinical associations within P. agglomerans. In the P. agglomerans sensu stricto (in the stricter sense group, there was no discrete clustering of clinical/biocontrol strains and no marker was identified that was uniquely associated to clinical strains. A putative biocontrol-specific fAFLP marker was identified only in biocontrol strains. The partial ORF located in this band corresponded to an ABC transporter that was found in all P. agglomerans strains. Conclusion Taxonomic mischaracterization was identified as a major problem with P. agglomerans, and current techniques removed a majority of clinical strains from this species. Although clear discrimination between P. agglomerans plant and clinical strains was not obtained with phylogenetic analysis, a single marker characteristic of biocontrol strains was identified which may be of use in strain biosafety determinations. In addition, the lack of Koch's postulate fulfilment, rare retention of clinical strains for subsequent confirmation, and the polymicrobial nature of P
Strain-based failure criteria for steel containments
International Nuclear Information System (INIS)
Fanous, F.; Greimann, L.F.
1989-01-01
The Containment Integrity Division of the Sandia National Laboratories (Sandia) has been conducting a program to evaluate the performance of containment buildings with internal pressure. Sandia has suggested that in the absence of leakage past penetrations, containment buildings will fail by rupturing after large plastic strains are developed up to ultimate strain of the material. This paper represents a portion of work conducted at Ames Laboratory for Sandia, the objective of which was to identify fabrication details that may affect the performance of a containment building. Construction drawings for nine steel containment buildings were surveyed, and several significant strain concentration regions were identified by using recommendations from Sandia and Section NE-3217 of the ASME Boiler and Pressure Vessel Code. These following regions were identified as: eccentricities in stiffener patterns around penetrations, eccentricities in containment shell middle surface, flat plate covers used on spare penetrations, containment base connection details, and containment heads. Examples of each of these regions were analyzed by the finite-element method, by simplified equations or both. In the case of middle surface eccentricities, the strains were found to be self-limiting. Even though flat plates have primary strains, they are typically designed so as not to control. Bolts in the base connection have primary strains and may control. The circumferential compressive strains introduced at the knuckle during buckling of the containment head grow as the pressure increases, but are somewhat restricted by the meridional tension. Finally, three analysis techniques and their associated failure criteria for the analysis of containment strength are introduced. (orig.)
Assessment of mechanical strain in the intact plantar fascia.
Clark, Ross A; Franklyn-Miller, Andrew; Falvey, Eanna; Bryant, Adam L; Bartold, Simon; McCrory, Paul
2009-09-01
A method of measuring tri-axial plantar fascia strain that is minimally affected by external compressive force has not previously been reported. The purpose of this study was to assess the use of micro-strain gauges to examine strain in the different axes of the plantar fascia. Two intact limbs from a thawed, fresh-frozen cadaver were dissected, and a combination of five linear and one three-way rosette gauges were attached to the fascia of the foot and ankle. Strain was assessed during two trials, both consisting of an identical controlled, loaded dorsiflexion. An ICC analysis of the results revealed that the majority of gauge placement sites produced reliable measures (ICC>0.75). Strain mapping of the plantar fascia indicates that the majority of the strain is centrally longitudinal, which provides supportive evidence for finite element model analysis. Although micro-strain gauges do possess the limitation of calibration difficulty, they provide a repeatable measure of fascial strain and may provide benefits in situations that require tri-axial assessment or external compression.
Consumer perceptions of strain differences in Cannabis aroma.
Directory of Open Access Journals (Sweden)
Avery N Gilbert
Full Text Available The smell of marijuana (Cannabis sativa L. is of interest to users, growers, plant breeders, law enforcement and, increasingly, to state-licensed retail businesses. The numerous varieties and strains of Cannabis produce strikingly different scents but to date there have been few, if any, attempts to quantify these olfactory profiles directly. Using standard sensory evaluation techniques with untrained consumers we have validated a preliminary olfactory lexicon for dried cannabis flower, and characterized the aroma profile of eleven strains sold in the legal recreational market in Colorado. We show that consumers perceive differences among strains, that the strains form distinct clusters based on odor similarity, and that strain aroma profiles are linked to perceptions of potency, price, and smoking interest.
Consumer perceptions of strain differences in Cannabis aroma
DiVerdi, Joseph A.
2018-01-01
The smell of marijuana (Cannabis sativa L.) is of interest to users, growers, plant breeders, law enforcement and, increasingly, to state-licensed retail businesses. The numerous varieties and strains of Cannabis produce strikingly different scents but to date there have been few, if any, attempts to quantify these olfactory profiles directly. Using standard sensory evaluation techniques with untrained consumers we have validated a preliminary olfactory lexicon for dried cannabis flower, and characterized the aroma profile of eleven strains sold in the legal recreational market in Colorado. We show that consumers perceive differences among strains, that the strains form distinct clusters based on odor similarity, and that strain aroma profiles are linked to perceptions of potency, price, and smoking interest. PMID:29401526
Apt strain measurement technique for impulsive loading applications
International Nuclear Information System (INIS)
Nanda, Soumya Ranjan; Kulkarni, Vinayak; Sahoo, Niranjan
2017-01-01
The necessity of precise measurement of strain time history for impulsive loading applications has been addressed in the present investigation. Finite element modeling is initially carried out for a hemispherical test model and stress bar assembly to arrive at an appropriate location for strain measurement. In dynamic calibration experiments, strain measurements are performed using two wire and three wire quarter bride arrangements along with half bridge circuit. Usefulness of these arrangements has been verified by analyzing strain signals in time and frequency domains. Comparison of recovered force time histories proved that the half bridge circuit is the most suitable for such applications. Actual shock tube testing of the instrumented hemispherical test model confirmed the applicability of half bridge circuit for short duration strain measurements. (technical note)
Identification and characterisation of potential biofertilizer bacterial strains
Karagöz, Kenan; Kotan, Recep; Dadaşoǧlu, Fatih; Dadaşoǧlu, Esin
2016-04-01
In this study we aimed that isolation, identification and characterizations of PGPR strains from rhizosphere of legume plants. 188 bacterial strains isolated from different legume plants like clover, sainfoin and vetch in Erzurum province of Turkey. These three plants are cultivated commonly in the Erzurum province. It was screen that 50 out of 188 strains can fix nitrogen and solubilize phosphate. These strains were identified via MIS (Microbial identification system). According to MIS identification results, 40 out of 50 strains were identified as Bacillus, 5 as Pseudomonas, 3 as Paenibacillus, 1 as Acinetobacter, 1 as Brevibacterium. According to classical test results, while the catalase test result of all isolates are positive, oxidase, KOH and starch hydrolysis rest results are variable.
Strain Dependence of Photoluminescense of Individual Carbon Nanotubes
Nikolaev, Pavel N.; Leeuw, Tonya K.; Tsyboulski, Dmitri A.; Bachilo, Sergei M.; Weisman, Bruce; Arepalli, Sivaram
2007-01-01
We have investigated strain dependence of photoluminescense (PL) spectra of single wall carbon nanotubes (SWNT). Nanotubes were sparsely dispersed in a thin PMMA film applied to acrylic bar, and strained in both compression and extension by bending this bar in either direction in a homebuilt four-point bending rig. The average surface strain was measured with high accuracy by a resistive strain gage applied on top of the film. The near infrared imaging and spectroscopy were performed on the inverted microscope equipped with high numerical aperture reflective objective lens and InGaAs CCD cameras. PL was excited with a diode laser at either 658, 730 or 785 nm, linearly polarized in the direction of the strain. We were able to measure (n,m) types and orientation of individual nanotubes with respect to strain direction and strain dependence of their PL maxima. It was found that PL peak shifts with respect to the values measured in SDS micelles are a sum of three components. First, a small environmental shift due to difference in the dielectric constant of the surrounding media, that is constant and independent of the nanotube type. Second, shift due to isotropic compression of the film during drying. Third, shifts produced by the uniaxial loading of the film in the experiment. Second and third shifts follow expression based on the first-order expansion of the TB hamiltonian. Their magnitude is proportional to the nanotube chiral angle and strain, and direction is determined by the nanotube quantum number. PL strain dependence measured for a number of various nanotube types allows to estimate TB carbon-carbon transfer integral.
Long term strain behavior of PMMA based polymer optical fibers
DEFF Research Database (Denmark)
Bundalo, Ivan-Lazar; Nielsen, Kristian; Woyessa, Getinet
2015-01-01
We are reporting on the viscoelasticity of PMMA based Fiber Bragg Grating (FBG) strain sensors when exposed to repeated sequences of long term strain and relaxation with various duty-cycles. In terms of the FBG wavelength and how it follows the strain cycle, we have shown that in the small strain...... regime (up to 1%) an elastic-dominated fast relaxing range, which is followed by a mainly viscous relaxation, depends both on the strain level and on the strain duration. For a small ratio of the strain-relax durations, this fast relaxation range stays almost the same. However, with increasing strain...... duration, for the same relaxation time, this range will be shortened, which might influence the sensing capabilities of the fiber sensor....
Estimation of lattice strain in nanocrystalline RuO2 by Williamson-Hall and size-strain plot methods
Sivakami, R.; Dhanuskodi, S.; Karvembu, R.
2016-01-01
RuO2 nanoparticles (RuO2 NPs) have been successfully synthesized by the hydrothermal method. Structure and the particle size have been determined by X-ray diffraction (XRD), scanning electron microscopy (SEM), atomic force microscopy (AFM) and transmission electron microscopy (TEM). UV-Vis spectra reveal that the optical band gap of RuO2 nanoparticles is red shifted from 3.95 to 3.55 eV. BET measurements show a high specific surface area (SSA) of 118-133 m2/g and pore diameter (10-25 nm) has been estimated by Barret-Joyner-Halenda (BJH) method. The crystallite size and lattice strain in the samples have been investigated by Williamson-Hall (W-H) analysis assuming uniform deformation, deformation stress and deformation energy density, and the size-strain plot method. All other relevant physical parameters including stress, strain and energy density have been calculated. The average crystallite size and the lattice strain evaluated from XRD measurements are in good agreement with the results of TEM.
Modeling of a Surface Acoustic Wave Strain Sensor
Wilson, W. C.; Atkinson, Gary M.
2010-01-01
NASA Langley Research Center is investigating Surface Acoustic Wave (SAW) sensor technology for harsh environments aimed at aerospace applications. To aid in development of sensors a model of a SAW strain sensor has been developed. The new model extends the modified matrix method to include the response of Orthogonal Frequency Coded (OFC) reflectors and the response of SAW devices to strain. These results show that the model accurately captures the strain response of a SAW sensor on a Langasite substrate. The results of the model of a SAW Strain Sensor on Langasite are presented
Strain gradient plasticity effects in whisker-reinforced metals
DEFF Research Database (Denmark)
Niordson, Christian Frithiof
2002-01-01
A metal reinforced by fibers in the micron range is studied using the strain gradient plasticity theory of Fleck and Hutchinson (2001). Cell-model analyzes are used to study the influence of the material length parameters numerically. Different higher order boundary conditions are considered...... at the fiber-matrix interface. The results are presented as overall stress-strain curves for the whisker-reinforced metal, and also contour plots of effective plastic strain are shown. The strain gradient plasticity theory predicts a significant stiffening effect when compared to conventional models...
Uniaxial tension test on Rubber at constant true strain rate
Directory of Open Access Journals (Sweden)
Sourne H.L.
2012-08-01
Full Text Available Elastomers are widely used for damping parts in different industrial contexts because of their remarkable dissipation properties. Indeed, they can undergo severe mechanical loading conditions, i.e., high strain rates and large strains. Nevertheless, the mechanical response of these materials can vary from purely rubber-like to glassy depending on the strain rate undergone. Classically, uniaxial tension tests are made in order to find a relation between the stress and the strain in the material at various strain rates. However, even if the strain rate is searched to be constant, it is the nominal strain rate that is considered. Here we develop a test at constant true strain rate, i.e. the strain rate that is experienced by the material. In order to do such a test, the displacement imposed by the machine is an exponential function of time. This test has been performed with a high speed hydraulic machine for strain rates between 0.01/s and 100/s. A specific specimen has been designed, yielding a uniform strain field (and so a uniform stress field. Furthermore, an instrumented aluminum bar has been used to take into account dynamic effects in the measurement of the applied force. A high speed camera enables the determination of strain in the sample using point tracking technique. Using this method, the stress-strain curve of a rubber-like material during a loading-unloading cycle has been determined, up to a stretch ratio λ = 2.5. The influence of the true strain rate both on stiffness and on dissipation of the material is then discussed.
Visual Measurement of Suture Strain for Robotic Surgery
Directory of Open Access Journals (Sweden)
John Martell
2011-01-01
Full Text Available Minimally invasive surgical procedures offer advantages of smaller incisions, decreased hospital length of stay, and rapid postoperative recovery to the patient. Surgical robots improve access and visualization intraoperatively and have expanded the indications for minimally invasive procedures. A limitation of the DaVinci surgical robot is a lack of sensory feedback to the operative surgeon. Experienced robotic surgeons use visual interpretation of tissue and suture deformation as a surrogate for tactile feedback. A difficulty encountered during robotic surgery is maintaining adequate suture tension while tying knots or following a running anastomotic suture. Displaying suture strain in real time has potential to decrease the learning curve and improve the performance and safety of robotic surgical procedures. Conventional strain measurement methods involve installation of complex sensors on the robotic instruments. This paper presents a noninvasive video processing-based method to determine strain in surgical sutures. The method accurately calculates strain in suture by processing video from the existing surgical camera, making implementation uncomplicated. The video analysis method was developed and validated using video of suture strain standards on a servohydraulic testing system. The video-based suture strain algorithm is shown capable of measuring suture strains of 0.2% with subpixel resolution and proven reliability under various conditions.
Revynthi, A M; Janssen, A; Egas, M
2018-03-01
Many phytoseiid species, including Phytoseiulus persimilis, are known to engage in cannibalism when food is scarce and when there is no possibility to disperse. In nature adult females of P. persimilis are known to disperse when prey is locally depleted. Males, in contrast, are expected to stay and wait for potential mates to mature. During this phase, males can obtain food by cannibalizing. Therefore, we hypothesize that male P. persimilis exhibit a higher tendency to cannibalize than females. Because rearing conditions in the laboratory usually prevent dispersal, prolonged culturing may also affect cannibalistic behavior. We hypothesize that this should especially affect cannibalism by females, because they consume far more food. We tested these hypotheses by comparing males and females from two strains, one of which had been in culture for over 20 years, whereas the other was recently collected from the field. It is known that this predator can discriminate between kin and non-kin and prefers cannibalizing the latter, hence to construct lines with high relatedness we created isofemale lines of these two original strains. We subsequently tested to what extent the adult females and males of the original strains and the isofemale lines cannibalized conspecific larvae from the same strain/line in a closed system. Relatedness with the victims did not affect cannibalistic behavior, but males engaged more often in cannibalism than females, and females of the laboratory strain engaged more in cannibalism than those of the field strain, both in agreement with our ideas. We hypothesize that the difference in cannibalism between the two genders will increase when they have the alternative to disperse.
Kinases of two strains of Mycoplasma hyopneumoniae and a strain of Mycoplasma synoviae: an overview
Directory of Open Access Journals (Sweden)
Alexandre Melo Bailão
2007-01-01
Full Text Available Mycoplasma synoviae and Mycoplasma hyopneumoniae are wall-less eubacteria belonging to the class of Mollicutes. These prokaryotes have a reduced genome size and reduced biosynthetic machinery. They cause great losses in animal production. M. synoviae is responsible for an upper respiratory tract disease of chickens and turkeys. M. hyopneumoniae is the causative agent of enzootic pneumonia in pigs. The complete genomes of these organisms showed 17 ORFs encoding kinases in M. synoviae and 15 in each of the M. hyopneumoniae strain. Four kinase genes were restricted to the avian pathogen while three were specific to the pig pathogen when compared to each other. All deduced kinases found in the non pathogenic strain (J[ATCC25934] were also found in the pathogenic M. hyopneumoniae strain. The enzymes were classified in nine families composing five fold groups.
Corrosion induced strain monitoring through fibre optic sensors
International Nuclear Information System (INIS)
Grattan, S K T; Basheer, P A M; Taylor, S E; Zhao, W; Sun, T; Grattan, K T V
2007-01-01
The use of strain sensors is commonplace within civil engineering. Fibre optic strain sensors offer a number of advantages over the current electrical resistance type gauges. In this paper the use of fibre optic strain sensors and electrical resistance gauges to monitor the production of corrosion by-products has been investigated and reported
Demming, Anna
2013-08-01
A little stress or strain has been known to improve the performance of athletes, actors and of course nanomaterials alike. In fact strain in silicon is now a major engineering tool for improving the performance of devices, and is ubiquitously used in device design and fabrication. Strain engineering alters a material's band structure, a model of electron behaviour that describes how as atoms come together in a solid, their discrete electron orbitals overlap to ultimately give rise to bands of allowed energy levels. In a strained crystal lattice of silicon or silicon germanium the distance between atoms in the lattice is greater than usual and the bands of allowed energy levels change. This July marks 100 years since Bohr submitted his paper 'On the constitution of atoms and molecules' [1] where he describes the structure of the atom in terms of discrete allowed energy levels. The paper was a seminal contribution to the development of quantum mechanics and laid the initial theoretical precepts for band gap engineering in devices. In this issue Nrauda and a collaboration of researchers in Europe and Australia study the growth of defect-free SiGe islands on pre-patterned silicon [2]. They analyse the strain in the islands and determine at what point lattice dislocations set in with a view to informing implementation of strain engineering in devices. The effects of strain on band structure in silicon and germanium were already studied and reported in the 1950s [3, 4]. Since then the increasing focus on nanoscale materials and the hunger for control of electronic properties has prompted further study of strain effects. The increased surface area to volume ratio in nanostructures changes the strain behaviour with respect to bulk materials, and this can also be exploited for handling and fine tuning strain to manipulate material properties. It is perhaps no surprise that graphene, one of the most high-profile materials in current nanotechnology research, has attracted
Regional strain variations in the human patellar tendon.
Pearson, Stephen J; Ritchings, Tim; Mohamed, Azlan S A
2014-07-01
Characteristics of localized tendon strain in vivo are largely unknown. The present study examines local tendon strain between the deep, middle, and surface structures at the proximal and distal aspects of the patellar tendon during ramped isometric contractions. Male subjects (age 28.0 ± 6.3 yr) were examined for patellar tendon excursion (anterior, midsection, and posterior) during ramped isometric voluntary contractions using real-time B-mode ultrasonography and dynamometry. Regional tendon excursion measurements were compared using an automated pixel tracking method. Strain was determined from the tendon delta length normalized to initial/resting segment length. Strain increased from 10% to 100% of force for all regions. Significantly greater mean strain was seen for the anterior proximal region compared to the posterior and mid layer of the tendon (7.5% ± 1.1% vs 3.7% ± 0.5% vs 5.5% ± 1.0%; P < 0.05). Similarly, the distal posterior region showed greater mean strain compared to the mid and anterior regions (7.9% ± 0.6% vs 5.0% ± 0.6% vs 5.4% ± 0.6%; P < 0.05). Relative changes in strain differences from 50% to 100% of force for the proximal region were greatest for the anterior to midline regions (4.6% ± 0.6% and 5.6% ± 0.6%, respectively) and those for the distal region were also greatest for the anterior to midline regions (4.4% ± 0.2% and 5.3% ± 0.2%, respectively). The largest mean strain for the proximal region was at the anterior layer (7.5% ± 1.1%) and that for the distal tendon region was at the posterior layer (7.9% ± 0.9%). This study shows significant regional differences in strain during ramped isometric contractions for the patellar tendon. Lower proximal strains in the posterior tendon compared to the anterior region may be associated with the suggestion of "stress shielding" as an etiological factor in insertional tendinopathy.
Probiotic attributes of autochthonous Lactobacillus rhamnosus strains of human origin.
Pithva, Sheetal; Shekh, Satyamitra; Dave, Jayantilal; Vyas, Bharatkumar Rajiv Manuel
2014-05-01
The study was aimed at evaluating the probiotic potential of indigenous autochthonous Lactobacillus rhamnosus strains isolated from infant feces and vaginal mucosa of healthy female. The survival of the selected strains and the two reference strains (L. rhamnosus GG and L. casei Actimel) was 67-81 % at pH 2 and 70-80 % after passage through the simulated gastrointestinal fluid. These strains are able to grow in the presence of 4 % bile salt, 10 % NaCl, and 0.6 % phenol. The cell surface of L. rhamnosus strains is hydrophilic in nature as revealed by bacterial adhesion to hydrocarbons (BATH) assay. Despite this, L. rhamnosus strains showed mucin adherence, autoaggregation and coaggregation properties that are strain-specific. In addition, they produce bile salt hydrolase (BSH) and β-galactosidase activities. L. rhamnosus strains exhibit antimicrobial activity against food spoilage organisms and gastrointestinal pathogens, as well as Candida and Aspergillus spp. L. rhamnosus strains have similar antibiotic susceptibility pattern, and resistance to certain antibiotics is intrinsic or innate. The strains are neither haemolytic nor producer of biogenic amines such as histamine, putrescine, cadaverine and tyramine. Lyophilized cells of L. rhamnosus Fb exhibited probiotic properties demonstrating potential of the strain for technological suitability and in the preparation of diverse probiotic food formulations.
Energy Technology Data Exchange (ETDEWEB)
Shervin, Shahab; Asadirad, Mojtaba [Department of Mechanical Engineering, University of Houston, Houston, Texas 77204-4006 (United States); Materials Science and Engineering Program, University of Houston, Houston, Texas 77204 (United States); Kim, Seung-Hwan; Ravipati, Srikanth; Lee, Keon-Hwa [Department of Mechanical Engineering, University of Houston, Houston, Texas 77204-4006 (United States); Bulashevich, Kirill [STR Group, Inc., Engels av. 27, P.O. Box 89, 194156, St. Petersburg (Russian Federation); Ryou, Jae-Hyun, E-mail: jryou@uh.edu [Department of Mechanical Engineering, University of Houston, Houston, Texas 77204-4006 (United States); Materials Science and Engineering Program, University of Houston, Houston, Texas 77204 (United States); Texas Center for Superconductivity at the University of Houston (TcSUH), University of Houston, Houston, Texas 77204 (United States)
2015-11-09
This paper presents strain-effect transistors (SETs) based on flexible III-nitride high-electron-mobility transistors (HEMTs) through theoretical calculations. We show that the electronic band structures of InAlGaN/GaN thin-film heterostructures on flexible substrates can be modified by external bending with a high degree of freedom using polarization properties of the polar semiconductor materials. Transfer characteristics of the HEMT devices, including threshold voltage and transconductance, are controlled by varied external strain. Equilibrium 2-dimensional electron gas (2DEG) is enhanced with applied tensile strain by bending the flexible structure with the concave-side down (bend-down condition). 2DEG density is reduced and eventually depleted with increasing compressive strain in bend-up conditions. The operation mode of different HEMT structures changes from depletion- to enchantment-mode or vice versa depending on the type and magnitude of external strain. The results suggest that the operation modes and transfer characteristics of HEMTs can be engineered with an optimum external bending strain applied in the device structure, which is expected to be beneficial for both radio frequency and switching applications. In addition, we show that drain currents of transistors based on flexible InAlGaN/GaN can be modulated only by external strain without applying electric field in the gate. The channel conductivity modulation that is obtained by only external strain proposes an extended functional device, gate-free SETs, which can be used in electro-mechanical applications.
Methods for predicting isochronous stress-strain curves
International Nuclear Information System (INIS)
Kiyoshige, Masanori; Shimizu, Shigeki; Satoh, Keisuke.
1976-01-01
Isochronous stress-strain curves show the relation between stress and total strain at a certain temperature with time as a parameter, and they are drawn up from the creep test results at various stress levels at a definite temperature. The concept regarding the isochronous stress-strain curves was proposed by McVetty in 1930s, and has been used for the design of aero-engines. Recently the high temperature characteristics of materials are shown as the isochronous stress-strain curves in the design guide for the nuclear energy equipments and structures used in high temperature creep region. It is prescribed that these curves are used as the criteria for determining design stress intensity or the data for analyzing the superposed effects of creep and fatigue. In case of the isochronous stress-strain curves used for the design of nuclear energy equipments with very long service life, it is impractical to determine the curves directly from the results of long time creep test, accordingly the method of predicting long time stress-strain curves from short time creep test results must be established. The method proposed by the authors, for which the creep constitution equations taking the first and second creep stages into account are used, and the method using Larson-Miller parameter were studied, and it was found that both methods were reliable for the prediction. (Kako, I.)
Solution hardening and strain hardening at elevated temperatures
International Nuclear Information System (INIS)
Kocks, U.F.
1982-10-01
Solutes can significantly increase the rate of strain hardening; as a consequence, the saturation stress, at which strain hardening tends to cease for a given temperature and strain rate, is increased more than the yield stress: this is the major effect of solutes on strength at elevated temperatures, especially in the regime where dynamic strain-aging occurs. It is shown that local solute mobility can affect both the rate of dynamic recovery and the dislocation/dislocation interaction strength. The latter effect leads to multiplicative solution strengthening. It is explained by a new model based on repeated dislocation unlocking, in a high-temperature limit, which also rationalizes the stress dependence of static and dynamic strain-aging, and may help explain the plateau of the yield stress at elevated temperatures. 15 figures
Establishment and characterization of a hypocatalasemic mouse cell strain
International Nuclear Information System (INIS)
Utsumi, Hiroshi; Tano, Keizo; Hashimoto, Mitsumasa W.; Kodama, Seiji; Watanabe, Hiromitsu
1998-01-01
Contact-inhibited catalase-deficient fibroblast cell strain has been established from the homozygous hypocatalasemic C3H/Cs b mutant mouse. This cell strain has low level of catalase enzyme activity and has normal level of enzyme activities of both glutathione peroxidase and superoxide dismutase. Catalase-deficient C3H/Cs b mutant cell strain is markedly more sensitive to the toxicity of hydrogen peroxide compared to wild-type C3H/Cs a cell strain. In addition, mutant cell strain is sensitive to X-rays and near-UV compared to wild-type cell strain, but shows the same sensitivities to topoisomerase II inhibitors, adriamycin and 4'-(9-acridinylamino) methanesulfon-m-anisidide (m-AMSA), and the DNA cross-linking agents, cis-diamminedichloroplatinum (II) (cis-Pt) and trans-diamminedichloroplatinum (II) (trans-Pt). These cell strains will be of use in the study of the roles which catalase plays in the intracellular prevention of DNA damage induced by oxidative stress. (author)
Directory of Open Access Journals (Sweden)
Hermann Inge-Marie
2010-06-01
Full Text Available Abstract Background Intravesical immunotherapy with Mycobacterium bovis bacillus Calmette-Guérin has been established as the most effective adjuvant treatment for high risk non-muscle-invasive bladder cancer (NMIBC. We investigated the differences between the S4-Jena BCG strain and commercially available BCG strains. We tested the genotypic varieties between S4-Jena and other BCG strains and analysed the effect of the BCG strains TICE and S4-Jena on two bladder cancer cell lines. Results In contrast to commercially available BCG strains the S4-Jena strain shows genotypic differences. Spoligotyping verifies the S4-Jena strain as a BCG strain. Infection with viable S4-Jena or TICE decreased proliferation in the T24 cell line. Additionally, hallmarks of apoptosis were detectable. In contrast, Cal29 cells showed only a slightly decreased proliferation with TICE. Cal29 cells infected with S4-Jena, though, showed a significantly decreased proliferation in contrast to TICE. Concordantly with these results, infection with TICE had no effect on the morphology and hallmarks of apoptosis of Cal29 cells. However, S4-Jena strain led to clearly visible morphological changes and caspases 3/7 activation and PS flip. Conclusions S4-Jena strain has a direct influence on bladder cancer cell lines as shown by inhibition of cell proliferation and induction of apoptosis. The data implicate that the T24 cells are responder for S4-Jena and TICE BCG. However, the Cal29 cells are only responder for S4-Jena and they are non-responder for TICE BCG. S4-Jena strain may represent an effective therapeutic agent for NMIBC.
Strain gauge measurement uncertainties on hydraulic turbine runner blade
International Nuclear Information System (INIS)
Arpin-Pont, J; Gagnon, M; Tahan, S A; Coutu, A; Thibault, D
2012-01-01
Strains experimentally measured with strain gauges can differ from those evaluated using the Finite Element (FE) method. This difference is due mainly to the assumptions and uncertainties inherent to each method. To circumvent this difficulty, we developed a numerical method based on Monte Carlo simulations to evaluate measurement uncertainties produced by the behaviour of a unidirectional welded gauge, its position uncertainty and its integration effect. This numerical method uses the displacement fields of the studied part evaluated by an FE analysis. The paper presents a study case using in situ data measured on a hydraulic turbine runner. The FE analysis of the turbine runner blade was computed, and our numerical method used to evaluate uncertainties on strains measured at five locations with welded strain gauges. Then, measured strains and their uncertainty ranges are compared to the estimated strains. The uncertainty ranges obtained extended from 74 με to 165 με. Furthermore, the biases observed between the median of the uncertainty ranges and the FE strains varied from −36 to 36 με. Note that strain gauge measurement uncertainties depend mainly on displacement fields and gauge geometry.
Strain localisation in granular media
Desrues , Jacques
1984-01-01
This study is devoted to strain localisation in Granular materials. Both experimental and theoretical results have been obtained.The first part of the thesis is a review of the methods and theories about rupture in sols mechanics and more generally, in solid mechanics. The classical framework of Shear Band analysis is presented, and the main results available for different classes of materials are discussed.The second part describes an experimental study of strain localisation in sand specime...
Peri-Implant Strain in an In Vitro Model.
Hussaini, Souheil; Vaidyanathan, Tritala K; Wadkar, Abhinav P; Quran, Firas A Al; Ehrenberg, David; Weiner, Saul
2015-10-01
An in vitro experimental model was designed and tested to determine the influence that peri-implant strain may have on the overall crestal bone. Strain gages were attached to polymethylmethacrylate (PMMA) models containing a screw-type root form implant at sites 1 mm from the resin-implant interface. Three different types of crown superstructures (cemented, 1-screw [UCLA] and 2-screw abutment types) were tested. Loading (1 Hz, 200 N load) was performed using a MTS Mechanical Test System. The strain gage data were stored and organized in a computer for statistical treatment. Strains for all abutment types did not exceed the physiological range for modeling and remodeling of cancellous bone, 200-2500 με (microstrain). For approximately one-quarter of the trials, the strain values were less than 200 με the zone for bone atrophy. The mean microstrain obtained was 517.7 με. In conclusion, the peri-implant strain in this in vitro model did not exceed the physiologic range of bone remodeling under axial occlusal loading.
Standard guide for high-temperature static strain measurement
American Society for Testing and Materials. Philadelphia
1998-01-01
1.1 This guide covers the selection and application of strain gages for the measurement of static strain up to and including the temperature range from 425 to 650°C (800 to 1200°F). This guide reflects some current state-of-the-art techniques in high temperature strain measurement, and will be expanded and updated as new technology develops. 1.2 This practice assumes that the user is familiar with the use of bonded strain gages and associated signal conditioning and instrumentation as discussed in Refs. (1) and (2). The strain measuring systems described are those that have proven effective in the temperature range of interest and were available at the time of issue of this practice. It is not the intent of this practice to limit the user to one of the gage types described nor is it the intent to specify the type of system to be used for a specific application. However, in using any strain measuring system including those described, the proposer must be able to demonstrate the capability of the proposed sy...
Phonon dispersion evolution in uniaxially strained aluminum crystal
Parthasarathy, Ranganathan; Misra, Anil; Aryal, Sitaram; Ouyang, Lizhi
2018-04-01
The influence of loading upon the phonon dispersion of crystalline materials could be highly nonlinear with certain particular trends that depend upon the loading path. In this paper, we have calculated the influence of [100] uniaxial strain on the phonon dispersion and group velocities in fcc aluminum using second moments of position obtained from molecular dynamics (MD) simulation at 300 K. In contrast to nonlinear monotonic variation of both longitudinal and transverse phonon frequencies along the Δ , Λ and Σ lines of the first Brillouin zone under tension, transverse phonon branches along the Λ line show inflection at specific wavevectors when the compressive strain exceeds 5%. Further, the longitudinal group velocities along the high-symmetry Δ line vary non-monotonically with strain, reaching a minimum at 5% compressive strain. Throughout the strain range studied, the equilibrium positions of atoms displace in an affine manner preserving certain static structural symmetry. We attribute the anomalies in the phonon dispersion to the non-affine evolution of second moments of atomic position, and the associated plateauing of force constants under the applied strain path.
Unconventional strain-dependent conductance oscillations in pristine phosphorene.
Ray, S J; Kamalakar, M Venkata
2018-05-16
Phosphorene is a single elemental, two-dimensional semiconductor that has quickly emerged as a high mobility material for transistors and optoelectronic devices. In addition, being a 2D material it can sustain high levels of strain, enabling sensitive modification of its electronic properties. In this paper, we investigate the strain dependent electronic properties of phosphorene nanocrystals. By performing extensive calculations we determine the electrical conductance as a function of uniaxial, as well as biaxial strain stimuli and uncover a unique zone phase diagram. This enables us to uncover conductance oscillations in pristine phosphorene for the first time, by the simple application of strain. We show that such unconventional current-voltage behaviour is tuneable by the nature of strain, and that an additional gate voltage can modulate the amplitude (peak to valley ratio) of the observed phenomena and its switching efficiency. Furthermore, we show that the switching is highly robust against doping and defects. Our detailed results present new leads for innovation in strain based gauging and high-frequency nanoelectronic switches of phosphorene.
Surface instabilities during straining of anisotropic materials
DEFF Research Database (Denmark)
Legarth, Brian Nyvang; Richelsen, Ann Bettina
2006-01-01
The development of instabilities in traction-free surfaces is investigated numerically using a unit cell model. Full finite strain analyses are conducted using isotropic as well as anisotropic yield criteria and both plane strain tension and compression are considered. In the load range of tensio...... of principal overall strain. For other orientations surface instabilities are seen when non-associated plastic flow is taken into account. Compared to tension, smaller compressive deformations are needed in order to initiate a surface instability....
Strain-Level Diversity of Secondary Metabolism in Streptomyces albus
Seipke, Ryan F.
2015-01-01
Streptomyces spp. are robust producers of medicinally-, industrially- and agriculturally-important small molecules. Increased resistance to antibacterial agents and the lack of new antibiotics in the pipeline have led to a renaissance in natural product discovery. This endeavor has benefited from inexpensive high quality DNA sequencing technology, which has generated more than 140 genome sequences for taxonomic type strains and environmental Streptomyces spp. isolates. Many of the sequenced streptomycetes belong to the same species. For instance, Streptomyces albus has been isolated from diverse environmental niches and seven strains have been sequenced, consequently this species has been sequenced more than any other streptomycete, allowing valuable analyses of strain-level diversity in secondary metabolism. Bioinformatics analyses identified a total of 48 unique biosynthetic gene clusters harboured by Streptomyces albus strains. Eighteen of these gene clusters specify the core secondary metabolome of the species. Fourteen of the gene clusters are contained by one or more strain and are considered auxiliary, while 16 of the gene clusters encode the production of putative strain-specific secondary metabolites. Analysis of Streptomyces albus strains suggests that each strain of a Streptomyces species likely harbours at least one strain-specific biosynthetic gene cluster. Importantly, this implies that deep sequencing of a species will not exhaust gene cluster diversity and will continue to yield novelty. PMID:25635820
Biodiversity of Lactobacillus sanfranciscensis strains isolated from five sourdoughs.
Kitahara, M; Sakata, S; Benno, Y
2005-01-01
Five different sourdoughs were investigated for the composition of lactic acid bacteria (LAB) and the biodiversity of Lactobacillus sanfranciscensis strains. A total of 57 strains were isolated from five sourdoughs. Isolated strains were all identified by the 16S rDNA sequence and species-specific primers for L. sanfranciscensis. Results of identification showed that LAB strains were L. sanfranciscensis, Lactobacillus plantarum, Lactobacillus paralimentarius, Lactobacillus fermentum, Lactobacillus pontis, Lactobacillus casei, Weisella confusa and Pediococcus pentosaceus. A total of 21 strains were identified as L. sanfranciscensis and these isolates were detected in all five sourdoughs. Ribotyping was applied to investigate the relationship between intraspecies diversity of L. sanfranciscensis and sourdough. A total of 22 strains of L. sanfranciscensis including L. sanfranciscensis JCM 5668T were compared by ribotyping. The dendrogram of 21 ribotyping patterns showed four clusters, and L. sanfranciscensis JCM 5668T was independent of the others. The different biotypes of L. sanfranciscensis were present in two sourdoughs compared with other three sourdoughs. The LAB compositions of five sourdoughs were different and the relationship between intraspecies diversity of L. sanfranciscensis strains and five sourdoughs was shown by ribotyping. This study demonstrated that ribotyping was useful for distinguishing L. sanfranciscensis strains. A further important result is that the intra-species diversity of L. sanfranciscensis strains seems to be related to the sourdough preparation.
Directory of Open Access Journals (Sweden)
Maria Beatriz Junqueira Borges
1996-08-01
Full Text Available Four virus clones were derived from the Edmonston strain of measles virus by repeated plaque purification. These clones were compared with the vaccine strains Schwarz and CAM-70 in terms of biological activities including plaque formation, hemagglutination, hemolysis and replication in Vero cells and chick embryo fibroblasts (CEF. Two clones of intermediate plaque yielded mixed plaque populations on subcultivation whereas the other two, showing small and large plaque sizes, showed stable plaque phenotypes. The vaccine strains showed consistent homogeneous plaque populations. All the Edmonston clones showed agglutination of monkey erythrocytes in isotonic solution while both vaccine strains hemagglutinated only in the presence of high salt concentrations. Variation in the hemolytic activity was observed among the four clones but no hemolytic activity was detected for the vaccine virus strains. Vaccine strains replicated efficiently both in Vero cells and CEF. All four clones showed efficient replication in Vero cells but different replication profiles in CEF. Two of them replicated efficiently, one was of intermediate efficiency and the other showed no replication in CEF. Two of the clones showed characteristics similar to vaccine strains. One in terms of size and homogeneity of plaques, the other for a low hemolytic activity and both for the efficiency of propagation in CEF.
Directory of Open Access Journals (Sweden)
Hannah R. Chase
2017-06-01
Full Text Available Cronobacter (C. sakazakii is an opportunistic pathogen and has been associated with serious infections with high mortality rates predominantly in pre-term, low-birth weight and/or immune compromised neonates and infants. Infections have been epidemiologically linked to consumption of intrinsically and extrinsically contaminated lots of reconstituted powdered infant formula (PIF, thus contamination of such products is a challenging task for the PIF producing industry. We present the draft genome of C. sakazakii H322, a highly persistent sequence type (ST 83, clonal complex (CC 65, serotype O:7 strain obtained from a batch of non-released contaminated PIF product. The presence of this strain in the production environment was traced back more than 4 years. Whole genome sequencing (WGS of this strain together with four more ST83 strains (PIF production environment-associated confirmed a high degree of sequence homology among four of the five strains. Phylogenetic analysis using microarray (MA and WGS data showed that the ST83 strains were highly phylogenetically related and MA showed that between 5 and 38 genes differed from one another in these strains. All strains possessed the pESA3-like virulence plasmid and one strain possessed a pESA2-like plasmid. In addition, a pCS1-like plasmid was also found. In order to assess the potential in vivo pathogenicity of the ST83 strains, each strain was subjected to infection studies using the recently developed zebrafish embryo model. Our results showed a high (90–100% zebrafish mortality rate for all of these strains, suggesting a high risk for infections and illness in neonates potentially exposed to PIF contaminated with ST83 C. sakazakii strains. In summary, virulent ST83, CC65, serotype CsakO:7 strains, though rarely found intrinsically in PIF, can persist within a PIF manufacturing facility for years and potentially pose significant quality assurance challenges to the PIF manufacturing industry.
Antimicrobial resistance of bacterial strains isolated from avian cellulitis
Directory of Open Access Journals (Sweden)
MM Santos
2014-03-01
Full Text Available Avian cellulitis is an inflammatory process in the subcutaneous tissue, mainly located in the abdomen and thighs. This problem is commonly observed in poultry at slaughter and it is considered one of the major causes of condemnation of carcasses in Brazil. The aim of this study was to perform the microbial isolation of lesions of avian cellulitis from a processing plant located in the State of Goiás in order to analyze antimicrobial resistance by antibiogram test and to detect resistance genes by polymerase chain reaction. A total of 25 samples of avian cellulitis lesions were analyzed, from which 30 bacterial strains were isolated. There were eleven (44% strains of Escherichia coli, nine (36% strains of Staphylococcus epidermidis, seven (28% strains of Proteus mirabilis and three (12% strains of Manheimiahaemolytica. The antibiogram test showed that all strains were resistant to at least one antimicrobial. The gene of antimicrobial resistance tetB was detected in E. coli, S. epidermidis and P. mirabilis strains, and was the most frequently observed gene. The gene of antimicrobial resistance Sul1 was detected in all bacterial species, while tetA was found in E. coli and S. epidermidis strains, SHV in E. coli strains, S. epidermidis and P. mirabilis,and cat1 in one P. mirabilis strain. The results suggest a potential public health hazard due to the ability of these microorganisms to transmit antimicrobial resistancegenes to other microorganisms present in the intestinal tract of humans and animals, which may affect clinical-medical usage of these drugs.
A NEW STRAIN OF TRANSMISSIBLE LEUCEMIA IN FOWLS (STRAIN H).
Ellermann, V
1921-03-31
1. A new strain of fowl leucosis has been transmitted through twelve generations of fowls. 2. An increase in virulence was observed during its passage. This was shown in a shortening of the interval between inoculation and death. The increase in virulence does not affect the number of successful inoculations, which remains approximately constant in from 20 to 40 per cent of the birds employed. 3. As with former strains, the disease manifests itself in various forms; i.e., myeloid and intravascular lymphoid types. A single lymphatic case was observed. 4. In several intravascular cases a diminution in the hemolytic power of the serum was established. This phenomenon was absent in a number of myeloid cases. 5. Active immunization cannot be produced by means of the subcutaneous injection of virulent material. 6. The finding of previous experiments that the virus is filterable has been confirmed. 7. The inoculation of human leucemic material into fowls gave negative results.
Plastic strain caused by contraction of pores in polycrystalline graphites
International Nuclear Information System (INIS)
Ioka, Ikuo; Yoda, Shinichi; Konishi, Takashi.
1989-01-01
The effects of porosity on mechanical properties and deformation behavior of four isotropic polycrystalline graphites were studied. The pore size distributions of the graphites were measured using a conventional mercury penetration technique. The average pore radius of ISO-88 graphite was about one-tenth of that of ISEM-1, IG-11 or IG-15 graphites. Young's modulus of the graphites decreased with increasing porosity. The stress-strain curve of each graphite was measured in its lateral and axial directions. Young's modulus of graphite decreased with increasing load. The plastic strain at a given compressive load was calculated from the stress-strain curve and the initial gradient of the unloading curve at the load. The ratio of lateral plastic strain to axial plastic strain for the graphites was less than 0.5, indicating that the volume of the graphites decreased during compressive loading. By assuming that the volume change was caused by contraction of pores, plastic strain associated with contraction of pores was calculated from the axial plastic strain and lateral plastic strain by slips along the basal planes. The plastic strain increased with increasing axial plastic strain and porosity of graphite. (author)
Fumonisin and Ochratoxin Production in Industrial Aspergillus niger Strains
Frisvad, Jens C.; Larsen, Thomas O.; Thrane, Ulf; Meijer, Martin; Varga, Janos; Samson, Robert A.; Nielsen, Kristian F.
2011-01-01
Aspergillus niger is perhaps the most important fungus used in biotechnology, and is also one of the most commonly encountered fungi contaminating foods and feedstuffs, and occurring in soil and indoor environments. Many of its industrial applications have been given GRAS status (generally regarded as safe). However, A. niger has the potential to produce two groups of potentially carcinogenic mycotoxins: fumonisins and ochratoxins. In this study all available industrial and many non-industrial strains of A. niger (180 strains) as well as 228 strains from 17 related black Aspergillus species were examined for mycotoxin production. None of the related 17 species of black Aspergilli produced fumonisins. Fumonisins (B2, B4, and B6) were detected in 81% of A. niger, and ochratoxin A in 17%, while 10% of the strains produced both mycotoxins. Among the industrial strains the same ratios were 83%, 33% and 26% respectively. Some of the most frequently used strains in industry NRRL 337, 3112 and 3122 produced both toxins and several strains used for citric acid production were among the best producers of fumonisins in pure agar culture. Most strains used for other biotechnological processes also produced fumonisins. Strains optimized through random mutagenesis usually maintained their mycotoxin production capability. Toxigenic strains were also able to produce the toxins on media suggested for citric acid production with most of the toxins found in the biomass, thereby questioning the use of the remaining biomass as animal feed. In conclusion it is recommended to use strains of A. niger with inactive or inactivated gene clusters for fumonisins and ochratoxins, or to choose isolates for biotechnological uses in related non-toxigenic species such as A. tubingensis, A. brasiliensis, A vadensis or A. acidus, which neither produce fumonisins nor ochratoxins. PMID:21853139
El-Ashram, Saeed; Yin, Qing; Liu, Hongbin; Al Nasr, Ibrahim; Liu, Xianyong; Suo, Xun; Barta, John
2015-01-01
Two immunologically distinct strains of E. maxima were examined in this study: the M6 strain and the Guelph strain. The differential expression between the sporozoites of the two strains of E. maxima was determined by image analysis of 100 μg of protein from each strain separated by standard one- and conventional two-dimensional polyacrylamide gel electrophoresis. In addition to differences in both molecular weight and the electrophoretic mobility, differences in the intensity of polypeptide bands for example, GS 136.4 and M6 169 were explored. Pooled gels were prepared from each strain. A representative 2D-PAGE gel spanning a non-linear pH range of 3-10 of E. maxima strain M6 consisted of approximately 694 polypeptide spots with about 67 (9.6%) of the polypeptide spots being unique relative to the other strain. E. maxima strain GS had about 696 discernable polypeptide spots with 69 spots (9.9%) that differed from those of the M6 strain. In-depth characterization of the variable polypeptide spots; unique polypeptide spots (absence or presence) and shared polypeptide spots with modifications may lead to novel vaccine target in the form of multi-component, multi-stage, multi-immunovariant strains, multi-species subunit vaccine, and diagnostic probe for E. maxima.
Job strain and the risk of stroke
DEFF Research Database (Denmark)
Fransson, Eleonor I; Nyberg, Solja T; Heikkilä, Katriina
2015-01-01
BACKGROUND AND PURPOSE: Psychosocial stress at work has been proposed to be a risk factor for cardiovascular disease. However, its role as a risk factor for stroke is uncertain. METHODS: We conducted an individual-participant-data meta-analysis of 196 380 males and females from 14 European cohort...... studies to investigate the association between job strain, a measure of work-related stress, and incident stroke. RESULTS: In 1.8 million person-years at risk (mean follow-up 9.2 years), 2023 first-time stroke events were recorded. The age- and sex-adjusted hazard ratio for job strain relative to no job....... CONCLUSION: Job strain may be associated with an increased risk of ischemic stroke, but further research is needed to determine whether interventions targeting job strain would reduce stroke risk beyond existing preventive strategies....
The radiographic observation of the cervical strain
International Nuclear Information System (INIS)
Rhee, Chung Sik
1972-01-01
A total of 100 cases of cervical disorders were analysed of clinical signs and symptoms. The cervical strain is proved by the loss of normal lordotic curvature of the cervical spinal column on the lateral x-ray film in Ewha University Hospital from January, 1970 to december 1971 with the following results. 1. The 53 cervical strain was diagnosed in radiographic study for its abnormal locations. The hyperextension with abnormal curve is twice more after than hyperflection type. 2. The most frequent location of the cervical strain is demonstrated in the 4-6 th cervical spinal bodies (80%). 3. Most pronounced symptoms of cervical strain are local tenderness (40%), limitation of motion (17%) and radiating pain (15%). 4. The ratio of the sex incidence of male female was 3:2
The radiographic observation of the cervical strain
Energy Technology Data Exchange (ETDEWEB)
Rhee, Chung Sik [Ewha Womans University College of Medicine, Seoul (Korea, Republic of)
1972-12-15
A total of 100 cases of cervical disorders were analysed of clinical signs and symptoms. The cervical strain is proved by the loss of normal lordotic curvature of the cervical spinal column on the lateral x-ray film in Ewha University Hospital from January, 1970 to december 1971 with the following results. 1. The 53 cervical strain was diagnosed in radiographic study for its abnormal locations. The hyperextension with abnormal curve is twice more after than hyperflection type. 2. The most frequent location of the cervical strain is demonstrated in the 4-6 th cervical spinal bodies (80%). 3. Most pronounced symptoms of cervical strain are local tenderness (40%), limitation of motion (17%) and radiating pain (15%). 4. The ratio of the sex incidence of male female was 3:2.
Evolution and Strain Variation in BCG
Abdallah, Abdallah
2017-11-07
BCG vaccines were derived by in vitro passage, during the years 1908–1921, at the Pasteur Institute of Lille. Following the distribution of stocks of BCG to vaccine production laboratories around the world, it was only a few decades before different BCG producers recognized that there were variants of BCG, likely due to different passaging conditions in the different laboratories. This ultimately led to the lyophilization of stable BCG products in the 1950s and 1960s, but not before considerable evolution of the different BCG strains had taken place. The application of contemporary research methodologies has now revealed genomic, transcriptomic and proteomic differences between BCG strains. These molecular differences in part account for phenotypic differences in vitro between BCG strains, such as their variable secretion of antigenic proteins. Yet, the relevance of BCG variability for immunization policy remains elusive. In this chapter we present an overview of what is known about BCG evolution and its resulting strain variability, and provide some speculation as to the potential relevance for a vaccine given to over 100 million newborns each year.
International Nuclear Information System (INIS)
Ghosh, Ashmita; Khanra, Saumyakanti; Mondal, Madhumanti; Halder, Gopinath; Tiwari, O.N.; Saini, Supreet; Bhowmick, Tridib Kumar; Gayen, Kalyan
2016-01-01
Highlights: • Sample collection, isolation and identification to obtain a pure microalgal species. • Isolation of microalgal strains worldwide based on continent and habitat. • Genetic engineering tools for enhanced production of biodiesel and value added chemicals. • Cultivation systems for genetically modified strain. - Abstract: Microalgae and cyanobacteria are promising sources of biodiesel because of their high oil content (∼10 fold higher) and shorter cultivation time (∼4 fold lesser) than conventional oil producing territorial plants (e.g., soybean, corn and jatropha). These organisms also provide source of several valuable natural chemicals including pigments, food supplements like eicosapentanoic acid [EPA], decosahexaenoic acid [DHA] and vitamins. In addition, many cellular components of these organisms are associated with therapeutic properties like antioxidant, anti-inflammatory, immunostimulating, and antiviral. Isolation and identification of high-yielding strains with the faster growth rate is the key for successful implementation of algal biodiesel (or other products) at a commercial level. A number of research groups in Europe, America, and Australia are thus extensively involved in exploration of novel microalgal strain. Further, genetic engineering provides a tool to engineer the native strain resulting in transgenic strain with higher yields. Despite these efforts, no consensus has yet been reached so far in zeroing on the best microalgal strain for sustainable production of biofuel at reasonable cost. The search for novel microalgal strain and transgenesis of microalgae, are continuing side by side with the hope of commercial scale production of microalgae biofuel in near future. However, no consolidated review report exists which guides to isolate and identify a uncontaminated microalgal strain along with their transgenesis. The present review is focused on: (i) key factors for sample collection, isolation, and identification to
Directory of Open Access Journals (Sweden)
Vienna R Brown
Full Text Available Francisella tularensis is a highly virulent bacterium that is capable of causing severe disease (tularemia in a wide range of species. This organism is characterized into two distinct subspecies: tularensis (type A and holarctica (type B which vary in several crucial ways, with some type A strains having been found to be considerably more virulent in humans and laboratory animals. Cottontail rabbits have been widely implicated as a reservoir species for this subspecies; however, experimental inoculation in our laboratory revealed type A organisms to be highly virulent, resulting in 100% mortality following challenge with 50-100 organisms. Inoculation of cottontail rabbits with the same number of organisms from type B strains of bacteria was found to be rarely lethal and to result in a robust humoral immune response. The objective of this study was to characterize the protection afforded by a prior challenge with type B strains against a later inoculation with a type A strain in North American cottontail rabbits (Sylvilagus spp. Previous infection with a type B strain of organism was found to lengthen survival time and in some cases prevent death following inoculation with a type A2 strain of F. tularensis. In contrast, inoculation of a type A1b strain was uniformly lethal in cottontail rabbits irrespective of a prior type B inoculation. These findings provide important insight about the role cottontail rabbits may play in environmental maintenance and transmission of this organism.
International Nuclear Information System (INIS)
Wang, S.Q.; Liu, J.H.; Chen, D.L.
2014-01-01
Highlights: • Only stage III hardening occurs after yielding in Ti–6Al–4V/Ti17 dissimilar joints. • Voce stress and strength of the joints increase with increasing strain rate. • With increasing strain rate, hardening capacity and strain hardening exponent decrease. • With increasing temperature, hardening capacity and strain hardening exponent increase. • Strain rate sensitivity of the joints decreases as the true strain increases. - Abstract: The aim of this study was to evaluate the influence of strain rate and temperature on the tensile properties, strain hardening behavior, strain rate sensitivity, and fracture characteristics of electron beam welded (EBWed) dissimilar joints between Ti–6Al–4V and Ti17 (Ti–5Al–4Mo–4Cr–2Sn–2Zr) titanium alloys. The welding led to significant microstructural changes across the joint, with hexagonal close-packed martensite (α′) and orthorhombic martensite (α″) in the fusion zone (FZ), α′ in the heat-affected zone (HAZ) on the Ti–6Al–4V side, and coarse β in the HAZ on the Ti17 side. A distinctive asymmetrical hardness profile across the dissimilar joint was observed with the highest hardness in the FZ and a lower hardness on the Ti–6Al–4V side than on the Ti17 side, where a soft zone was present. Despite a slight reduction in ductility, the yield strength (YS) and ultimate tensile strength (UTS) of the joints lay in-between the two base metals (BMs) of Ti–6Al–4V and Ti17, with the Ti17 alloy having a higher strength. While the YS, UTS, and Voce stress of the joints increased, both hardening capacity and strain hardening exponent decreased with increasing strain rate or decreasing temperature. Stage III hardening occurred in the joints after yielding. The hardening rate was strongly dependent on the strain rate and temperature. As the strain rate increased or temperature decreased, the strain hardening rate increased at a given true stress. The strain rate sensitivity evaluated via
The importance of strain localisation in shear zones
Bons, Paul D.; Finch, Melanie; Gomez-Rivas, Enrique; Griera, Albert; Llorens, Maria-Gema; Steinbach, Florian; Weikusat, Ilka
2016-04-01
The occurrence of various types of shear bands (C, C', C'') in shear zones indicate that heterogeneity of strain is common in strongly deformed rocks. However, the importance of strain localisation is difficult to ascertain if suitable strain markers are lacking, which is usually the case. Numerical modelling with the finite-element method has so far not given much insight in the development of shear bands. We suggest that this is not only because the modelled strains are often not high enough, but also because this technique (that usually assumes isotropic material properties within elements) does not properly incorporate mineral deformation behaviour. We simulated high-strain, simple-shear deformation in single- and polyphase materials with a full-field theory (FFT) model coupled to the Elle modelling platform (www.elle.ws; Lebensohn 2001; Bons et al. 2008). The FFT-approach simulates visco-plastic deformation by dislocation glide, taking into account the different available slip systems and their critical resolved shear stresses in relations to the applied stresses. Griera et al. (2011; 2013) have shown that this approach is particularly well suited for strongly anisotropic minerals, such as mica and ice Ih (Llorens 2015). We modelled single- and polyphase composites of minerals with different anisotropies and strengths, roughly equivalent to minerals such as ice Ih, mica, quartz and feldspar. Single-phase polycrystalline aggregates show distinct heterogeneity of strain rate, especially in case of ice Ih, which is mechanically close to mica (see also Griera et al. 2015). Finite strain distributions are heterogeneous as well, but the patterns may differ from that of the strain rate distribution. Dynamic recrystallisation, however, usually masks any strain and strain rate localisation (Llorens 2015). In case of polyphase aggregates, equivalent to e.g. a granite, we observe extensive localisation in both syn- and antithetic shear bands. The antithetic shear bands
Prediction (early recognition) of emerging flu strain clusters
Li, X.; Phillips, J. C.
2017-08-01
Early detection of incipient dominant influenza strains is one of the key steps in the design and manufacture of an effective annual influenza vaccine. Here we report the most current results for pandemic H3N2 flu vaccine design. A 2006 model of dimensional reduction (compaction) of viral mutational complexity derives two-dimensional Cartesian mutational maps (2DMM) that exhibit an emergent dominant strain as a small and distinct cluster of as few as 10 strains. We show that recent extensions of this model can detect incipient strains one year or more in advance of their dominance in the human population. Our structural interpretation of our unexpectedly rich 2DMM involves sialic acid, and is based on nearly 6000 strains in a series of recent 3-year time windows. Vaccine effectiveness is predicted best by analyzing dominant mutational epitopes.
Strained Si/SiGe MOS transistor model
Directory of Open Access Journals (Sweden)
Tatjana Pešić-Brđanin
2009-06-01
Full Text Available In this paper we describe a new model of surfacechannel strained-Si/SiGe MOSFET based on the extension of non-quasi-static (NQS circuit model previously derived for bulk-Si devices. Basic equations of the NQS model have been modified to account for the new physical parameters of strained-Si and relaxed-SiGe layers. From the comparisons with measurements, it is shown that a modified NQS MOS including steady-state self heating can accurately predict DC characteristics of Strained Silicon MOSFETs.
Self-sensing concrete-filled FRP tubes using FBG strain sensors
Yan, Xin; Li, Hui
2007-07-01
Concrete-filled fiber-reinforced polymer (FRP) tube is a type of newly developed structural column. It behaves brittle failure at its peak strength, and so the health monitoring on the hoop strain of the FRP tube is essential for the life cycle safety of the structure. Herein, three types of FRP tubes including 5-ply tube, 2-ply tube with local reinforcement and FRP-steel composite tube were embedded with the optic fiber Bragg grating (FBG) strain sensors in the inter-ply of FRP or the interface between FRP and steel in the middle height and the hoop direction. The compressive behaviors of the concrete-filled FRP tubes were experimentally studied. The hoop strains of the FRP tubes were recorded in real time using the embedded FBG strain sensors as well as the embedded or surface electric resistance strain gauges. Results indicated that the FBG strain sensors can faithfully record the hoop strains of the FRP tubes in compression as compared with the embedded or surface electric resistance strain gauges, and the strains recorded can reach more than μɛ.
Oh, Youkeun K; Kreinbrink, Jennifer L; Wojtys, Edward M; Ashton-Miller, James A
2012-04-01
Anterior cruciate ligament (ACL) injuries most frequently occur under the large loads associated with a unipedal jump landing involving a cutting or pivoting maneuver. We tested the hypotheses that internal tibial torque would increase the anteromedial (AM) bundle ACL relative strain and strain rate more than would the corresponding external tibial torque under the large impulsive loads associated with such landing maneuvers. Twelve cadaveric female knees [mean (SD) age: 65.0 (10.5) years] were tested. Pretensioned quadriceps, hamstring, and gastrocnemius muscle-tendon unit forces maintained an initial knee flexion angle of 15°. A compound impulsive test load (compression, flexion moment, and internal or external tibial torque) was applied to the distal tibia while recording the 3D knee loads and tibofemoral kinematics. AM-ACL relative strain was measured using a 3 mm DVRT. In this repeated measures experiment, the Wilcoxon signed-rank test was used to test the null hypotheses with p < 0.05 considered significant. The mean (±SD) peak AM-ACL relative strains were 5.4 ± 3.7% and 3.1 ± 2.8% under internal and external tibial torque, respectively. The corresponding mean (± SD) peak AM-ACL strain rates reached 254.4 ± 160.1%/s and 179.4 ± 109.9%/s, respectively. The hypotheses were supported in that the normalized mean peak AM-ACL relative strain and strain rate were 70 and 42% greater under internal than under external tibial torque, respectively (p = 0.023, p = 0.041). We conclude that internal tibial torque is a potent stressor of the ACL because it induces a considerably (70%) larger peak strain in the AM-ACL than does a corresponding external tibial torque. Copyright © 2011 Orthopaedic Research Society.
Strain-enhanced tunneling magnetoresistance in MgO magnetic tunnel junctions.
Loong, Li Ming; Qiu, Xuepeng; Neo, Zhi Peng; Deorani, Praveen; Wu, Yang; Bhatia, Charanjit S; Saeys, Mark; Yang, Hyunsoo
2014-09-30
While the effects of lattice mismatch-induced strain, mechanical strain, as well as the intrinsic strain of thin films are sometimes detrimental, resulting in mechanical deformation and failure, strain can also be usefully harnessed for applications such as data storage, transistors, solar cells, and strain gauges, among other things. Here, we demonstrate that quantum transport across magnetic tunnel junctions (MTJs) can be significantly affected by the introduction of controllable mechanical strain, achieving an enhancement factor of ~2 in the experimental tunneling magnetoresistance (TMR) ratio. We further correlate this strain-enhanced TMR with coherent spin tunneling through the MgO barrier. Moreover, the strain-enhanced TMR is analyzed using non-equilibrium Green's function (NEGF) quantum transport calculations. Our results help elucidate the TMR mechanism at the atomic level and can provide a new way to enhance, as well as tune, the quantum properties in nanoscale materials and devices.
Isasawin, Siriwan; Aketarawong, Nidchaya; Lertsiri, Sittiwat; Thanaphum, Sujinda
2014-01-01
The carambola fruit fly, Bactrocera carambolae Drew & Hancock is a high profile key pest that is widely distributed in the southwestern ASEAN region. In addition, it has trans-continentally invaded Suriname, where it has been expanding east and southward since 1975. This fruit fly belongs to Bactrocera dorsalis species complex. The development and application of a genetic sexing strain (Salaya1) of B. dorsalis sensu stricto (s.s.) (Hendel) for the sterile insect technique (SIT) has improved the fruit fly control. However, matings between B. dorsalis s.s. and B. carambolae are incompatible, which hinder the application of the Salaya1 strain to control the carambola fruit fly. To solve this problem, we introduced genetic sexing components from the Salaya1 strain into the B. carambolae genome by interspecific hybridization. Morphological characteristics, mating competitiveness, male pheromone profiles, and genetic relationships revealed consistencies that helped to distinguish Salaya1 and B. carambolae strains. A Y-autosome translocation linking the dominant wild-type allele of white pupae gene and a free autosome carrying a recessive white pupae homologue from the Salaya1 strain were introgressed into the gene pool of B. carambolae. A panel of Y-pseudo-linked microsatellite loci of the Salaya1 strain served as markers for the introgression experiments. This resulted in a newly derived genetic sexing strain called Salaya5, with morphological characteristics corresponding to B. carambolae. The rectal gland pheromone profile of Salaya5 males also contained a distinctive component of B. carambolae. Microsatellite DNA analyses confirmed the close genetic relationships between the Salaya5 strain and wild B. carambolae populations. Further experiments showed that the sterile males of Salaya5 can compete with wild males for mating with wild females in field cage conditions. Introgression of sex sorting components from the Salaya1 strain to a closely related B. carambolae
Strain-enhanced tunneling magnetoresistance in MgO magnetic tunnel junctions
Loong, Li Ming; Qiu, Xuepeng; Neo, Zhi Peng; Deorani, Praveen; Wu, Yang; Bhatia, Charanjit S.; Saeys, Mark; Yang, Hyunsoo
2014-01-01
While the effects of lattice mismatch-induced strain, mechanical strain, as well as the intrinsic strain of thin films are sometimes detrimental, resulting in mechanical deformation and failure, strain can also be usefully harnessed for applications such as data storage, transistors, solar cells, and strain gauges, among other things. Here, we demonstrate that quantum transport across magnetic tunnel junctions (MTJs) can be significantly affected by the introduction of controllable mechanical...
Sivakami, R; Dhanuskodi, S; Karvembu, R
2016-01-05
RuO2 nanoparticles (RuO2 NPs) have been successfully synthesized by the hydrothermal method. Structure and the particle size have been determined by X-ray diffraction (XRD), scanning electron microscopy (SEM), atomic force microscopy (AFM) and transmission electron microscopy (TEM). UV-Vis spectra reveal that the optical band gap of RuO2 nanoparticles is red shifted from 3.95 to 3.55eV. BET measurements show a high specific surface area (SSA) of 118-133m(2)/g and pore diameter (10-25nm) has been estimated by Barret-Joyner-Halenda (BJH) method. The crystallite size and lattice strain in the samples have been investigated by Williamson-Hall (W-H) analysis assuming uniform deformation, deformation stress and deformation energy density, and the size-strain plot method. All other relevant physical parameters including stress, strain and energy density have been calculated. The average crystallite size and the lattice strain evaluated from XRD measurements are in good agreement with the results of TEM. Copyright © 2015 Elsevier B.V. All rights reserved.
Food poisoning potential of Bacillus cereus strains from Norwegian dairies.
Stenfors Arnesen, Lotte P; O'sullivan, Kristin; Granum, Per Einar
2007-05-10
Characteristics concerning diarrhoeal potential were investigated in B. cereus dairy strains. The thirty-nine strains, isolated from whipping cream, were tested for cytotoxicity after culturing at human body temperature as well as 25 degrees C and 32 degrees C. At 37 degrees C, none of the strains were highly cytotoxic. This observation suggests that those strains should be considered to pose a minor risk with regard to diarrhoeal food poisoning. However, some strains were moderately or highly cytotoxic when grown at 25 degrees C and 32 degrees C. While the majority of the strains were able to grow at refrigeration temperatures, only four B. weihenstephanensis strains were identified among them when subjected to discriminative PCR assays and growth temperatures which delimit this species.
Study of dynamic strain aging in dual phase steel
International Nuclear Information System (INIS)
Queiroz, R.R.U.; Cunha, F.G.G.; Gonzalez, B.M.
2012-01-01
Highlights: ► Characterization of the high temperature mechanical behavior of a dual phase steel. ► Determination of the effect of dynamic strain aging on the strain hardening rate. ► Identification of the mechanism associated with dynamic strain aging. ► The value of the interaction energy carbon–dislocation in ferrite was confirmed. - Abstract: The susceptibility to dynamic strain aging of a dual phase steel was evaluated by the variation of mechanical properties in tension with the temperature and the strain rate. The tensile tests were performed at temperatures varying between 25 °C and 600 °C and at strain rates ranging from 10 −2 to 5 × 10 −4 s −1 . The studied steel presented typical manifestations related to dynamic strain aging: serrated flow (the Portevin–Le Chatelier effect) for certain combinations of temperature and strain rates; the presence of a plateau in the variation of yield stress with temperature; a maximum in the curves of tensile strength, flow stress, and work hardening exponent as a function of temperature; and a minimum in the variation of total elongation with temperature. The determined apparent activation energy values, associated with the beginning of the Portevin–Le Chatelier effect and the maximum in the variation of flow stress with temperature, were 83 kJ/mol and 156 kJ/mol, respectively. These values suggest that the mechanism responsible for dynamic strain aging in the dual phase steel is the locking of dislocations by carbon atoms in ferrite and that the formation of clusters and/or transition carbides and carbide precipitation in martensite do not interfere with the dynamic strain aging process.
Large strain cyclic behavior of metastable austenic stainless steel
International Nuclear Information System (INIS)
Geijselaers, H.J.M.; Hilkhuijsen, P.; Bor, T.C.; Boogaard, A.H. van den
2015-01-01
Metastable austenitic stainless steel will transform to martensite when subjected to mechanical working. In this research an austenitic stainless steel has been subjected to large amplitude strain paths containing a strain reversal. During the tests, apart from the stress and the strain also magnetic induction was measured. From the in situ magnetic induction measurements an estimate of the stress partitioning among the phases is determined. When the strain path reversal is applied at low strains, a classical Bauschinger effect is observed. When the strain reversal is applied at higher strains, a higher flow stress is measured after the reversal compared to the flow stress before reversal. Also a stagnation of the transformation is observed, meaning that a higher strain as well as a higher stress than before the strain path change is required to restart the transformation after reversal. The observed behavior can be explained by a model in which for the martensitic transformation a stress induced transformation model is used. The constitutive behavior of both the austenite phase and the martensite is described by a Chaboche model to account for the Bauschinger effect. Mean-field homogenization of the material behavior of the individual phases is employed to obtain a constitutive behavior of the two-phase composite. The overall applied stress, the stress in the martensite phase and the observed transformation behavior during cyclic shear are very well reproduced by the model simulations
Large strain cyclic behavior of metastable austenic stainless steel
Energy Technology Data Exchange (ETDEWEB)
Geijselaers, H.J.M., E-mail: h.j.m.geijselaers@utwente.nl; Hilkhuijsen, P.; Bor, T.C.; Boogaard, A.H. van den
2015-04-17
Metastable austenitic stainless steel will transform to martensite when subjected to mechanical working. In this research an austenitic stainless steel has been subjected to large amplitude strain paths containing a strain reversal. During the tests, apart from the stress and the strain also magnetic induction was measured. From the in situ magnetic induction measurements an estimate of the stress partitioning among the phases is determined. When the strain path reversal is applied at low strains, a classical Bauschinger effect is observed. When the strain reversal is applied at higher strains, a higher flow stress is measured after the reversal compared to the flow stress before reversal. Also a stagnation of the transformation is observed, meaning that a higher strain as well as a higher stress than before the strain path change is required to restart the transformation after reversal. The observed behavior can be explained by a model in which for the martensitic transformation a stress induced transformation model is used. The constitutive behavior of both the austenite phase and the martensite is described by a Chaboche model to account for the Bauschinger effect. Mean-field homogenization of the material behavior of the individual phases is employed to obtain a constitutive behavior of the two-phase composite. The overall applied stress, the stress in the martensite phase and the observed transformation behavior during cyclic shear are very well reproduced by the model simulations.
Strain engineering of magnetic state in vacancy-doped phosphorene
Energy Technology Data Exchange (ETDEWEB)
Ren, Jie [Hunan Provincial Key Laboratory of Micro–Nano Energy Materials and Devices, Xiangtan University, Xiangtan 411105, Hunan (China); Zhang, Chunxiao, E-mail: zhangchunxiao@xtu.edu.cn [Hunan Provincial Key Laboratory of Micro–Nano Energy Materials and Devices, Xiangtan University, Xiangtan 411105, Hunan (China); Li, Jin [Hunan Provincial Key Laboratory of Micro–Nano Energy Materials and Devices, Xiangtan University, Xiangtan 411105, Hunan (China); Guo, Zhixin [Department of Physics, Xiangtan University, Xiangtan 411105, Hunan (China); Xiao, Huaping, E-mail: hpxiao@xtu.edu.cn [Hunan Provincial Key Laboratory of Micro–Nano Energy Materials and Devices, Xiangtan University, Xiangtan 411105, Hunan (China); Zhong, Jianxin [Hunan Provincial Key Laboratory of Micro–Nano Energy Materials and Devices, Xiangtan University, Xiangtan 411105, Hunan (China)
2016-09-23
Inducing and manipulating the magnetism in two-dimensional materials play an important role for the development of the next-generation spintronics. In this letter, the effects of the biaxial strain on magnetic properties of vacancy-doped phosphorene are investigated using first-principles calculation. We find although only SV956 doping induces magnetism for unstrained phosphorene, the biaxial strain induces nonzero magnetic moment for SV5566 and DVa doped phosphorene. The biaxial strain also modulates the magnetic state for SV956, SV5566 and DVa doped phosphorene. The local magnetic moment derives from the spin polarization of the dangling bonds near the vacancy. The biaxial strain influences the local bonding configuration near the vacancy which determines the presence of dangling bonds, and then modulates the magnetic state. Our findings promise the synergistic effect of strain engineering and vacancy decoration is an effective method for the operation of phosphorene-based spintronic devices. - Highlights: • Investigation of the magnetic moment of vacancy-doped phosphorene by DFT calculation. • The modulation of the magnetic moment by the biaxial strain. • The analysis of the bonding configuration with the biaxial strain. • The analysis of the electronic structures to explain the evolution of the magnetic moment. • The effects of the biaxial strain on the band gap and doping levels.
Printed strain sensors for early damage detection in engineering structures
Zymelka, Daniel; Yamashita, Takahiro; Takamatsu, Seiichi; Itoh, Toshihiro; Kobayashi, Takeshi
2018-05-01
In this paper, we demonstrate the analysis of strain measurements recorded using a screen-printed sensors array bonded to a metal plate and subjected to high strains. The analysis was intended to evaluate the capabilities of the printed strain sensors to detect abnormal strain distribution before actual defects (cracks) in the analyzed structures appear. The results demonstrate that the developed device can accurately localize the enhanced strains at the very early stage of crack formation. The promising performance and low fabrication cost confirm the potential suitability of the printed strain sensors for applications within the framework of structural health monitoring (SHM).
[A prophylactic program for strain urinary incontinence].
Stadnicka, Grazyna; Iwanowicz-Palus, Grazyna J; Bień, Agnieszka M
2002-01-01
The aim of the study was to work out a prophylactic program for strain urinary incontinence. Analysis of literature on the subject and results of own investigations presented in the first part of the paper indicate that the program of prophylaxis of strain urinary incontinence should primarily include: (1) Preparation of the medical staff (nurses, midwives) for propagating health education among women on prevention of strain urinary incontinence. (2) Preparation of adequate educational materials in the form of brochures, leaflets, information posters about symptoms, causes and prophylaxis of urinary incontinence indicating health care institutions available to all women when the disease is suspected or already present. (3) Propagation of problems connected with strain urinary incontinence in the mass media providing information to a wide audience in order to make people realize the significance of this social problem and break stereotypes associated with this disease of "shame". (4) Preparation of sets of exercises for the muscles of the base of the pelvis to be performed during pregnancy, confinement and menopause to maintain their proper function. (5) Indicating factors predisposing to strain urinary incontinence with focus on possibilities of their reduction or elimination.
Novel distributed strain sensing in polymeric materials
International Nuclear Information System (INIS)
Abot, Jandro L; Song, Yi; Medikonda, Sandeep; Rooy, Nathan; Schulz, Mark J
2010-01-01
Monitoring the state of strain throughout an entire structure is essential to determine its state of stress, detect potential residual stresses after fabrication, and also to help to establish its integrity. Several sensing technologies are presently available to determine the strain in the surface or inside a structure. Large sensor dimensions, complex signal conditioning equipment, and difficulty in achieving a widely distributed system have however hindered their development into robust structural health monitoring techniques. Recently, carbon nanotube forests were spun into a microscale thread that is electrically conductive, tough, and easily tailorable. The thread was integrated into polymeric materials and used for the first time as a piezoresistive sensor to monitor strain and also to detect damage in the material. It is revealed that the created self-sensing polymeric materials are sensitive to normal strains above 0.07% and that the sensor thread exhibits a perfectly linear delta resistance–strain response above 0.3%. The longitudinal gauge factors were determined to be in the 2–5 range. This low cost and simple built-in sensor thread may provide a new integrated and distributed sensor technology that enables robust real-time health monitoring of structures
A piezoelectric transducer for measurement of dynamic strain in pipes
Energy Technology Data Exchange (ETDEWEB)
Lannes, Daniel P.; Gama, Antonio L. [Universidade Federal Fluminense (UFF), Niteroi, RJ (Brazil). Dept. de Engenharia Mecanica
2009-07-01
This work presents a new strain transducer developed mainly for the inspection and evaluation of piping systems with excessive vibration. Vibration is one of the most common causes of piping failures. These failures could be avoided if the vibration problems were identified and quickly evaluated. Procedures for evaluation of piping vibration are usually based on pipe velocity or displacement. Although simple and fast, these procedures do not provide precise information on the risk of piping fatigue failure. Through the measurement of pipe dynamic strains the risk of failure due to vibration can be determined more accurately. The measurement of strain is usually performed using the conventional strain gauge method. Although efficient and accurate, the implementation of the conventional strain gauge technique may become a difficult task in certain industrial scenarios. Motivated by the need of a simple and rapid method for pipe dynamic strain measurement, a piezoelectric dynamic strain transducer was developed. This work presents a description of the piezoelectric strain transducer and the preliminary results of pipe strain measurements. The transducer can be applied directly to the pipe through magnetic bases allowing for the quick measurement of the dynamic strains in many points of the pipe. The transducer signal can be read with the same commercial data collectors used for accelerometers. (author)
Strain effect on the phase diagram of Ba-122
Energy Technology Data Exchange (ETDEWEB)
Iida, Kazumasa [IFW Dresden (Germany); Nagoya University (Japan); Grinenko, Vadim; Kurth, Fritz; Efremov, Dmitriy; Drechsler, Stefan-Ludwig; Engelmann, Jan; Aswartham, Saicharan; Wurmehl, Sabine; Moench, Ingolf; Huehne, Ruben [IFW Dresden (Germany); Langer, Marco; Erbe, Manuela; Haenisch, Jens; Holzapfel, Bernhard [IFW Dresden (Germany); Karlsruhe Institute of Technology (KIT) (Germany); Ichinose, Ataru; Tsukada, Ichiro [Central Research Institute of Electric Power Industry, Nagasaka (Japan); Ahrens, Eike [TU Dresden (Germany); Ikuta, Hiroshi [Nagoya University (Japan)
2015-07-01
Thin films offer a possibility for tuning superconducting (SC) properties without external pressure or chemical doping. In-plane strain controls the Neel temperature of the antiferromagnetic (AF) transition and the SC transition temperature or even induce superconductivity in the parent compound. We studied the electronic and magnetic properties of Co, Ru, and P doped Ba-122 thin films in different strain states. We have found that the strain shifts nearly rigidly the whole phase diagram including the AF region and the SC dome in the direction of higher or lower substitution levels depending on the direction of strain (i.e. compressive or tensile). In particular, we found that the strain affects the band structure similarly as Co doping despite that the crystal structure changes differently. As a result tensile or compressive strain acts as additional el or h doping, respectively.
Directory of Open Access Journals (Sweden)
Johann P. Müller
2013-10-01
Full Text Available The cladoceran herbivore Daphnia magna is a major consumer of phytoplankton in lakes. Therefore, this organism may control the phytoplankton community and the proliferation of some algae or cyanobacteria. Cladoceran behaviour and migration in relation to temperature, light or presence of planktivorous fishes have been well studied. In particular, it is known that the detection of kairomones produced by predators may induce avoidance. Avoidance could also occur with other semiochemicals such as cyanotoxins. In order to explore this hypothesis, we used an olfactometer to observe and measure the exploratory behaviour of D. magna individuals based on the motivation for food. Daphnids were allowed to choose between different compounds: water, a pure cyanotoxin, i.e. the microcystin-RR [(MC-RR], extracts of one MC-producing strain (PMC 75.02 and one MC-free strain (PMC 87.02 of Planktothrix agardhii, or a green algae Scenedesmus obliquus. With this experimental design, we observed that i cladocerans are able to detect resources with different qualities, ii they can explore before exhibiting preferences, and iii daphnids are able to avoid compounds that are potentially toxic (e.g., microcystins. First, daphnids explored the environment, subsequently (after about 1.5 h, they showed a significant tendency to stay where there is a profitable resource such as S. obliquus. These results also suggest that specimens of D. magna cannot detect MC compounds from P. agardhii, but they respond to it as a food resource. The study of zooplankton ability to explore the environment when exposed to semiochemicals needs further investigation.
Strain modification on electronic transport of the phosphorene nanoribbon
Directory of Open Access Journals (Sweden)
Yawen Yuan
2017-07-01
Full Text Available We demonstrate theoretically how local strains can be tailored to control quantum transport of carriers on monolayer armchair and zigzag phosphorene nanoribbon. We find that the electron tunneling is forbidden when the in-plane strain exceeds a critical value. The critical strain is different for different crystal orientation of the ribbons, widths, and incident energies. By tuning the Fermi energy and strain, the channels can be transited from opaque to transparent. Moreover, for the zigzag-phosphorene nanoribbon, the two-fold degenerate quasi-flat edge band splits completely under certain strain. These properties provide us an efficient way to control the transport of monolayer phosphorene-based microstructure.
Khanafer, Khalil; Duprey, Ambroise; Schlicht, Marty; Berguer, Ramon
2009-04-01
Tensile tests on Polydimethylsiloxane (PDMS) materials were conducted to illustrate the effects of mixing ratio, definition of the stress-strain curve, and the strain rate on the elastic modulus and stress-strain curve. PDMS specimens were prepared according to the ASTM standards for elastic materials. Our results indicate that the physiological elastic modulus depends strongly on the definition of the stress-strain curve, mixing ratio, and the strain rate. For various mixing ratios and strain rates, true stress-strain definition results in higher stress and elastic modulus compared with engineering stress-strain and true stress-engineering strain definitions. The elastic modulus increases as the mixing ratio increases up-to 9:1 ratio after which the elastic modulus begins to decrease even as the mixing ratio continues to increase. The results presented in this study will be helpful to assist the design of in vitro experiments to mimic blood flow in arteries and to understand the complex interaction between blood flow and the walls of arteries using PDMS elastomer.
Strain-induced changes to the electronic structure of germanium
Tahini, H. A.
2012-04-17
Density functional theory calculations (DFT) are used to investigate the strain-induced changes to the electronic structure of biaxially strained (parallel to the (001), (110) and (111) planes) and uniaxially strained (along the [001], [110] and [111] directions) germanium (Ge). It is calculated that a moderate uniaxial strain parallel to the [111] direction can efficiently transform Ge to a direct bandgap material with a bandgap energy useful for technological applications. © 2012 IOP Publishing Ltd.
Strain-induced changes to the electronic structure of germanium
Tahini, H. A.; Chroneos, Alexander I.; Grimes, Robin W.; Schwingenschlö gl, Udo; Dimoulas, Athanasios Dimoulas
2012-01-01
Density functional theory calculations (DFT) are used to investigate the strain-induced changes to the electronic structure of biaxially strained (parallel to the (001), (110) and (111) planes) and uniaxially strained (along the [001], [110] and [111] directions) germanium (Ge). It is calculated that a moderate uniaxial strain parallel to the [111] direction can efficiently transform Ge to a direct bandgap material with a bandgap energy useful for technological applications. © 2012 IOP Publishing Ltd.
Ductile Damage Evolution and Strain Path Dependency
International Nuclear Information System (INIS)
Tasan, C. C.; Hoefnagels, J. M. P.; Peerlings, R. H. J.; Geers, M. G. D.; ten Horn, C. H. L. J.; Vegter, H.
2007-01-01
Forming limit diagrams are commonly used in sheet metal industry to define the safe forming regions. These diagrams are built to define the necking strains of sheet metals. However, with the rise in the popularity of advance high strength steels, ductile fracture through damage evolution has also emerged as an important parameter in the determination of limit strains. In this work, damage evolution in two different steels used in the automotive industry is examined to observe the relationship between damage evolution and the strain path that is followed during the forming operation
A methodology for strain-based fatigue reliability analysis
International Nuclear Information System (INIS)
Zhao, Y.X.
2000-01-01
A significant scatter of the cyclic stress-strain (CSS) responses should be noted for a nuclear reactor material, 1Cr18Ni9Ti pipe-weld metal. Existence of the scatter implies that a random cyclic strain applied history will be introduced under any of the loading modes even a deterministic loading history. A non-conservative evaluation might be given in the practice without considering the scatter. A methodology for strain-based fatigue reliability analysis, which has taken into account the scatter, is developed. The responses are approximately modeled by probability-based CSS curves of Ramberg-Osgood relation. The strain-life data are modeled, similarly, by probability-based strain-life curves of Coffin-Manson law. The reliability assessment is constructed by considering interference of the random fatigue strain applied and capacity histories. Probability density functions of the applied and capacity histories are analytically given. The methodology could be conveniently extrapolated to the case of deterministic CSS relation as the existent methods did. Non-conservative evaluation of the deterministic CSS relation and availability of present methodology have been indicated by an analysis of the material test results
Psychological strains and youth suicide in rural China.
Zhang, Jie; Wieczorek, William F; Conwell, Yeates; Tu, Xin Ming
2011-06-01
The strain theory of suicide postulates that suicide is usually preceded by psychological strains. A strain can be a consequence of any of four conflicts: differential values, aspiration and reality, relative deprivation, and lack of coping skills for a crisis. This study, with a blend of psychiatric and social predictors of suicide, identified correlates of suicide that are relevant to Chinese culture and tested the strain theory of suicide with Chinese data. We sampled 392 suicides and 416 living controls (both aged 15-34 years) from 16 rural counties in China in 2008 and interviewed two informants for each suicide and each control. We found that marriage and religion/religiosity did not distinguish the suicides from the living controls among Chinese rural young women. Religion/religiosity tended to be stronger for suicides than for controls. Psychological strains in the forms of relative deprivation, unrealized aspiration, and lack of coping skills were significantly associated with suicide, even after accounting for the role of mental illness. The strain theory of suicide forms a challenge to the psychiatric model popular in the West, at least in explaining the Chinese suicide. Copyright © 2011 Elsevier Ltd. All rights reserved.
Strain measurement in concrete using embedded carbon roving-based sensors
International Nuclear Information System (INIS)
Quadflieg, Till; Gries, Thomas; Stolyarov, Oleg
2016-01-01
This paper presents the results of the application of carbon rovings as strain sensors for measuring the strain in concrete. In this work, three types of electrically conductive carbon roving with different characteristics were used. The possibility of using carbon rovings as a strain sensor is demonstrated via measurements in tensile and four point bending tests. The experimental setups and methods for measuring the electrical resistance of carbon roving in the roving and concrete are described. The results of the characterization of the electrical behavior as a function of strain of carbon rovings and concrete are presented and discussed. The obtained results indicate that the strain range of carbon rovings optimally corresponds to the strain range of concrete. This characteristic behavior makes the carbon rovings well suited for the use as strain sensors. A good correlation has been found between the electrical resistance-strain curve of the carbon roving and the measurements in the concrete.
Standard practice for strain controlled thermomechanical fatigue testing
American Society for Testing and Materials. Philadelphia
2010-01-01
1.1 This practice covers the determination of thermomechanical fatigue (TMF) properties of materials under uniaxially loaded strain-controlled conditions. A “thermomechanical” fatigue cycle is here defined as a condition where uniform temperature and strain fields over the specimen gage section are simultaneously varied and independently controlled. This practice is intended to address TMF testing performed in support of such activities as materials research and development, mechanical design, process and quality control, product performance, and failure analysis. While this practice is specific to strain-controlled testing, many sections will provide useful information for force-controlled or stress-controlled TMF testing. 1.2 This practice allows for any maximum and minimum values of temperature and mechanical strain, and temperature-mechanical strain phasing, with the restriction being that such parameters remain cyclically constant throughout the duration of the test. No restrictions are placed on en...
Research on the Phenotypic Characterization of Mrsa Strains Isolated from Animals
Directory of Open Access Journals (Sweden)
Iulia Maria BUCUR
2017-05-01
Full Text Available Keywords: chromogen, methicillin, MRSA, resistance Introduction: Currently, both in staphylococci isolated from animals with different diseases, as well as in humans, the MRSA strains (Methicillin Resistant S. aureus are monitored, as the methicillin resistance is associated with the resistance to other antibiotic groups. Methicillin resistance is encoded by mec staphylococcal chromosomal cassettes (SCCmec, which are islands of resistance. These strains can be identified by molecular biology tests and tests that reveal several phenotypic characteristics. The research was made in order to characterize and identify phenotypically the MRSA staphylococci strains isolated from animals. Materials and Methods: Researches were made on 240 coagulase positive and coagulase negative strains of staphylococci. Mannitol fermentation was tested on Champan medium, free coagulase was revealed on Baird-Parker medium and to identify S. aureus subsp. aureus was used the chromogenic medium Chromatic Staph. Methicillin-resistant strains were detected by disc diffusion method, using biodiscs with methicillin, oxacillin and cefoxitin. Also, to identify the MRSA strains, was used the chromogenic medium Chromatic MRSA. Results: The isolates were positive to mannitol and produced complete haemolysis or were unhaemolytic. A total of 44 strains produced free coagulase on Baird-Parker medium, considered coagulase positive strains, while 196 were coagulase negative strains. The isolates conducted differently to methicillin: 22,08% of strains were resistant, 51,25% of strains were susceptible and 26,66% had intermediate resistance, while the resistant strains to oxacillin were 42,91%. The increased frequency of methicillin-resistant strains of staphylococci and, particularly, MRSA strains, determined using the cefoxitin disk diffusion test, which is more reliable than methicillin and oxacillin. On the MRSA chromogenic medium, the methicillin-resistant strains of staphylococci
Effects of strain on Goos-Hänchen shifts of monolayer phosphorene
Li, Kaihui; Cheng, Fang
2018-03-01
We investigate the Goos-Hänchen(GH) shift for ballistic electrons (i) reflected from a step-like inhomogeneity of strain, and (ii) transmitted through a monolayer phosphoresce junction consisting of a positive strained region and two normal regions (or a normal region and two negative strained regions). Refraction occurs at the interface between the unstrained/positive-strain(negative-strain/unstrained), in analogy with optical refraction. The critical angle is different for different strengths and directions of the strains. The critical angles for electrons tunneling through unstrained/positive-strain junction can even decrease to zero when the positive strain exceeds a critical value. For the monolayer phosphorene junction consisting of a positive strain region and two normal regions (or a normal region and two negative strain regions), we find that the GH shifts resonantly depends on the middle region width. The resonant values and the plus-minus sign of the displacement can be controlled by the incident angle, incident energy and the strain. These properties will be useful for the applications in phosphorene-based electronic devices.
Step width alters iliotibial band strain during running.
Meardon, Stacey A; Campbell, Samuel; Derrick, Timothy R
2012-11-01
This study assessed the effect of step width during running on factors related to iliotibial band (ITB) syndrome. Three-dimensional (3D) kinematics and kinetics were recorded from 15 healthy recreational runners during overground running under various step width conditions (preferred and at least +/- 5% of their leg length). Strain and strain rate were estimated from a musculoskeletal model of the lower extremity. Greater ITB strain and strain rate were found in the narrower step width condition (p running, especially in persons whose running style is characterized by a narrow step width, may be beneficial in the treatment and prevention of running-related ITB syndrome.
Residual strains in girth-welded linepipe
International Nuclear Information System (INIS)
MacEwen, S.R.; Holden, T.M.; Powell, B.M.; Lazor, R.B.
1987-07-01
High resolution neutron diffraction has been used to measure the axial residual strains in and adjacent to a multipass girth weld in a complete section of 914 mm (36 inches) diameter, 16 mm (5/8 inch) wall, linepipe. The experiments were carried out at the NRU reactor, Chalk River using the L3 triple-axis spectrometer. The through-wall distribution of axial residual strain was measured at 0, 4, 8, 20 and 50 mm from the weld centerline; the axial variation was determined 1, 5, 8, and 13 mm from the inside surface of the pipe wall. The results have been compared with strain gauge measurements on the weld surface and with through-wall residual stress distributions determined using the block-layering and removal technique
Analysis of stress-strain behavior in Bi2223 composite tapes
International Nuclear Information System (INIS)
Sugano, M.; Osamura, K.; Nyilas, A.
2004-01-01
Tensile test was carried out for Bi2223/Ag/Ag alloy composite tapes at RT, 77 and 7 K. Two yielding points are observed in the stress-strain curves. From the stress-strain behavior of the components and critical current (I c ) as a function of tensile strain, it was found that the microscopic reason for these yieldings is attributed to yielding of Ag alloy and fracture of Bi2223, respectively. The strain at the second yielding has temperature dependence and it becomes larger with decreasing measured temperature. From the thermo-mechanical analysis, it can be explained by temperature dependence of compressive residual strain of Bi2223. Reversible recovery of I c was found during loading-unloading test. The relationship between the reversible strain limit and the intrinsic strain of Bi2223 was discussed
Yamamoto, K; Kaji, K; Kondo, H; Matsuo, M; Shibata, Y; Tasaki, Y; Utakoji, T; Ooka, H
1991-01-01
A new human diploid cell strain, TIG-7, which has the male karyotype, was established and characterized. Isozyme and histocompatibility typing of the cell strain was performed. The average in vitro life span of the cells is 73 population doublings. Changes in cell volume, doubling time, saturation density, the efficiency of cell attachment, plating efficiency, and relative DNA content were examined during in vitro cellular aging. Hydrocortisone slightly prolongs the life span of the cell strain when the hormone is administered to the cultures during middle passages. The age-related changes in the parameters of TIG-7 are not appreciably different from those of the previously established TIG-1 cell strain. These results show that this cell strain is useful for research on cellular aging; further profit is anticipated from research using a combination of these two sexually different cell strains.
Nan, Wenlong; Tan, Pengfei; Wang, Yong; Xu, Zouliang; Mao, Kairong; Peng, Daxin; Chen, Yiping
2014-09-01
Immunisation with attenuated Brucella spp. vaccines prevents brucellosis, but may also interfere with diagnosis. In this study, a duplex PCR was developed to distinguish Brucella suis vaccine strain S2 from field strains of B. suis biovar 1 and other Brucella spp. The PCR detected 60 fg genomic DNA of B. suis S2 or biovar 1 field strains and was able to distinguish B. suis S2 and wild-type strains of B. suis biovar 1 among 76 field isolates representing all the common species and biovars, as well as four vaccine strains, of Brucella. Copyright © 2014 Elsevier Ltd. All rights reserved.
Comparative genomic characterization of citrus-associated Xylella fastidiosa strains
Directory of Open Access Journals (Sweden)
Nunes Luiz R
2007-12-01
Full Text Available Abstract Background The xylem-inhabiting bacterium Xylella fastidiosa (Xf is the causal agent of Pierce's disease (PD in vineyards and citrus variegated chlorosis (CVC in orange trees. Both of these economically-devastating diseases are caused by distinct strains of this complex group of microorganisms, which has motivated researchers to conduct extensive genomic sequencing projects with Xf strains. This sequence information, along with other molecular tools, have been used to estimate the evolutionary history of the group and provide clues to understand the capacity of Xf to infect different hosts, causing a variety of symptoms. Nonetheless, although significant amounts of information have been generated from Xf strains, a large proportion of these efforts has concentrated on the study of North American strains, limiting our understanding about the genomic composition of South American strains – which is particularly important for CVC-associated strains. Results This paper describes the first genome-wide comparison among South American Xf strains, involving 6 distinct citrus-associated bacteria. Comparative analyses performed through a microarray-based approach allowed identification and characterization of large mobile genetic elements that seem to be exclusive to South American strains. Moreover, a large-scale sequencing effort, based on Suppressive Subtraction Hybridization (SSH, identified 290 new ORFs, distributed in 135 Groups of Orthologous Elements, throughout the genomes of these bacteria. Conclusion Results from microarray-based comparisons provide further evidence concerning activity of horizontally transferred elements, reinforcing their importance as major mediators in the evolution of Xf. Moreover, the microarray-based genomic profiles showed similarity between Xf strains 9a5c and Fb7, which is unexpected, given the geographical and chronological differences associated with the isolation of these microorganisms. The newly
3D Strain Modelling of Tear Fault Analogues
Hindle, D.; Vietor, T.
2005-12-01
Tear faults can be described as vertical discontinuities, with near fault parallel displacements terminating on some sort of shallow detachment. As such, they are difficult to study in "cross section" i.e. 2 dimensions as is often the case for fold-thrust systems. Hence, little attempt has been made to model the evolution of strain around tear faults and the processes of strain localisation in such structures due to the necessity of describing these systems in 3 dimensions and the problems this poses for both numerical and analogue modelling. Field studies suggest that strain in such regions can be distributed across broad zones on minor tear systems, which are often not easily mappable. Such strain is probably assumed to be due to distributed strain and to displacement gradients which are themselves necessary for the initiation of the tear itself. We present a numerical study of the effects of a sharp, basal discontinutiy parallel to the transport direction in a shortening wedge of material. The discontinuity is represented by two adjacent basal surfaces with strongly contrasting (0.5 and 0.05) friction coefficient. The material is modelled using PFC3D distinct element software for simulating granular material, whose properties are chosen to simulate upper crustal, sedimentary rock. The model geometry is a rectangular bounding box, 2km x 1km, and 0.35-0.5km deep, with a single, driving wall of constant velocity. We show the evolution of strain in the model in horizontal and vertical sections, and interpret strain localization as showing the spontaneous development of tear fault like features. The strain field in the model is asymmetrical, rotated towards the strong side of the model. Strain increments seem to oscillate in time, suggesting achievement of a steady state. We also note that our model cannot be treated as a critical wedge, since the 3rd dimension and the lateral variations of strength rule out this type of 2D approximation.
Isolation and characterization of a new Pseudomonas-related strain ...
African Journals Online (AJOL)
% with Pseudomonas putida ()AB680847). The phylogenetic tree formed by 16S rDNA sequences from both strain SKDP-1 and its most related bacteria also proved strain SKDP-1 to be one member of the genus Pseudomonas. Strain SKDP-1 ...
Role Strain in Collegiate Athletic Training Approved Clinical Instructors
Henning, Jolene M; Weidner, Thomas G
2008-01-01
Context: Certified athletic trainers who serve as Approved Clinical Instructors (ACIs) in the collegiate setting are balancing various roles (eg, patient care and related administrative tasks, clinical education). Whether this balancing act is associated with role strain in athletic trainers has not been examined. Objective: To examine the degree of, and contributing factors (eg, socialization experiences, professional and employment demographics, job congruency) to, role strain in collegiate ACIs. Design: Cross-sectional survey design. Setting: Geographically stratified random sample of ACIs affiliated with accredited athletic training education programs at National Collegiate Athletic Association (NCAA) Division I, II, and III institutions. Patients or Other Participants: 118 collegiate ACIs (47 head athletic trainers, 45 assistant athletic trainers, 26 graduate assistant athletic trainers). Main Outcome Measure(s): The Athletic Training ACI Role Strain Inventory, which measures total degree of role strain, 7 subscales of role strain, socialization experiences, professional and employment characteristics, and congruency in job responsibilities. Results: A total of 49% (n = 58) of the participants experienced a moderate to high degree of role strain. Role Overload was the highest contributing subscale to total role strain. No differences were noted between total role strain and role occupant groups, NCAA division, or sex. Graduate assistant athletic trainers experienced a greater degree of role incompetence than head athletic trainers did (P = .001). Division II ACIs reported a greater degree of inter-role conflict than those in Division I (P = .02). Female ACIs reported a greater degree of role incompetence than male ACIs (P = .01). Those ACIs who stated that the ACI training provided by their institution did not adequately prepare them for the role as an ACI experienced greater role strain (P < .001). Conclusions: The ACIs in the
Directory of Open Access Journals (Sweden)
John Orchard
2010-09-01
Full Text Available John Orchard1, Patrick Farhart2, Alex Kountouris3, Trefor James3, Marc Portus31School of Public Health, University of Sydney, Australia; 2Punjab Kings XI team, Indian Premier League, India; 3Cricket Australia, Melbourne, AustraliaObjective: To assess whether a history of lumbar stress fracture in pace bowlers in cricket is a risk factor for lower limb muscle strains.Methods: This was a prospective cohort risk factor study, conducted using injury data from contracted first class pace bowlers in Australia during seasons 1998–1999 to 2008–2009 inclusive. There were 205 pace bowlers, 33 of whom suffered a lumbar stress fracture when playing first class cricket. Risk ratios ([RR] with 95% confidence intervals[CI] were calculated to compare the seasonal incidence of various injuries between bowlers with a prior history of lumbar stress fracture and those with no history of lumbar stress fracture.Results: Risk of calf strain was strongly associated with prior lumbar stress fracture injury history (RR = 4.1; 95% CI: 2.4–7.1. Risks of both hamstring strain (RR = 1.5; 95% CI: 1.03–2.1 and quadriceps strain (RR = 2.0; 95% CI: 1.1–3.5 were somewhat associated with history of lumbar stress fracture. Risk of groin strain was not associated with history of lumbar stress fracture (RR = 0.7; 95% CI: 0.4–1.1. Other injuries showed little association with prior lumbar stress fracture, although knee cartilage injuries were more likely in the non-stress fracture group.Conclusion: Bony hypertrophy associated with lumbar stress fracture healing may lead to subsequent lumbar nerve root impingement, making lower limb muscle strains more likely to occur. Confounders may be responsible for some of the findings. In particular, bowling speed is likely to be independently correlated with risk of lumbar stress fracture and risk of muscle strain. However, as the relationship between lumbar stress fracture history and calf strain was very strong, and that there is a
Hole doped Dirac states in silicene by biaxial tensile strain
Kaloni, Thaneshwor P.
2013-03-11
The effects of biaxial tensile strain on the structure, electronic states, and mechanical properties of silicene are studied by ab-initio calculations. Our results show that up to 5% strain the Dirac cone remains essentially at the Fermi level, while higher strain induces hole doped Dirac states because of weakened Si–Si bonds. We demonstrate that the silicene lattice is stable up to 17% strain. It is noted that the buckling first decreases with the strain (up to 10%) and then increases again, which is accompanied by a band gap variation. We also calculate the Grüneisen parameter and demonstrate a strain dependence similar to that of graphene.
Hole doped Dirac states in silicene by biaxial tensile strain
Kaloni, Thaneshwor P.; Cheng, Yingchun; Schwingenschlö gl, Udo
2013-01-01
The effects of biaxial tensile strain on the structure, electronic states, and mechanical properties of silicene are studied by ab-initio calculations. Our results show that up to 5% strain the Dirac cone remains essentially at the Fermi level, while higher strain induces hole doped Dirac states because of weakened Si–Si bonds. We demonstrate that the silicene lattice is stable up to 17% strain. It is noted that the buckling first decreases with the strain (up to 10%) and then increases again, which is accompanied by a band gap variation. We also calculate the Grüneisen parameter and demonstrate a strain dependence similar to that of graphene.
Genetic characterization of type A enterotoxigenic Clostridium perfringens strains.
Directory of Open Access Journals (Sweden)
Agi Deguchi
2009-05-01
Full Text Available Clostridium perfringens type A, is both a ubiquitous environmental bacterium and a major cause of human gastrointestinal disease, which usually involves strains producing C. perfringens enterotoxin (CPE. The gene (cpe encoding this toxin can be carried on the chromosome or a large plasmid. Interestingly, strains carrying cpe on the chromosome and strains carrying cpe on a plasmid often exhibit different biological characteristics, such as resistance properties against heat. In this study, we investigated the genetic properties of C. perfringens by PCR-surveying 21 housekeeping genes and genes on representative plasmids and then confirmed those results by Southern blot assay (SB of five genes. Furthermore, sequencing analysis of eight housekeeping genes and multilocus sequence typing (MLST analysis were also performed. Fifty-eight C. perfringens strains were examined, including isolates from: food poisoning cases, human gastrointestinal disease cases, foods in Japan or the USA, or feces of healthy humans. In the PCR survey, eight of eleven housekeeping genes amplified positive reactions in all strains tested. However, by PCR survey and SB assay, one representative virulence gene, pfoA, was not detected in any strains carrying cpe on the chromosome. Genes involved in conjugative transfer of the cpe plasmid were also absent from almost all chromosomal cpe strains. MLST showed that, regardless of their geographic origin, date of isolation, or isolation source, chromosomal cpe isolates, i assemble into one definitive cluster ii lack pfoA and iii lack a plasmid related to the cpe plasmid. Similarly, independent of their origin, strains carrying a cpe plasmid also appear to be related, but are more variable than chromosomal cpe strains, possibly because of the instability of cpe-borne plasmid(s and/or the conjugative transfer of cpe-plasmid(s into unrelated C. perfringens strains.
Investigation of Sclerotinia sclerotiorum strains variability in Brazil.
Abreu, M J; Souza, E A
2015-06-18
White mold is a common bean disease caused by the fungus Sclerotinia sclerotiorum, resulting in economic losses in Brazil and worldwide. Lack of knowledge about the population structure of the pathogen makes it difficult to control the disease. The aim of this study was to characterize strains of S. sclerotiorum obtained from ex-perimental and commercial common bean fields in Brazil. We analyzed 50 strains of S. sclerotiorum collected at several locations in the state of Minas Gerais. The strains were characterized according to their ability and time for developing apothecia. Morphological and physiological analyses such as the mycelial growth index, colony color, the time re-quired to form the first sclerotia on media, the number of sclerotia per plate, average sclerotium size, and sclerotium shape were performed. We determined the mycelial compatibility, conducted molecular analy-sis of microsatellites, and evaluated the aggressiveness of 28 strains. Most strains had the ability to form apothecia. A small group of strains showed mycelial compatibility, and the strains showed different aggres-siveness levels. Overall, the population studied here demonstrated wide variability based on the morphological, physiological, and molecular traits analyzed. The average size and shape of sclerotia presented a cor-relation of 0.617, whereas the times required to form sclerotia and the number of sclerotia per plate showed a correlation of -0.455. The char-acterization of the pathogen population described herein will provide an important tool for promoting the development of bean cultivars re-sistant to white mold.
Genetic characterization of L-Zagreb mumps vaccine strain.
Ivancic, Jelena; Gulija, Tanja Kosutic; Forcic, Dubravko; Baricevic, Marijana; Jug, Renata; Mesko-Prejac, Majda; Mazuran, Renata
2005-04-01
Eleven mumps vaccine strains, all containing live attenuated virus, have been used throughout the world. Although L-Zagreb mumps vaccine has been licensed since 1972, only its partial nucleotide sequence was previously determined (accession numbers , and ). Therefore, we sequenced the entire genome of L-Zagreb vaccine strain (Institute of Immunology Inc., Zagreb, Croatia). In order to investigate the genetic stability of the vaccine, sequences of both L-Zagreb master seed and currently produced vaccine batch were determined and no difference between them was observed. A phylogenetic analysis based on SH gene sequence has shown that L-Zagreb strain does not belong to any of established mumps genotypes and that it is most similar to old, laboratory preserved European strains (1950s-1970s). L-Zagreb nucleotide and deduced protein sequences were compared with other mumps virus sequences obtained from the GenBank. Emphasis was put on functionally important protein regions and known antigenic epitopes. The extensive comparisons of nucleotide and deduced protein sequences between L-Zagreb vaccine strain and other previously determined mumps virus sequences have shown that while the functional regions of HN, V, and L proteins are well conserved among various mumps strains, there can be a substantial amino acid difference in antigenic epitopes of all proteins and in functional regions of F protein. No molecular pattern was identified that can be used as a distinction marker between virulent and attenuated strains.
Representative Stress-Strain Curve by Spherical Indentation on Elastic-Plastic Materials
Directory of Open Access Journals (Sweden)
Chao Chang
2018-01-01
Full Text Available Tensile stress-strain curve of metallic materials can be determined by the representative stress-strain curve from the spherical indentation. Tabor empirically determined the stress constraint factor (stress CF, ψ, and strain constraint factor (strain CF, β, but the choice of value for ψ and β is still under discussion. In this study, a new insight into the relationship between constraint factors of stress and strain is analytically described based on the formation of Tabor’s equation. Experiment tests were performed to evaluate these constraint factors. From the results, representative stress-strain curves using a proposed strain constraint factor can fit better with nominal stress-strain curve than those using Tabor’s constraint factors.
Directory of Open Access Journals (Sweden)
Tatiana eKondakova
2016-03-01
Full Text Available Human exposure to nitrogen dioxide (NO2, an air pollutant of increasing interest in biology, results in several toxic effects to human health and also to the air microbiota. The aim of this study was to investigate the bacterial response to gaseous NO2. Two Pseudomonas fluorescens strains, namely the airborne strain MFAF76a and the clinical strain MFN1032 were exposed to 0.1, 5 or 45 ppm concentrations of NO2, and their effects on bacteria were evaluated in terms of motility, biofilm formation, antibiotic resistance, as well as expression of several chosen target genes. While 0.1 and 5 ppm of NO2 did not lead to any detectable modification in the studied phenotypes of the two bacteria, several alterations were observed when the bacteria were exposed to 45 ppm of gaseous NO2. We thus chose to focus on this high concentration. NO2-exposed P. fluorescens strains showed reduced swimming motility, and decreased swarming in case of the strain MFN1032. Biofilm formed by NO2-treated airborne strain MFAF76a showed increased maximum thickness compared to non-treated cells, while NO2 had no apparent effect on the clinical MFN1032 biofilm structure. It is well known that biofilm and motility are inversely regulated by intracellular c-di-GMP level. The c-di-GMP level was however not affected in response to NO2 treatment. Finally, NO2-exposed P. fluorescens strains were found to be more resistant to ciprofloxacin and chloramphenicol. Accordingly, the resistance nodulation cell division (RND MexEF-OprN efflux pump encoding genes were highly upregulated in the two P. fluorescens strains. Noticeably, similar phenotypes had been previously observed following a NO treatment. Interestingly, an hmp-homologue gene in P. fluorescens strains MFAF76a and MFN1032 encodes a NO dioxygenase that is involved in NO detoxification into nitrites. Its expression was upregulated in response to NO2, suggesting a possible common pathway between NO and NO2 detoxification. Taken
On lower order strain gradient plasticity theories
DEFF Research Database (Denmark)
Niordson, Christian Frithiof; Hutchinson, J. W.
2002-01-01
By way of numerical examples, this paper explores the nature of solutions to a class of strain gradient plasticity theories that employ conventional stresses, equilibrium equations and boundary conditions. Strain gradients come into play in these modified conventional theories only to alter...
Phylogenetic analysis of Hungarian goose parvovirus isolates and vaccine strains.
Tatár-Kis, Tímea; Mató, Tamás; Markos, Béla; Palya, Vilmos
2004-08-01
Polymerase chain reaction and sequencing were used to analyse goose parvovirus field isolates and vaccine strains. Two fragments of the genome were amplified. Fragment "A" represents a region of VP3 gene, while fragment "B" represents a region upstream of the VP3 gene, encompassing part of the VP1 gene. In the region of fragment "A" the deduced amino acid sequence of the strains was identical, therefore differentiation among strains could be done only at the nucleotide level, which resulted in the formation of three groups: Hungarian, West-European and Asian strains. In the region of fragment "B", separation of groups could be done by both nucleotide and deduced amino acid sequence level. The nucleotide sequences resulted in the same groups as for fragment "A" but with a different clustering pattern among the Hungarian strains. Within the "Hungarian" group most of the recent field isolates fell into one cluster, very closely related or identical to each other, indicating a very slow evolutionary change. The attenuated strains and field isolates from 1979/80 formed a separate cluster. When vaccine strains and field isolates were compared, two specific amino acid differences were found that can be considered as possible markers for vaccinal strains. Sequence analysis of fragment "B" seems to be a suitable method for differentiation of attenuated vaccine strains from virulent strains. Copyright 2004 Houghton Trust Ltd
Probabilistic analysis of structures involving random stress-strain behavior
Millwater, H. R.; Thacker, B. H.; Harren, S. V.
1991-01-01
The present methodology for analysis of structures with random stress strain behavior characterizes the uniaxial stress-strain curve in terms of (1) elastic modulus, (2) engineering stress at initial yield, (3) initial plastic-hardening slope, (4) engineering stress at point of ultimate load, and (5) engineering strain at point of ultimate load. The methodology is incorporated into the Numerical Evaluation of Stochastic Structures Under Stress code for probabilistic structural analysis. The illustrative problem of a thick cylinder under internal pressure, where both the internal pressure and the stress-strain curve are random, is addressed by means of the code. The response value is the cumulative distribution function of the equivalent plastic strain at the inner radius.
Five challenges in modelling interacting strain dynamics
Directory of Open Access Journals (Sweden)
Paul S. Wikramaratna
2015-03-01
Full Text Available Population epidemiological models where hosts can be infected sequentially by different strains have the potential to help us understand many important diseases. Researchers have in recent years started to develop and use such models, but the extra layer of complexity from multiple strains brings with it many technical challenges. It is therefore hard to build models which have realistic assumptions yet are tractable. Here we outline some of the main challenges in this area. First we begin with the fundamental question of how to translate from complex small-scale dynamics within a host to useful population models. Next we consider the nature of so-called “strain space”. We describe two key types of host heterogeneities, and explain how models could help generate a better understanding of their effects. Finally, for diseases with many strains, we consider the challenge of modelling how immunity accumulates over multiple exposures.
Performance of rats orogastrically dosed with faecal strains of ...
African Journals Online (AJOL)
Administrator
strains of Lactobacillus acidophilus and challenged ... Albino rats (Rattus norvegicus) were orogastrically dosed with faecal strains of Lactobacillus .... Chang et al. (2001) reported a similar observation in piglets fed probiotic strain, Lactobacillus reuteri BSA 131. Francisco et al. (1995) had earlier reported that selected ...
The shape of a strain-based failure assessment diagram
International Nuclear Information System (INIS)
Budden, P.J.; Ainsworth, R.A.
2012-01-01
There have been a number of recent developments of strain-based fracture assessment approaches, including proposals by Budden [Engng Frac Mech 2006;73:537–52] for a strain-based failure assessment diagram (FAD) related to the conventional stress-based FAD. However, recent comparisons with finite element (FE) data have shown that this proposed strain-based FAD can be non-conservative in some cases, particularly for deeper cracks and materials with little strain-hardening capacity. Therefore, this paper re-examines the shape of the strain-based FAD, guided by these FE analyses and some theoretical analysis. On this basis, modified proposals for the shape of the strain-based FAD are given, including simplified and more detailed options in line with the options available for stress-based FADs in existing fitness-for-service procedures. The proposals are then illustrated by a worked example and by comparison with FE data, which demonstrate that the new proposals are generally conservative. - Highlights: ► The strain-based failure assessment diagram approach to fracture is developed. ► The new approach modifies earlier proposals by Budden. ► A new generic Option 1 strain-based failure assessment diagram is proposed. ► Validation based on finite element J data for plates and cylinders is presented. ► The new approach is generally conservative compared with the finite element data.
Drug gastrointestinal absorption in rat: Strain and gender differences.
Oltra-Noguera, Davinia; Mangas-Sanjuan, Victor; González-Álvarez, Isabel; Colon-Useche, Sarin; González-Álvarez, Marta; Bermejo, Marival
2015-10-12
Predictive animal models of intestinal drug absorption are essential tools in drug development to identify compounds with promising biopharmaceutical properties. In situ perfusion absorption studies are routinely used in the preclinical setting to screen drug candidates. The objective of this work is to explore the differences in magnitude and variability on intestinal absorption associated with rat strain and gender. Metoprolol and Verapamil absorption rate coefficients were determined using the in situ closed loop perfusion model in four strains of rats and in both genders. Strains used were Sprague-Dawley, Wistar-Han, Wistar-Unilever, Long-Evans and CD∗IGS. In the case of Metoprolol only CD∗IGS and Wistar Unilever showed differences between males and females. For Verapamil, Wistar Han and Sprague-Dawley strains do not show differences between male and female rats. That means that in these strains permeability data from male and female could be combined. In male rats, which are commonly used for permeability estimation, there were differences for Metoprolol permeability between Sprague-Dawley (with lower permeability values) and the other strains, while for Verapamil Sprague-Dawley and Wistar-Han showed the lower permeability values. In conclusion, the selection of rat's strain and gender for intestinal absorption experiments is a relevant element during study design and data from different strains may not be always comparable. Copyright © 2015 Elsevier B.V. All rights reserved.
Moon, Byongook; Morash, Merry
2017-01-01
The present study of 659 Korean adolescents tests General Strain Theory's (GST) utility in explaining gender differences in delinquency causation. It models the effects of key strains, negative emotions, and a composite measure of several conditioning factors separately for boys and girls and for delinquency. Consistent with the theory, males and…
Dynamic strain measurements in a sliding microstructured contact
International Nuclear Information System (INIS)
Bennewitz, Roland; David, Jonathan; Lannoy, Charles-Francois de; Drevniok, Benedict; Hubbard-Davis, Paris; Miura, Takashi; Trichtchenko, Olga
2008-01-01
A novel experiment is described which measures the tangential strain development across the contact between a PDMS (polydimethylsiloxane) block and a glass surface during the initial stages of sliding. The surface of the PDMS block has been microfabricated to take the form of a regular array of pyramidal tips at 20 μm separation. Tangential strain is measured by means of light scattering from the interface between the block and surface. Three phases are observed in all experiments: initial shear deformation of the whole PDMS block, a pre-sliding tangential compression of the tip array with stepwise increase of the compressive strain, and sliding in stick-slip movements as revealed by periodic variation of the strain. The stick-slip sliding between the regular tip array and the randomly rough counter surface always takes on the periodicity of the tip array. The fast slip can cause either a sudden increase or a sudden decrease in compressive strain
New lager yeast strains generated by interspecific hybridization.
Krogerus, Kristoffer; Magalhães, Frederico; Vidgren, Virve; Gibson, Brian
2015-05-01
The interspecific hybrid Saccharomyces pastorianus is the most commonly used yeast in brewery fermentations worldwide. Here, we generated de novo lager yeast hybrids by mating a domesticated and strongly flocculent Saccharomyces cerevisiae ale strain with the Saccharomyces eubayanus type strain. The hybrids were characterized with respect to the parent strains in a wort fermentation performed at temperatures typical for lager brewing (12 °C). The resulting beers were analysed for sugar and aroma compounds, while the yeasts were tested for their flocculation ability and α-glucoside transport capability. These hybrids inherited beneficial properties from both parent strains (cryotolerance, maltotriose utilization and strong flocculation) and showed apparent hybrid vigour, fermenting faster and producing beer with higher alcohol content (5.6 vs 4.5 % ABV) than the parents. Results suggest that interspecific hybridization is suitable for production of novel non-GM lager yeast strains with unique properties and will help in elucidating the evolutionary history of industrial lager yeast.
Construction of acetoin high-producing Bacillus subtilis strain
Directory of Open Access Journals (Sweden)
Yanjun Tian
2016-07-01
Full Text Available This paper describes the construction and selection of a high-producing mutant, Bacillus subtilis HB-32, with enhanced acetoin yield and productivity. The mutant was obtained by the protoplast fusion of a Bacillus subtilis mutant TH-49 (Val− producing acetoin and Bacillus licheniformis AD-30 producing α-acetolactate decarboxylase, with the fusogen polyethylene glycol and after the regeneration and selection, etc. of the fusant. The acetoin production reached 49.64 g/L, which is an increase of 61.8% compared to that of B. subtilis strain TH-49. Random amplified polymorphic DNA analysis was performed to determine the mutagenic and protoplast fusion effects and the genomic changes in the acetoin high-producing strain compared to the parent strains at the molecular level. The constructed strain was shown to be promising for large-scale acetoin production. Future studies should focus on the application of the mutant strain in practice.
Genetic recombination in auxotrophic strains of Phanerochaete chrysosporium
International Nuclear Information System (INIS)
Krejci, R.
1987-01-01
Four auxotrophic strains of ligninolytic basidiomycete Phanerochaete chrysosporium were obtained by UV mutagenesis. The heterokaryotic mycelium formed by complementation of different auxotrophic isolates was able to fruit and produce basidiospores. Prototrophic strains and strains with a recombined set of parental nutritional requirements were isolated from the basidiospore progeny of the heterokaryons. Genetic recombination hence takes place in fruit bodies produced by the heterokaryotic mycelium. (author). 3 tabs., 13 refs
Borehole strain observations of very low frequency earthquakes
Hawthorne, J. C.; Ghosh, A.; Hutchinson, A. A.
2016-12-01
We examine the signals of very low frequency earthquakes (VLFEs) in PBO borehole strain data in central Cascadia. These MW 3.3 - 4.1 earthquakes are best observed in seismograms at periods of 20 to 50 seconds. We look for the strain they produce on timescales from about 1 to 30 minutes. First, we stack the strain produced by 13 VLFEs identified by a grid search moment tensor inversion algorithm by Ghosh et. al. (2015) and Hutchinson and Ghosh (2016), as well as several thousand VLFEs detected through template matching these events. The VLFEs are located beneath southernmost Vancouver Island and the eastern Olympic Peninsula, and are best recorded at co-located stations B005 and B007. However, even at these stations, the signal to noise in the stack is often low, and the records are difficult to interpret. Therefore we also combine data from multiple stations and VLFE locations, and simply look for increases in the strain rate at the VLFE times, as increases in strain rate would suggest an increase in the moment rate. We compare the background strain rate in the 12 hours centered on the VLFEs with the strain rate in the 10 minutes centered on the VLFEs. The 10-minute duration is chosen as a compromise that averages out some instrumental noise without introducing too much longer-period random walk noise. Our results suggest a factor of 2 increase in strain rate--and thus moment rate--during the 10-minute VLFE intervals. The increase gives an average VLFE magnitude around M 3.5, within the range of magnitudes obtained with seismology. Further analyses are currently being carried out to better understand the evolution of moment release before, during, and after the VLFEs.
Creep strain accumulation in a typical LMFBR piperun
International Nuclear Information System (INIS)
Johnstone, T.L.
1975-01-01
The analysis described allows the strain concentrations in typical LMFBR two anchor point uniplanar piperuns to be calculated. Account is taken of the effect of pipe elbows in attracting creep strain to themselves as well as possible movements of the thrust line due to strain redistribution. The influence of the initial load conditions is also examined. The stress relaxation analysis is facilitated by making the assumption that a cross-sectional stress distribution determined by the asymptotic fully developed state of creep exists at all times. Use is then made of Hoff(s) analogy between materials with a creep law of the Norton type and those with a corresponding non-linear elastic stress strain law, to determine complementary strain energy rates for straight pipes and bends. Ovalisation of the latter produces an increased strain energy rate which can be simply calculated by comparison with an equal length of straight pipe through employing a creep flexibility factor due to Spence. Deflection rates at any location in the pipework can then be evaluated in terms of the thermal restraint forces at that location by an application of Castigliano's principle. In particular for an anchor point the deflection rates are identically zero and this leads to the generation of 3 simultaneous differential equations determining the relaxation of the anchor reactions. Indicative results are presented for the continuous relaxation at 570 deg C of the thermally induced stress in a planar approximation to a typical LMFBR pipe run chosen to have peak elbow stresses close to the code maximum. The results indicate a ratio, after 10 5 hours, of 3 for creep strain concentration relative to initial peak strain (calculated on the assumption of fully elastic behavior) in the most severely affected elbow, when either austenitic 316 or 321 creep properties are employed
Informal eldercare and work-related strain.
Trukeschitz, Birgit; Schneider, Ulrike; Mühlmann, Richard; Ponocny, Ivo
2013-03-01
In light of an aging workforce, reconciling informal eldercare and paid work becomes increasingly pertinent. This article investigates the association between informal eldercare and work-related strain and tests for both the "competing demands" and "expansion" hypotheses. The sample of 938 Austrian employees consisted of employees caring for older relatives and a control group of employees without eldercare obligations. We ran a Tobit regression model on work-related strain with different measures of informal eldercare as explanatory variables and controls for both personal and workplace characteristics. Accounting for different characteristics of eldercare within one estimation model revealed that informal eldercare was associated with work-related strain in 2 ways, that is, it increased with both care hours and subjective care burden. However, after controlling for these burdensome attributes of eldercare, the carer status as such was found to be negatively associated with work-related strain. In addition and independently of care commitments, work-related factors, such as advanced skills and job motivation, reduced work-related strain. This article lends support to both the "competing demands" and the "expansion" hypotheses. Commitment to eldercare can enhance work-related outcomes but entails work-related problems if care burden and time demands of eldercare are substantial. Thus, workers with eldercare responsibilities cannot be considered less productive from the outset. An individual assessment of their situation, considering the care and work setting, is required. Findings from this study support the design of workplace initiatives to uphold workers' productivity in general and bring specific attention to policies alleviating workers' eldercare burden.
Bacillus subtilis strain specificity affects performance improvement in broilers.
Rhayat, L; Jacquier, V; Brinch, K S; Nielsen, P; Nelson, A; Geraert, P-A; Devillard, E
2017-07-01
The study reports the effects on broiler performance of a newly isolated Bacillus subtilis strain, which is phylogenetically not closely related to already well-described strains of B. subtilis. In the first experiment, birds were reared in battery cages and exposed to C. perfringens. An increase in growth performance was observed with the strain when compared to the challenged animals. Three additional growth trials were conducted to 35 d of age, in different rearing conditions (genetic breeds, corn-soybean meal-based diet with or without animal proteins, in presence or absence of phytase, on fresh or used litter) to investigate the efficacy and the specificity of this new B. subtilis strain on the improvement of BWG and FCR of broilers in comparison with a B. subtilis-based DFM already used in the field. Whatever the rearing conditions tested, the new B. subtilis strain led to an average 3.2% improvement in feed conversion ratio or bodyweight. Comparatively, the commercial Bacillus strain significantly improved broiler performance in only one trial out of 3 with an average improvement reaching 2%. All these results indicate that this new B. subtilis strain consistently improves broiler performances. © 2017 Poultry Science Association Inc.
Antimicrobial properties of Pseudomonas strains producing the antibiotic mupirocin.
Matthijs, Sandra; Vander Wauven, Corinne; Cornu, Bertrand; Ye, Lumeng; Cornelis, Pierre; Thomas, Christopher M; Ongena, Marc
2014-10-01
Mupirocin is a polyketide antibiotic with broad antibacterial activity. It was isolated and characterized about 40 years ago from Pseudomonas fluorescens NCIMB 10586. To study the phylogenetic distribution of mupirocin producing strains in the genus Pseudomonas a large collection of Pseudomonas strains of worldwide origin, consisting of 117 Pseudomonas type strains and 461 strains isolated from different biological origins, was screened by PCR for the mmpD gene of the mupirocin gene cluster. Five mmpD(+) strains from different geographic and biological origin were identified. They all produced mupirocin and were strongly antagonistic against Staphylococcus aureus. Phylogenetic analysis showed that mupirocin production is limited to a single species. Inactivation of mupirocin production leads to complete loss of in vitro antagonism against S. aureus, except on certain iron-reduced media where the siderophore pyoverdine is responsible for the in vitro antagonism of a mupirocin-negative mutant. In addition to mupirocin some of the strains produced lipopeptides of the massetolide group. These lipopeptides do not play a role in the observed in vitro antagonism of the mupirocin producing strains against S. aureus. Copyright © 2014 Institut Pasteur. Published by Elsevier Masson SAS. All rights reserved.
Complete Genome Sequence of Escherichia coli Strain WG5
DEFF Research Database (Denmark)
Imamovic, Lejla; Misiakou, Maria-Anna; van der Helm, Eric
2018-01-01
Escherichia coli strain WG5 is a widely used host for phage detection, including somatic coliphages employed as standard ISO method 10705-1 (2000). Here, we present the complete genome sequence of a commercial E. coli WG5 strain.......Escherichia coli strain WG5 is a widely used host for phage detection, including somatic coliphages employed as standard ISO method 10705-1 (2000). Here, we present the complete genome sequence of a commercial E. coli WG5 strain....
Effect of plastic strain on fracture strength of cracked components
International Nuclear Information System (INIS)
Kamaya, Masayuki
2009-01-01
Nuclear power plant components are occasionally subjected to large load by earthquake and may suffer plastic strain. Although the plastic strain induced in materials increases the strength, it may reduce the fracture toughness due to a crack in the components. In this study, the effect of the plastic strain on strength of cracked components was investigated. Firstly, the change in the tensile properties and fracture toughness due to plastic strain were examined for Type 316 stainless steel and carbon steel (SM490). The degree of nominal plastic strain was 5%, 10%, 20% and 40% (only for stainless steel). Secondly, the J-integral values of surface crack on a pipe were evaluated by finite element analyses. Finally, the critical load for fracture of the cracked pipe was evaluated for various pipe and crack geometries using the J-integral values and the fracture toughness obtained. It was concluded that the plastic strain enhances the fracture strength of the cracked components when the induced plastic strain is less than 10%, although the extremely large plastic strain could reduce the strength. (author)
Effect of plastic strain on fracture strength of cracked components
International Nuclear Information System (INIS)
Kamaya, Masayuki
2010-01-01
Nuclear power plant components are occasionally subjected to excessive load by earthquake and may suffer plastic strain. Although the plastic strain introduced in materials increases the strength, it may reduce the fracture toughness. In this study, the effect of the plastic strain on strength of cracked components was investigated. Firstly, the change in the tensile properties and fracture toughness due to plastic strain were examined for Type 316 stainless steel and carbon steel (SM 490). The degree of nominal plastic strain was 5%, 10%, 20% and 40% (only for stainless steel). Secondly, the J-integral values of surface crack on a pipe were evaluated by finite element analyses. Finally, the critical load for fracture of the cracked pipe was evaluated for various pipe and crack geometries using the J-integral values and the fracture toughness obtained. It was concluded that the plastic strain enhances the fracture strength of the cracked components when the induced plastic strain is less than 10%, although the extremely large plastic strain could reduce the strength. (author)
International Nuclear Information System (INIS)
Kuang, Wenjun; Was, Gary S.
2015-01-01
Graphical abstract: The stress amplitude of serrations first increases with decreasing strain rate and then gradually saturates. The matrix carbon concentration affects the stress amplitude and the tendency to saturation. - Abstract: The effect of strain rate on dynamic strain aging of cold-rolled Ni-based alloy was investigated. With decreasing strain rate, the stress amplitude of serrations first increased and then saturated. Compared with the solution-annealed condition, the thermally-treated condition produced smaller stress amplitudes that saturated at a lower strain rate. Observations are consistent with a mechanism in which the locking strength of solute atmospheres first increases with increasing solute atom arrival at dislocations and gradually saturates as solute reaches a critical level
Brittle superconducting magnets: an equivilent strain model
International Nuclear Information System (INIS)
Barzi, E.; Danuso, M.
2010-01-01
To exceed fields of 10 T in accelerator magnets, brittle superconductors like A15 Nb 3 Sn and Nb 3 Al or ceramic High Temperature Superconductors have to be used. For such brittle superconductors it is not their maximum tensile yield stress that limits their structural resistance as much as strain values that provoke deformations in their delicate lattice, which in turn affect their superconducting properties. Work on the sensitivity of Nb 3 Sn cables to strain has been conducted in a number of stress states, including uniaxial and multi-axial, producing usually different results. This has made the need of a constituent design criterion imperative for magnet builders. In conventional structural problems an equivalent stress model is typically used to verify mechanical soundness. In the superconducting community a simple scalar equivalent strain to be used in place of an equivalent stress would be an extremely useful tool. As is well known in fundamental mechanics, there is not one single way to reduce a multiaxial strain state as represented by a 2nd order tensor to a scalar. The conceptual experiment proposed here will help determine the best scalar representation to use in the identification of an equivalent strain model.
Crack initiation under generalized plane strain conditions
International Nuclear Information System (INIS)
Shum, D.K.M.; Merkle, J.G.
1991-01-01
A method for estimating the decrease in crack-initiation toughness, from a reference plane strain value, due to positive straining along the crack front of a circumferential flaw in a reactor pressure vessel is presented in this study. This method relates crack initiation under generalized plane strain conditions with material failure at points within a distance of a few crack-tip-opening displacements ahead of a crack front, and involves the formulation of a micromechanical crack-initiation model. While this study is intended to address concerns regarding the effects of positive out-of- plane straining on ductile crack initiation, the approach adopted in this work can be extended in a straightforward fashion to examine conditions of macroscopic cleavage crack initiation. Provided single- parameter dominance of near-tip fields exists in the flawed structure, results from this study could be used to examine the appropriateness of applying plane strain fracture toughness to the evaluation of circumferential flaws, in particular to those in ring-forged vessels which have no longitudinal welds. In addition, results from this study could also be applied toward the analysis of the effects of thermal streaming on the fracture resistance of circumferentially oriented flaws in a pressure vessel. 37 refs., 8 figs., 1 tab
Axial strain in GaAs/InAs core-shell nanowires
Energy Technology Data Exchange (ETDEWEB)
Biermanns, Andreas; Pietsch, Ullrich [Universitaet Siegen, Festkoerperphysik, 57068 Siegen (Germany); Rieger, Torsten; Gruetzmacher, Detlev; Ion Lepsa, Mihail [Peter Gruenberg Institute (PGI-9), Forschungszentrum, 52425 Juelich (Germany); JARA-Fundamentals of Future Information Technology, 52425 Juelich (Germany); Bussone, Genziana [Universitaet Siegen, Festkoerperphysik, 57068 Siegen (Germany); ESRF, 6 rue Jules Horowitz, BP220, F-38043 Grenoble Cedex (France)
2013-01-28
We study the axial strain relaxation in GaAs/InAs core-shell nanowire heterostructures grown by molecular beam epitaxy. Besides a gradual strain relaxation of the shell material, we find a significant strain in the GaAs core, increasing with shell thickness. This strain is explained by a saturation of the dislocation density at the core-shell interface. Independent measurements of core and shell lattice parameters by x-ray diffraction reveal a relaxation of 93% in a 35 nm thick InAs shell surrounding cores of 80 nm diameter. The compressive strain of -0.5% compared to bulk InAs is accompanied by a tensile strain up to 0.9% in the GaAs core.
Mobilomics in Saccharomyces cerevisiae strains.
Menconi, Giulia; Battaglia, Giovanni; Grossi, Roberto; Pisanti, Nadia; Marangoni, Roberto
2013-03-20
Mobile Genetic Elements (MGEs) are selfish DNA integrated in the genomes. Their detection is mainly based on consensus-like searches by scanning the investigated genome against the sequence of an already identified MGE. Mobilomics aims at discovering all the MGEs in a genome and understanding their dynamic behavior: The data for this kind of investigation can be provided by comparative genomics of closely related organisms. The amount of data thus involved requires a strong computational effort, which should be alleviated. Our approach proposes to exploit the high similarity among homologous chromosomes of different strains of the same species, following a progressive comparative genomics philosophy. We introduce a software tool based on our new fast algorithm, called regender, which is able to identify the conserved regions between chromosomes. Our case study is represented by a unique recently available dataset of 39 different strains of S.cerevisiae, which regender is able to compare in few minutes. By exploring the non-conserved regions, where MGEs are mainly retrotransposons called Tys, and marking the candidate Tys based on their length, we are able to locate a priori and automatically all the already known Tys and map all the putative Tys in all the strains. The remaining putative mobile elements (PMEs) emerging from this intra-specific comparison are sharp markers of inter-specific evolution: indeed, many events of non-conservation among different yeast strains correspond to PMEs. A clustering based on the presence/absence of the candidate Tys in the strains suggests an evolutionary interconnection that is very similar to classic phylogenetic trees based on SNPs analysis, even though it is computed without using phylogenetic information. The case study indicates that the proposed methodology brings two major advantages: (a) it does not require any template sequence for the wanted MGEs and (b) it can be applied to infer MGEs also for low coverage genomes
Mobilomics in Saccharomyces cerevisiae strains
2013-01-01
Background Mobile Genetic Elements (MGEs) are selfish DNA integrated in the genomes. Their detection is mainly based on consensus–like searches by scanning the investigated genome against the sequence of an already identified MGE. Mobilomics aims at discovering all the MGEs in a genome and understanding their dynamic behavior: The data for this kind of investigation can be provided by comparative genomics of closely related organisms. The amount of data thus involved requires a strong computational effort, which should be alleviated. Results Our approach proposes to exploit the high similarity among homologous chromosomes of different strains of the same species, following a progressive comparative genomics philosophy. We introduce a software tool based on our new fast algorithm, called regender, which is able to identify the conserved regions between chromosomes. Our case study is represented by a unique recently available dataset of 39 different strains of S.cerevisiae, which regender is able to compare in few minutes. By exploring the non–conserved regions, where MGEs are mainly retrotransposons called Tys, and marking the candidate Tys based on their length, we are able to locate a priori and automatically all the already known Tys and map all the putative Tys in all the strains. The remaining putative mobile elements (PMEs) emerging from this intra–specific comparison are sharp markers of inter–specific evolution: indeed, many events of non–conservation among different yeast strains correspond to PMEs. A clustering based on the presence/absence of the candidate Tys in the strains suggests an evolutionary interconnection that is very similar to classic phylogenetic trees based on SNPs analysis, even though it is computed without using phylogenetic information. Conclusions The case study indicates that the proposed methodology brings two major advantages: (a) it does not require any template sequence for the wanted MGEs and (b) it can be applied to
Present-day crustal deformation and strain transfer in northeastern Tibetan Plateau
Li, Yuhang; Liu, Mian; Wang, Qingliang; Cui, Duxin
2018-04-01
The three-dimensional present-day crustal deformation and strain partitioning in northeastern Tibetan Plateau are analyzed using available GPS and precise leveling data. We used the multi-scale wavelet method to analyze strain rates, and the elastic block model to estimate slip rates on the major faults and internal strain within each block. Our results show that shear strain is strongly localized along major strike-slip faults, as expected in the tectonic extrusion model. However, extrusion ends and transfers to crustal contraction near the eastern margin of the Tibetan Plateau. The strain transfer is abrupt along the Haiyuan Fault and diffusive along the East Kunlun Fault. Crustal contraction is spatially correlated with active uplifting. The present-day strain is concentrated along major fault zones; however, within many terranes bounded by these faults, intra-block strain is detectable. Terranes having high intra-block strain rates also show strong seismicity. On average the Ordos and Sichuan blocks show no intra-block strain, but localized strain on the southwestern corner of the Ordos block indicates tectonic encroachment.
1977-03-10
Regulus calendula cineaceus Ruby-crowned Kinglet 197. Anthus spinoietta rubescens Water Pipit 198. Bombycilla cedrorum Cedar Waxwing 199. Phainopela nitens...supersonic routes over Nevada, and I’m not entirely familiar with the terminology used for these routes, but I know they have oil burner routes, et...that B-52 was on an oil burner route, but I don’t know, but he has to file a clearance also. MR. GILLIGAM: The only thing I am concerned about is if
Contribution to a macromycete survey of the states of Rio Grande do Sul and Santa Catarina in Brazil
Sobestiansky, Georg
2005-01-01
Collections of macromycetes made in seven municipalities in southern Brazil, viz. six in Rio Grande do Sul and one in Santa Catarina, are listed. They belonged to the Myxomycota (6 spp.), Ascomycota (54 spp.) and Basidiomycota (189 spp.). First records for Brazil could be Battarrea phalloides, Amanita rubescens, Boletus edulis and Mycena filopes, the last three found under exotic Pinus.São listadas as coletas executadas pelo autor em sete municípios no sul do Brasil, sendo seis no estado de R...
DEFF Research Database (Denmark)
Christensen, Laurids Siig; Schöller, S.; Schierup, M. H.
2002-01-01
A total of 199 serum samples from patients with measles collected in Denmark, Greenland and the Faroe Islands from 1964 to 1983 were analysed by PCR. Measles virus (MV) RNA could be detected in 38 (19%) of the samples and a total of 18 strains were subjected to partial sequence analysis of the he......A total of 199 serum samples from patients with measles collected in Denmark, Greenland and the Faroe Islands from 1964 to 1983 were analysed by PCR. Measles virus (MV) RNA could be detected in 38 (19%) of the samples and a total of 18 strains were subjected to partial sequence analysis...... of the hemagglutinin gene. The strains exhibited a considerable genomic diversity, which is at odds with the assumption that one genome type prevailed among globally circulating MV strains prior to the advent of live-attenuated vaccines. Our data indicate that the similarity of the various vaccine strains...... is attributed to their having originated from the same primary isolate. Consequently, it is implied that a small number of clinical manifestations of MV worldwide from which strains similar to the vaccine strain were identified were vaccine related rather than being caused by members of a persistently...
Genetic diversity among major endemic strains of Leptospira interrogans in China
Directory of Open Access Journals (Sweden)
Zhang Zhi-Ming
2007-07-01
Full Text Available Abstract Background Leptospirosis is a world-widely distributed zoonosis. Humans become infected via exposure to pathogenic Leptospira spp. from contaminated water or soil. The availability of genomic sequences of Leptospira interrogans serovar Lai and serovar Copenhageni opened up opportunities to identify genetic diversity among different pathogenic strains of L. interrogans representing various kinds of serotypes (serogroups and serovars. Results Comparative genomic hybridization (CGH analysis was used to compare the gene content of L. interrogans serovar Lai strain Lai with that of other 10 L. interrogans strains prevailed in China and one identified from Brazil using a microarray spotted with 3,528 protein coding sequences (CDSs of strain Lai. The cutoff ratio of sample/reference (S/R hybridization for detecting the absence of genes from one tested strain was set by comparing the ratio of S/R hybridization and the in silico sequence similarities of strain Lai and serovar Copenhageni strain Fiocruz L1-130. Among the 11 strains tested, 275 CDSs were found absent from at least one strain. The common backbone of the L. interrogans genome was estimated to contain about 2,917 CDSs. The genes encoding fundamental cellular functions such as translation, energy production and conversion were conserved. While strain-specific genes include those that encode proteins related to either cell surface structures or carbohydrate transport and metabolism. We also found two genomic islands (GIs in strain Lai containing genes divergently absent in other strains. Because genes encoding proteins with potential pathogenic functions are located within GIs, these elements might contribute to the variations in disease manifestation. Differences in genes involved in O-antigen biosynthesis were also identified for strains belonging to different serogroups, which offers an opportunity for future development of genomic typing tools for serological classification