
Sample records for planktothrix rubescens strain

  1. A genome-wide analysis of nonribosomal peptide synthetase gene clusters and their peptides in a Planktothrix rubescens strain

    Directory of Open Access Journals (Sweden)

    Nederbragt Alexander J


    Full Text Available Abstract Background Cyanobacteria often produce several different oligopeptides, with unknown biological functions, by nonribosomal peptide synthetases (NRPS. Although some cyanobacterial NRPS gene cluster types are well described, the entire NRPS genomic content within a single cyanobacterial strain has never been investigated. Here we have combined a genome-wide analysis using massive parallel pyrosequencing ("454" and mass spectrometry screening of oligopeptides produced in the strain Planktothrix rubescens NIVA CYA 98 in order to identify all putative gene clusters for oligopeptides. Results Thirteen types of oligopeptides were uncovered by mass spectrometry (MS analyses. Microcystin, cyanopeptolin and aeruginosin synthetases, highly similar to already characterized NRPS, were present in the genome. Two novel NRPS gene clusters were associated with production of anabaenopeptins and microginins, respectively. Sequence-depth of the genome and real-time PCR data revealed three copies of the microginin gene cluster. Since NRPS gene cluster candidates for microviridin and oscillatorin synthesis could not be found, putative (gene encoded precursor peptide sequences to microviridin and oscillatorin were found in the genes mdnA and oscA, respectively. The genes flanking the microviridin and oscillatorin precursor genes encode putative modifying enzymes of the precursor oligopeptides. We therefore propose ribosomal pathways involving modifications and cyclisation for microviridin and oscillatorin. The microviridin, anabaenopeptin and cyanopeptolin gene clusters are situated in close proximity to each other, constituting an oligopeptide island. Conclusion Altogether seven nonribosomal peptide synthetase (NRPS gene clusters and two gene clusters putatively encoding ribosomal oligopeptide biosynthetic pathways were revealed. Our results demonstrate that whole genome shotgun sequencing combined with MS-directed determination of oligopeptides successfully

  2. Health risk evaluation associated to Planktothrix rubescens: An integrated approach to design tailored monitoring programs for human exposure to cyanotoxins. (United States)

    Manganelli, Maura; Scardala, Simona; Stefanelli, Mara; Vichi, Susanna; Mattei, Daniela; Bogialli, Sara; Ceccarelli, Piegiorgio; Corradetti, Ernesto; Petrucci, Ines; Gemma, Simonetta; Testai, Emanuela; Funari, Enzo


    Increasing concern for human health related to cyanotoxin exposure imposes the identification of pattern and level of exposure; however, current monitoring programs, based on cyanobacteria cell counts, could be inadequate. An integrated approach has been applied to a small lake in Italy, affected by Planktothrix rubescens blooms, to provide a scientific basis for appropriate monitoring program design. The cyanobacterium dynamic, the lake physicochemical and trophic status, expressed as nutrients concentration and recycling rates due to bacterial activity, the identification/quantification of toxic genotype and cyanotoxin concentration have been studied. Our results indicate that low levels of nutrients are not a marker for low risk of P. rubescens proliferation and confirm that cyanobacterial density solely is not a reliable parameter to assess human exposure. The ratio between toxic/non-toxic cells, and toxin concentrations, which can be better explained by toxic population dynamic, are much more diagnostic, although varying with time and environmental conditions. The toxic fraction within P. rubescens population is generally high (30-100%) and increases with water depth. The ratio toxic/non-toxic cells is lowest during the bloom, suggesting a competitive advantage for non-toxic cells. Therefore, when P. rubescens is the dominant species, it is important to analyze samples below the thermocline, and quantitatively estimate toxic genotype abundance. In addition, the identification of cyanotoxin content and congeners profile, with different toxic potential, are crucial for risk assessment. Copyright 2009 Elsevier Ltd. All rights reserved.

  3. Management of a toxic cyanobacterium bloom (Planktothrix rubescens) affecting an Italian drinking water basin: a case study. (United States)

    Bogialli, Sara; Nigro di Gregorio, Federica; Lucentini, Luca; Ferretti, Emanuele; Ottaviani, Massimo; Ungaro, Nicola; Abis, Pier Paolo; Cannarozzi de Grazia, Matteo


    An extraordinary bloom of Planktothrix rubescens, which can produce microcystins (MCs), was observed in early 2009 in the Occhito basin, used even as a source of drinking water in Southern Italy. Several activities, coordinated by a task force, were implemented to assess and manage the risk associated to drinking water contaminated by cyanobacteria. Main actions were: evaluation of analytical protocols for screening and confirmatory purpose, monitoring the drinking water supply chain, training of operators, a dedicated web site for risk communication. ELISA assay was considered suitable for health authorities as screening method for MCs and to optimize frequency of sampling according to alert levels, and as internal control for the water supplier. A liquid chromatography-tandem mass spectrometric method able to quantify 9 MCs was optimized with the aim of supporting health authorities in a comprehensive risk evaluation based on the relative toxicity of different congeners. Short, medium, and long-term corrective actions were implemented to mitigate the health risk. Preoxidation with chlorine dioxide followed by flocculation and settling have been shown to be effective in removing MCs in the water treatment plant. Over two years, despite the high levels of cyanobacteria (up to 160 × 10(6) cells/L) and MCs (28.4 μg/L) initially reached in surface waters, the drinking water distribution was never limited.

  4. [ADMAdda5]-microcystins in Planktothrix agardhii strain PH-123 (cyanobacteria) -  importance for monitoring of microcystins in the environment

    DEFF Research Database (Denmark)

    Laub, J.; Henriksen, P.; Brittain, S.M.


    Two major and two minor microcystins (MCYST) were isolated from a hepatotoxic Danish strain of Planktothrix agardhii (Gomont) Anagnostidis et Komárek by reversed-phase high-performance liquid chromatography. The microcystins were characterized by UV spectroscopy, amino acid analysis, fast atom bo...... in Wiley InterScience ( DOI 10.1002/tox.10042...

  5. Frequency of inhibitors of daphnid trypsin in the widely distributed cyanobacterial genus Planktothrix

    DEFF Research Database (Denmark)

    Rohrlack, T.; Christoffersen, K.; Friberg-Jensen, U.


    on the frequency of such compounds in the widely distributed cyanobacterial genus Planktothrix. Of the 89 Planktothrix strains analysed, about 70% produced inhibitors of daphnid trypsin. The strains tested positive represented three common Planktothrix species and were isolated from diverse localities...

  6. Low antiplasmodial activity of alkaloids and amides from the stem bark of Zanthoxylum rubescens (Rutaceae

    Directory of Open Access Journals (Sweden)

    Penali L.


    Full Text Available The stem bark of Zanthoxylum rubescens (syn. Fagara rubescens is used for treating fevers associated with malaria in the Ivory Coast. Three alkaloids: N-nornitidine, 7,9-dimethoxy-2,3- methylenedioxybenzophenanthridine, and bis[6-(5,6- dihydrochelerythrinyl] ether; and two amides: zanthomamide and lemairamide, were isolated from the stem bark of this plant. These compounds were screened in vitro against the chloroquine-sensitive 3D7 strain and the chloroquine-resistant FCM29 strain of P. falciparum. N-nornitidine was found to be inactive. 7,9- dimethoxy-2,3-methylenedioxybenzophenanthridine, lemairamide and zanthomamide showed weak activity with average IC50 values ranging from 45.6 μM to 149.9 μM. Bis[6-(5,6- dihydrochelerythrinyl] ether was the most active of the tested compounds with mean IC50s of 14.9 ± 1.4 μM in FCM29 strain and 15.3 ± 3.4 μM in 3D7 strain (~ 58 to ~ 1130 times less active than chloroquine respectively. The anti-Plasmodium activities of the tested alkaloids of Z. rubescens were low; and do not encourage the use of this plant as antimalarial.

  7. Antibacterial Activities and Mechanism of Action of Acetone Extracts from Rabdosia rubescens

    Directory of Open Access Journals (Sweden)

    Li Ping Cheng


    Full Text Available The antibacterial activities and mechanism of action of acetone extracts from R. rubescens were reported in this paper. The results showed that 80% acetone extracts had both the highest contents of total phenolics and flavonoids. Acetone extracts showed better antibacterial activities against Gram-positive bacterial strains and there were no inhibitory effects found on tested Gram-negative bacteria. In addition, 80% acetone extracts from R. rubescens had relatively higher antibacterial activities with the lowest values of MIC and MBC at 2.5 mg/mL and 5 mg/mL against B. subtilis. The antibacterial mechanism of 80% acetone extracts against Bacillus subtilis might be described as disrupting cell wall, increasing cell membrane permeability, and finally leading to the leakage of cell constituents

  8. Study on the Application of Chinese Patent Drug and Chinese Formula of Rabdosia Rubescens (United States)

    Peng, Mengfan; Liu, Baosong; Mao, Mingsan


    Rabdosia rubescens contais many active ingredients such as terpenoids, flavonoids, polysaccharides and organic acids. Modern research has proved that Rabdosia rubescens has the effect of heat-clearing and detoxicating, antibacterial and anticancer, promoting blood circulation to arrest pain and anti-tumor. It is used in the treatment of sore throat, rheumatoid arthritis and various kinds of cancer. The clinical application of Rabdosia rubescens is restricted in the fat-soluble components, and the solubility of water solubility is ignored. The application of prescriptions, Chinese patent drug and food therapy of Rabdosia rubescens are less and fragmented. This paper inquires relevant literature, the application of Rabdosia rubescens in prescription, Chinese patent medicine and food therapy was reviewed, in order to make Rabdosiae rubescens play a greater role in the relevant area. On the basis of make the best use of everything, to promote the innovation and development of Chinese medicine and services to the people in our country.

  9. MIB-producing cyanobacteria (Planktothrix sp.) in a drinking water reservoir: distribution and odor producing potential. (United States)

    Su, Ming; Yu, Jianwei; Zhang, Junzhi; Chen, Hui; An, Wei; Vogt, Rolf D; Andersen, Tom; Jia, Dongmin; Wang, Jingshi; Yang, Min


    The production of odorant 2-methylisoborneol (MIB) in water bodies by Planktothrix sp. have not been understood very well. Through a four-year investigation in Miyun Reservoir, a huge mesotrophic drinking water reservoir known to have the MIB episodes, we found that the Planktothrix sp. bloomed during September and October causing the high levels of MIB in the reservoir. The concentration of MIB and the biomass of MIB-producing cyanobacteria Planktothrix were measured (n = 887) at different sites and depths during different seasons. The results indicated that the shallow region of the reservoir is the major habitat for Planktothrix sp. due to that the light is able to penetrate down to the relatively high concentrations of nutrients close to the sediments. Quantile regression analysis between Planktothrix biomass and MIB concentration shows that the risk of MIB exceeding the odor threshold (15 ng L⁻¹) in water was as high as 90% when the Planktothrix density was more than 4.0 × 10⁵ cells L⁻¹, while the risk was reduced to 10% when the Planktothrix density remained below 1.6 × 10⁴ cells L⁻¹. This study will improve the understanding of the environmental behaviors of Planktothrix sp., and can provide useful information for better management of drinking water lakes/reservoirs experiencing the taste and odor (T&O) problems caused by deep living cyanobacterial species.

  10. Protein (Cyanobacteria): 652391838 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  11. Antinociceptive effect of critoniella acuminata, physalis peruviana and salvia rubescens


    Munóz, Carol; Vergel, Nadezdha E.; Aragón, Diana Marcela; Ospina, Luis Fernando


    Se evaluó el efecto antinociceptivo de extractos, fracciones y compuestos de Critoniella acuminata, Physalis peruviana y Salvia rubescens mediante los métodos de placa caliente, contorsiones abdominales inducidas por ácido acético y ensayo de la formalina. La fracción de Critoniella acuminata en dosis de 100 mg/kg p.o. presentó actividad antinociceptiva al aumentar el tiempo de reacción del animal ante la aplicación de un estímulo térmico (método de la placa caliente), mient...

  12. A New Asymmetric ent-Kauranoid Dimer from Rabdosia rubescens

    Institute of Scientific and Technical Information of China (English)

    LU Hai-ying; LIANG Jing-yu


    Objective To study the ent-kaurane diterpenoids from Rabdosia rubescens.Methods The compounds were isolated by chromatographies and their structures were identified by spectral analyses.Results Four compounds were isolated,and they were identified as bisrubescensin E (1),2α,3α,24-trihydroxyurs-12-en-28-oic acid (2),2α,3α,24-trihydroxyurs-12,20-(30)-dien-28-oic acid (3),and 6,7-dihydroxycoumarin (4).Conclusion Compound 1 is a new asymmetric ent-kauranoid dimer.Compound 2 is isolated from the plant for the first time.Compounds 3 and 4 are isolated from the plants ofRabdosia (B1.) Hassk for the first time.

  13. Detection of a Planktothrix agardhii Bloom in Portuguese Marine Coastal Waters

    Directory of Open Access Journals (Sweden)

    Catarina Churro


    Full Text Available Cyanobacteria blooms are frequent in freshwaters and are responsible for water quality deterioration and human intoxication. Although, not a new phenomenon, concern exists on the increasing persistence, scale, and toxicity of these blooms. There is evidence, in recent years, of the transfer of these toxins from inland to marine waters through freshwater outflow. However, the true impact of these blooms in marine habitats has been overlooked. In the present work, we describe the detection of Planktothrix agardhii, which is a common microcystin producer, in the Portuguese marine coastal waters nearby a river outfall in an area used for shellfish harvesting and recreational activities. P. agardhii was first observed in November of 2016 in seawater samples that are in the scope of the national shellfish monitoring system. This occurrence was followed closely between November and December of 2016 by a weekly sampling of mussels and water from the sea pier and adjacent river mouth with salinity ranging from 35 to 3. High cell densities were found in the water from both sea pier and river outfall, reaching concentrations of 4,960,608 cells·L−1 and 6810.3 × 106 cells·L−1 respectively. Cultures were also established with success from the environment and microplate salinity growth assays showed that the isolates grew at salinity 10. HPLC-PDA analysis of total microcystin content in mussel tissue, water biomass, and P. agardhii cultures did not retrieve a positive result. In addition, microcystin related genes were not detected in the water nor cultures. So, the P. agardhii present in the environment was probably a non-toxic strain. This is, to our knowledge, the first report on a P. agardhii bloom reaching the sea and points to the relevance to also monitoring freshwater harmful phytoplankton and related toxins in seafood harvesting and recreational coastal areas, particularly under the influence of river plumes.

  14. Morpho-physiological effects of ibuprofen on Scenedesmus rubescens. (United States)

    Moro, Isabella; Matozzo, Valerio; Piovan, Anna; Moschin, Emanuela; Vecchia, Francesca Dalla


    The pollution of aquatic bodies by drugs is an emerging environmental problem, because of their extensive use in animal and human context. Ibuprofen, 2-[4-(2-methylpropyl)phenyl]propanoic acid, is the non-steroidal anti-inflammatory drug mainly present both in wastewater and in rivers and lakes in Europe. Since in literature there is little information about the effects of ibuprofen on microalgae, in this paper we presented the results on the effects of this molecule at different concentrations (62.5μgL(-1), 250μgL(-1) and 1000μgL(-1)) on cultures of the freshwater microalga Scenedesmus rubescens (P.J.L. Dangeard) E. Kesslet et al. Ibuprofen effects on the alga were assayed at first through analyses of the growth curve. Moreover, analyses of cell morphology, ultrastructure, and photosynthetic pigments were additionally performed. The first negative effect of the drug was on the microalga growth, suggesting a drug action dose-dependent mechanism type, more evident at the concentration of 1000μgL(-1) ibuprofen and in the last phase of the growth curve. In support of this, following ibuprofen exposure, the cells exhibited morphological and ultrastructural alterations, mainly consisting in large cytoplasmic inclusions, probably of lipids and/or carotenoids. The decrease of chlorophyll amounts and, on the contrary, the increase of carotenoids were correlated with a stressful condition induced by drug. Copyright © 2014 Elsevier B.V. All rights reserved.

  15. Development of nitrogen supply strategy for Scenedesmus rubescens attached cultivation toward growth and lipid accumulation. (United States)

    Cheng, Pengfei; Wang, Yan; Osei-Wusu, David; Wang, Yuanzhu; Liu, Tianzhong


    In this study, the microalgae Scenedesmus rubescens were cultivated under the following nitrogen sources, nitrogen concentrations, and nitrogen feeding times (NFTs). This was to help assess biomass and lipid productivity. Scenedesmus rubescens can grow well by adhering to the cellulose acetate membrane in five kinds of nitrogen medium: KNO 3 , urea, NaNO 3 , (NH 4 ) 2 CO 3 , and NH 4 NO 3 . Under the criteria of bio-productivity and lipid productivity, urea was the optimal nitrogen source. Among different urea concentrates, biomass productivity and lipid content of S. rubescens cultivated in 0.27 g/L urea medium were optimized at 8.8 g/(m 2  day) and 31.1%, respectively. With attached cultivation, the highest biomass of 9.4 g/m 2 was obtained at NFTs of 4 days. These results showed that culturing S. rubescens using urea as sole nitrogen source by improving nitrogen uptake with attached cultivation is more efficient.

  16. Protein (Cyanobacteria): 652390766 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  17. In-situ optical and acoustical measurements of the buoyant cyanobacterium p. Rubescens: spatial and temporal distribution patterns.

    Directory of Open Access Journals (Sweden)

    Hilmar Hofmann

    Full Text Available Optical (fluorescence and acoustic in-situ techniques were tested in their ability to measure the spatial and temporal distribution of plankton in freshwater ecosystems with special emphasis on the harmful and buoyant cyanobacterium P. rubescens. Fluorescence was measured with the multi-spectral FluoroProbe (Moldaenke FluoroProbe, MFP and a Seapoint Chlorophyll Fluorometer (SCF. In-situ measurements of the acoustic backscatter strength (ABS were conducted with three different acoustic devices covering multiple acoustic frequencies (614 kHz ADCP, 2 MHz ADP, and 6 MHz ADV. The MFP provides a fast and reliable technique to measure fluorescence at different wavelengths in situ, which allows discriminating between P. rubescens and other phytoplankton species. All three acoustic devices are sensitive to P. rubescens even if other scatterers, e.g., zooplankton or suspended sediment, are present in the water column, because P. rubescens containing gas vesicles has a strong density difference and hence acoustic contrast to the ambient water and other scatterers. After calibration, the combination of optical and acoustical measurements not only allows qualitative and quantitative observation of P. rubescens, but also distinction between P. rubescens, other phytoplankton, and zooplankton. As the measuring devices can sample in situ at high rates they enable assessment of plankton distributions at high temporal (minutes and spatial (decimeters resolution or covering large temporal (seasonal and spatial (basin scale scales.

  18. Effect of total flavonoid in rabdosia rubescens on tolerant mice models under cerebral anoxia

    Directory of Open Access Journals (Sweden)

    Le Kang


    Conclusion: The total flavonoid in rabdosia rubescens can stimulate an endogenous protective mechanism by inducing the release of low levels of cytokines NO and NOS, which reduces the release of serum NSE, relieves the brain tissue ischemia-reperfusion injury, and further improves the protection effect of ischemic preconditioning on brain injury. The damage of brain tissue ischemia and reperfusion, and further improve the ischemia Protective effect of preconditioning on brain injury.

  19. Sprectroradiometric characteristics of inland water bodies infestated by Oscillatoria rubescens algae (United States)

    Ciraolo, Giuseppe; La Loggia, Goffredo; Maltese, Antonino


    In December 2006 blooms of Oscillatoria rubescens were found in the reservoir Prizzi in Sicily. Oscillatoria is a genus of filamentous alga comprising approximately 6 species, between these the O. rubescens is sadly famous since this organism produces microcystins which are powerful hepatotoxins. Firstly found in Europe in 1825 on Geneva lake, recently (2006) those algae has been find out in Pozzillo, Nicoletti e Ancipa reservoirs (Enna Province), as well as in Prizzi (Palermo Province) and Garcia reservoirs (Trapani Province). Toxins produced by those bacteria (usually called microcystine LR-1 and LR-2) are highly toxic since they can activate oncogenes cells causing cancer pathologies on liver and gastrointestinal tract. Even if water treatment plants should ensure the provision of safe drinking water from surface waters contaminated with those toxic algae blooms, the contamination of reservoirs used for civil and agricultural supply highlights human health risks. International literature suggests a threshold value of 0.01 μgl-1 to avoid liver cancer using water coming from contaminated water bodies for a long period. Since O. rubescens activities is strongly related to phosphate and nitrogen compounds as well as to temperature and light transmission within water, the paper presents the comparison between optical properties of the water of an infested reservoir and those of a reservoir characterized by clear water. Field campaigns were carried out in February-March 2008 in order to quantify the spectral transparencies of two water bodies through the calculation of the diffuse attenuation coefficient, measuring underwater downwelling irradiance at different depths as well as water spectral reflectance. Results show that diffuse attenuation coefficient is reduced by approximately 15% reducing light penetration in the water column; coherently reflectance spectral signature generally decreases, exhibiting a characteristic peak around 703 nm not present in

  20. Analysis of the transcriptome of Isodon rubescens and key enzymes involved in terpenoid biosynthesis

    Directory of Open Access Journals (Sweden)

    Xiuhong Su


    Full Text Available Isodon rubescens is an important medicinal plant in China that has been shown to reduce tumour growth due to the presence of the compound oridonin. In an effort to facilitate molecular research on oridonin biosynthesis, we reported the use of next generation massively parallel sequencing technologies and de novo transcriptome assembly to gain a comprehensive overview of I. rubescens transcriptome. In our study, a total of 50,934,276 clean reads, 101,640 transcripts and 44,626 unigenes were generated through de novo transcriptome assembly. A number of unigenes – 23,987, 10,263, 7359, 18,245, 17,683, 19,485, 9361 – were annotated in the National Center for Biotechnology Information (NCBI non-redundant protein (Nr, NCBI nucleotide sequences (Nt, Kyoto Encyclopedia of Genes and Genomes (KEGG Orthology (KO, Swiss-Prot, protein family (Pfam, gene ontology (GO, eukaryotic ortholog groups (KOG databases, respectively. Furthermore, the annotated unigenes were functionally classified according to the GO, KOG and KEGG. Based on these results, candidate genes encoding enzymes involved in terpenoids backbone biosynthesis were detected. Our data provided the most comprehensive sequence resource available for the study on I. rubescens, as well as demonstrated the effective use of Illumina sequencing and de novo transcriptome assembly on a species lacking genomic information.

  1. Simultaneous characterization and quantification of 17 main compounds in Rabdosia rubescens by high performance liquid chromatography

    Directory of Open Access Journals (Sweden)

    Sen Guo


    Full Text Available Rabdosia rubescens is a healthy herbal tea and well-known Chinese medicinal herb. To evaluate the quality of R. rubescens from China, a high performance liquid chromatography method with dual-wavelength detection was developed and validated. The method was successfully applied for the simultaneous characterization and quantification of 17 main constituents from four different cultivation regions in China. Under optimal conditions, analysis was performed on a Luna C-18 column and gradient elution with a solvent system of acetonitrile and 0.5% (v/v acetic acid–water at a flow rate of 1.0 mL/min and wavelength of 220 nm and 280 nm. All standard calibration curves exhibited good linearity (r2 > 0.9992 within the test ranges. The precision was evaluated by intraday and interday tests, which revealed relative standard deviation values within the ranges of 0.57–2.35% and 0.52–3.40%, respectively. The recoveries were in the range of 96.37–101.66%. The relative standard deviation values for stability and repeatability were < 5%. The contents of some compounds were low and varied with different cultivars. The proposed method could serve as a prerequisite for quality control of R. rubescens materials and products.

  2. Pulsed nitrogen supply induces dynamic changes in the amino acid composition and microcystin production of the harmful cyanobacterium Planktothrix agardhii

    NARCIS (Netherlands)

    van de Waal, D.B.; Ferreruela, G.; Tonk, L.; van Donk, E.; Huisman, J.; Visser, P.M.; Matthijs, H.C.P.


    Planktothrix agardhii is a widespread harmful cyanobacterium of eutrophic waters, and can produce the hepatotoxins [Asp3]microcystin-LR and [Asp3]microcystin-RR. These two microcystin variants differ in their first variable amino acid position, which is occupied by either leucine (L) or arginine

  3. Pulsed nitrogen supply induces dynamic changes in the amino acid compositionand microcystin production of the harmful cyanobacterium Planktothrix agardhii

    NARCIS (Netherlands)

    Van de Waal, D.B.; Ferreruela, G.; Tonk, L.; Van Donk, E.; Huisman, J.; Visser, P.M.; Matthijs, H.C.P.


    Planktothrix agardhii is a widespread harmful cyanobacterium of eutrophic waters, and can produce the hepatotoxins [Asp3]microcystin-LR and [Asp3]microcystin-RR. These two microcystin variants differ in their first variable amino acid position, which is occupied by either leucine (L) or arginine

  4. Effects of the Rabdosia rubescens total flavonoids on focal cerebral ischemia reperfusion model in rats

    Directory of Open Access Journals (Sweden)

    Mingsan Miao


    Full Text Available The effect of the Rabdosia rubescens total flavonoids on focal cerebral ischemia reperfusion model in rats was observed. The model group, nimodipine group, cerebral collateral group, and large, medium and small dose group of the Rabdosia rubescens total flavonoids were administered with corresponding drugs but sham operation group and model group were administered the same volume of 0.5%CMC, 1 times a day, continuous administration of 7 d. After 1 h at 7 d to medicine, left incision in the middle of the neck of rats after anesthesia, we can firstly expose and isolate the left common carotid artery (CCA, and then expose external carotid artery (ECA and internal carotid artery (ICA. The common carotid artery and the external carotid artery are ligated. Then internal carotid artery with arterial clamp is temporarily clipped. Besides, cut the incision of 0.2 mm from 5 cm of the bifurcation of the common carotid artery. A thread Line bolt is inserted with more than 18–20 mm from bifurcation of CCA into the internal carotid artery until there is resistance. Then the entrance of the middle cerebral artery is blocked and internal carotid artery is ligated (the blank group only exposed the left blood vessel without Plugging wire. Finally it is gently pulled out the plug line after 2 h. Results: Compared with the model mice, Rabdosia rubescens total flavonoids can significantly relieve the injury of brain in hippocampus and cortex nerve cells; experimental rat focal cerebral ischemia was to improve again perfusion model of nerve function defect score mortality; significantly reduce brain homogenate NOS activity and no content, MDA, IL-1, TNF-a, ICAM-1 content; increase in brain homogenate SOD and ATPase activity (P < 0.05, P < 0.01; and reduce the serum S-100β protein content. Each dose group of the Rabdosia rubescens total flavonoids has a better Improvement effect on focal cerebral ischemia reperfusion model in rats.

  5. Study of mechanical properties of Palosangre wood (Brosimum rubescens Taub.), from Leticia-Colombia provenance

    International Nuclear Information System (INIS)

    Triana Gomez, Max Alejandro; Gonzalez Roso, Gladis; Paspur Posso, Segundo Demetrio


    The technical recommendations of the Pan-American Committee of Technical Norms COPANT were applied for carrying out technological tests of tangential static flexion, parallel compression, tangential parallel shear, radial parallel shear, tangential impact, and radial impact in the wood of Brosimum rubescens Taub. (Moraceae) coming from Leticia, state of Amazonas, Colombia. The statistical analysis was made based on the arithmetic mean, the standard deviation and the variation coefficient to obtain representativeness. Results were adjusted to 12% of content of humidity. The mechanical properties of the wood were also classified, and its possible uses determined. The wood of B. rubescens exhibited the best response to the static flexion effort. According to the ASTM classification, the elasticity module (MOE) and the Maximum Unitary Effort corresponded to the Very High range, while the Proportional Limit Effort to the Middle range. The Maximum Unitary Effort and Proportional Limit Effort obtained for the parallel compression were assigned to the High and Medium ranges, respectively, while the tangential shear matched the High range. The less favorable response was found for the radial shear effort and the impact in the tangential and radial planes that corresponded to the Medium range. It was found that the most appropriate uses of the wood were: interior finishes, external finishes, athletic and sport articles, hand crafts, ends for tools, joinery, furniture, chassis, piles, musical instruments, construction, arches for violin and similar musical instruments, breeches for weapons, structures, mischievous, keels, floors and beams.

  6. Biosynthesis of the oxygenated diterpene nezukol in the medicinal plant Isodon rubescens is catalyzed by a pair of diterpene synthases.

    Directory of Open Access Journals (Sweden)

    Kyle A Pelot

    Full Text Available Plants produce an immense diversity of natural products (i.e. secondary or specialized metabolites that offer a rich source of known and potentially new pharmaceuticals and other desirable bioproducts. The Traditional Chinese Medicinal plant Isodon rubescens (Lamiaceae contains an array of bioactive labdane-related diterpenoid natural products. Of these, the ent-kauranoid oridonin is the most prominent specialized metabolite that has been extensively studied for its potent antimicrobial and anticancer efficacy. Mining of a previously established transcriptome of I. rubescens leaf tissue identified seven diterpene synthase (diTPSs candidates. Here we report the functional characterization of four I. rubescens diTPSs. IrTPS5 and IrTPS3 were identified as an ent-copalyl diphosphate (CPP synthase and a (+-CPP synthase, respectively. Distinct transcript abundance of IrTPS5 and the predicted ent-CPP synthase IrTPS1 suggested a role of IrTPS5 in specialized ent-kaurene metabolism possibly en route to oridonin. Nicotiana benthamiana co-expression assays demonstrated that IrTPS4 functions sequentially with IrTPS3 to form miltiradiene. In addition, IrTPS2 converted the IrTPS3 product (+-CPP into the hydroxylated tricyclic diterpene nezukol not previously identified in I. rubescens. Metabolite profiling verified the presence of nezukol in I. rubescens leaf tissue. The proposed IrTPS2-catalyzed reaction mechanism proceeds via the common ionization of the diphosphate group of (+-CPP, followed by formation of an intermediary pimar-15-en-8-yl+ carbocation and neutralization of the carbocation by water capture at C-8 to yield nezukol, as confirmed by nuclear magnetic resonance (NMR analysis. Oxygenation activity is rare for the family of class I diTPSs and offers new catalysts for developing metabolic engineering platforms to produce a broader spectrum of bioactive diterpenoid natural products.

  7. Aqueous extract of Rabdosia rubescens leaves: forming nanoparticles, targeting P-selectin, and inhibiting thrombosis

    Directory of Open Access Journals (Sweden)

    Wang Y


    Full Text Available Yuji Wang,1 Jingcheng Tang,1 Haimei Zhu,1 Xueyun Jiang,1 Jiawang Liu,1 Wenyun Xu,1 Haiping Ma,1 Qiqi Feng,1 Jianhui Wu,1 Ming Zhao,1,2 Shiqi Peng1 1Beijing Area Major Laboratory of Peptide and Small Molecular Drugs, Engineering Research Center of Endogenous Prophylactic of Ministry of Education of China, Beijing Laboratory of Biomedical Materials, College of Pharmaceutical Sciences, Capital Medical University, Beijing, People’s Republic of China; 2Faculty of Biomedical Science and Environmental Biology, Kaohsiung Medical University, Kaohsiung, Taiwan Abstract: The hot water extract of Rabdosia rubescens was traditionally used as an antithrombotic medicine. To explore its antithrombotic utility and mechanism, we carried out a series of in vitro and in vivo assays in this study. In vitro platelet aggregation assay showed that the half maximal inhibitory concentration values of aqueous extract of R. rubescens leaves (AERL inhibiting platelet aggregation induced by thrombin, arachidonic acid, adenosine diphosphate, and platelet-activating factor ranged from 0.12 mg/mL to 1.43 mg/mL. The minimal effective oral dose of AERL inhibiting the rats from forming thrombus was 25 mg/kg. Both in vitro and in vivo actions were correlated with AERL concentration-dependently inhibiting sP-selectin release. In water, AERL formed nanoparticles, and their size depended on the concentration. Docking the five nucleotides, 21 phenolic acids, and four diterpenoids identified by high-performance liquid chromatography–photodiode array detector/(-electrospray ionization-tandem mass spectrometry analysis into the active site of P-selectin, rosmarinic acid was predicted to be the antithrombotic ingredient of AERL. In flow cytometry analysis, 1 µM of rosmarinic acid effectively inhibited sP-selectin release in arachidonic acid-activated platelets. In a rat model, 5 mg/kg of oral rosmarinic acid effectively inhibited thrombosis. Keywords: R. rubescens, s

  8. Isolation and Purification of Oridonin from the Whole Plant of Isodon rubescens by High-Speed Counter-Current Chromatography

    Directory of Open Access Journals (Sweden)

    ChunYue Yu


    Full Text Available Semi-preparative high-speed counter-current chromatography (HSCCC was successfully used for isolation and purification of oridonin from Isodon rubescens by using a two-phase-solvent system composed of n-hexane-ethyl acetate-methanol-water (2.8:5:2.8:5, v/v/v/v. The targeted compound isolated, collected and purified by HSCCC was analyzed by high performance liquid chromatography (HPLC. A total of 40.6 mg of oridonin with the purity of 73.5% was obtained in less than 100 min from 100 mg of crude Isodon rubescens extract. The chemical structure of the compound was identified by IR, 1H-NMR and 13C-NMR.

  9. Cellular responses and bioremoval of nonylphenol by the bloom-forming cyanobacterium Planktothrix agardhii 1113 (United States)

    Medvedeva, Nadezda; Zaytseva, Tatyana; Kuzikova, Irina


    Nonylphenol (NP) is extensively used in agricultural, industrial and household applications. Moreover, NP is the major breakdown product of the nonionic surfactants, nonylphenol ethoxylates (NPEOs), the most widely used group of surfactants. Nonylphenol is persistent in the environment, highly toxic to aquatic organisms and is a potential endocrine disruptor. NP and NPEOs have been identified as priority hazardous substances under the Environmental Quality Standards Directive 2013/39/EU and are referred to in the list of substances of particular risk to the Baltic Sea. The toxicity of NP to the bloom-forming cyanobacterium Planktothrix agardhii 1113 isolated from the eastern Gulf of Finland, Baltic Sea and the bioremoval of NP by P. agardhii were studied. NP in concentrations > 0.4 mg L- 1 suppressed cyanobacterial growth. The median effective concentration of NP for P. agardhii after 4 days of treatment (EC50) was 1.5 mg L- 1. The removal of NP from the culture medium was primarily due to abiotic processes and biodegradation by the cyanobacterium rather than sorption by the cells. NP significantly increased the photosynthetic pigments, extracellular proteins and soluble exopolysaccharides content. The cyanobacterial growth inhibition was accompanied by the increased synthesis of microcystin dm-RR and of the odorous metabolites, geosmin and 2-methylisoborneol (MIB), by P. agardhii 1113. NP also notably increased the microcystin released into the environment. Increased levels of extracellular proteins, soluble exopolysaccharides, microcystins and odorous metabolites may affect the microbial loop in aquatic ecosystems. An increased level of malondialdehyde (MDA) was indicative of the formation of free radicals in P. agardhii under NP stress, whereas increased levels of superoxide dismutase (SOD), catalase (CAT), reduced glutathione (GSH) and proline indicated the occurrence of a scavenging mechanism.

  10. Effect of ultraviolet radiation on photosynthesis, biomass, and fatty acid content and profile of a Scenedesmus rubescens-like microalga. (United States)

    Li, Ping; Lin, Junda


    The effects of ultraviolet radiation (UVR) and nitrogen (NaNO(3)) concentration on photosynthesis, biomass, and fatty acid content and profile of a Scenedesmus rubescens-like microalga were measured in an outdoor 8-day culture study. UV-induced photoinhibition decreased from 42.6% to 3.5%, in the presence of 75 mg/L NaNO(3) (HN) and from 52.9% to 22.6% in the presence of 7.5mg/L NaNO(3) (LN) nitrogen concentration, respectively. The concentrations of UV-absorbing compounds increased 4.3 and 4.9 times under HN and LN, respectively. Biomass accumulation was suppressed (10.7%) by UVR under HN, but not under LN conditions. Carotenoid content decreased from 1.05 ± 0.06 to 0.96 ± 0.15 (with UV radiation) and to 0.91 ± 0.07 (without UV radiation), respectively, under HN, while it decreased to 0.05 ± 0.04 (with UV radiation) and to 0.11 ± 0.08 (without UV radiation), respectively, under LN. The content of C18:1n9 fatty acids increased by about 430%, whereas that of C18:3n3 decreased by about 65% in both radiation treatments during nitrogen starvation. The results showed that the absence of UVR screening does not change the fatty acid content and profile of S. rubescens-like algae cultivated outdoors under HN and LN conditions. Copyright © 2012 Elsevier Ltd. All rights reserved.

  11. The dynamics of toxic microcystis strains and microcystin production in two hypertrofic South African reservoirs


    Barnard, Sandra; Conradie, Karin Ronel


    The South African impoundments of Hartbeespoort and Roodeplaat experience excessive blooms of Microcystis species each year. Microcystins, produced primarily by strains of cyanobacteria belonging to the genera Microcystis, Anabaena and Planktothrix, are harmful cyanobacterial hepatotoxins. These bloom-forming cyanobacteria form toxic and non-toxic strains that co-occur and are visually indistinguishable, but can be identified and quantified molecularly. We described the relationships between ...

  12. Interactions between cyanobacteria and gastropods II. Impact of toxic Planktothrix agardhii on the life-history traits of Lymnaea stagnalis. (United States)

    Lance, Emilie; Paty, Chrystelle; Bormans, Myriam; Brient, Luc; Gérard, Claudia


    Hepatotoxins are frequently produced by many cyanobacterial species. Microcystins (MCs) are the most frequent and widely studied hepatotoxins, with potentially hazardous repercussions on aquatic organisms. As a ubiquitous herbivore living in eutrophic freshwaters, the snail Lymnaea stagnalis (Gastropoda: Pulmonata) is particularly exposed to cyanobacteria. The toxic filamentous Planktothrix agardhii is common in temperate lakes and is therefore, a potential food resource for gastropods. In the first part of this study, we demonstrated the ingestion of toxic P. agardhii by L. stagnalis during a 5 weeks exposure, with concomitant accumulation of, on average, 60% of total MCs ingested. After 3 weeks of non-toxic food (lettuce), approximately 90% of MCs were eliminated from tissues. Here, we investigate the impact of toxic P. agardhii consumption on the life-history traits (survival, growth and fecundity), locomotion and the structure of digestive and genital glands of juvenile and adult L. stagnalis. We observed a decrease of growth regardless of age, although this was more marked in juveniles, and a reduction of fecundity in adults. Survival and locomotion were not affected. Reduction of growth and fecundity continued to be observed even after feeding of non-toxic food for 3 weeks. The structure of the digestive gland was altered during the intoxication period but not irreversibly as cells tended to recover a normal status after the 3-week detoxification period. No histopathological changes occurred in the genital gland and oocytes, and spermatozoids were present in the gonadic acini. The density of cyanobacterial suspensions used in this study was comparable to those regularly observed in lakes, particularly in eutrophic waters. These results are discussed in terms of the negative impact of toxic cyanobacteria on natural communities of freshwater gastropods, and potential cascading effects on the equilibrium and functioning of the ecosystem.

  13. Effect of rabdosia rubescens combined with new assistant chemotherapy on serum CA199, CEA, CA15-3 and T lymphocyte subsets in patients with breast cancer

    Directory of Open Access Journals (Sweden)

    Lei Xi


    Full Text Available Objective: To study the effects of Rabdosia rubescens combined with neoadjuvant chemotherapy on serum CA199, CEA, CA15-3 levels and T lymphocyte subsets in patients with breast cancer. Methods: A total of 70 patients with breast cancer in our hospital were enrolled as the subjects of this study. The subjects were divided into control group (n=35 and treatment group (n=35 randomly. Patients in the control group were treated with new assistant chemotherapy, while those who were in the treatment group were treated with rabdosia rubescens combined with new assistant chemotherapy. The two groups of patients were treated for 3 periods. The serum CA199, CEA, CA15-3 levels and peripheral blood CD4+, CD8+, CD4+/CD8+ cells of the two groups before and after treatment were compared. Results: There were no significantly differences among the serum CA199, CEA, CA15-3 levels and peripheral blood CD4+, CD8+, CD4+/CD8+ cells of the two groups before treatment. The serum CA199, CEA and CA15-3 levels of the two groups after treatment were significantly lower than those before treatment, besides, the serum CA199, CEA and CA15-3 levels of the treatment group were significantly lower than those of the control group. The peripheral blood CD4+, CD4+/ CD8+ cells of the control group after treatment were significantly lower than before treatment, and the peripheral blood CD4+, CD4+/CD8+ cells of the treatment group after treatment were significantly higher than those of the control group. Conclusion: Rabdosia rubescens combined with new assistant chemotherapycan can significantly reduce the serum CA199, CEA and CA15-3 levels, and improve peripheral blood CD4+, CD8+, CD4+/CD8+ levels of patients with breast cancer. It is worthy of clinical application.

  14. Protein (Cyanobacteria): 652389878 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available WP_026785726.1 ... 1117:3298 ... 1150:52043 1301283:73215 ... 54304:1908 59512:262 ... hypothetical protein Plankt...othrix rubescens MPTFFPEGKTININGEVELLAFQCQDTVVQLAAIAPGAIFPLHQHTESQIGMIFNGNLEMNLNGNKT

  15. Protein (Cyanobacteria): 652391756 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available WP_026787603.1 ... 1117:6086 ... 1150:52096 1301283:73273 ... 54304:1956 59512:755 ... hypothetical protein Plankt...othrix rubescens MKNAMLEAADIKILEAAAAEDLARDRQFILEEDSNKTLAQQSYKAQQRDQRLVKAALIPRTGEAASP

  16. Protein (Cyanobacteria): 652390640 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available WP_026786488.1 ... 1117:44775 ... 1150:52433 1301283:73648 ... 54304:2259 59512:501 ... hypothetical protein Plankt...othrix rubescens MKIIQGYNPSKTISPMKIRKVKGVTIVEKYGDNLYVLPDENNNKTVPEFNKTDSFDINNWAEQATDLDGFYFINAITMTGNYLGSEWNDIILGLKFRGLATYISNH

  17. Protein (Cyanobacteria): 652392751 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available WP_026788598.1 ... 1117:7257 ... 1150:51123 1301283:72193 ... 54304:108 59512:73 ... hypothetical protein Plankt...othrix rubescens MNSVEELARLQKRFQEAAKVIDDLSRIKQELDQLSKSYKDKLSNNSFELSQTKQEIESLSINHKEYKKYWHETFNAIHNKT

  18. Protein (Cyanobacteria): 652390540 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available WP_026786388.1 ... 1117:7027 ... 1150:51287 1301283:72374 ... 54304:1227 59512:475 ... carbonate dehydratase Plankt...othrix rubescens MNKTQQNLTISRRNLLKFGAGVAGTAVLTVGLGTKVSLFKAQPAVAQNGITPDEALNQLLEGNKRF

  19. Protein (Cyanobacteria): 652393259 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  20. Protein (Cyanobacteria): 652392000 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available WP_026787847.1 ... 1117:3748 ... 1150:52103 1301283:73282 ... 54304:1962 59512:816 ... NUDIX hydrolase Plankt...othrix rubescens MNKTLILEDFKVGVDNVIFSVDTEQNRLLVLLVKRKEEPFINTWSLPGTLVQKGESLENAAYRILAEKILVE

  1. Protein (Cyanobacteria): 652391725 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available WP_026787573.1 ... 1117:6169 ... 1150:52274 1301283:73471 ... 54304:2115 59512:749 ... hypothetical protein Plankt...othrix rubescens MGNVSFASENKTLAQSSNISGWVDSFGFASTKQGAGQAGIDQGEKLGILFDGNFDNVINSLKANQLK

  2. Protein (Cyanobacteria): 652390481 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available WP_026786329.1 ... 1117:7618 ... 1150:52216 1301283:73407 ... 54304:2063 59512:458 ... hypothetical protein Plankt...othrix rubescens MIPFQDSRLLLRALTYRSYMFENPNKTQGDNEQLEFLGDSVLQFLAGDYVYEKYFGEQEGQLTQKRE

  3. Resíduos madeireiros do alburno de pau-rainha (Brosimum rubescens: investigação de metabólitos secundários e alguns aspectos tecnológicos Residues of sapwood of "pau-rainha" (Brosimum rubescens: investigation of secondary metabolites and some technological aspects

    Directory of Open Access Journals (Sweden)

    Willian Hayasida


    Full Text Available Estudos fitoquímicos prévios com resíduos do cerne de pau-rainha (Brosimum rubescens, identificaram um alto teor de xantiletina, uma cumarina com potencial biológico. Dando prosseguimento aos estudos com serragens desta espécie, este estudo relata a densidade básica bem como o isolamento e identificação do triterpeno 3β-acetoxi-olean-12-eno-28-al e do β- sitosterol nos extratos hexânico e metanólico do alburno da planta. A estrutura do triterpeno foi determinada com base nos espectros de RMN em 1D (¹H e 13C e 2D (HSQC e HMBC além de comparação com dados da literatura. A densidade básica encontrada para o alburno foi de 0,58 g cm-3 que, embora seja inferior a do cerne, poderá ser utilizada na confecção de vários produtos, inclusive em técnicas de marchetaria.Previous phytochemical studies on residues of pau-rainha’s heartwood (Brosimum rubescens showed a high content of xanthyletin, a coumarin with biological potential. Continuing our studies with sawdust of this species, this work relates the basic density, isolation and identification of the triterpene 3β-acetoxy-olean-12-ene-28-al and β-sitosterol in n-hexane and MeOH extracts of the plant´s sapwood. The structure of the triterpene was determined on the basis of NMR spectra in 1D (¹H and 13C and 2D (HSQC and HMBC and comparison with literature data. The basic density found for sapwood was 0.58 g cm-3, that even so is inferior the one of heartwood, could be used in the confection of some products, also in marquetry techniques.

  4. Stability of toxin gene proportion in red-pigmented populations of the cyanobacterium Planktothrix during 29 years of re-oligotrophication of Lake Zürich

    Directory of Open Access Journals (Sweden)

    Ostermaier Veronika


    Full Text Available Abstract Background Harmful algal blooms deteriorate the services of aquatic ecosystems. They are often formed by cyanobacteria composed of genotypes able to produce a certain toxin, for example, the hepatotoxin microcystin (MC, but also of nontoxic genotypes that either carry mutations in the genes encoding toxin synthesis or that lost those genes during evolution. In general, cyanobacterial blooms are favored by eutrophication. Very little is known about the stability of the toxic/nontoxic genotype composition during trophic change. Results Archived samples of preserved phytoplankton on filters from aquatic ecosystems that underwent changes in the trophic state provide a so far unrealized possibility to analyze the response of toxic/nontoxic genotype composition to the environment. During a period of 29 years of re-oligotrophication of the deep, physically stratified Lake Zürich (1980 to 2008, the population of the stratifying cyanobacterium Planktothrix was at a minimum during the most eutrophic years (1980 to 1984, but increased and dominated the phytoplankton during the past two decades. Quantitative polymerase chain reaction revealed that during the whole observation period the proportion of the toxic genotype was strikingly stable, that is, close to 100%. Inactive MC genotypes carrying mutations within the MC synthesis genes never became abundant. Unexpectedly, a nontoxic genotype, which lost its MC genes during evolution, and which could be shown to be dominant under eutrophic conditions in shallow polymictic lakes, also co-occurred in Lake Zürich but was never abundant. As it is most likely that this nontoxic genotype contains relatively weak gas vesicles unable to withstand the high water pressure in deep lakes, it is concluded that regular deep mixing selectively reduced its abundance through the destruction of gas vesicles. Conclusions The stability in toxic genotype dominance gives evidence for the adaptation to deep mixing of a


    Directory of Open Access Journals (Sweden)

    Cristine da Silva Autran


    Full Text Available Ainda que recente, a técnica para a determinação da cor da madeira por meio da colorimetria quantitativa mostra-se precisa e eficaz. O sistema CIELAB 1976, que determina os parâmetros colorimétricos L*, a*, b*, C e h*, mostrou-se eficiente para a determinação da cor das madeiras de muirapiranga (Brosimum rubescens e de seringueira (Hevea brasiliensis, clone Tjir 16. A madeira de muirapiranga é de cor vermelha-amarronzada (L* de 42,39, tendo o pigmento vermelho (a* de 22,02 como determinante, apesar de o pigmento amarelo (b* ter influência significativa na definição de sua cor. A madeira de seringueira apresenta cor amarela (L* de 77,55, fortemente influenciada pelo pigmento amarelo (b* de 19,61. Considerando o parâmetro cor, ambas as madeiras apresentam potenciais para serem utilizadas em interiores.



    Фомiна, М. О.


    Aim. The aim of this work was to study the effects of nitrogen source on the speciation of copper accumulated by fungi and ectomycorrhizas grown in the presence of copper phosphate. Materials and Methods. Ectomycorrhizal fungus Rhizopogon rubescens and its symbiotic ectomycorrhizal association with Scots Pine were grown in the presence of copper phosphate at different nitrogen sources: either ammonium or nitrate. The coordination of copper released from copper phosphate and bioaccumulated by ...

  7. Strain-Modulated Epitaxy

    National Research Council Canada - National Science Library

    Brown, April


    Strain-Modulated Epitaxy (SME) is a novel approach, invented at Georgia Tech, to utilize subsurface stressors to control strain and therefore material properties and growth kinetics in the material above the stressors...

  8. Hamstring strain - aftercare (United States)

    Pulled hamstring muscle; Sprain - hamstring ... There are 3 levels of hamstring strains: Grade 1 -- mild muscle strain or pull Grade 2 -- partial muscle tear Grade 3 -- complete muscle tear Recovery time depends ...

  9. ACTIVIDAD ANTIFUNGICA DEL EXTRACTO DE Brosimum rubescens (Palisangre

    Directory of Open Access Journals (Sweden)

    María Fachín-Espinar


    Full Text Available El extracto etanólico  y sus fracciones cromatográficas del tallo de Brosimum rubencens Taubert  fueron evaluados para determinar la actividad antifúngica in vitro mediante el método de macrodilución para hongos filamentosos. El tamizaje fitoquímico del extracto etanólico del tallo de B. rubencens evidenció la presencia de cumarinas, quinonas y taninos, además de flavonoides y triterpenos; para el estudio de la actividad antifúngica se utilizó cepas de Trichosporum rubrum ATCC 28188 y Trichosporum mentagrophytes ATCC 24953. En ambos casos la fracción insoluble en dilución ácida evidenció mayor actividad antifúngica que el extracto etanólico contra dermatofitos. El fraccionamiento del extracto etanólico permitió inferir que el responsables de la actividad se debe a los fitocomplejos, no así a las fracciones frente a T. rubrum ATCC 28188.

  10. A strain gauge

    DEFF Research Database (Denmark)


    The invention relates to a strain gauge of a carrier layer and a meandering measurement grid positioned on the carrier layer, wherein the strain gauge comprises two reinforcement members positioned on the carrier layer at opposite ends of the measurement grid in the axial direction....... The reinforcement members are each placed within a certain axial distance to the measurement grid with the axial distance being equal to or smaller than a factor times the grid spacing. The invention further relates to a multi-axial strain gauge such as a bi-axial strain gauge or a strain gauge rosette where each...... of the strain gauges comprises reinforcement members. The invention further relates to a method for manufacturing a strain gauge as mentioned above....

  11. Three dimensional strained semiconductors (United States)

    Voss, Lars; Conway, Adam; Nikolic, Rebecca J.; Leao, Cedric Rocha; Shao, Qinghui


    In one embodiment, an apparatus includes a three dimensional structure comprising a semiconductor material, and at least one thin film in contact with at least one exterior surface of the three dimensional structure for inducing a strain in the structure, the thin film being characterized as providing at least one of: an induced strain of at least 0.05%, and an induced strain in at least 5% of a volume of the three dimensional structure. In another embodiment, a method includes forming a three dimensional structure comprising a semiconductor material, and depositing at least one thin film on at least one surface of the three dimensional structure for inducing a strain in the structure, the thin film being characterized as providing at least one of: an induced strain of at least 0.05%, and an induced strain in at least 5% of a volume of the structure.

  12. Strain measurement technique

    International Nuclear Information System (INIS)


    The 10 contributions are concerned with selected areas of application, such as strain measurements in wood, rubber/metal compounds, sets of strain measurements on buildings, reinforced concrete structures without gaps, pipes buried in the ground and measurements of pressure fluctuations. To increase the availability and safety of plant, stress analyses were made on gas turbine rotors with HT-DMS or capacitive HT-DMS (high temperature strain measurements). (DG) [de

  13. Strained Silicon Photonics

    Directory of Open Access Journals (Sweden)

    Ralf B. Wehrspohn


    Full Text Available A review of recent progress in the field of strained silicon photonics is presented. The application of strain to waveguide and photonic crystal structures can be used to alter the linear and nonlinear optical properties of these devices. Here, methods for the fabrication of strained devices are summarized and recent examples of linear and nonlinear optical devices are discussed. Furthermore, the relation between strain and the enhancement of the second order nonlinear susceptibility is investigated, which may enable the construction of optically active photonic devices made of silicon.

  14. A strain gauge

    DEFF Research Database (Denmark)


    The invention relates to a strain gauge of a carrier layer and a meandering measurement grid (101) positioned on the carrier layer, wherein the measurement grid comprises a number of measurement grid sections placed side by side with gaps in between, and a number of end loops (106) interconnecting...... relates to a method for manufacturing a strain gauge as mentioned above....

  15. Internally Mounting Strain Gages (United States)

    Jett, J. R., Jr.


    Technique for mounting strain gages inside bolt or cylinder simultaneously inserts gage, attached dowel segment, and length of expandable tubing. Expandable tubing holds gage in place while adhesive cures, assuring even distribution of pressure on gage and area gaged.

  16. Running Title: Strained Yoghurts

    African Journals Online (AJOL)



    Sep 27, 2012 ... ever, the traditional method of producing strained yoghurt ... Food market studies have the essential function of providing ..... Communication No: 2001/21. ... fermented foods and beverages of Turkey. Crit. Rev. Food. Sci. Nutr.

  17. Flexible piezotronic strain sensor. (United States)

    Zhou, Jun; Gu, Yudong; Fei, Peng; Mai, Wenjie; Gao, Yifan; Yang, Rusen; Bao, Gang; Wang, Zhong Lin


    Strain sensors based on individual ZnO piezoelectric fine-wires (PFWs; nanowires, microwires) have been fabricated by a simple, reliable, and cost-effective technique. The electromechanical sensor device consists of a single electrically connected PFW that is placed on the outer surface of a flexible polystyrene (PS) substrate and bonded at its two ends. The entire device is fully packaged by a polydimethylsiloxane (PDMS) thin layer. The PFW has Schottky contacts at its two ends but with distinctly different barrier heights. The I- V characteristic is highly sensitive to strain mainly due to the change in Schottky barrier height (SBH), which scales linear with strain. The change in SBH is suggested owing to the strain induced band structure change and piezoelectric effect. The experimental data can be well-described by the thermionic emission-diffusion model. A gauge factor of as high as 1250 has been demonstrated, which is 25% higher than the best gauge factor demonstrated for carbon nanotubes. The strain sensor developed here has applications in strain and stress measurements in cell biology, biomedical sciences, MEMS devices, structure monitoring, and more.

  18. Strains and Sprains (United States)

    ... lot of pressure on a muscle or you push it too far, such as when lifting a heavy object. Strains may be more likely to happen if you haven't warmed up first to get blood circulating to the muscles. They're also common for someone returning to a sport after the off-season. That first time playing ...

  19. Strains in general relativity

    International Nuclear Information System (INIS)

    Bini, Donato; Felice, Fernando de; Geralico, Andrea


    The definition of relative accelerations and strains among a set of comoving particles is studied in connection with the geometric properties of the frame adapted to a 'fiducial observer'. We find that a relativistically complete and correct definition of strains must take into account the transport law of the chosen spatial triad along the observer's congruence. We use special congruences of (accelerated) test particles in some familiar spacetimes to elucidate such a point. The celebrated idea of Szekeres' compass of inertia, arising when studying geodesic deviation among a set of free-falling particles, is here generalized to the case of accelerated particles. In doing so we have naturally contributed to the theory of relativistic gravity gradiometer. Moreover, our analysis was made in an observer-dependent form, a fact that would be very useful when thinking about general relativistic tests on space stations orbiting compact objects like black holes and also in other interesting gravitational situations

  20. Strain Induced Adatom Correlations


    Kappus, Wolfgang


    A Born-Green-Yvon type model for adatom density correlations is combined with a model for adatom interactions mediated by the strain in elastic anisotropic substrates. The resulting nonlinear integral equation is solved numerically for coverages from zero to a limit given by stability constraints. W, Nb, Ta and Au surfaces are taken as examples to show the effects of different elastic anisotropy regions. Results of the calculation are shown by appropriate plots and discussed. A mapping to sup...

  1. Ratchetting strain prediction

    International Nuclear Information System (INIS)

    Noban, Mohammad; Jahed, Hamid


    A time-efficient method for predicting ratchetting strain is proposed. The ratchetting strain at any cycle is determined by finding the ratchetting rate at only a few cycles. This determination is done by first defining the trajectory of the origin of stress in the deviatoric stress space and then incorporating this moving origin into a cyclic plasticity model. It is shown that at the beginning of the loading, the starting point of this trajectory coincides with the initial stress origin and approaches the mean stress, displaying a power-law relationship with the number of loading cycles. The method of obtaining this trajectory from a standard uniaxial asymmetric cyclic loading is presented. Ratchetting rates are calculated with the help of this trajectory and through the use of a constitutive cyclic plasticity model which incorporates deviatoric stresses and back stresses that are measured with respect to this moving frame. The proposed model is used to predict the ratchetting strain of two types of steels under single- and multi-step loadings. Results obtained agree well with the available experimental measurements

  2. Strain measurement based battery testing (United States)

    Xu, Jeff Qiang; Steiber, Joe; Wall, Craig M.; Smith, Robert; Ng, Cheuk


    A method and system for strain-based estimation of the state of health of a battery, from an initial state to an aged state, is provided. A strain gauge is applied to the battery. A first strain measurement is performed on the battery, using the strain gauge, at a selected charge capacity of the battery and at the initial state of the battery. A second strain measurement is performed on the battery, using the strain gauge, at the selected charge capacity of the battery and at the aged state of the battery. The capacity degradation of the battery is estimated as the difference between the first and second strain measurements divided by the first strain measurement.

  3. Studies on Drosophila radiosensitive strains

    International Nuclear Information System (INIS)

    Varentsova, E.P.; Zakharov, I.A.


    45 of radiosensitive strains of Drosophila melanogaster were isolated by Curly/Lobe technique after EMS treatment of Livadia population males. The lethality of non-Curly late larvae after gamma-irradiation (4000r) characterized radiosensitivity strains. Most of them exhibited higher frequency of the spontaneous dominant lethals (up to 69%). The males of 6 strains were semi-sterile. 5 of these strains exhibited higher frequency of X-chromosome non-disjunction

  4. Strain induced adatom correlations (United States)

    Kappus, Wolfgang


    A Born-Green-Yvon type model for adatom density correlations is combined with a model for adatom interactions mediated by the strain in elastic anisotropic substrates. The resulting nonlinear integral equation is solved numerically for coverages from zero to a limit given by stability constraints. W, Nb, Ta and Au surfaces are taken as examples to show the effects of different elastic anisotropy regions. Results of the calculation are shown by appropriate plots and discussed. A mapping to superstructures is tried. Corresponding adatom configurations from Monte Carlo simulations are shown.

  5. Strain actuated aeroelastic control (United States)

    Lazarus, Kenneth B.


    Viewgraphs on strain actuated aeroelastic control are presented. Topics covered include: structural and aerodynamic modeling; control law design methodology; system block diagram; adaptive wing test article; bench-top experiments; bench-top disturbance rejection: open and closed loop response; bench-top disturbance rejection: state cost versus control cost; wind tunnel experiments; wind tunnel gust alleviation: open and closed loop response at 60 mph; wind tunnel gust alleviation: state cost versus control cost at 60 mph; wind tunnel command following: open and closed loop error at 60 mph; wind tunnel flutter suppression: open loop flutter speed; and wind tunnel flutter suppression: closed loop state cost curves.

  6. Colony Dimorphism in Bradyrhizobium Strains (United States)

    Sylvester-Bradley, Rosemary; Thornton, Philip; Jones, Peter


    Ten isolates of Bradyrhizobium spp. which form two colony types were studied; the isolates originated from a range of legume species. The two colony types differed in the amount of gum formed or size or both, depending on the strain. Whole 7-day-old colonies of each type were subcultured to determine the proportion of cells which had changed to the other type. An iterative computerized procedure was used to determine the rate of switching per generation between the two types and to predict proportions reached at equilibrium for each strain. The predicted proportions of the wetter (more gummy) or larger colony type at equilibrium differed significantly between strains, ranging from 0.9999 (strain CIAT 2383) to 0.0216 (strain CIAT 2469), because some strains switched faster from dry to wet (or small to large) and others switched faster from wet to dry (or large to small). Predicted equilibrium was reached after about 140 generations in strain USDA 76. In all but one strain (CIAT 3030) the growth rate of the wetter colony type was greater than or similar to that of the drier type. The mean difference in generation time between the two colony types was 0.37 h. Doubling times calculated for either colony type after 7 days of growth on the agar surface ranged from 6.0 to 7.3 h. The formation of two persistent colony types by one strain (clonal or colony dimorphism) may be a common phenomenon among Bradyrhizobium strains. Images PMID:16347599

  7. Strain Pattern in Supercooled Liquids (United States)

    Illing, Bernd; Fritschi, Sebastian; Hajnal, David; Klix, Christian; Keim, Peter; Fuchs, Matthias


    Investigations of strain correlations at the glass transition reveal unexpected phenomena. The shear strain fluctuations show an Eshelby-strain pattern [˜cos (4 θ ) /r2 ], characteristic of elastic response, even in liquids, at long times. We address this using a mode-coupling theory for the strain fluctuations in supercooled liquids and data from both video microscopy of a two-dimensional colloidal glass former and simulations of Brownian hard disks. We show that the long-ranged and long-lived strain signatures follow a scaling law valid close to the glass transition. For large enough viscosities, the Eshelby-strain pattern is visible even on time scales longer than the structural relaxation time τ and after the shear modulus has relaxed to zero.

  8. Hydrogen production from microbial strains (United States)

    Harwood, Caroline S; Rey, Federico E


    The present invention is directed to a method of screening microbe strains capable of generating hydrogen. This method involves inoculating one or more microbes in a sample containing cell culture medium to form an inoculated culture medium. The inoculated culture medium is then incubated under hydrogen producing conditions. Once incubating causes the inoculated culture medium to produce hydrogen, microbes in the culture medium are identified as candidate microbe strains capable of generating hydrogen. Methods of producing hydrogen using one or more of the microbial strains identified as well as the hydrogen producing strains themselves are also disclosed.

  9. Asymptomatic bacteriuria Escherichia coli strains

    DEFF Research Database (Denmark)

    Hancock, Viktoria; Nielsen, E.M.; Klemm, Per


    Urinary tract infections (UTIs) affect millions of people each year. Escherichia coli is the most common organism associated with asymptomatic bacteriuria (ABU) in humans. Persons affected by ABU may carry a particular E. coli strain for extended periods of time without any symptoms. In contrast...... to uropathogenic E. coli (UPEC) that cause symptomatic UTI, very little is known about the mechanisms by which these strains colonize the urinary tract. Here, we have investigated the growth characteristics in human urine as well as adhesin repertoire of nine ABU strains; the ability of ABU strains to compete...

  10. TL transgenic mouse strains

    International Nuclear Information System (INIS)

    Obata, Y.; Matsudaira, Y.; Hasegawa, H.; Tamaki, H.; Takahashi, T.; Morita, A.; Kasai, K.


    As a result of abnormal development of the thymus of these mice, TCR αβ lineage of the T cell differentiation is disturbed and cells belonging to the TCR γδ CD4 - CD8 - double negative (DN) lineage become preponderant. The γδ DN cells migrate into peripheral lymphoid organs and constitute nearly 50% of peripheral T cells. Immune function of the transgenic mice is severely impaired, indicating that the γδ cells are incapable of participating in these reactions. Molecular and serological analyses of T-cell lymphomas reveal that they belong to the γδ lineage. Tg.Tla a -3-1 mice should be useful in defining the role of TL in normal and abnormal T cell differentiation as well as in the development of T-cell lymphomas, and further they should facilitate studies on the differentiation and function of γδ T cells. We isolated T3 b -TL gene from B6 mice and constructed a chimeric gene in which T3 b -TL is driven by the promoter of H-2K b . With the chimeric gene, two transgenic mouse strains, Tg. Con.3-1 and -2 have been derived in C3H background. Both strains express TL antigen in various tissues including skin. The skin graft of transgenic mice on C3H and (B6 X C3H)F 1 mice were rejected. In the mice which rejected the grafts, CD8 + TCRαβ cytotoxic T cells (CTL) against TL antigens were recognized. The recognition of TL by CTL did not require the antigen presentation by H-2 molecules. The results indicated that TL antigen in the skin becomes a transplantation antigen and behaves like a typical allogeneic MHC class I antigen. The facts that (B6 X C3H)F 1 mice rejected the skin expressing T3 b -TL antigen and induced CTL that killed TL + lymphomas of B6 origin revealed that TL antigen encoded by T3 b -TL is recognized as non-self in B6 mice. Experiments are now extended to analyze immune responses to TL antigen expressed on autochthonous T cell lymphomas. (J.P.N.)

  11. Nutritionally fastidious Ruminococct $ flovefociens : strains

    African Journals Online (AJOL)

    than those obtained in a medium containing rumen fluid. Growth of all strains was remarkably uniform. Where the same inoculum was used, differences in the qualitative com- position of the medium usually had little effect on growth. In contrast, the R. f/avefaciens strains were much more variable in their growth responses.

  12. Haldane model under nonuniform strain (United States)

    Ho, Yen-Hung; Castro, Eduardo V.; Cazalilla, Miguel A.


    We study the Haldane model under strain using a tight-binding approach, and compare the obtained results with the continuum-limit approximation. As in graphene, nonuniform strain leads to a time-reversal preserving pseudomagnetic field that induces (pseudo-)Landau levels. Unlike a real magnetic field, strain lifts the degeneracy of the zeroth pseudo-Landau levels at different valleys. Moreover, for the zigzag edge under uniaxial strain, strain removes the degeneracy within the pseudo-Landau levels by inducing a tilt in their energy dispersion. The latter arises from next-to-leading order corrections to the continuum-limit Hamiltonian, which are absent for a real magnetic field. We show that, for the lowest pseudo-Landau levels in the Haldane model, the dominant contribution to the tilt is different from graphene. In addition, although strain does not strongly modify the dispersion of the edge states, their interplay with the pseudo-Landau levels is different for the armchair and zigzag ribbons. Finally, we study the effect of strain in the band structure of the Haldane model at the critical point of the topological transition, thus shedding light on the interplay between nontrivial topology and strain in quantum anomalous Hall systems.

  13. Pin clad strains in Phenix

    International Nuclear Information System (INIS)

    Languille, A.


    The Phenix reactor has operated for 4 years in a satisfactory manner. The first 2 sub-assembly loadings contained pins clad in solution treated 316. The principal pin strains are: diametral strain (swelling and irradiation creep), ovality and spiral bending of the pin (interaction of wire and pin cluster and wrapper). A pin cluster irradiated to a dose of 80 dpa F reached a pin diameter strain of 5%. This strain is principally due to swelling (low fission gas pressure). The principal parameters governing the swelling are instantaneous dose, time and temperature for a given type of pin cladding. Other types of steel are or will be irradiated in Phenix. In particular, cold-worked titanium stabilised 316 steel should contribute towards a reduction in the pin clad strains and increase the target burn-up in this reactor. (author)

  14. Strain expansion-reduction approach (United States)

    Baqersad, Javad; Bharadwaj, Kedar


    Validating numerical models are one of the main aspects of engineering design. However, correlating million degrees of freedom of numerical models to the few degrees of freedom of test models is challenging. Reduction/expansion approaches have been traditionally used to match these degrees of freedom. However, the conventional reduction/expansion approaches are only limited to displacement, velocity or acceleration data. While in many cases only strain data are accessible (e.g. when a structure is monitored using strain-gages), the conventional approaches are not capable of expanding strain data. To bridge this gap, the current paper outlines a reduction/expansion technique to reduce/expand strain data. In the proposed approach, strain mode shapes of a structure are extracted using the finite element method or the digital image correlation technique. The strain mode shapes are used to generate a transformation matrix that can expand the limited set of measurement data. The proposed approach can be used to correlate experimental and analytical strain data. Furthermore, the proposed technique can be used to expand real-time operating data for structural health monitoring (SHM). In order to verify the accuracy of the approach, the proposed technique was used to expand the limited set of real-time operating data in a numerical model of a cantilever beam subjected to various types of excitations. The proposed technique was also applied to expand real-time operating data measured using a few strain gages mounted to an aluminum beam. It was shown that the proposed approach can effectively expand the strain data at limited locations to accurately predict the strain at locations where no sensors were placed.

  15. Roll bonding of strained aluminium

    DEFF Research Database (Denmark)

    Staun, Jakob M.


    This report investigates roll bonding of pre-strained (å ~ 4) aluminium sheets to produce high strain material from high purity aluminium (99.996%) and commercial pure aluminium (99.6%). The degree of bonding is investigated by optical microscopy and ultrasonic scanning. Under the right...... of the cross rolled volume fraction is found. To further asses this effect, and the anisotropy, it is necessary to acquire knowledge about both texture and microstructure, e.g. by TEM. Roll bonding of pre-strained aluminium is found to be a possible alternative to ARB in the quest for ultra-fine grained...

  16. Strain fluctuations and elastic constants

    Energy Technology Data Exchange (ETDEWEB)

    Parrinello, M.; Rahman, A.


    It is shown that the elastic strain fluctuations are a direct measure of elastic compliances in a general anisotropic medium; depending on the ensemble in which the fluctuation is measured either the isothermal or the adiabatic compliances are obtained. These fluctuations can now be calculated in a constant enthalpy and pressure, and hence, constant entropy, ensemble due to recent develpments in the molecular dynamics techniques. A calculation for a Ni single crystal under uniform uniaxial 100 tensile or compressive load is presented as an illustration of the relationships derived between various strain fluctuations and the elastic modulii. The Born stability criteria and the behavior of strain fluctuations are shown to be related.

  17. Strain accumulation in quasicrystalline solids

    International Nuclear Information System (INIS)

    Nori, F.; Ronchetti, M.; Elser, V.


    We study the relaxation of 2D quasicrystalline elastic networks when their constituent bonds are perturbed homogeneously. Whereas ideal, quasiperiodic networks are stable against such perturbations, we find significant accumulations of strain in a class of disordered networks generated by a growth process. The grown networks are characterized by root mean square phason fluctuations which grow linearly with system size. The strain accumulation we observe in these networks also grows linearly with system size. Finally, we find a dependence of strain accumulation on cooling rate

  18. Strain localisation in granular media


    Desrues , Jacques


    This study is devoted to strain localisation in Granular materials. Both experimental and theoretical results have been obtained.The first part of the thesis is a review of the methods and theories about rupture in sols mechanics and more generally, in solid mechanics. The classical framework of Shear Band analysis is presented, and the main results available for different classes of materials are discussed.The second part describes an experimental study of strain localisation in sand specime...

  19. Job strain and male fertility. (United States)

    Hjollund, Niels Henrik I; Bonde, Jens Peter E; Henriksen, Tine Brink; Giwercman, Aleksander; Olsen, Jørn


    Job strain, defined as high job demands and low job control, has not previously been explored as a possible determinant of male fertility. We collected prospective data on job strain among men, and describe the associations with semen quality and probability of conceiving a clinical pregnancy during a menstrual cycle. Danish couples (N = 399) who were trying to become pregnant for the first time were followed for up to 6 menstrual periods. All men collected semen samples, and a blood sample was drawn from both partners. Job demand and job control were measured by a self-administered questionnaire at entry, and in each cycle the participants recorded changes in job control or job demand during the previous 30 days. In adjusted analyses, no associations were found between any semen characteristic or sexual hormones and any job strain variable. The odds for pregnancy were not associated with job strain. Psychologic job strain encountered in normal jobs in Denmark does not seem to affect male reproductive function.

  20. Crack tip stress and strain

    International Nuclear Information System (INIS)

    Francois, D.


    The study of potential energy variations in a loaded elastic solid containing a crack leads to determination of the crack driving force G. Generalization of this concept to cases other than linear elasticity leads to definition of the integral J. In a linear solid, the crack tip stress field is characterized by a single parameter: the stress-intensity factor K. When the crack tip plastic zone size is confined to the elastic singularity J=G, it is possible to establish relationship between these parameters and plastic strain (and in particular the crack tip opening displacement delta). The stress increases because of the triaxiality effect. This overload rises with increasing strain hardening. When the plastic zone size expands, using certain hypotheses, delta can be calculated. The plastic strain intensity is exclusively dependent on parameter J [fr

  1. Management of digital eye strain. (United States)

    Coles-Brennan, Chantal; Sulley, Anna; Young, Graeme


    Digital eye strain, an emerging public health issue, is a condition characterised by visual disturbance and/or ocular discomfort related to the use of digital devices and resulting from a range of stresses on the ocular environment. This review aims to provide an overview of the extensive literature on digital eye strain research with particular reference to the clinical management of symptoms. As many as 90 per cent of digital device users experience symptoms of digital eye strain. Many studies suggest that the following factors are associated with digital eye strain: uncorrected refractive error (including presbyopia), accommodative and vergence anomalies, altered blinking pattern (reduced rate and incomplete blinking), excessive exposure to intense light, closer working distance, and smaller font size. Since a symptom may be caused by one or more factors, a holistic approach should be adopted. The following management strategies have been suggested: (i) appropriate correction of refractive error, including astigmatism and presbyopia; (ii) management of vergence anomalies, with the aim of inducing or leaving a small amount of heterophoria (~1.5 Δ Exo); (iii) blinking exercise/training to maintain normal blinking pattern; (iv) use of lubricating eye drops (artificial tears) to help alleviate dry eye-related symptoms; (v) contact lenses with enhanced comfort, particularly at end-of-day and in challenging environments; (vi) prescription of colour filters in all vision correction options, especially blue light-absorbing filters; and (vii) management of accommodative anomalies. Prevention is the main strategy for management of digital eye strain, which involves: (i) ensuring an ergonomic work environment and practice (through patient education and the implementation of ergonomic workplace policies); and (ii) visual examination and eye care to treat visual disorders. Special consideration is needed for people at a high risk of digital eye strain, such as computer

  2. Taxonomy of oxalotrophic Methylobacterium strains (United States)

    Sahin, Nurettin; Kato, Yuko; Yilmaz, Ferah


    Most of the oxalotrophic bacteria are facultative methylotrophs and play important ecological roles in soil fertility and cycling of elements. This study gives a detailed picture of the taxonomy and diversity of these bacteria and provides new information about the taxonomical variability within the genus Methylobacterium. Twelve mesophilic, pink-pigmented, and facultatively methylotrophic oxalate-oxidizing strains were included in this work that had been previously isolated from the soil and some plant tissues by the potassium oxalate enrichment method. The isolates were characterized using biochemical tests, cellular lipid profiles, spectral characteristics of carotenoid pigments, G+C content of the DNA, and 16S rDNA sequencing. The taxonomic similarities among the strains were analyzed using the simple matching ( S SM) and Jaccard ( S J) coefficients, and the UPGMA clustering algorithm. The phylogenetic position of the strains was inferred by the neighbor-joining method on the basis of the 16S rDNA sequences. All isolates were Gram-negative, facultatively methylotrophic, oxidase and catalase positive, and required no growth factors. Based on the results of numerical taxonomy, the strains formed four closely related clusters sharing ≥85% similarity. Analysis of the 16S rDNA sequences demonstrated that oxalotrophic, pink-pigmented, and facultatively methylotrophic strains could be identified as members of the genus Methylobacterium. Except for M. variabile and M. aquaticum, all of the Methylobacterium type strains tested had the ability of oxalate utilization. Our results indicate that the capability of oxalate utilization seems to be an uncommon trait and could be used as a valuable taxonomic criterion for differentiation of Methylobacterium species.

  3. Cyanobacteria biennal dynamic in a volcanic mesotrophic lake in central Italy: Strategies to prevent dangerous human exposures to cyanotoxins. (United States)

    Manganelli, Maura; Stefanelli, Mara; Vichi, Susanna; Andreani, Paolo; Nascetti, Giuseppe; Scialanca, Fabrizio; Scardala, Simona; Testai, Emanuela; Funari, Enzo


    Vico Lake, a volcanic meso-eutrophic lake in Central Italy, whose water is used for drinking and recreational activities, experienced the presence of the microcystins (MC) producing cyanobacterium Planktothrix rubescens. In order to assess the human health risks and to provide the local health authorities with a scientific basis for planning tailored monitoring activities, we studied P. rubescens ecology and toxicity for two years. P. rubescens generally dominated the phytoplankton community, alternating with Limnothrix redekei, potentially toxic. P. rubescens was distributed throughout the water column during winter; in summer it produced intense blooms where drinking water is collected (-20 m); here MC were detected all year round (0.5-5 μg/L), with implications for drinking water quality. In surface waters, MC posed no risk for recreational activities in summer, while in winter surface blooms and foams (containing up to 56 μg MC/L) can represent a risk for people and children practicing water sports and for animals consuming raw water. Total phosphorus, phosphate and inorganic nitrogen were not relevant to predict densities nor toxicity; however, a strong correlation between P. rubescens density and aminopeptidase ectoenzymatic activity, an enzyme involved in protein degradation, suggested a role of organic nitrogen for this species. The fraction of potentially toxic population, determined both as mcyB(+)/16SrDNA (10-100%) and as the MC/mcyB(+) cells (0.03-0.79 pg MC/cell), was much more variable than usually observed for P. rubescens. Differently from other Italian and European lakes, the correlation between cell density or the mcyB(+) cells and MC explained only ∼50 and 30% of MC variability, respectively: for Vico Lake, monitoring only cell or the mcyB(+) cell density is not sufficient to predict MC concentrations, and consequently to protect population health. Finally, during a winter bloom one site has been sampled weekly, showing that

  4. Noncontacting-optical-strain device (United States)

    Silver, R. H.


    Noncontacting-strain-measuring gauge and extensometer remotely measures the mechanical displacement along the entire length of a test specimen. Measurement is accomplished by continuous scanning of a reflected light from reflective bench markings or stripes previously affixed to the specimen.

  5. Job strain and tobacco smoking

    DEFF Research Database (Denmark)

    Heikkilä, Katriina; Nyberg, Solja T; Fransson, Eleonor I


    Tobacco smoking is a major contributor to the public health burden and healthcare costs worldwide, but the determinants of smoking behaviours are poorly understood. We conducted a large individual-participant meta-analysis to examine the extent to which work-related stress, operationalised as job...... strain, is associated with tobacco smoking in working adults....

  6. Strain effects in oxide superconductors

    International Nuclear Information System (INIS)

    Wada, H.; Kuroda, T.; Sekine, H.; Yuyama, M.; Itoh, K.


    Strain sensitivities of superconducting properties are critical to high magnetic field applications of superconductors, since critical temperature, T c , upper critical field, H c2 , and critical current (density), I c (J c ), are all degraded under strains. Oxide superconductors so far known are all very fragile, thus requiring to be fabricated in the form of composite. In the case of practical metallic superconductors, such as Nb 3 Sn and V 3 Ga, the so-called bronze method has been developed where these superconducting intermetallics are enveloped in a ductile metallic sheath. Recently, a fabrication method similar to the bronze method has been developed for the Bi 2 Sr 2 Ca 2 Cu 3 O x superconductors using Ag tubes as sheath. In the present study mono- and multicore BiPbSrCaCuO tape conductors were prepared by means of this Ag-sheath composite method, and examined in terms of strain sensitivity by measuring their T c and I c (J c ) under bending or tensile strains. (orig.)

  7. Mobilomics in Saccharomyces cerevisiae strains. (United States)

    Menconi, Giulia; Battaglia, Giovanni; Grossi, Roberto; Pisanti, Nadia; Marangoni, Roberto


    Mobile Genetic Elements (MGEs) are selfish DNA integrated in the genomes. Their detection is mainly based on consensus-like searches by scanning the investigated genome against the sequence of an already identified MGE. Mobilomics aims at discovering all the MGEs in a genome and understanding their dynamic behavior: The data for this kind of investigation can be provided by comparative genomics of closely related organisms. The amount of data thus involved requires a strong computational effort, which should be alleviated. Our approach proposes to exploit the high similarity among homologous chromosomes of different strains of the same species, following a progressive comparative genomics philosophy. We introduce a software tool based on our new fast algorithm, called regender, which is able to identify the conserved regions between chromosomes. Our case study is represented by a unique recently available dataset of 39 different strains of S.cerevisiae, which regender is able to compare in few minutes. By exploring the non-conserved regions, where MGEs are mainly retrotransposons called Tys, and marking the candidate Tys based on their length, we are able to locate a priori and automatically all the already known Tys and map all the putative Tys in all the strains. The remaining putative mobile elements (PMEs) emerging from this intra-specific comparison are sharp markers of inter-specific evolution: indeed, many events of non-conservation among different yeast strains correspond to PMEs. A clustering based on the presence/absence of the candidate Tys in the strains suggests an evolutionary interconnection that is very similar to classic phylogenetic trees based on SNPs analysis, even though it is computed without using phylogenetic information. The case study indicates that the proposed methodology brings two major advantages: (a) it does not require any template sequence for the wanted MGEs and (b) it can be applied to infer MGEs also for low coverage genomes

  8. Mobilomics in Saccharomyces cerevisiae strains (United States)


    Background Mobile Genetic Elements (MGEs) are selfish DNA integrated in the genomes. Their detection is mainly based on consensus–like searches by scanning the investigated genome against the sequence of an already identified MGE. Mobilomics aims at discovering all the MGEs in a genome and understanding their dynamic behavior: The data for this kind of investigation can be provided by comparative genomics of closely related organisms. The amount of data thus involved requires a strong computational effort, which should be alleviated. Results Our approach proposes to exploit the high similarity among homologous chromosomes of different strains of the same species, following a progressive comparative genomics philosophy. We introduce a software tool based on our new fast algorithm, called regender, which is able to identify the conserved regions between chromosomes. Our case study is represented by a unique recently available dataset of 39 different strains of S.cerevisiae, which regender is able to compare in few minutes. By exploring the non–conserved regions, where MGEs are mainly retrotransposons called Tys, and marking the candidate Tys based on their length, we are able to locate a priori and automatically all the already known Tys and map all the putative Tys in all the strains. The remaining putative mobile elements (PMEs) emerging from this intra–specific comparison are sharp markers of inter–specific evolution: indeed, many events of non–conservation among different yeast strains correspond to PMEs. A clustering based on the presence/absence of the candidate Tys in the strains suggests an evolutionary interconnection that is very similar to classic phylogenetic trees based on SNPs analysis, even though it is computed without using phylogenetic information. Conclusions The case study indicates that the proposed methodology brings two major advantages: (a) it does not require any template sequence for the wanted MGEs and (b) it can be applied to


    Ellermann, V


    1. A new strain of fowl leucosis has been transmitted through twelve generations of fowls. 2. An increase in virulence was observed during its passage. This was shown in a shortening of the interval between inoculation and death. The increase in virulence does not affect the number of successful inoculations, which remains approximately constant in from 20 to 40 per cent of the birds employed. 3. As with former strains, the disease manifests itself in various forms; i.e., myeloid and intravascular lymphoid types. A single lymphatic case was observed. 4. In several intravascular cases a diminution in the hemolytic power of the serum was established. This phenomenon was absent in a number of myeloid cases. 5. Active immunization cannot be produced by means of the subcutaneous injection of virulent material. 6. The finding of previous experiments that the virus is filterable has been confirmed. 7. The inoculation of human leucemic material into fowls gave negative results.

  10. Computational strain gradient crystal plasticity

    DEFF Research Database (Denmark)

    Niordson, Christian Frithiof; Kysar, Jeffrey W.


    A numerical method for viscous strain gradient crystal plasticity theory is presented, which incorporates both energetic and dissipative gradient effects. The underlying minimum principles are discussed as well as convergence properties of the proposed finite element procedure. Three problems...... of plane crystal plasticity are studied: pure shear of a single crystal between rigid platens as well as plastic deformation around cylindrical voids in hexagonal close packed and face centered cubic crystals. Effective in-plane constitutive slip parameters for plane strain deformation of specifically...... oriented face centered cubic crystals are developed in terms of the crystallographic slip parameters. The effect on geometrically necessary dislocation structures introduced by plastic deformation is investigated as a function of the ratio of void radius to plasticity length scale....

  11. Strain-Detecting Composite Materials (United States)

    Wallace, Terryl A. (Inventor); Smith, Stephen W. (Inventor); Piascik, Robert S. (Inventor); Horne, Michael R. (Inventor); Messick, Peter L. (Inventor); Alexa, Joel A. (Inventor); Glaessgen, Edward H. (Inventor); Hailer, Benjamin T. (Inventor)


    A composite material includes a structural material and a shape-memory alloy embedded in the structural material. The shape-memory alloy changes crystallographic phase from austenite to martensite in response to a predefined critical macroscopic average strain of the composite material. In a second embodiment, the composite material includes a plurality of particles of a ferromagnetic shape-memory alloy embedded in the structural material. The ferromagnetic shape-memory alloy changes crystallographic phase from austenite to martensite and changes magnetic phase in response to the predefined critical macroscopic average strain of the composite material. A method of forming a composite material for sensing the predefined critical macroscopic average strain includes providing the shape-memory alloy having an austenite crystallographic phase, changing a size and shape of the shape-memory alloy to thereby form a plurality of particles, and combining the structural material and the particles at a temperature of from about C. to form the composite material.

  12. Nutrient content of sorghum beer strainings

    African Journals Online (AJOL)

    Sorghum beer strainings were analysed for starch, protein, fat, crude fibre, ash, minerals and ... The importance of minerals in animal nutrition has been recognized for many ..... strainings is probably due to yeast activity during fermentation ...

  13. Yeast strains and methods of use thereof


    Goddard, Matthew Robert; Gardner, Richard Clague; Anfang, Nicole


    The present invention relates to yeast strains and, in particular, to yeast stains for use in fermentation processes. The invention also relates to methods of fermentation using the yeast strains of the invention either alone or in combination with other yeast strains. The invention thither relates to methods for the selection of yeast strains suitable for fermentation cultures by screening for various metabolic products and the use of specific nutrient sources.

  14. Development of Industrial Yeast Platform Strains

    DEFF Research Database (Denmark)

    Bergdahl, Basti; Dato, Laura; Förster, Jochen


    Most of the current metabolic engineering projects are carried out using laboratory strains as the starting host. Although such strains are easily manipulated genetically, their robustness does not always meet the requirements set by industrial fermentation conditions. In such conditions, the cells...... screening of the 36 industrial and laboratory yeast strains. In addition, progress in the development of molecular biology methods for generating the new strains will be presented....


    Directory of Open Access Journals (Sweden)

    O.L. Lukoyanova


    Full Text Available The questions of feeding of children with strained off breast milk are discussed in this article. Author presents medical indications to such type of feeding, peculiarities and rules of storage of strained off milk. There is a brief literature review on the influence of different factors on the composition of strained off breast milk.Key words: strained milk, breast feeding, pasteurization, freezing.(Voprosy sovremennoi pediatrii — Current Pediatrics. 2010;9(2:70-73

  16. Haemophilus ducreyi Cutaneous Ulcer Strains Are Nearly Identical to Class I Genital Ulcer Strains.

    Directory of Open Access Journals (Sweden)

    Dharanesh Gangaiah

    Full Text Available Although cutaneous ulcers (CU in the tropics is frequently attributed to Treponema pallidum subspecies pertenue, the causative agent of yaws, Haemophilus ducreyi has emerged as a major cause of CU in yaws-endemic regions of the South Pacific islands and Africa. H. ducreyi is generally susceptible to macrolides, but CU strains persist after mass drug administration of azithromycin for yaws or trachoma. H. ducreyi also causes genital ulcers (GU and was thought to be exclusively transmitted by microabrasions that occur during sex. In human volunteers, the GU strain 35000HP does not infect intact skin; wounds are required to initiate infection. These data led to several questions: Are CU strains a new variant of H. ducreyi or did they evolve from GU strains? Do CU strains contain additional genes that could allow them to infect intact skin? Are CU strains susceptible to azithromycin?To address these questions, we performed whole-genome sequencing and antibiotic susceptibility testing of 5 CU strains obtained from Samoa and Vanuatu and 9 archived class I and class II GU strains. Except for single nucleotide polymorphisms, the CU strains were genetically almost identical to the class I strain 35000HP and had no additional genetic content. Phylogenetic analysis showed that class I and class II strains formed two separate clusters and CU strains evolved from class I strains. Class I strains diverged from class II strains ~1.95 million years ago (mya and CU strains diverged from the class I strain 35000HP ~0.18 mya. CU and GU strains evolved under similar selection pressures. Like 35000HP, the CU strains were highly susceptible to antibiotics, including azithromycin.These data suggest that CU strains are derivatives of class I strains that were not recognized until recently. These findings require confirmation by analysis of CU strains from other regions.

  17. Strain gradient effects in surface roughening

    DEFF Research Database (Denmark)

    Borg, Ulrik; Fleck, N.A.


    evidence for strain gradient effects. Numerical analyses of a bicrystal undergoing in-plane tensile deformation are also studied using a strain gradient crystal plasticity theory and also by using a strain gradient plasticity theory for an isotropic solid. Both theories include an internal material length...

  18. Engineering piezoresistivity using biaxially strained silicon

    DEFF Research Database (Denmark)

    Pedersen, Jesper Goor; Richter, Jacob; Brandbyge, Mads


    of the piezocoefficient on temperature and dopant density is altered qualitatively for strained silicon. In particular, we find that a vanishing temperature coefficient may result for silicon with grown-in biaxial tensile strain. These results suggest that strained silicon may be used to engineer the iezoresistivity...

  19. drug resistant strains of Salmonella enterica

    African Journals Online (AJOL)

    Conclusions: The aqueous extract of Thonningia sanguinea can provide an alternative therapy for the treatment of salmonellosis, mainly for typhoid fever caused by MDR strains of S. Typhi.The extract also inhibits S.Hadar a MDR emerging strain in Ivory Coast. Keywords: Thonningia sanguinea; Salmonella, MDR strains, ...

  20. Development of high temperature strain gage, (5)

    International Nuclear Information System (INIS)

    Yuuki, Hiroshi; Kobayashi, Yukio; Kanai, Kenji; Yamaura, Yoshio


    Development and improvement of resistance wire type strain gages usable for experimental measurement of thermal strains generated at high temperature in various structures and equipments that consist of a Fast Breeder Reactor have been carried out, and various characteristics of the strain gages have been investigated. Based on the results obtained up to now, development and research of this time mainly aim to improve strain and fatigue characteristics. As the results, characteristics of strain gages with sensing elements of nichrome V are improved, specifically mechanical hysteresis is decreased, strain limit is increased, etc. Also, improvement is recognized in thermal output, and it becomes clear that dummy gages work effectively. However, a filling method of MgO and an inserting method of active-dummy elements are selected as primary objects to improve strain characteristics, and many hours are taken for these objects, so confirmations of characteristics of platinum-tungsten strain gages, strain sensing elements of which are troublesome to produce, have not been completely done, though the performance of the gages has been improved in several points. As to nichrome V strain gages, there is a fair prospect of obtaining ones, specifications of which are quite close to the goal, though problems in manufacturing technics remain for future. As to platinum-tungsten strain gages, it is expected that similar strain gages to nichrome V are obtainable by improvement in manufacturing of sensing elements. (auth.)

  1. Strain path dependency in metal plasticity

    NARCIS (Netherlands)

    Viatkina, E.M.; Brekelmans, W.A.M.; Geers, M.G.D.


    A change in strain path has a significant effect on the mechanical response of metals. Strain path change effects physically originate from a complex microstructure evolution. This paper deals with the contribution of cell structure evolution to the strain path change effect. The material with cells

  2. Stress and strain measurements in solids

    International Nuclear Information System (INIS)

    Askegaard, V.


    A design basis is given for stress- and strain cells to be used in a solid either externally loaded or with a stressfree strain field (for example shrinkage). A stress- and a strain cell has been designed for use in granular materials. Calibration tests show either good or reasonably good correspondance with calculated values. (orig.) [de

  3. Spontaneous abortion and physical strain around implantation

    DEFF Research Database (Denmark)

    Hjollund, N H; Jensen, Tina Kold; Bonde, Jens Peter


    pregnancy the women recorded physical strain prospectively in a structured diary. Physical strain around the time of implantation was associated with later spontaneous abortion. The adjusted risk ratio for women who reported physical strain higher than average at day 6 to 9 after the estimated date...

  4. Strain engineering of van der Waals heterostructures

    NARCIS (Netherlands)

    Vermeulen, Paul A.; Mulder, Jefta; Momand, Jamo; Kooi, Bart J.


    Modifying the strain state of solids allows control over a plethora of functional properties. The weak interlayer bonding in van der Waals (vdWaals) materials such as graphene, hBN, MoS2, and Bi2Te3 might seem to exclude strain engineering, since strain would immediately relax at the vdWaals

  5. On lower order strain gradient plasticity theories

    DEFF Research Database (Denmark)

    Niordson, Christian Frithiof; Hutchinson, J. W.


    By way of numerical examples, this paper explores the nature of solutions to a class of strain gradient plasticity theories that employ conventional stresses, equilibrium equations and boundary conditions. Strain gradients come into play in these modified conventional theories only to alter...... the tangent moduli governing increments of stress and strain. It is shown that the modification is far from benign from a mathematical standpoint, changing the qualitative character of solutions and leading to a new type of localization that is at odds with what is expected from a strain gradient theory....... The findings raise questions about the physical acceptability of this class of strain gradient theories....

  6. Spontaneous abortion and physical strain around implantation

    DEFF Research Database (Denmark)

    Hjøllund, Niels Henrik Ingvar; Jensen, T.K.; Bonde, J.P.


    Existing studies of physical strain and spontaneous abortion are mainly retrospective or based only on pregnancies that have survived the first trimester. Furthermore, almost all studies have relied on averaged measures of physical strain, which tend to blur an effect if peak values during short...... pregnancy the women recorded physical strain prospectively in a structured diary. Physical strain around the time of implantation was associated with later spontaneous abortion. The adjusted risk ratio for women who reported physical strain higher than average at day 6 to 9 after the estimated date...

  7. Local strains in waste tank deflagration analysis

    International Nuclear Information System (INIS)

    Bryan, B.J.; Flanders, H.E. Jr.


    In recent years extensive effort has been expended to qualify buried nuclear waste storage tanks under accident conditions. One of these conditions is deflagration of the combustible gases which may build up over time. While much work has been done to calculate the general strain state, less effort has been made to address the local strains at structural discontinuities. An analytical method is presented for calculating these local strains and combining them with the general strain state. A closed form solution of the local strains is compared to a finite element solution

  8. Sensibility of different wheat varieties (strains) to Ar+ implantation

    International Nuclear Information System (INIS)

    Cui Huanhu; Jing Hua; Ma Aiping; Kang Xiuli; Yang Liping; Huang Mingjing; Ma Buzhou; Shanxi Academy of Agricultural Sciences, Taiyuan


    The sensibility of different wheat varieties (strains) to Ar + implantation was studied. The results showed that the survival rate of 21 wheat varieties (strains) at the dose of 6 x 10 16 Ar + /cm 2 could be divided into five groups: surplus sensitive varieties (strains), sensitive varieties (strains), transitional varieties (strains), obtuse varieties (strains) and surplus obtuse varieties (strains). The sensibility of wheat varieties (strains) to Ar + injection is high-moisture-fertility wheat varieties (strains) > medium-moisture-fertility wheat varieties (strains) > dry land wheat varieties (strains). The study has provided theoretical basis in induced mutation medial lethal dose of different wheat varieties (strains) to Ar + implantation. (authors)

  9. Stress-strain properties of railway steel at strain rates of upto 105 per second

    International Nuclear Information System (INIS)

    Hashmi, M.S.J.; Islam, M.N.


    This paper presents the stress-strain characteristics of railway steel at strain rates of up to 10 5 /s at room temperature determined by a new technique. In determining the results, account has been taken of the strain-rate variation, the total strain and the strain rate history. The effect of friction, material inertia and temperature rise is also assessed and an empirical constitutive equation describing the strain-rate and strain sensitive flow stress for this type of steel is proposed. (orig.)

  10. Strain quantification in epitaxial thin films

    International Nuclear Information System (INIS)

    Cushley, M


    Strain arising in epitaxial thin films can be beneficial in some cases but devastating in others. By altering the lattice parameters, strain may give a thin film properties hitherto unseen in the bulk material. On the other hand, heavily strained systems are prone to develop lattice defects in order to relieve the strain, which can cause device failure or, at least, a decrease in functionality. Using convergent beam electron diffraction (CBED) and high-resolution transmission electron microscopy (HRTEM), it is possible to determine local strains within a material. By comparing the results from CBED and HRTEM experiments, it is possible to gain a complete view of a material, including the strain and any lattice defects present. As well as looking at how the two experimental techniques differ from each other, I will also look at how results from different image analysis algorithms compare. Strain in Si/SiGe samples and BST/SRO/MgO capacitor structures will be discussed.

  11. Studies on Drosophila radiosensitivity strains

    International Nuclear Information System (INIS)

    Varentsova, E.R.; Sharygin, V.I.; Khromykh, Yu.U.


    Fertility of radiosensitive mutant drosophila female strain rad (2) 201 61 after irradiation and frequency of dominant lethal mutations (DLM), induced by γ-radiation for 0-5 h and 5-7 days, are investigated. It is shown, that oocytes of the mutant strain are more radiosensitive as compared with cells of mongrel flies as to criterion of DLM appearance over the period of maturing. Early oocytes of stages 2-7 are the most sensitive, i.e. at the stages, corresponding to the manifestation of previously established recombination-defective properties of mutations rad (2) 201 61 . It is also sown, that doses of γ-rays, exceeding 10 Gy produce a strong sterilizing effect on mutant females due to destruction and resorption of egg chambers, irradiated at the stages of previtellogenetic growth of oocytes. In females, carrying mutation of radiosensitivity there is no direct correlation betwen sensitivity of oocytes proper to DLM induction and sensitivity of egg folleicles to resorbing effect of γ-rays. The ways of possible involvement of mutant locus studied into genetic processes in various specialized cells of drosophila

  12. Noninvasive characterization of carotid plaque strain. (United States)

    Khan, Amir A; Sikdar, Siddhartha; Hatsukami, Thomas; Cebral, Juan; Jones, Michael; Huston, John; Howard, George; Lal, Brajesh K


    Current risk stratification of internal carotid artery plaques based on diameter-reducing percentage stenosis may be unreliable because ischemic stroke results from plaque disruption with atheroembolization. Biomechanical forces acting on the plaque may render it vulnerable to rupture. The feasibility of ultrasound-based quantification of plaque displacement and strain induced by hemodynamic forces and their relationship to high-risk plaques have not been determined. We studied the feasibility and reliability of carotid plaque strain measurement from clinical B-mode ultrasound images and the relationship of strain to high-risk plaque morphology. We analyzed carotid ultrasound B-mode cine loops obtained in patients with asymptomatic ≥50% stenosis during routine clinical scanning. Optical flow methods were used to quantify plaque motion and shear strain during the cardiac cycle. The magnitude (maximum absolute shear strain rate [MASSR]) and variability (entropy of shear strain rate [ESSR] and variance of shear strain rate [VSSR]) of strain were combined into a composite shear strain index (SSI), which was assessed for interscan repeatability and correlated with plaque echolucency. Nineteen patients (mean age, 70 years) constituting 36 plaques underwent imaging; 37% of patients (n = 7) showed high strain (SSI ≥0.5; MASSR, 2.2; ESSR, 39.7; VSSR, 0.03) in their plaques; the remaining clustered into a low-strain group (SSI routine B-mode imaging using clinical ultrasound machines. High plaque strain correlates with known high-risk echolucent morphology. Strain measurement can complement identification of patients at high risk for plaque disruption and stroke. Copyright © 2017 Society for Vascular Surgery. Published by Elsevier Inc. All rights reserved.

  13. Computational Strain Gradient Crystal Plasticity

    DEFF Research Database (Denmark)

    Niordson, Christian Frithiof; Kysar, Jeffrey W.


    A model for strain gradient crystal visco-plasticity is formulated along the lines proposed by Fleck andWillis (2009) for isotropic plasticity. Size-effects are included in the model due to the addition of gradient terms in both the free energy as well as through a dissipation potential. A finite...... element solution method is presented, which delivers the slip-rate field and the velocity-field based on two minimum principles. Some plane deformation problems relevant for certain specific orientations of a face centered cubic crystal under plane loading conditions are studied, and effective in......-plane parameters are developed based on the crystallographic properties of the material. The problem of cyclic shear of a single crystal between rigid platens is studied as well as void growth of a cylindrical void....

  14. Thermoresistance in radioresistant strains of 'Drosophila nebulosa'

    International Nuclear Information System (INIS)

    Kratz, F.L.


    The detection of thermoresistance in radioresistant strains of 'D. nebulosa' is described, as well as some conclusions on the genetic nature of these differences are presented. The strains used in this experiment were MF 204, from 'Morro de Ferro', in Pocos de Caldas (MG) (one of the biggest radioactive anomalies in the world) whose radioresistance is due to its additive genetic components (Kratz, 1973 and 1975); 85(87) R, an induced radioresistant strain; and MF K a control 'pooled' strain obtained near 'Morro do Ferro'. Survival tests, 72 hours after temperature shocks, performed in the interval of 36 0 C to 39 0 C showed a decreasing gradient of thermoresistance with the following regression coefficients: MF 204 b= - 5,4; 85(87)R b= - 7,2 and MF K b= - 7,9. Bifactorial analysis (strains and sexes) performed at 38 0 C and 39 0 C confirmed differences among strains (P [pt

  15. The many shades of prion strain adaptation. (United States)

    Baskakov, Ilia V


    In several recent studies transmissible prion disease was induced in animals by inoculation with recombinant prion protein amyloid fibrils produced in vitro. Serial transmission of amyloid fibrils gave rise to a new class of prion strains of synthetic origin. Gradual transformation of disease phenotypes and PrP(Sc) properties was observed during serial transmission of synthetic prions, a process that resembled the phenomenon of prion strain adaptation. The current article discusses the remarkable parallels between phenomena of prion strain adaptation that accompanies cross-species transmission and the evolution of synthetic prions occurring within the same host. Two alternative mechanisms underlying prion strain adaptation and synthetic strain evolution are discussed. The current article highlights the complexity of the prion transmission barrier and strain adaptation and proposes that the phenomenon of prion adaptation is more common than previously thought.

  16. Effect of strain rate and temperature at high strains on fatigue behavior of SAP alloys

    DEFF Research Database (Denmark)

    Blucher, J.T.; Knudsen, Per; Grant, N.J.


    Fatigue behavior of three SAP alloys of two nominal compositions (7 and 13% Al2O3) was studied in terms of strain rate and temperature at high strains; strain rate had no effect on life at 80 F, but had increasingly greater effect with increasing temperature above 500 F; life decreased with decre......Fatigue behavior of three SAP alloys of two nominal compositions (7 and 13% Al2O3) was studied in terms of strain rate and temperature at high strains; strain rate had no effect on life at 80 F, but had increasingly greater effect with increasing temperature above 500 F; life decreased...

  17. Surface instabilities during straining of anisotropic materials

    DEFF Research Database (Denmark)

    Legarth, Brian Nyvang; Richelsen, Ann Bettina


    The development of instabilities in traction-free surfaces is investigated numerically using a unit cell model. Full finite strain analyses are conducted using isotropic as well as anisotropic yield criteria and both plane strain tension and compression are considered. In the load range of tensio...... of principal overall strain. For other orientations surface instabilities are seen when non-associated plastic flow is taken into account. Compared to tension, smaller compressive deformations are needed in order to initiate a surface instability....

  18. Strain comparisons in aquaculture species: a manual


    Ponzoni, R.W.; James, J.W.; Nguyen, N.H.; Mekkawy, W.; Khaw, H.L.


    When different strains or breeds of a particular species are available, the best choice is seldom immediately obvious for producers. Scientists are also interested in the relative performance of different strains because it provides a basis for recommendations to producers and it often stimulates the conduct of work aimed at unraveling the underlying biological mechanisms involved in the expression of such differences. Hence, strain or breed comparisons of some sort are frequently conducted. ...

  19. [Characteristics of Lactobacillus strains contained in pharmaceuticals]. (United States)

    Banach, W; Bucholc, B; Wójcik, B


    The aim of the study was to characterize lactic acid bacteria (LAB) which are components of drugs administered orally in cases of intestinal disturbances, or antibiotic--related diarrhea. Biochemical properties, growth behavior, bile tolerance, and survival at low pH of six LAB strains (four strains L. rhamnosus and two L. acidophilus) were studied. The survival at low pH was determined in MRS broth (Difco) acidified to pH 1; 2; 3; and 4. Bile tolerance was tested on MRS broth with 0.3% oxgall (Difco). Between tested strains differences in ability to grow at low pH and survival in bile were observed. Only 0.01% inoculum of all examined strains survived at pH 1. Differences between strains in survival at low pH (pH 2 and pH 3) and tolerance of bile were observed. However, after 2 h incubation at pH 4, 100% of strains stayed alive. Examined strains demonstrated good 3% bile tolerance. All strains met the criteria for probiotic strains: ability to survive at pH 3 and in the presence of bile.

  20. Properties of strain gages at cryogenic temperature

    International Nuclear Information System (INIS)

    Shibata, Nobuo; Fujiyoshi, Toshimitsu.


    At the time of developing superconduction generators, the stress measurement for rotor parts is required to grasp the safety and performance of the rotor at cryogenic temperature, which is cooled with liquid helium. In case of carrying out the stress measurement with strain gages, the problems are as follows. The strain gages and lead wires are exposed to cryogenic temperature from 4 to 10 K and strong magnetic field of about 3T, and subjected to high centrifugal acceleration of about 500G. In order to establish the techniques of the stress measurement under such conditions, the adhesives and damp-proof coatings for strain gages and strain gages themselves in Japan and foreign countries were examined on the properties at cryogenic temperature. As for the properties of strain gages, mainly the apparent strain owing to temperature change was investigated, and the change of the gage factors was studies only at liquid nitrogen temperature. The stress measurement with strain gages at low temperature had been studied in detail down to liquid nitrogen temperature concerning LNG tanks. The experimental apparatus, the samples, the testing methods and the test results of cooling tests on adhesives and damp-proof coatings, and the temperature characteristics of strain gages are reported. The usable adhesives and coatings were found, and correction by accurate temperature measurement is required for apparent strain. (Kako, I.)

  1. Comparison of Thermal Creep Strain Calculation Results Using Time Hardening and Strain Hardening Rules

    International Nuclear Information System (INIS)

    Kim, Junehyung; Cheon, Jinsik; Lee, Byoungoon; Lee, Chanbock


    One of the design criteria for the fuel rod in PGSFR is the thermal creep strain of the cladding, because the cladding is exposed to a high temperature for a long time during reactor operation period. In general, there are two kind of calculation scheme for thermal creep strain: time hardening and strain hardening rules. In this work, thermal creep strain calculation results for HT9 cladding by using time hardening and strain hardening rules are compared by employing KAERI's current metallic fuel performance analysis code, MACSIS. Also, thermal creep strain calculation results by using ANL's metallic fuel performance analysis code, LIFE-METAL which adopts strain hardening rule are compared with those by using MACSIS. Thermal creep strain calculation results for HT9 cladding by using time hardening and strain hardening rules were compared by employing KAERI's current metallic fuel performance analysis code, MACSIS. Also, thermal creep strain calculation results by using ANL's metallic fuel performance analysis code, LIFE-METAL which adopts strain hardening rule were compared with those by using MACSIS. Tertiary creep started earlier in time hardening rule than in strain hardening rule. Also, calculation results by MACSIS with strain hardening and those obtained by using LIFE-METAL were almost identical to each other

  2. Predicting creep rupture from early strain data

    International Nuclear Information System (INIS)

    Holmstroem, Stefan; Auerkari, Pertti


    To extend creep life modelling from classical rupture modelling, a robust and effective parametric strain model has been developed. The model can reproduce with good accuracy all parts of the creep curve, economically utilising the available rupture models. The resulting combined model can also be used to predict rupture from the available strain data, and to further improve the rupture models. The methodology can utilise unfailed specimen data for life assessment at lower stress levels than what is possible from rupture data alone. Master curves for creep strain and rupture have been produced for oxygen-free phosphorus-doped (OFP) copper with a maximum testing time of 51,000 h. Values of time to specific strain at given stress (40-165 MPa) and temperature (125-350 deg. C) were fitted to the models in the strain range of 0.1-38%. With typical inhomogeneous multi-batch creep data, the combined strain and rupture modelling involves the steps of investigation of the data quality, extraction of elastic and creep strain response, rupture modelling, data set balancing and creep strain modelling. Finally, the master curves for strain and rupture are tested and validated for overall fitting efficiency. With the Wilshire equation as the basis for the rupture model, the strain model applies classical parametric principles with an Arrhenius type of thermal activation and a power law type of stress dependence for the strain rate. The strain model also assumes that the processes of primary and secondary creep can be reasonably correlated. The rupture model represents a clear improvement over previous models in the range of the test data. The creep strain information from interrupted and running tests were assessed together with the rupture data investigating the possibility of rupture model improvement towards lower stress levels by inverse utilisation of the combined rupture based strain model. The developed creep strain model together with the improved rupture model is

  3. Conduction band structure and electron mobility in uniaxially strained Si via externally applied strain in nanomembranes

    Energy Technology Data Exchange (ETDEWEB)

    Chen Feng [Xi' an Jiaotong University, Xi' an, Shaanxi 710049 (China); Euaruksakul, Chanan; Himpsel, F J; Lagally, Max G [University of Wisconsin-Madison, Madison, WI 53706 (United States); Liu Zheng; Liu Feng, E-mail: [University of Utah, Salt Lake City, UT 84112 (United States)


    Strain changes the band structure of semiconductors. We use x-ray absorption spectroscopy to study the change in the density of conduction band (CB) states when silicon is uniaxially strained along the [1 0 0] and [1 1 0] directions. High stress can be applied to silicon nanomembranes, because their thinness allows high levels of strain without fracture. Strain-induced changes in both the sixfold degenerate {Delta} valleys and the eightfold degenerate L valleys are determined quantitatively. The uniaxial deformation potentials of both {Delta} and L valleys are directly extracted using a strain tensor appropriate to the boundary conditions, i.e., confinement in the plane in the direction orthogonal to the straining direction, which correspond to those of strained CMOS in commercial applications. The experimentally determined deformation potentials match the theoretical predictions well. We predict electron mobility enhancement created by strain-induced CB modifications.

  4. Nanocomposite Strain Gauges Having Small TCRs (United States)

    Gregory, Otto; Chen, Ximing


    Ceramic strain gauges in which the strain-sensitive electrically conductive strips made from nanocomposites of noble metal and indium tin oxide (ITO) are being developed for use in gas turbine engines and other power-generation systems in which gas temperatures can exceed 1,500 F (about 816 C). In general, strain gauges exhibit spurious thermally induced components of response denoted apparent strain. When temperature varies, a strain-gauge material that has a nonzero temperature coefficient of resistance (TCR) exhibits an undesired change in electrical resistance that can be mistaken for the change in resistance caused by a change in strain. It would be desirable to formulate straingauge materials having TCRs as small as possible so as to minimize apparent strain. Most metals exhibit positive TCRs, while most semiconductors, including ITO, exhibit negative TCRs. The present development is based on the idea of using the negative TCR of ITO to counter the positive TCRs of noble metals and of obtaining the benefit of the ability of both ITO and noble metals to endure high temperatures. The noble metal used in this development thus far has been platinum. Combinatorial libraries of many ceramic strain gauges containing nanocomposites of various proportions of ITO and platinum were fabricated by reactive co-sputtering from ITO and platinum targets onto alumina- and zirconia-based substrates mounted at various positions between the targets.

  5. Strain differentiation of polioviruses with monoclonal antibodies.

    NARCIS (Netherlands)

    A.D.M.E. Osterhaus (Albert); A.L. van Wezel; A.J.H. Stegmann; J.A.A.M. van Asten (Jack)


    textabstractPanels of monoclonal antibodies raised against different poliovirus type 1, 2 and 3 strains, were tested in a micro-neutralization test and in a micro-enzyme linked immunosorbent assay against a large number of poliovirus strains. The results were compared with those obtained with the

  6. Organic metabolites produced by Vibrio parahaemolyticus strain ...

    African Journals Online (AJOL)

    Identification and action of several antibacterial metabolites produced by a fish pathogen Vibrio parahaemolyticus strain An3 from marine ecosystem of Goa has been demonstrated. Antibacterial activity of the crude cell extract of the test bacterium has been evaluated against indicator pathogenic bacterial strains such as ...

  7. On lower order strain gradient plasticity theories

    DEFF Research Database (Denmark)

    Niordson, Christian Frithiof; Hutchinson, J. W.


    By way of numerical examples, this paper explores the nature of solutions to a class of strain gradient plasticity theories that employ conventional stresses, equilibrium equations and boundary conditions. Strain gradients come into play in these modified conventional theories only to alter...

  8. Job strain and time to pregnancy

    DEFF Research Database (Denmark)

    Hjollund, N H; Kold Jensen, T; Bonde, Jens Peter


    The association between fertility and job strain defined as high job demands and low job control has not previously been studied. A follow-up study was conducted with prospective collection of information on job strain among women, achievement of pregnancy, and potential confounding variables....

  9. Medically Complex Home Care and Caregiver Strain (United States)

    Moorman, Sara M.; Macdonald, Cameron


    Purpose of the study: To examine (a) whether the content of caregiving tasks (i.e., nursing vs. personal care) contributes to variation in caregivers' strain and (b) whether the level of complexity of nursing tasks contributes to variation in strain among caregivers providing help with such tasks. Design and methods: The data came from the Cash…

  10. Five challenges in modelling interacting strain dynamics

    DEFF Research Database (Denmark)

    Wikramaratna, Paul S; Kurcharski, Adam; Gupta, Sunetra


    population models. Next we consider the nature of so-called “strain space”. We describe two key types of host heterogeneities, and explain how models could help generate a better understanding of their effects. Finally, for diseases with many strains, we consider the challenge of modelling how immunity...

  11. Multiple Genome Sequences of Lactobacillus plantarum Strains


    Kafka, Thomas A.; Geissler, Andreas J.; Vogel, Rudi F.


    ABSTRACT We report here the genome sequences of four Lactobacillus plantarum strains which vary in surface hydrophobicity. Bioinformatic analysis, using additional genomes of Lactobacillus plantarum strains, revealed a possible correlation between the cell wall teichoic acid-type and cell surface hydrophobicity and provide the basis for consecutive analyses.

  12. Preliminary characterization of slow growing rhizobial strains ...

    African Journals Online (AJOL)

    In this paper, we did some preliminary characterization of six slow growing rhizobial strains, isolated from Retama monosperma (L.) Boiss. root nodules sampled from 3 sites along the coast of Oran (CapeFalcon, Bousfer and MersElHadjadj) in Northwestern Algeria. Results of this study showed that all strains had a very ...

  13. Typing of lymphogranuloma venereum Chlamydia trachomatis strains

    NARCIS (Netherlands)

    Christerson, Linus; de Vries, Henry J. C.; de Barbeyrac, Bertille; Gaydos, Charlotte A.; Henrich, Birgit; Hoffmann, Steen; Schachter, Julius; Thorvaldsen, Johannes; Vall-Mayans, Martí; Klint, Markus; Herrmann, Björn; Morré, Servaas A.


    We analyzed by multilocus sequence typing 77 lymphogranuloma venereum Chlamydia trachomatis strains from men who have sex with men in Europe and the United States. Specimens from an outbreak in 2003 in Europe were monoclonal. In contrast, several strains were in the United States in the 1980s,

  14. Typing of Lymphogranuloma Venereum Chlamydia trachomatis Strains (United States)

    Christerson, Linus; de Vries, Henry J.C.; de Barbeyrac, Bertille; Gaydos, Charlotte A.; Henrich, Birgit; Hoffmann, Steen; Schachter, Julius; Thorvaldsen, Johannes; Vall-Mayans, Martí; Klint, Markus; Morré, Servaas A.


    We analyzed by multilocus sequence typing 77 lymphogranuloma venereum Chlamydia trachomatis strains from men who have sex with men in Europe and the United States. Specimens from an outbreak in 2003 in Europe were monoclonal. In contrast, several strains were in the United States in the 1980s, including a variant from Europe. PMID:21029543

  15. MARSI: metabolite analogues for rational strain improvement

    DEFF Research Database (Denmark)

    Cardoso, João G. R.; Zeidan, Ahmad A; Jensen, Kristian


    reactions in an organism can be used to predict effects of MAs on cellular phenotypes. Here, we present the Metabolite Analogues for Rational Strain Improvement (MARSI) framework. MARSI provides a rational approach to strain improvement by searching for metabolites as targets instead of genes or reactions...

  16. General Strain Theory and Delinquency: Focusing on the Influences of Key Strain Characteristics on Delinquency (United States)

    Moon, Byongook; Blurton, David; McCluskey, John D.


    The study examines the effects of recent, older, and chronic strains and of perceived injustice of strain on delinquency, sampling 777 Korean youth. Seven key strains most likely leading to delinquency, some of which were often overlooked in previous research, were included, and these are family conflict, parental punishment, teachers' punishment,…

  17. Strain localization band width evolution by electronic speckle pattern interferometry strain rate measurement

    Energy Technology Data Exchange (ETDEWEB)

    Guelorget, Bruno [Institut Charles Delaunay-LASMIS, Universite de technologie de Troyes, FRE CNRS 2848, 12 rue Marie Curie, B.P. 2060, 10010 Troyes Cedex (France)], E-mail:; Francois, Manuel; Montay, Guillaume [Institut Charles Delaunay-LASMIS, Universite de technologie de Troyes, FRE CNRS 2848, 12 rue Marie Curie, B.P. 2060, 10010 Troyes Cedex (France)


    In this paper, electronic speckle pattern interferometry strain rate measurements are used to quantify the width of the strain localization band, which occurs when a sheet specimen is submitted to tension. It is shown that the width of this band decreases with increasing strain. Just before fracture, this measured width is about five times wider than the shear band and the initial sheet thickness.

  18. Limitations of Hollomon and Ludwigson stress-strain relations in assessing the strain hardening parameters

    International Nuclear Information System (INIS)

    Samuel, K G


    It is shown that the deviation from the ideal Hollomon relation in describing the stress-strain behaviour is characteristic of all materials at low strains. The Ludwigson relation describing the deviation from the Hollomon relation at low strains is critically analysed and it is shown that the deviation at low strains is a consequence of some unknown 'plastic strain equivalent' present in the material. Stress strain curves obeying an ideal Hollomon relation as well as that of a structurally modified (prior cold worked) material were simulated and compared. The results show that the yield strength and the flow strength of a material at constant strain rate and temperature are dictated by the magnitude of the 'plastic strain equivalent' term. It is shown that this component need not necessarily mean a prior plastic strain present in the material due to prior cold work alone and that prior cold work strain will add to this. If this component is identified, the stress-strain behaviour can be adequately described by the Swift relation. It is shown that in both formalisms, the strain hardening index is a function of the yield strength of the material

  19. Atlas of stress-strain curves

    CERN Document Server


    The Atlas of Stress-Strain Curves, Second Edition is substantially bigger in page dimensions, number of pages, and total number of curves than the previous edition. It contains over 1,400 curves, almost three times as many as in the 1987 edition. The curves are normalized in appearance to aid making comparisons among materials. All diagrams include metric (SI) units, and many also include U.S. customary units. All curves are captioned in a consistent format with valuable information including (as available) standard designation, the primary source of the curve, mechanical properties (including hardening exponent and strength coefficient), condition of sample, strain rate, test temperature, and alloy composition. Curve types include monotonic and cyclic stress-strain, isochronous stress-strain, and tangent modulus. Curves are logically arranged and indexed for fast retrieval of information. The book also includes an introduction that provides background information on methods of stress-strain determination, on...

  20. [New antibiotics produced by Bacillus subtilis strains]. (United States)

    Malanicheva, I A; Kozlov, D G; Efimenko, T A; Zenkova, V A; Kastrukha, G S; Reznikova, M I; Korolev, A M; Borshchevskaia, L N; Tarasova, O D; Sineokiĭ, S P; Efremenkova, O V


    Two Bacillus subtilis strains isolated from the fruiting body of a basidiomycete fungus Pholiota squarrosa exhibited a broad range of antibacterial activity, including those against methicillin-resistant Staphylococcus aureus INA 00761 (MRSA) and Leuconostoc mes6nteroides VKPM B-4177 resistant to glycopep-> tide antibiotics, as well as antifungal activity. The strains were identified as belonging to the "B. subtilis" com- plex based on their morphological and physiological characteristics, as well as by sequencing of the 16S rRNA gene fragments. Both strains (INA 01085 and INA 01086) produced insignificant amounts of polyene antibiotics (hexaen and pentaen, respectively). Strain INA 01086 produced also a cyclic polypeptide antibiotic containing Asp, Gly, Leu, Pro, Tyr, Thr, Trp, and Phe, while the antibiotic of strain INA 01085 contained, apart from these, two unidentified nonproteinaceous amino acids. Both polypeptide antibiotics were new compounds efficient against gram-positive bacteria and able to override the natural bacterial antibiotic resistance.

  1. On fracture in finite strain gradient plasticity

    DEFF Research Database (Denmark)

    Martínez Pañeda, Emilio; Niordson, Christian Frithiof


    In this work a general framework for damage and fracture assessment including the effect of strain gradients is provided. Both mechanism-based and phenomenological strain gradient plasticity (SGP) theories are implemented numerically using finite deformation theory and crack tip fields are invest......In this work a general framework for damage and fracture assessment including the effect of strain gradients is provided. Both mechanism-based and phenomenological strain gradient plasticity (SGP) theories are implemented numerically using finite deformation theory and crack tip fields...... are investigated. Differences and similarities between the two approaches within continuum SGP modeling are highlighted and discussed. Local strain hardening promoted by geometrically necessary dislocations (GNDs) in the vicinity of the crack leads to much higher stresses, relative to classical plasticity...... in the multiple parameter version of the phenomenological SGP theory. Since this also dominates the mechanics of indentation testing, results suggest that length parameters characteristic of mode I fracture should be inferred from nanoindentation....

  2. Dark field electron holography for strain measurement

    Energy Technology Data Exchange (ETDEWEB)

    Beche, A., E-mail: [CEA-Grenoble, INAC/SP2M/LEMMA, F-38054 Grenoble (France); Rouviere, J.L. [CEA-Grenoble, INAC/SP2M/LEMMA, F-38054 Grenoble (France); Barnes, J.P.; Cooper, D. [CEA-LETI, Minatec Campus, F-38054 Grenoble (France)


    Dark field electron holography is a new TEM-based technique for measuring strain with nanometer scale resolution. Here we present the procedure to align a transmission electron microscope and obtain dark field holograms as well as the theoretical background necessary to reconstruct strain maps from holograms. A series of experimental parameters such as biprism voltage, sample thickness, exposure time, tilt angle and choice of diffracted beam are then investigated on a silicon-germanium layer epitaxially embedded in a silicon matrix in order to obtain optimal dark field holograms over a large field of view with good spatial resolution and strain sensitivity. -- Research Highlights: {yields} Step by step explanation of the dark field electron holography technique. {yields} Presentation of the theoretical equations to obtain quantitative strain map. {yields} Description of experimental parameters influencing dark field holography results. {yields} Quantitative strain measurement on a SiGe layer embedded in a silicon matrix.

  3. Pseudomagnetic fields and triaxial strain in graphene

    DEFF Research Database (Denmark)

    Settnes, Mikkel; Power, Stephen; Jauho, Antti-Pekka


    Pseudomagnetic fields, which can result from nonuniform strain distributions, have received much attention in graphene systems due to the possibility of mimicking real magnetic fields with magnitudes of greater than 100 T. We examine systems with such strains confined to finite regions ("pseudoma......Pseudomagnetic fields, which can result from nonuniform strain distributions, have received much attention in graphene systems due to the possibility of mimicking real magnetic fields with magnitudes of greater than 100 T. We examine systems with such strains confined to finite regions......-binding calculations of single pseudomagnetic dots in extended graphene sheets confirm these predictions, and are also used to study the effect of rotating the strain direction with respect to the underlying graphene lattice, and varying the size of the pseudomagnetic dot....


    Directory of Open Access Journals (Sweden)

    G. A. Ivashinnikova


    Full Text Available The new rapid molecular genotyping method was developed for studying the structure of ptxP promoter of pertussis toxin. Method is based on PCR-RFLP analysis, which allows studying the specific restriction profiles of the B. pertussis strains and allows differentiation of the strains with the ptxP structural particularities. The developed method for genotyping of strains of B. pertussis can be hhelpful when monitoring strains of the causative agent of whooping cough in system of an epidemiological surveillance over pertussis infections, allowing observation over circulating population of B.pertussis, revealing strains of the causative agent of whooping cough with high production of pertussis toxin and to watch their distribution.

  5. Strain rate effects in stress corrosion cracking

    Energy Technology Data Exchange (ETDEWEB)

    Parkins, R.N. (Newcastle upon Tyne Univ. (UK). Dept. of Metallurgy and Engineering Materials)


    Slow strain rate testing (SSRT) was initially developed as a rapid, ad hoc laboratory method for assessing the propensity for metals an environments to promote stress corrosion cracking. It is now clear, however, that there are good theoretical reasons why strain rate, as opposed to stress per se, will often be the controlling parameter in determining whether or not cracks are nucleated and, if so, are propagated. The synergistic effects of the time dependence of corrosion-related reactions and microplastic strain provide the basis for mechanistic understanding of stress corrosion cracking in high-pressure pipelines and other structures. However, while this may be readily comprehended in the context of laboratory slow strain tests, its extension to service situations may be less apparent. Laboratory work involving realistic stressing conditions, including low-frequency cyclic loading, shows that strain or creep rates give good correlation with thresholds for cracking and with crack growth kinetics.

  6. Strain-controlled nonvolatile magnetization switching (United States)

    Geprägs, S.; Brandlmaier, A.; Brandt, M. S.; Gross, R.; Goennenwein, S. T. B.


    We investigate different approaches towards a nonvolatile switching of the remanent magnetization in single-crystalline ferromagnets at room temperature via elastic strain using ferromagnetic thin film/piezoelectric actuator hybrids. The piezoelectric actuator induces a voltage-controllable strain along different crystalline directions of the ferromagnetic thin film, resulting in modifications of its magnetization by converse magnetoelastic effects. We quantify the magnetization changes in the hybrids via ferromagnetic resonance spectroscopy and superconducting quantum interference device magnetometry. These measurements demonstrate a significant strain-induced change of the magnetization, limited by an inefficient strain transfer and domain formation in the particular system studied. To overcome these obstacles, we address practicable engineering concepts and use a model to demonstrate that a strain-controlled, nonvolatile magnetization switching should be possible in appropriately engineered ferromagnetic/piezoelectric actuator hybrids.

  7. Amerindian Helicobacter pylori strains go extinct, as european strains expand their host range.

    Directory of Open Access Journals (Sweden)

    Maria G Domínguez-Bello

    Full Text Available We studied the diversity of bacteria and host in the H. pylori-human model. The human indigenous bacterium H. pylori diverged along with humans, into African, European, Asian and Amerindian groups. Of these, Amerindians have the least genetic diversity. Since niche diversity widens the sets of resources for colonizing species, we predicted that the Amerindian H. pylori strains would be the least diverse. We analyzed the multilocus sequence (7 housekeeping genes of 131 strains: 19 cultured from Africans, 36 from Spanish, 11 from Koreans, 43 from Amerindians and 22 from South American Mestizos. We found that all strains that had been cultured from Africans were African strains (hpAfrica1, all from Spanish were European (hpEurope and all from Koreans were hspEAsia but that Amerindians and Mestizos carried mixed strains: hspAmerind and hpEurope strains had been cultured from Amerindians and hpEurope and hpAfrica1 were cultured from Mestizos. The least genetically diverse H. pylori strains were hspAmerind. Strains hpEurope were the most diverse and showed remarkable multilocus sequence mosaicism (indicating recombination. The lower genetic structure in hpEurope strains is consistent with colonization of a diversity of hosts. If diversity is important for the success of H. pylori, then the low diversity of Amerindian strains might be linked to their apparent tendency to disappear. This suggests that Amerindian strains may lack the needed diversity to survive the diversity brought by non-Amerindian hosts.

  8. Strain hardening rate sensitivity and strain rate sensitivity in TWIP steels

    Energy Technology Data Exchange (ETDEWEB)

    Bintu, Alexandra [TEMA, Department of Mechanical Engineering, University of Aveiro, Campus Universitário de Santiago, 3810-193 (Portugal); Vincze, Gabriela, E-mail: [TEMA, Department of Mechanical Engineering, University of Aveiro, Campus Universitário de Santiago, 3810-193 (Portugal); Picu, Catalin R. [Department of Mechanical, Aerospace and Nuclear Engineering, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States); Lopes, Augusto B. [CICECO, Department of Materials and Ceramic Engineering, University of Aveiro, Campus Universitário de Santiago, 3810-193 (Portugal); Grácio, Jose J. [TEMA, Department of Mechanical Engineering, University of Aveiro, Campus Universitário de Santiago, 3810-193 (Portugal); Barlat, Frederic [Materials Mechanics Laboratory, Graduate Institute of Ferrous Technology, Pohang University of Science and Technology, Pohang 790-784 (Korea, Republic of)


    TWIP steels are materials with very high strength and exceptional strain hardening capability, parameters leading to large energy absorption before failure. However, TWIP steels also exhibit reduced (often negative) strain rate sensitivity (SRS) which limits the post-necking deformation. In this study we demonstrate for an austenitic TWIP steel with 18% Mn a strong dependence of the twinning rate on the strain rate, which results in negative strain hardening rate sensitivity (SHRS). The instantaneous component of SHRS is large and negative, while its transient is close to zero. The SRS is observed to decrease with strain, becoming negative for larger strains. Direct observations of the strain rate dependence of the twinning rate are made using electron microscopy and electron backscatter diffraction, which substantiate the proposed mechanism for the observed negative SHRS.

  9. Strain hardening rate sensitivity and strain rate sensitivity in TWIP steels

    International Nuclear Information System (INIS)

    Bintu, Alexandra; Vincze, Gabriela; Picu, Catalin R.; Lopes, Augusto B.; Grácio, Jose J.; Barlat, Frederic


    TWIP steels are materials with very high strength and exceptional strain hardening capability, parameters leading to large energy absorption before failure. However, TWIP steels also exhibit reduced (often negative) strain rate sensitivity (SRS) which limits the post-necking deformation. In this study we demonstrate for an austenitic TWIP steel with 18% Mn a strong dependence of the twinning rate on the strain rate, which results in negative strain hardening rate sensitivity (SHRS). The instantaneous component of SHRS is large and negative, while its transient is close to zero. The SRS is observed to decrease with strain, becoming negative for larger strains. Direct observations of the strain rate dependence of the twinning rate are made using electron microscopy and electron backscatter diffraction, which substantiate the proposed mechanism for the observed negative SHRS

  10. Measurement of Strain and Strain Rate during the Impact of Tennis Ball Cores

    Directory of Open Access Journals (Sweden)

    Ben Lane


    Full Text Available The aim of this investigation was to establish the strains and strain rates experienced by tennis ball cores during impact to inform material characterisation testing and finite element modelling. Three-dimensional surface strains and strain rates were measured using two high-speed video cameras and corresponding digital image correlation software (GOM Correlate Professional. The results suggest that material characterisation testing to a maximum strain of 0.4 and a maximum rate of 500 s−1 in tension and to a maximum strain of −0.4 and a maximum rate of −800 s−1 in compression would encapsulate the demands placed on the material during impact and, in turn, define the range of properties required to encapsulate the behavior of the material during impact, enabling testing to be application-specific and strain-rate-dependent properties to be established and incorporated in finite element models.

  11. Factors affecting finite strain estimation in low-grade, low-strain clastic rocks (United States)

    Pastor-Galán, Daniel; Gutiérrez-Alonso, Gabriel; Meere, Patrick A.; Mulchrone, Kieran F.


    The computer strain analysis methods SAPE, MRL and DTNNM have permitted the characterization of finite strain in two different regions with contrasting geodynamic scenarios; (1) the Talas Ala Tau (Tien Shan, Kyrgyzs Republic) and (2) the Somiedo Nappe and Narcea Antiform (Cantabrian to West Asturian-Leonese Zone boundary, Variscan Belt, NW of Iberia). The performed analyses have revealed low-strain values and the regional strain trend in both studied areas. This study also investigates the relationship between lithology (grain size and percentage of matrix) and strain estimates the two methodologies used. The results show that these methods are comparable and the absence of significant finite strain lithological control in rocks deformed under low metamorphic and low-strain conditions.

  12. Chemical Profile of Monascus ruber Strains

    Directory of Open Access Journals (Sweden)

    Ahamed M. Moharram


    Full Text Available Chemical profile of Monascus ruber strains has been studied using gas chromatography-mass spectrometry (GC/MS analysis. The colour intensity of the red pigment and secondary metabolic products of two M. ruber strains (AUMC 4066 and AUMC 5705 cultivated on ten different media were also studied. Metabolic products can be classified into four categories: anticholesterol, anticancer, food colouring, and essential fatty acids necessary for human health. Using GC/MS, the following 88 metabolic products were detected: butyric acid and its derivatives (25 products, other fatty acids and their derivatives (19 products, pyran and its derivatives (22 products and other metabolites (22 products. Among these, 32 metabolites were specific for AUMC 4066 strain and 34 for AUMC 5705 strain, whereas 22 metabolites were produced by both strains on different tested substrates. Production of some metabolites depended on the substrate used. High number of metabolites was recorded in the red pigment extract obtained by both strains grown on malt broth and malt agar. Also, 42 aroma compounds were recorded (4 alcohols, 2 benzaldehydes, 27 esters, 3 lactones, 1 phenol, 1 terpenoid, 3 thiol compounds and acetate-3-mercapto butyric acid. Thin layer chromatography and GC/MS analyses revealed no mycotoxin citrinin in any media used for the growth of the two M. ruber strains.

  13. Resolution of axial shear strain elastography

    International Nuclear Information System (INIS)

    Thitaikumar, Arun; Righetti, Raffaella; Krouskop, Thomas A; Ophir, Jonathan


    The technique of mapping the local axial component of the shear strain due to quasi-static axial compression is defined as axial shear strain elastography. In this paper, the spatial resolution of axial shear strain elastography is investigated through simulations, using an elastically stiff cylindrical lesion embedded in a homogeneously softer background. Resolution was defined as the smallest size of the inclusion for which the strain value at the inclusion/background interface was greater than the average of the axial shear strain values at the interface and inside the inclusion. The resolution was measured from the axial shear strain profile oriented at 45 0 to the axis of beam propagation, due to the absence of axial shear strain along the normal directions. The effects of the ultrasound system parameters such as bandwidth, beamwidth and transducer element pitch along with signal processing parameters such as correlation window length (W) and axial shift (ΔW) on the estimated resolution were investigated. The results show that the resolution (at 45 0 orientation) is determined by the bandwidth and the beamwidth. However, the upper bound on the resolution is limited by the larger of the beamwidth and the window length, which is scaled inversely to the bandwidth. The results also show that the resolution is proportional to the pitch and not significantly affected by the axial window shift

  14. Development of intra-strain self-cloning procedure for breeding baker's yeast strains. (United States)

    Nakagawa, Youji; Ogihara, Hiroyuki; Mochizuki, Chisato; Yamamura, Hideki; Iimura, Yuzuru; Hayakawa, Masayuki


    Previously reported self-cloning procedures for breeding of industrial yeast strains require DNA from other strains, plasmid DNA, or mutagenesis. Therefore, we aimed to construct a self-cloning baker's yeast strain that exhibits freeze tolerance via an improved self-cloning procedure. We first disrupted the URA3 gene of a prototrophic baker's yeast strain without the use of any marker gene, resulting in a Δura3 homozygous disruptant. Then, the URA3 gene of the parental baker's yeast strain was used as a selection marker to introduce the constitutive TDH3 promoter upstream of the PDE2 gene encoding high-affinity cyclic AMP phosphodiesterase. This self-cloning procedure was performed without using DNA from other Saccharomyces cerevisiae strains, plasmid DNA, or mutagenesis and was therefore designated an intra-strain self-cloning procedure. Using this self-cloning procedure, we succeeded in producing self-cloning baker's yeast strains that harbor the TDH3p-PDE2 gene heterozygously and homozygously, designated TDH3p-PDE2 hetero and TDH3p-PDE2 homo strains, respectively. These self-cloning strains expressed much higher levels of PDE2 mRNA than the parental strain and exhibited higher viability after freeze stress, as well as higher fermentation ability in frozen dough, when compared with the parental strain. The TDH3p-PDE2 homo strain was genetically more stable than the TDH3p-PDE2 hetero strain. These results indicate that both heterozygous and homozygous strains of self-cloning PDE2-overexpressing freeze-tolerant strains of industrial baker's yeast can be prepared using the intra-strain self-cloning procedure, and, from a practical viewpoint, the TDH3p-PDE2 homo strain constructed in this study is preferable to the TDH3p-PDE2 hetero strain for frozen dough baking. Copyright © 2016 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  15. [Screening and optimization of cholesterol conversion strain]. (United States)

    Fan, Dan; Xiong, Bingjian; Pang, Cuiping; Zhu, Xiangdong


    Bacterial strain SE-1 capable of transforming cholesterol was isolated from soil and characterized. The transformation products were identified. Fermentation conditions were optimized for conversion. Cholesterol was used as sole carbon source to isolate strain SE-1. Morphology, physiological and biochemical characteristics of strain SE-1 were studied. 16S rRNA gene was sequenced and subjected to phylogenetic analysis. Fermentation supernatants were extracted with chloroform, the transformation products were analyzed by silica gel thin layer chromatography and Sephadex LH20. Their structures were identified by 1H-NMR and 13C-NMR. Fermentation medium including carbon and nitrogen, methods of adding substrates and fermentation conditions for Strain SE-1 were optimized. Strain SE-1 was a Gram-negative bacterium, exhibiting the highest homologs to Burkholderia cepacia based on the physiological analysis. The sequence analysis of 16S rRNA gene of SE-1 strain and comparison with related Burkholderia show that SE-1 strain was very close to B. cepacia (Genbank No. U96927). The similarity was 99%. The result of silica gel thin layer chromatography shows that strain SE-1 transformed cholesterol to two products, 7beta-hydroxycholesterol and the minor product was 7-oxocholesterol. The optimum culture conditions were: molasses 5%, (NH4 )2SO4 0.3%, 4% of inoculation, pH 7.5 and 36 degrees C. Under the optimum culture condition, the conversion rate reached 34.4% when concentration of cholesterol-Tween 80 was 1 g/L. Cholesterol 7beta-hydroxylation conversion rate under optimal conditions was improved by 20.8%. Strain SE-1 isolated from soil is capable of converting cholesterol at lab-scale.

  16. Ductile Damage Evolution and Strain Path Dependency

    International Nuclear Information System (INIS)

    Tasan, C. C.; Hoefnagels, J. M. P.; Peerlings, R. H. J.; Geers, M. G. D.; ten Horn, C. H. L. J.; Vegter, H.


    Forming limit diagrams are commonly used in sheet metal industry to define the safe forming regions. These diagrams are built to define the necking strains of sheet metals. However, with the rise in the popularity of advance high strength steels, ductile fracture through damage evolution has also emerged as an important parameter in the determination of limit strains. In this work, damage evolution in two different steels used in the automotive industry is examined to observe the relationship between damage evolution and the strain path that is followed during the forming operation

  17. Strain-energy effects on dynamic fragmentation

    International Nuclear Information System (INIS)

    Glenn, L.A.; Chudnovsky, A.


    Grady's model of the dynamic fragmentation process, in which the average fragment size is determined by balancing the local kinetic energy and the surface energy, is modified to include the stored elastic (strain) energy. The revised model predicts that the strain energy should dominate for brittle materials, with low fracture toughness and high fracture-initiation stress. This conclusion is not borne out, however, by limited experimental data on brittle steels, even when the kinetic-energy density is small compared with the strain-energy density

  18. Stability of germanene under tensile strain

    KAUST Repository

    Kaloni, Thaneshwor P.


    The stability of germanene under biaxial tensile strain and the accompanying modifications of the electronic properties are studied by density functional theory. The phonon spectrum shows that up to 16% strain the germanene lattice is stable, where the Dirac cone shifts towards higher energy and hole-doped Dirac states are achieved. The latter is due to weakening of the Ge-Ge bonds and reduction of the s-p hybridization. Our calculated Grüneisen parameter shows a similar dependence on the strain as reported for silicene (which is different from that of graphene). © 2013 Elsevier B.V. All rights reserved.

  19. Stability of germanene under tensile strain

    KAUST Repository

    Kaloni, Thaneshwor P.; Schwingenschlö gl, Udo


    The stability of germanene under biaxial tensile strain and the accompanying modifications of the electronic properties are studied by density functional theory. The phonon spectrum shows that up to 16% strain the germanene lattice is stable, where the Dirac cone shifts towards higher energy and hole-doped Dirac states are achieved. The latter is due to weakening of the Ge-Ge bonds and reduction of the s-p hybridization. Our calculated Grüneisen parameter shows a similar dependence on the strain as reported for silicene (which is different from that of graphene). © 2013 Elsevier B.V. All rights reserved.

  20. Rat Strain Ontology: structured controlled vocabulary designed to facilitate access to strain data at RGD. (United States)

    Nigam, Rajni; Munzenmaier, Diane H; Worthey, Elizabeth A; Dwinell, Melinda R; Shimoyama, Mary; Jacob, Howard J


    The Rat Genome Database (RGD) ( is the premier site for comprehensive data on the different strains of the laboratory rat (Rattus norvegicus). The strain data are collected from various publications, direct submissions from individual researchers, and rat providers worldwide. Rat strain, substrain designation and nomenclature follow the Guidelines for Nomenclature of Mouse and Rat Strains, instituted by the International Committee on Standardized Genetic Nomenclature for Mice. While symbols and names aid in identifying strains correctly, the flat nature of this information prohibits easy search and retrieval, as well as other data mining functions. In order to improve these functionalities, particularly in ontology-based tools, the Rat Strain Ontology (RS) was developed. The Rat Strain Ontology (RS) reflects the breeding history, parental background, and genetic manipulation of rat strains. This controlled vocabulary organizes strains by type: inbred, outbred, chromosome altered, congenic, mutant and so on. In addition, under the chromosome altered category, strains are organized by chromosome, and further by type of manipulations, such as mutant or congenic. This allows users to easily retrieve strains of interest with modifications in specific genomic regions. The ontology was developed using the Open Biological and Biomedical Ontology (OBO) file format, and is organized on the Directed Acyclic Graph (DAG) structure. Rat Strain Ontology IDs are included as part of the strain report (RS: ######). As rat researchers are often unaware of the number of substrains or altered strains within a breeding line, this vocabulary now provides an easy way to retrieve all substrains and accompanying information. Its usefulness is particularly evident in tools such as the PhenoMiner at RGD, where users can now easily retrieve phenotype measurement data for related strains, strains with similar backgrounds or those with similar introgressed regions. This

  1. Biological assay of attenuated strain NADL-2 and virulent strain NADL-8 of porcine parvovirus. (United States)

    Mengeling, W L; Pejsak, Z; Paul, P S


    Attenuated strain NADL-2 and virulent strain NADL-8 of porcine parvovirus (PPV) were titrated in vivo and in vitro under similar conditions to provide a better understanding of some of the factors involved in virulence of PPV in causing maternal reproductive failure of swine. Both strains cause fetal death when they are injected directly into fetal fluids, but only strain NADL-8 does so when administered to pregnant swine. The strains were tested for their hemagglutinating activity (HA), median cell culture infective dose (CCID50), median fetal infective dose (FID50), and median fetal lethal dose (FLD50). The FID50 and FLD50 were determined by injecting virus directly into the amniotic fluid of fetuses in utero at 44 +/- 2 days of gestation and collecting the fetuses 15 +/- 1 days later. Both strains had an HA titer of 64, suggesting that there is a similar number of virions in stock preparations. However, other measurements differed markedly. The CCID50, FID50, and FLD50 were 10(5.5), 10(3.5), and 10(0.5), respectively, for strain NADL-2, and 10(4.5), 10(7.7), and 10(6.3), respectively, for strain NADL-8. Collectively, the values indicate that more than 10,000 times as much strain NADL-2 would need to reach the conceptus transplacentally to establish infection. These observations may help to explain the different consequences of oronasal exposure of pregnant swine to these strains of PPV.

  2. Solitary waves in morphogenesis: Determination fronts as strain-cued strain transformations among automatous cells (United States)

    Cox, Brian N.; Landis, Chad M.


    We present a simple theory of a strain pulse propagating as a solitary wave through a continuous two-dimensional population of cells. A critical strain is assumed to trigger a strain transformation, while, simultaneously, cells move as automata to tend to restore a preferred cell density. We consider systems in which the strain transformation is a shape change, a burst of proliferation, or the commencement of growth (which changes the shape of the population sheet), and demonstrate isomorphism among these cases. Numerical and analytical solutions describe a strain pulse whose height does not depend on how the strain disturbance was first launched, or the rate at which the strain transformation is achieved, or the rate constant in the rule for the restorative cell motion. The strain pulse is therefore very stable, surviving the imposition of strong perturbations: it would serve well as a timing signal in development. The automatous wave formulation is simple, with few model parameters. A strong case exists for the presence of a strain pulse during amelogenesis. Quantitative analysis reveals a simple relationship between the velocity of the leading edge of the pulse in amelogenesis and the known speed of migration of ameloblast cells. This result and energy arguments support the depiction of wave motion as an automatous cell response to strain, rather than as a response to an elastic energy gradient. The theory may also contribute to understanding the determination front in somitogenesis, moving fronts of convergent-extension transformation, and mitotic wavefronts in the syncytial drosophila embryo.

  3. Five challenges in modelling interacting strain dynamics

    Directory of Open Access Journals (Sweden)

    Paul S. Wikramaratna


    Full Text Available Population epidemiological models where hosts can be infected sequentially by different strains have the potential to help us understand many important diseases. Researchers have in recent years started to develop and use such models, but the extra layer of complexity from multiple strains brings with it many technical challenges. It is therefore hard to build models which have realistic assumptions yet are tractable. Here we outline some of the main challenges in this area. First we begin with the fundamental question of how to translate from complex small-scale dynamics within a host to useful population models. Next we consider the nature of so-called “strain space”. We describe two key types of host heterogeneities, and explain how models could help generate a better understanding of their effects. Finally, for diseases with many strains, we consider the challenge of modelling how immunity accumulates over multiple exposures.

  4. (HN1) strain of Aspergillus niger

    African Journals Online (AJOL)



    Sep 26, 2016 ... olive oil) increased the production of lipase up to 20% in case of both the strains. The production of ... insoluble triacylglycerols to generate free fatty acids, mono and ... Two fermentation processes, including solid state.

  5. Mumps vaccine virus strains and aseptic meningitis. (United States)

    Bonnet, Marie-Claude; Dutta, Anil; Weinberger, Clement; Plotkin, Stanley A


    Mumps immunization can easily be included in national schedules, particularly if combined with measles or measles and rubella vaccines, but debate continues concerning the relative safety of various licensed mumps vaccine strains. The opportunities for control of mumps are also being affected by differences in the cost of the vaccines prepared with different strains of mumps virus. The present report evaluates available data on the association of the Urabe and other strains of mumps vaccine with the occurrence of aseptic meningitis. We also review the comparative immunogenicity and efficacies of the most widely used mumps vaccines in controlled clinical trials and field evaluations, and briefly examine relative cost as it relates to the implementation of national immunization programs. We conclude that extensive experience with the most widely used mumps vaccine strains in many countries has shown that the risk-benefit ratio of live mumps vaccines is highly favourable for vaccination, despite the occasional occurence of aseptic meningitis.

  6. Characterization of 3 Strains of Yersinia Pestis

    National Research Council Canada - National Science Library

    Kournikakis, B


    .... Antibiotic sensitivities showed that the 3 strains were sensitive to aminoglycosides, the cephalosporins/ cephams, most of the beta lactams/penicillins (e.g. ampicillin) and quinolones (e.g. ciprofloxacin...

  7. Flexoelectricity: strain gradient effects in ferroelectrics

    Energy Technology Data Exchange (ETDEWEB)

    Ma Wenhui [Department of Physics, Shantou Unversity, Shantou, Guangdong 515063 (China)


    Mechanical strain gradient induced polarization effect or flexoelectricity in perovskite-type ferroelectric and relaxor ferroelectric ceramics was investigated. The flexoelectric coefficients measured at room temperature ranged from about 1 {mu} C m{sup -1} for lead zirconate titanate to 100 {mu} C m{sup -1} for barium strontium titanate. Flexoelectric effects were discovered to be sensitive to chemical makeup, phase symmetry, and domain structures. Based on phenomenological discussion and experimental data on flexoelectricity, the present study proposed that mechanical strain gradient field could influence polarization responses in a way analogous to electric field. Flexoelectric coefficients were found to be nonlinearly enhanced by dielectric permittivity and strain gradient. Interfacial mismatch in epitaxial thin films can give rise to high strain gradients, enabling flexoelectric effects to make a significant impact in properly engineered ferroelectric heterostructure systems.

  8. Review of strain buckling: analysis methods

    International Nuclear Information System (INIS)

    Moulin, D.


    This report represents an attempt to review the mechanical analysis methods reported in the literature to account for the specific behaviour that we call buckling under strain. In this report, this expression covers all buckling mechanisms in which the strains imposed play a role, whether they act alone (as in simple buckling under controlled strain), or whether they act with other loadings (primary loading, such as pressure, for example). Attention is focused on the practical problems relevant to LMFBR reactors. The components concerned are distinguished by their high slenderness ratios and by rather high thermal levels, both constant and variable with time. Conventional static buckling analysis methods are not always appropriate for the consideration of buckling under strain. New methods must therefore be developed in certain cases. It is also hoped that this review will facilitate the coding of these analytical methods to aid the constructor in his design task and to identify the areas which merit further investigation

  9. Systems strategies for developing industrial microbial strains

    DEFF Research Database (Denmark)

    Lee, Sang Yup; Kim, Hyun Uk


    Industrial strain development requires system-wide engineering and optimization of cellular metabolism while considering industrially relevant fermentation and recovery processes. It can be conceptualized as several strategies, which may be implemented in an iterative fashion and in different...

  10. Characterization of 21 Strains of Bacillus Anthracis

    National Research Council Canada - National Science Library

    Kournikakis, B


    Twenty-one strains of Bacillus anthracis currently held in the culture collection at DRES were characterized by colonial morphology, antibiotic sensitivity and BiologTM metabolic identification profiles...

  11. Phenotypic variability among strains of Pasteurella multocida ...

    African Journals Online (AJOL)



    May 2, 2008 ... Available online at ISSN 1684–5315 ... extended phenotypic characterization methods supported by DNA ... septicaemia African (Obudu) strain (E:2) which are currently employed as ...

  12. Job strain and the risk of stroke

    DEFF Research Database (Denmark)

    Fransson, Eleonor I; Nyberg, Solja T; Heikkilä, Katriina


    BACKGROUND AND PURPOSE: Psychosocial stress at work has been proposed to be a risk factor for cardiovascular disease. However, its role as a risk factor for stroke is uncertain. METHODS: We conducted an individual-participant-data meta-analysis of 196 380 males and females from 14 European cohort...... studies to investigate the association between job strain, a measure of work-related stress, and incident stroke. RESULTS: In 1.8 million person-years at risk (mean follow-up 9.2 years), 2023 first-time stroke events were recorded. The age- and sex-adjusted hazard ratio for job strain relative to no job....... CONCLUSION: Job strain may be associated with an increased risk of ischemic stroke, but further research is needed to determine whether interventions targeting job strain would reduce stroke risk beyond existing preventive strategies....

  13. The radiographic observation of the cervical strain

    International Nuclear Information System (INIS)

    Rhee, Chung Sik


    A total of 100 cases of cervical disorders were analysed of clinical signs and symptoms. The cervical strain is proved by the loss of normal lordotic curvature of the cervical spinal column on the lateral x-ray film in Ewha University Hospital from January, 1970 to december 1971 with the following results. 1. The 53 cervical strain was diagnosed in radiographic study for its abnormal locations. The hyperextension with abnormal curve is twice more after than hyperflection type. 2. The most frequent location of the cervical strain is demonstrated in the 4-6 th cervical spinal bodies (80%). 3. Most pronounced symptoms of cervical strain are local tenderness (40%), limitation of motion (17%) and radiating pain (15%). 4. The ratio of the sex incidence of male female was 3:2

  14. The radiographic observation of the cervical strain

    Energy Technology Data Exchange (ETDEWEB)

    Rhee, Chung Sik [Ewha Womans University College of Medicine, Seoul (Korea, Republic of)


    A total of 100 cases of cervical disorders were analysed of clinical signs and symptoms. The cervical strain is proved by the loss of normal lordotic curvature of the cervical spinal column on the lateral x-ray film in Ewha University Hospital from January, 1970 to december 1971 with the following results. 1. The 53 cervical strain was diagnosed in radiographic study for its abnormal locations. The hyperextension with abnormal curve is twice more after than hyperflection type. 2. The most frequent location of the cervical strain is demonstrated in the 4-6 th cervical spinal bodies (80%). 3. Most pronounced symptoms of cervical strain are local tenderness (40%), limitation of motion (17%) and radiating pain (15%). 4. The ratio of the sex incidence of male female was 3:2.

  15. A strain gradient plasticity theory with application to wire torsion

    KAUST Repository

    Liu, J. X.; El Sayed, Tamer S.


    Based on the framework of the existing strain gradient plasticity theories, we have examined three kinds of relations for the plastic strain dependence of the material intrinsic length scale, and thus developed updated strain gradient plasticity

  16. MM98.57 Quantification of Combined Strain Paths

    DEFF Research Database (Denmark)

    Nielsen, Morten Sturgård; Wanheim, Tarras


    this curve into useful scalar relations from experimental data.The strain history for plane strain when assuming volume constancy may be plotted in a shear strain, normal strain diagram, which has the property of showing both the rotation of principal deformation axes during the deformation and the amount...... is to describe the total strain history as a curve in the 6-dimensional shear strain, normal strain space. In order to be able to use these experimental data for calculation, the development of this strain curve must be transformed into a set of scalar relations that may be used for predicting the yield surface...... at a given point in a new strain history. A simple example of this concept is to take the length of the strain curve as describing scalar relation: E.g. to use the equivalent strain as parameter for describing the yield stress. This paper focuses on the strain curve concept and the possibilities to convert...

  17. On generalization uniaxial stress-strain relation

    International Nuclear Information System (INIS)

    Sahay, C.; Dubey, R.N.


    Different forms of constitutive relations have been advanced for elastic, plastic and elastic-plastic behaviour of materials. It is shown that the various forms of the stress-strain relationship are specialized forms of generalization of a single stress-strain relation. For example, it is shown how the laws of elastic deformation, and the incremental and total deformation relationship for plastic behaviour are derivable from the Ramberg-Osgood relation. (orig.)

  18. Survival and activity of individual bioaugmentation strains

    DEFF Research Database (Denmark)

    Dueholm, Morten Simonsen; G. Marquesa, Irina; Karst, Søren Michael


    Successful application of bioaugmentation for enhanced degradation of environmental pollutants is often limited by the lack of methods to monitor the survival and activity of individual bioaugmentation strains. However, recent advancements in sequencing technologies and molecular techniques now...... allow us to address these limitations. Here a complementing set of general applicable molecular methods are presented that provides detailed information on the performance of individual bioaugmentation strains under in situ conditions. The approach involves genome sequencing to establish highly specific...

  19. Strain limit criteria to predict failure

    International Nuclear Information System (INIS)

    Flanders, H.E.


    In recent years extensive effort has been expended to qualify existing structures for conditions that are beyond the original design basis. Determination of the component failure load is useful for this type of evaluation. This paper presents criteria based upon strain limits to predict the load at failure. The failure modes addressed are excessive plastic deformations, localized plastic strains, and structural instability. The effects of analytical method sophistication, as built configurations, material properties degradation, and stress state are addressed by the criteria

  20. Deformation strain inhomogeneity in columnar grain nickel

    DEFF Research Database (Denmark)

    Wu, G.L.; Godfrey, A.; Juul Jensen, D.


    A method is presented for determination of the local deformation strain of individual grains in the bulk of a columnar grain sample. The method, based on measurement of the change in grain area of each grain, is applied to 12% cold rolled nickel. Large variations are observed in the local strain...... associated with each grain. (c) 2005 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved....

  1. Antimicrobial properties of indigenous Lactobacillus sakei strain


    Vesković-Moračanin Slavica; Obradović D.; Velebit B.; Borović Branka; Škrinjar Marija; Turubatović L.


    The strain I 154 of Lactobacillus sakei has been isolated from traditionally fermented sausages in the course of the realization of the international project (INCO PROJECT No ICA4-CT-2002-10037). This strain exhibited the ability for bacteriocin production. Antimicrobial properties of the isolated bacteriocin (sakacine), its sensibility towards proteolytic enzymes, as well as the effect of increased to high temperatures on its stability have been examined in this work. Semi purified bacterioc...

  2. A closer look at prion strains (United States)

    Solforosi, Laura; Milani, Michela; Mancini, Nicasio; Clementi, Massimo; Burioni, Roberto


    Prions are infectious proteins that are responsible for transmissible spongiform encephalopathies (TSEs) and consist primarily of scrapie prion protein (PrPSc), a pathogenic isoform of the host-encoded cellular prion protein (PrPC). The absence of nucleic acids as essential components of the infectious prions is the most striking feature associated to these diseases. Additionally, different prion strains have been isolated from animal diseases despite the lack of DNA or RNA molecules. Mounting evidence suggests that prion-strain-specific features segregate with different PrPSc conformational and aggregation states. Strains are of practical relevance in prion diseases as they can drastically differ in many aspects, such as incubation period, PrPSc biochemical profile (e.g., electrophoretic mobility and glycoform ratio) and distribution of brain lesions. Importantly, such different features are maintained after inoculation of a prion strain into genetically identical hosts and are relatively stable across serial passages. This review focuses on the characterization of prion strains and on the wide range of important implications that the study of prion strains involves. PMID:23357828

  3. Instrument for measuring fuel cladding strain

    International Nuclear Information System (INIS)

    Billeter, T.R.


    Development work to provide instrumentation for the continuous measurement of strain of material specimens such as nuclear fuel cladding has shown that a microwave sensor and associated instrumentation hold promise. The cylindrical sensor body enclosing the specimen results in a coaxial resonator absorbing microwave energy at frequencies dependent upon the diameter of the specimen. Diametral changes of a microinch can be resolved with use of the instrumentation. Very reasonable values of elastic strain were measured at 75 0 F and 1000 0 F for an internally pressurized 20 percent C.W. 316 stainless steel specimen simulating nuclear fuel cladding. The instrument also indicated the creep strain of the same specimen pressurized at 6500 psi and at a temperature of 1000 0 F for a period of 700 hours. Although the indicated strain appears greater than actual, the sensor/specimen unit experienced considerable oxidation even though an inert gas purge persisted throughout the test duration. By monitoring at least two modes of resonance, the measured strain was shown to be nearly independent of sensor temperature. To prevent oxidation, a second test was performed in which the specimen/sensor units were contained in an evacuated enclosure. The strain of the two prepressurized specimens as indicated by the microwave instrumentation agreed very closely with pre- and post-test measurements obtained with use of a laser interferometer

  4. Strain-controlled electrocatalysis on multimetallic nanomaterials (United States)

    Luo, Mingchuan; Guo, Shaojun


    Electrocatalysis is crucial for the development of clean and renewable energy technologies, which may reduce our reliance on fossil fuels. Multimetallic nanomaterials serve as state-of-the-art electrocatalysts as a consequence of their unique physico-chemical properties. One method of enhancing the electrocatalytic performance of multimetallic nanomaterials is to tune or control the surface strain of the nanomaterials, and tremendous progress has been made in this area in the past decade. In this Review, we summarize advances in the introduction, tuning and quantification of strain in multimetallic nanocrystals to achieve more efficient energy conversion by electrocatalysis. First, we introduce the concept of strain and its correlation with other key physico-chemical properties. Then, using the electrocatalytic reduction of oxygen as a model reaction, we discuss the underlying mechanisms behind the strain-adsorption-reactivity relationship based on combined classical theories and models. We describe how this knowledge can be harnessed to design multimetallic nanocrystals with optimized strain to increase the efficiency of oxygen reduction. In particular, we highlight the unexpectedly beneficial (and previously overlooked) role of tensile strain from multimetallic nanocrystals in improving electrocatalysis. We conclude by outlining the challenges and offering our perspectives on the research directions in this burgeoning field.

  5. Strain rate measurement by Electronic Speckle Pattern Interferometry: A new look at the strain localization onset

    International Nuclear Information System (INIS)

    Guelorget, Bruno; Francois, Manuel; Vial-Edwards, Cristian; Montay, Guillaume; Daniel, Laurent; Lu, Jian


    In-plane Electronic Speckle Pattern Interferometry has been successfully used during tensile testing of semi-hard copper sheets in order to measure the strain rate. On one hand, heterogeneity in strain rate field has been found before the maximum of the tensile force (ε t ≅ 19.4 and 25.4%, respectively). Thus, a localization phenomenon occurs before the classic Considere's criterion (dF = 0) for the diffuse neck initiation. On the other hand, strain rate measurement before fracture shows the moment where one of the two slip band systems becomes predominant, then strain concentrates in a small area, the shear band. Uncertainty evaluation has been carried out, which shows a very good accuracy of the total strain and the strain rate measurements

  6. Strain rate measurement by Electronic Speckle Pattern Interferometry: A new look at the strain localization onset

    Energy Technology Data Exchange (ETDEWEB)

    Guelorget, Bruno [Universite de Technologie de Troyes (UTT), Laboratoire des Systemes Mecaniques et d' ingenierie Simultanee (LASMIS, CNRS FRE 2719), 12 rue Marie Curie, B.P. 2060, 10010 Troyes Cedex (France)]. E-mail:; Francois, Manuel [Universite de Technologie de Troyes (UTT), Laboratoire des Systemes Mecaniques et d' ingenierie Simultanee (LASMIS, CNRS FRE 2719), 12 rue Marie Curie, B.P. 2060, 10010 Troyes Cedex (France); Vial-Edwards, Cristian [Departemento de Ingenieria Mecanica y Metalurgica, Pontificia Universidad Catolica de Chile, Vicuna Mackenna 4860, 6904411 Santiago (Chile); Montay, Guillaume [Universite de Technologie de Troyes (UTT), Laboratoire des Systemes Mecaniques et d' ingenierie Simultanee (LASMIS, CNRS FRE 2719), 12 rue Marie Curie, B.P. 2060, 10010 Troyes Cedex (France); Daniel, Laurent [Universite de Technologie de Troyes (UTT), Laboratoire des Systemes Mecaniques et d' ingenierie Simultanee (LASMIS, CNRS FRE 2719), 12 rue Marie Curie, B.P. 2060, 10010 Troyes Cedex (France); Lu, Jian [Universite de Technologie de Troyes (UTT), Laboratoire des Systemes Mecaniques et d' ingenierie Simultanee (LASMIS, CNRS FRE 2719), 12 rue Marie Curie, B.P. 2060, 10010 Troyes Cedex (France)


    In-plane Electronic Speckle Pattern Interferometry has been successfully used during tensile testing of semi-hard copper sheets in order to measure the strain rate. On one hand, heterogeneity in strain rate field has been found before the maximum of the tensile force ({epsilon} {sup t} {approx_equal} 19.4 and 25.4%, respectively). Thus, a localization phenomenon occurs before the classic Considere's criterion (dF = 0) for the diffuse neck initiation. On the other hand, strain rate measurement before fracture shows the moment where one of the two slip band systems becomes predominant, then strain concentrates in a small area, the shear band. Uncertainty evaluation has been carried out, which shows a very good accuracy of the total strain and the strain rate measurements.

  7. Molecular typing of Brucella melitensis endemic strains and differentiation from the vaccine strain Rev-1. (United States)

    Noutsios, Georgios T; Papi, Rigini M; Ekateriniadou, Loukia V; Minas, Anastasios; Kyriakidis, Dimitrios A


    In the present study forty-four Greek endemic strains of Br. melitensis and three reference strains were genotyped by Multi locus Variable Number Tandem Repeat (ML-VNTR) analysis based on an eight-base pair tandem repeat sequence that was revealed in eight loci of Br. melitensis genome. The forty-four strains were discriminated from the vaccine strain Rev-1 by Restriction Fragment Length Polymorphism (RFLP) and Denaturant Gradient Gel Electrophoresis (DGGE). The ML-VNTR analysis revealed that endemic, reference and vaccine strains are genetically closely related, while most of the loci tested (1, 2, 4, 5 and 7) are highly polymorphic with Hunter-Gaston Genetic Diversity Index (HGDI) values in the range of 0.939 to 0.775. Analysis of ML-VNTRs loci stability through in vitro passages proved that loci 1 and 5 are non stable. Therefore, vaccine strain can be discriminated from endemic strains by allele's clusters of loci 2, 4, 6 and 7. RFLP and DGGE were also employed to analyse omp2 gene and reveled different patterns among Rev-1 and endemic strains. In RFLP, Rev-1 revealed three fragments (282, 238 and 44 bp), while endemic strains two fragments (238 and 44 bp). As for DGGE, the electrophoretic mobility of Rev-1 is different from the endemic strains due to heterologous binding of DNA chains of omp2a and omp2b gene. Overall, our data show clearly that it is feasible to genotype endemic strains of Br. melitensis and differentiate them from vaccine strain Rev-1 with ML-VNTR, RFLP and DGGE techniques. These tools can be used for conventional investigations in brucellosis outbreaks.

  8. Strain-dependent diffusion behavior of H within tungsten

    International Nuclear Information System (INIS)

    Ding, Wenyi; He, Haiyan; Liu, Changsong; Ding, Rui; Chen, Junling; Pan, Bicai


    The diffusion behaviors of H in tungsten, a promising material serving as the first wall facing the plasma in nuclear reactors, under either biaxial strain or isotropic strain are theoretically studied. We find that under the isotropic strain, an individual H atom may diffuse along all pathways, and under the biaxial strain, it preferably migrates along the direction perpendicular to the loaded strain. Moreover, in the case of either the isotropic or the biaxial strain, the loaded compressive strain weakens the diffusion of H, while the loaded tensile strain enhances the diffusion of H in bulk W.

  9. Strain-dependent diffusion behavior of H within tungsten

    Energy Technology Data Exchange (ETDEWEB)

    Ding, Wenyi; He, Haiyan [Department of Physics, University of Science and Technology of China, Hefei, Anhui 230026 (China); Liu, Changsong [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, P.O. Box 1129, Hefei 230031 (China); Ding, Rui; Chen, Junling [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); Pan, Bicai, E-mail: [Department of Physics, University of Science and Technology of China, Hefei, Anhui 230026 (China); Hefei National Laboratory for Physical Science at Microscale, University of Science and Technology of China, Hefei, Anhui 230026 (China)


    The diffusion behaviors of H in tungsten, a promising material serving as the first wall facing the plasma in nuclear reactors, under either biaxial strain or isotropic strain are theoretically studied. We find that under the isotropic strain, an individual H atom may diffuse along all pathways, and under the biaxial strain, it preferably migrates along the direction perpendicular to the loaded strain. Moreover, in the case of either the isotropic or the biaxial strain, the loaded compressive strain weakens the diffusion of H, while the loaded tensile strain enhances the diffusion of H in bulk W.

  10. Information about the Current Strain of Clostridium difficile (United States)

    ... fluoroquinolones may provide the new strain with an advantage over susceptible strains to spread within healthcare facilities where these antibiotics are commonly used. Top of page What should ...

  11. Effects of strain on the Schwinger pair creation in graphene

    International Nuclear Information System (INIS)

    Fanbanrai, P.; Hutem, A.; Boonchui, S.


    The effects of strain on mechanically deformed graphene are determined by looking at how the strain affects the amplitude of the Schwinger two particle pair state. The influences of the lattice distortions, such as isotropic tensile strain ϵ is , shear strain ϵ ss , uniaxial armchair strain ϵ as , and zigzag strain ϵ zs , on the photon emission spectrum have been analyzed. We find that the intensities of the emission increases or decreases when compared to those of the unstrained graphene, depending on the type of strain applied. Thus the structure of energy band, the frequencies of the photons and the emission spectrum can be controlled by use of the different strains

  12. Intramyocardial strain estimation from cardiac cine MRI. (United States)

    Elnakib, Ahmed; Beache, Garth M; Gimel'farb, Georgy; El-Baz, Ayman


    Functional strain is one of the important clinical indicators for the quantification of heart performance and the early detection of cardiovascular diseases, and functional strain parameters are used to aid therapeutic decisions and follow-up evaluations after cardiac surgery. A comprehensive framework for deriving functional strain parameters at the endocardium, epicardium, and mid-wall of the left ventricle (LV) from conventional cine MRI data was developed and tested. Cine data were collected using short TR-/TE-balanced steady-state free precession acquisitions on a 1.5T Siemens Espree scanner. The LV wall borders are segmented using a level set-based deformable model guided by a stochastic force derived from a second-order Markov-Gibbs random field model that accounts for the object shape and appearance features. Then, the mid-wall of the segmented LV is determined based on estimating the centerline between the endocardium and epicardium of the LV. Finally, a geometrical Laplace-based method is proposed to track corresponding points on successive myocardial contours throughout the cardiac cycle in order to characterize the strain evolutions. The method was tested using simulated phantom images with predefined point locations of the LV wall throughout the cardiac cycle. The method was tested on 30 in vivo datasets to evaluate the feasibility of the proposed framework to index functional strain parameters. The cine MRI-based model agreed with the ground truth for functional metrics to within 0.30 % for indexing the peak systolic strain change and 0.29 % (per unit time) for indexing systolic and diastolic strain rates. The method was feasible for in vivo extraction of functional strain parameters. Strain indexes of the endocardium, mid-wall, and epicardium can be derived from routine cine images using automated techniques, thereby improving the utility of cine MRI data for characterization of myocardial function. Unlike traditional texture-based tracking, the

  13. Effects of the Strain Rate Sensitivity and Strain Hardening on the Saturated Impulse of Plates

    Directory of Open Access Journals (Sweden)

    Ling Zhu

    Full Text Available Abstract This paper studies the stiffening effects of the material strain rate sensitivity and strain hardening on the saturated impulse of elastic, perfectly plastic plates. Finite element (FE code ABAQUS is employed to simulate the elastoplastic response of square plates under rectangular pressure pulse. Rigid-plastic analyses for saturated impulse, which consider strain rate sensitivity and strain hardening, are conducted. Satisfactory agreement between the finite element models (FEM and predictions of the rigid-plastic analysis is obtained, which verifies that the proposed rigid-plastic methods are effective to solve the problem including strain rate sensitivity and strain hardening. The quantitative results for the scale effect of the strain rate sensitivity are given. The results for the stiffening effects suggest that two general stiffening factors n 1 and n 2, which characterizes the strain rate sensitivity and strain hardening effect, respectively can be defined. The saturated displacement is inversely proportional to the stiffening factors (i.e. n 1 and n 2 and saturated impulse is inversely proportional to the square roots of the stiffening factors (i.e. n 1 and n 2. Formulae for displacement and saturated impulse are proposed based on the empirical analysis.

  14. Genome-Wide Transcription Study of Cryptococcus neoformans H99 Clinical Strain versus Environmental Strains.

    Directory of Open Access Journals (Sweden)

    Elaheh Movahed

    Full Text Available The infection of Cryptococcus neoformans is acquired through the inhalation of desiccated yeast cells and basidiospores originated from the environment, particularly from bird's droppings and decaying wood. Three environmental strains of C. neoformans originated from bird droppings (H4, S48B and S68B and C. neoformans reference clinical strain (H99 were used for intranasal infection in C57BL/6 mice. We showed that the H99 strain demonstrated higher virulence compared to H4, S48B and S68B strains. To examine if gene expression contributed to the different degree of virulence among these strains, a genome-wide microarray study was performed to inspect the transcriptomic profiles of all four strains. Our results revealed that out of 7,419 genes (22,257 probes examined, 65 genes were significantly up-or down-regulated in H99 versus H4, S48B and S68B strains. The up-regulated genes in H99 strain include Hydroxymethylglutaryl-CoA synthase (MVA1, Mitochondrial matrix factor 1 (MMF1, Bud-site-selection protein 8 (BUD8, High affinity glucose transporter 3 (SNF3 and Rho GTPase-activating protein 2 (RGA2. Pathway annotation using DAVID bioinformatics resource showed that metal ion binding and sugar transmembrane transporter activity pathways were highly expressed in the H99 strain. We suggest that the genes and pathways identified may possibly play crucial roles in the fungal pathogenesis.

  15. Variation in the strain anisotropy of Zircaloy with temperature and strain

    International Nuclear Information System (INIS)

    Hindle, E.D.; Worswick, D.


    Strain anisotropy was investigated at temperatures in the range 293 to 1117K in circular tensile specimens prepared from rolled Zircaloy-2 plate so that their tensile axes were parallel to and transverse to the rolling direction. The strain anisotropy factor for both types of specimen increased markedly in the high alpha phase region above 923K reaching a maximum at circa 1070K. Above this temperature in the alpha-plus-beta phase region the strain anisotropy decreased rapidly as the proportion of beta phase increased and was almost non-existent at 1173K. The strain anisotropy was markedly strain dependent, particularly in the high alpha phase region. The study was extended to Zircaloy-4 pressurized water reactor (PWR) 17 x 17 type fuel rod tubing specimens which were strained under biaxial conditions using cooling conditions which promoted uniform diametral strain over most of their lengths (circa 250 mm). In these circumstances the strain anisotropy is manifest by a reduction in length. Measurement of this change along with that in diameter and wall thickness produced data from which the strain anisotropy factor was calculated. The results, although influenced by additional factors discussed in the paper, were similar to those observed in the uniaxial Zircaloy-2 tensile tests. (author)

  16. An ultrasensitive strain sensor with a wide strain range based on graphene armour scales. (United States)

    Yang, Yi-Fan; Tao, Lu-Qi; Pang, Yu; Tian, He; Ju, Zhen-Yi; Wu, Xiao-Ming; Yang, Yi; Ren, Tian-Ling


    An ultrasensitive strain sensor with a wide strain range based on graphene armour scales is demonstrated in this paper. The sensor shows an ultra-high gauge factor (GF, up to 1054) and a wide strain range (ε = 26%), both of which present an advantage compared to most other flexible sensors. Moreover, the sensor is developed by a simple fabrication process. Due to the excellent performance, this strain sensor can meet the demands of subtle, large and complex human motion monitoring, which indicates its tremendous application potential in health monitoring, mechanical control, real-time motion monitoring and so on.

  17. Dynamic strains for earthquake source characterization (United States)

    Barbour, Andrew J.; Crowell, Brendan W


    Strainmeters measure elastodynamic deformation associated with earthquakes over a broad frequency band, with detection characteristics that complement traditional instrumentation, but they are commonly used to study slow transient deformation along active faults and at subduction zones, for example. Here, we analyze dynamic strains at Plate Boundary Observatory (PBO) borehole strainmeters (BSM) associated with 146 local and regional earthquakes from 2004–2014, with magnitudes from M 4.5 to 7.2. We find that peak values in seismic strain can be predicted from a general regression against distance and magnitude, with improvements in accuracy gained by accounting for biases associated with site–station effects and source–path effects, the latter exhibiting the strongest influence on the regression coefficients. To account for the influence of these biases in a general way, we include crustal‐type classifications from the CRUST1.0 global velocity model, which demonstrates that high‐frequency strain data from the PBO BSM network carry information on crustal structure and fault mechanics: earthquakes nucleating offshore on the Blanco fracture zone, for example, generate consistently lower dynamic strains than earthquakes around the Sierra Nevada microplate and in the Salton trough. Finally, we test our dynamic strain prediction equations on the 2011 M 9 Tohoku‐Oki earthquake, specifically continuous strain records derived from triangulation of 137 high‐rate Global Navigation Satellite System Earth Observation Network stations in Japan. Moment magnitudes inferred from these data and the strain model are in agreement when Global Positioning System subnetworks are unaffected by spatial aliasing.

  18. Strain preservation of experimental animals: vitrification of two-cell stage embryos for multiple mouse strains. (United States)

    Eto, Tomoo; Takahashi, Riichi; Kamisako, Tsutomu


    Strain preservation of experimental animals is crucial for experimental reproducibility. Maintaining complete animal strains, however, is costly and there is a risk for genetic mutations as well as complete loss due to disasters or illness. Therefore, the development of effective vitrification techniques for cryopreservation of multiple experimental animal strains is important. We examined whether a vitrification method using cryoprotectant solutions, P10 and PEPeS, is suitable for preservation of multiple inbred and outbred mouse strains. First, we investigated whether our vitrification method using cryoprotectant solutions was suitable for two-cell stage mouse embryos. In vitro development of embryos exposed to the cryoprotectant solutions was similar to that of fresh controls. Further, the survival rate of the vitrified embryos was extremely high (98.1%). Next, we collected and vitrified two-cell stage embryos of 14 mouse strains. The average number of embryos obtained from one female was 7.3-33.3. The survival rate of vitrified embryos ranged from 92.8% to 99.1%, with no significant differences among mouse strains. In vivo development did not differ significantly between fresh controls and vitrified embryos of each strain. For strain preservation using cryopreserved embryos, two offspring for inbred lines and one offspring for outbred lines must be produced from two-cell stage embryos collected from one female. The expected number of surviving fetuses obtained from embryos collected from one female of either the inbred or outbred strains ranged from 2.9 to 19.5. The findings of the present study indicated that this vitrification method is suitable for strain preservation of multiple mouse strains. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

  19. Mycobacterium tuberculosis strains exhibit differential and strain-specific molecular signatures in pulmonary epithelial cells. (United States)

    Mvubu, Nontobeko Eunice; Pillay, Balakrishna; Gamieldien, Junaid; Bishai, William; Pillay, Manormoney


    Although pulmonary epithelial cells are integral to innate and adaptive immune responses during Mycobacterium tuberculosis infection, global transcriptomic changes in these cells remain largely unknown. Changes in gene expression induced in pulmonary epithelial cells infected with M. tuberculosis F15/LAM4/KZN, F11, F28, Beijing and Unique genotypes were investigated by RNA sequencing (RNA-Seq). The Illumina HiSeq 2000 platform generated 50 bp reads that were mapped to the human genome (Hg19) using Tophat (2.0.10). Differential gene expression induced by the different strains in infected relative to the uninfected cells was quantified and compared using Cufflinks (2.1.0) and MeV (4.0.9), respectively. Gene expression varied among the strains with the total number of genes as follows: F15/LAM4/KZN (1187), Beijing (1252), F11 (1639), F28 (870), Unique (886) and H37Rv (1179). A subset of 292 genes was commonly induced by all strains, where 52 genes were down-regulated while 240 genes were up-regulated. Differentially expressed genes were compared among the strains and the number of induced strain-specific gene signatures were as follows: F15/LAM4/KZN (138), Beijing (52), F11 (255), F28 (55), Unique (186) and H37Rv (125). Strain-specific molecular gene signatures associated with functional pathways were observed only for the Unique and H37Rv strains while certain biological functions may be associated with other strain signatures. This study demonstrated that strains of M. tuberculosis induce differential gene expression and strain-specific molecular signatures in pulmonary epithelial cells. Specific signatures induced by clinical strains of M. tuberculosis can be further explored for novel host-associated biomarkers and adjunctive immunotherapies. Copyright © 2016 Elsevier Ltd. All rights reserved.

  20. Anisotropic nature of radially strained metal tubes (United States)

    Strickland, Julie N.

    Metal pipes are sometimes swaged by a metal cone to enlarge them, which increases the strain in the material. The amount of strain is important because it affects the burst and collapse strength. Burst strength is the amount of internal pressure that a pipe can withstand before failure, while collapse strength is the amount of external pressure that a pipe can withstand before failure. If the burst or collapse strengths are exceeded, the pipe may fracture, causing critical failure. Such an event could cost the owners and their customers millions of dollars in clean up, repair, and lost time, in addition to the potential environmental damage. Therefore, a reliable way of estimating the burst and collapse strength of strained pipe is desired and valuable. The sponsor currently rates strained pipes using the properties of raw steel, because those properties are easily measured (for example, yield strength). In the past, the engineers assumed that the metal would be work-hardened when swaged, so that yield strength would increase. However, swaging introduces anisotropic strain, which may decrease the yield strength. This study measured the yield strength of strained material in the transverse and axial direction and compared them to raw material, to determine the amount of anisotropy. This information will be used to more accurately determine burst and collapse ratings for strained pipes. More accurate ratings mean safer products, which will minimize risk for the sponsor's customers. Since the strained metal has a higher yield strength than the raw material, using the raw yield strength to calculate burst and collapse ratings is a conservative method. The metal has even higher yield strength after strain aging, which indicates that the stresses are relieved. Even with the 12% anisotropy in the strained and 9% anisotropy in the strain aged specimens, the raw yield strengths are lower and therefore more conservative. I recommend that the sponsor continue using the raw

  1. [A prophylactic program for strain urinary incontinence]. (United States)

    Stadnicka, Grazyna; Iwanowicz-Palus, Grazyna J; Bień, Agnieszka M


    The aim of the study was to work out a prophylactic program for strain urinary incontinence. Analysis of literature on the subject and results of own investigations presented in the first part of the paper indicate that the program of prophylaxis of strain urinary incontinence should primarily include: (1) Preparation of the medical staff (nurses, midwives) for propagating health education among women on prevention of strain urinary incontinence. (2) Preparation of adequate educational materials in the form of brochures, leaflets, information posters about symptoms, causes and prophylaxis of urinary incontinence indicating health care institutions available to all women when the disease is suspected or already present. (3) Propagation of problems connected with strain urinary incontinence in the mass media providing information to a wide audience in order to make people realize the significance of this social problem and break stereotypes associated with this disease of "shame". (4) Preparation of sets of exercises for the muscles of the base of the pelvis to be performed during pregnancy, confinement and menopause to maintain their proper function. (5) Indicating factors predisposing to strain urinary incontinence with focus on possibilities of their reduction or elimination.

  2. Probiotic features of Lactobacillus plantarum mutant strains. (United States)

    Bove, Pasquale; Gallone, Anna; Russo, Pasquale; Capozzi, Vittorio; Albenzio, Marzia; Spano, Giuseppe; Fiocco, Daniela


    In this study, the probiotic potential of Lactobacillus plantarum wild-type and derivative mutant strains was investigated. Bacterial survival was evaluated in an in vitro system, simulating the transit along the human oro-gastro-intestinal tract. Interaction with human gut epithelial cells was studied by assessing bacterial adhesive ability to Caco-2 cells and induction of genes involved in innate immunity. L. plantarum strains were resistant to the combined stress at the various steps of the simulated gastrointestinal tract. Major decreases in the viability of L. plantarum cells were observed mainly under drastic acidic conditions (pH ≤ 2.0) of the gastric compartment. Abiotic stresses associated to small intestine poorly affected bacterial viability. All the bacterial strains significantly adhered to Caco-2 cells, with the ΔctsR mutant strain exhibiting the highest adhesion. Induction of immune-related genes resulted higher upon incubation with heat-inactivated bacteria rather than with live ones. For specific genes, a differential transcriptional pattern was observed upon stimulation with different L. plantarum strains, evidencing a possible role of the knocked out bacterial genes in the modulation of host cell response. In particular, cells from Δhsp18.55 and ΔftsH mutants strongly triggered immune defence genes. Our study highlights the relevance of microbial genetic background in host-probiotic interaction and might contribute to identify candidate bacterial genes and molecules involved in probiosis.

  3. Brittle superconducting magnets: an equivilent strain model

    International Nuclear Information System (INIS)

    Barzi, E.; Danuso, M.


    To exceed fields of 10 T in accelerator magnets, brittle superconductors like A15 Nb 3 Sn and Nb 3 Al or ceramic High Temperature Superconductors have to be used. For such brittle superconductors it is not their maximum tensile yield stress that limits their structural resistance as much as strain values that provoke deformations in their delicate lattice, which in turn affect their superconducting properties. Work on the sensitivity of Nb 3 Sn cables to strain has been conducted in a number of stress states, including uniaxial and multi-axial, producing usually different results. This has made the need of a constituent design criterion imperative for magnet builders. In conventional structural problems an equivalent stress model is typically used to verify mechanical soundness. In the superconducting community a simple scalar equivalent strain to be used in place of an equivalent stress would be an extremely useful tool. As is well known in fundamental mechanics, there is not one single way to reduce a multiaxial strain state as represented by a 2nd order tensor to a scalar. The conceptual experiment proposed here will help determine the best scalar representation to use in the identification of an equivalent strain model.

  4. Novel distributed strain sensing in polymeric materials

    International Nuclear Information System (INIS)

    Abot, Jandro L; Song, Yi; Medikonda, Sandeep; Rooy, Nathan; Schulz, Mark J


    Monitoring the state of strain throughout an entire structure is essential to determine its state of stress, detect potential residual stresses after fabrication, and also to help to establish its integrity. Several sensing technologies are presently available to determine the strain in the surface or inside a structure. Large sensor dimensions, complex signal conditioning equipment, and difficulty in achieving a widely distributed system have however hindered their development into robust structural health monitoring techniques. Recently, carbon nanotube forests were spun into a microscale thread that is electrically conductive, tough, and easily tailorable. The thread was integrated into polymeric materials and used for the first time as a piezoresistive sensor to monitor strain and also to detect damage in the material. It is revealed that the created self-sensing polymeric materials are sensitive to normal strains above 0.07% and that the sensor thread exhibits a perfectly linear delta resistance–strain response above 0.3%. The longitudinal gauge factors were determined to be in the 2–5 range. This low cost and simple built-in sensor thread may provide a new integrated and distributed sensor technology that enables robust real-time health monitoring of structures

  5. Crack initiation under generalized plane strain conditions

    International Nuclear Information System (INIS)

    Shum, D.K.M.; Merkle, J.G.


    A method for estimating the decrease in crack-initiation toughness, from a reference plane strain value, due to positive straining along the crack front of a circumferential flaw in a reactor pressure vessel is presented in this study. This method relates crack initiation under generalized plane strain conditions with material failure at points within a distance of a few crack-tip-opening displacements ahead of a crack front, and involves the formulation of a micromechanical crack-initiation model. While this study is intended to address concerns regarding the effects of positive out-of- plane straining on ductile crack initiation, the approach adopted in this work can be extended in a straightforward fashion to examine conditions of macroscopic cleavage crack initiation. Provided single- parameter dominance of near-tip fields exists in the flawed structure, results from this study could be used to examine the appropriateness of applying plane strain fracture toughness to the evaluation of circumferential flaws, in particular to those in ring-forged vessels which have no longitudinal welds. In addition, results from this study could also be applied toward the analysis of the effects of thermal streaming on the fracture resistance of circumferentially oriented flaws in a pressure vessel. 37 refs., 8 figs., 1 tab

  6. Methodology to measure strains at high temperatures using electrical strain gages with free filaments

    International Nuclear Information System (INIS)

    Atanazio Filho, Nelson N.; Gomes, Paulo T. Vida; Scaldaferri, Denis H.B.; Silva, Luiz L. da; Rabello, Emerson G.; Mansur, Tanius R.


    An experimental methodology used for strains measuring at high temperatures is show in this work. In order to do the measurements, it was used electric strain gages with loose filaments attached to a stainless steel 304 beam with specific cements. The beam has triangular shape and a constant thickness, so the strain is the same along its length. Unless the beam surface be carefully prepared, the strain gage attachment is not efficient. The showed results are for temperatures ranging from 20 deg C to 300 deg C, but the experimental methodology could be used to measure strains at a temperature up to 900 deg C. Analytical calculations based on solid mechanics were used to verify the strain gage electrical installation and the measured strains. At a first moment, beam deformations as a temperature function were plotted. After that, beam deformations with different weighs were plotted as a temperature function. The results shown allowed concluding that the experimental methodology is trustable to measure strains at temperatures up to 300 deg C. (author)

  7. Thermal strain measurement of EAST W/Cu divertor structure using electric resistance strain gauges

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Xingli [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Science Island Branch of Graduate School, University of Science & Technology of China, Hefei, 230031 (China); Wang, Wanjing, E-mail: [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Wang, Jichao [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Wei, Ran; Sun, Zhaoxuan [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Science Island Branch of Graduate School, University of Science & Technology of China, Hefei, 230031 (China); Li, Qiang; Xie, Chunyi [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Chen, Hong-En; Wang, Kaiqiang; Wu, Lei; Chen, Zhenmao [State Key Lab for Strength and Vibration of Mechanical Structures, Xi’an Jiaotong University (China); Luo, Guang-Nan [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Science Island Branch of Graduate School, University of Science & Technology of China, Hefei, 230031 (China); Hefei Center for Physical Science and Technology, Hefei, 230022 (China); Hefei Science Center of Chinese Academy of Sciences, Hefei, 230027 (China)


    Highlights: • To understand the service behavior of W/Cu divertor, an electrical resistance strain gauge system had been introduced in a thermal strain measurement experiment. • The measurement system successfully finished the experiment and obtained valued thermal strain data. • Two thermomechanical analyses had also been carried out and compared with the measurement results. • Experiment results corresponded well to simulations and threw a light upon the failure of W/Cu divertor in the previous baking tests. - Abstract: W/Cu divertor has complex structure and faces extreme work environment in EAST Tokamak device. To measure its thermal strain shall be a valued way to understand its service behavior and then optimize its design and manufacturing process. This work presents a preliminary study on measuring thermal strain of EAST W/Cu divertor structure using electric resistance strain gauges. Eight gauges had been used in the experiment and the heating temperature had been set to 230 °C with respect to the work temperature. To realize the measuring experiment, an appropriate fixing method of gauges in divertor narrow spaces had been taken and tested, which could not only withstand high temperature but also had no damage to the divertor sample. The measurement results were that three gauges showed positive strain while other three showed negative strain after having been compensated, which corresponded to tensile stress and compressed stress respectively. Two thermomechanical simulations had also been carried out and used for comparing with the experiment.

  8. Strain histograms are equal to strain ratios in predicting malignancy in breast tumours

    DEFF Research Database (Denmark)

    Carlsen, Jonathan Frederik; Ewertsen, Caroline; Sletting, Susanne


    Objectives: To assess whether strain histograms are equal to strain ratios in predicting breast tumour malignancy and to see if either could be used to upgrade Breast Imaging Reporting and Data System (BI-RADS) 3 tumours for immediate biopsy. Methods: Ninety-nine breast tumours were examined using...

  9. Validation of perceptual strain index to evaluate the thermal strain in experimental hot conditions

    Directory of Open Access Journals (Sweden)

    Habibollah Dehghan


    Conclusions: The research findings showed when there is no access to other forms of methods to evaluate the heat stress, it can be used the PeSI in evaluating the strain because of its favorable correlation with the thermal strain.

  10. Mechanical properties of biaxially strained poly(L-lactide) tubes: Strain rate and temperature dependence

    DEFF Research Database (Denmark)

    Løvdal, Alexandra Liv Vest; Andreasen, Jens Wenzel; Mikkelsen, Lars Pilgaard


    Poly(l-lactide) (PLLA) is a bioabsorbable polymer with high stiffness and strength compared to the other commercially available bioabsorbable polymers. The properties of PLLA can be improved by straining, causing deformation-mediated molecular orientation. PLLA tubes were biaxially strained above...

  11. Residual strains in girth-welded linepipe

    International Nuclear Information System (INIS)

    MacEwen, S.R.; Holden, T.M.; Powell, B.M.; Lazor, R.B.


    High resolution neutron diffraction has been used to measure the axial residual strains in and adjacent to a multipass girth weld in a complete section of 914 mm (36 inches) diameter, 16 mm (5/8 inch) wall, linepipe. The experiments were carried out at the NRU reactor, Chalk River using the L3 triple-axis spectrometer. The through-wall distribution of axial residual strain was measured at 0, 4, 8, 20 and 50 mm from the weld centerline; the axial variation was determined 1, 5, 8, and 13 mm from the inside surface of the pipe wall. The results have been compared with strain gauge measurements on the weld surface and with through-wall residual stress distributions determined using the block-layering and removal technique

  12. High Strain Rate Characterisation of Composite Materials

    DEFF Research Database (Denmark)

    Eriksen, Rasmus Normann Wilken

    -reinforced polymers, were considered, and it was first shown that the loading history controls equilibrium process. Then the High-speed servo-hydraulic test machine was analysed in terms its ability to create a state of constant strain rate in the specimen. The invertible inertial forces in the load train prevented...... from designing and constructing a high-speed servo-hydraulic test machine and by performing a comprehensive test series. The difficulties encountered in the test work could be addressed with the developed analysis. The conclusion was that the High-speed servo-hydraulic test machine is less suited...... for testing fibre-reinforced polymers due to their elastic behaviour and low strain to failure. This is problematic as the High-speed servo-hydraulic test machine closes the gap between quasi-static tests rates and lower strain rates, which are achievable with the Split Hopkinson Pressure Bar. The Split...

  13. Developments of borehole strain observation outside China

    Institute of Scientific and Technical Information of China (English)

    邱泽华; 石耀霖


    Borehole strain observation is playing an increasingly important role in the study on the crustal movements. It hasbeen used by many countries such as China, USA, Japan, Peru, Australia, South Africa, Iceland and Italy, in research fields of plate tectonics, earthquake, volcanic eruption, dam safety, oil field subsidence, mining collapse andso on. Borehole strainmeter has been improved rapidly and tends to get more and more components included inone probe. Based on observations by this kind of instruments, studies on seismic strain step, slow earthquake,earthquake precursor and volcanic eruption forecasting have made remarkable achievements. In the coming years,borehole strain observation is going to become one major geodetic means, together with GPS and InSAR.

  14. The asymptomatic bacteriuria Escherichia coli strain 83972 outcompetes uropathogenic E. coli strains in human urine

    DEFF Research Database (Denmark)

    Hancock, Viktoria; Ulett, G.C.; Schembri, M.A.


    Escherichia coli is the most common organism associated with asymptomatic bacteriuria (ABU). In contrast to uropathogenic E. coli (UPEC), which causes symptomatic urinary tract infections (UTI), very little is known about the mechanisms by which these strains colonize the human urinary tract....... The prototype ABU E. coli strain 83972 was originally isolated from a girl who had carried it asymptomatically for 3 years. Deliberate colonization of UTI-susceptible individuals with E. coli 83972 has been used successfully as an alternative approach for the treatment of patients who are refractory...... to conventional therapy. Colonization with strain 83972 appears to prevent infection with UPEC strains in such patients despite the fact that this strain is unable to express the primary adhesins involved in UTI, viz. P and type 1 fimbriae. Here we investigated the growth characteristics of E. coli 83972 in human...

  15. Evaluating location specific strain rates, temperatures, and accumulated strains in friction welds through microstructure modeling

    Directory of Open Access Journals (Sweden)

    Javed Akram


    Full Text Available A microstructural simulation method is adopted to predict the location specific strain rates, temperatures, grain evolution, and accumulated strains in the Inconel 718 friction welds. Cellular automata based 2D microstructure model was developed for Inconel 718 alloy using theoretical aspects of dynamic recrystallization. Flow curves were simulated and compared with experimental results using hot deformation parameter obtained from literature work. Using validated model, simulations were performed for friction welds of Inconel 718 alloy generated at three rotational speed i.e., 1200, 1500, and 1500 RPM. Results showed the increase in strain rates with increasing rotational speed. These simulated strain rates were found to match with the analytical results. Temperature difference of 150 K was noticed from center to edge of the weld. At all the rotational speeds, the temperature was identical implying steady state temperature (0.89Tm attainment. Keywords: Microstructure modeling, Dynamic recrystallization, Friction welding, Inconel 718, EBSD, Hot deformation, Strain map

  16. A new strain gage method for measuring the contractile strain ratio of Zircaloy tubing

    International Nuclear Information System (INIS)

    Hwang, S.K.; Sabol, G.P.


    An improved strain gage method for determining the contractile strain ratio (CSR) of Zircaloy tubing was developed. The new method consists of a number of load-unload cyclings at approximately 0.2% plastic strain interval. With this method the CSR of Zircaloy-4 tubing could be determined accurately because it was possible to separate the plastic strains from the elastic strain involvement. The CSR values determined by use of the new method were in good agreement with those calculated from conventional post-test manual measurements. The CSR of the tubing was found to decrease with the amount of deformation during testing because of uneven plastic flow in the gage section. A new technique of inscribing gage marks by use of a YAG laser is discussed. (orig.)

  17. Segregation of genes from donor strain during the production of recombinant congenic strains. (United States)

    van Zutphen, L F; Den Bieman, M; Lankhorst, A; Demant, P


    Recombinant congenic strains (RCS) constitute a set of inbred strains which are designed to dissect the genetic control of multigenic traits, such as tumour susceptibility or disease resistance. Each RCS contains a small fraction of the genome of a common donor strain, while the majority of genes stem from a common background strain. We tested at two stages of the inbreeding process in 20 RCS, derived from BALB/cHeA and STS/A, to see whether alleles from the STS/A donor strain are distributed over the RCS in a ratio as would theoretically be expected. Four marker genes (Pep-3; Pgm-1; Gpi-1 and Es-3) located at 4 different chromosomes were selected and the allelic distribution was tested after 3-4 and after 12 generations of inbreeding. The data obtained do not significantly deviate from the expected pattern, thus supporting the validity of the concept of RCS.

  18. Pheromonal divergence between two strains of Spodoptera frugiperda

    NARCIS (Netherlands)

    Unbehend, M.; Hänniger, S.; Meagher, R.L.; Heckel, D.G.; Groot, A.T.


    Spodoptera frugiperda consists of two genetically and behaviorally different strains, the corn- and the rice-strain, which seem to be in the process of sympatric speciation. We investigated the role of strain-specific sexual communication as a prezygotic mating barrier between both strains by

  19. Comparative developmental trajectory of four strains of chicken ...

    African Journals Online (AJOL)

    This study evaluated egg traits, embryonic growth, and early growth rate in four strains of chicken. A total of 1200 hatching eggs, 300 each from four strains of chicken were used for this study. The strains included Nigerian indigenous chicken (NIC), Arbor acre, Hubbard, and Marshall broiler strains. Embryonic weights, yolk ...


    NARCIS (Netherlands)

    HESS, F


    A new viscoplastic model for the plastic stress-strain behaviour of f.c.c. metals is presented. In this model the strain hardening results from increasing dislocation densities. The observed stagnation of strain hardening after strain reversals is explained by a lowering of the increase in

  1. Nucleation versus instability race in strained films (United States)

    Liu, Kailang; Berbezier, Isabelle; David, Thomas; Favre, Luc; Ronda, Antoine; Abbarchi, Marco; Voorhees, Peter; Aqua, Jean-Noël


    Under the generic term "Stranski-Krastanov" are grouped two different growth mechanisms of SiGe quantum dots. They result from the self-organized Asaro-Tiller-Grinfel'd (ATG) instability at low strain, while at high strain, from a stochastic nucleation. While these regimes are well known, we elucidate here the origin of the transition between these two pathways thanks to a joint theoretical and experimental work. Nucleation is described within the master equation framework. By comparing the time scales for ATG instability development and three-dimensional (3D) nucleation onset, we demonstrate that the transition between these two regimes is simply explained by the crossover between their divergent evolutions. Nucleation exhibits a strong exponential deviation at low strain while ATG behaves only algebraically. The associated time scale varies with exp(1 /x4) for nucleation, while it only behaves as 1 /x8 for the ATG instability. Consequently, at high (low) strain, nucleation (instability) occurs faster and inhibits the alternate evolution. It is then this different kinetic evolution which explains the transition from one regime to the other. Such a kinetic view of the transition between these two 3D growth regimes was not provided before. The crossover between nucleation and ATG instability is found to occur both experimentally and theoretically at a Ge composition around 50% in the experimental conditions used here. Varying the experimental conditions and/or the system parameters does not allow us to suppress the transition. This means that the SiGe quantum dots always grow via ATG instability at low strain and nucleation at high strain. This result is important for the self-organization of quantum dots.

  2. Tensile strain mapping in flat germanium membranes

    International Nuclear Information System (INIS)

    Rhead, S. D.; Halpin, J. E.; Myronov, M.; Patchett, D. H.; Allred, P. S.; Wilson, N. R.; Leadley, D. R.; Shah, V. A.; Kachkanov, V.; Dolbnya, I. P.; Reparaz, J. S.; Sotomayor Torres, C. M.


    Scanning X-ray micro-diffraction has been used as a non-destructive probe of the local crystalline quality of a thin suspended germanium (Ge) membrane. A series of reciprocal space maps were obtained with ∼4 μm spatial resolution, from which detailed information on the strain distribution, thickness, and crystalline tilt of the membrane was obtained. We are able to detect a systematic strain variation across the membranes, but show that this is negligible in the context of using the membranes as platforms for further growth. In addition, we show evidence that the interface and surface quality is improved by suspending the Ge

  3. Tensile strain mapping in flat germanium membranes

    Energy Technology Data Exchange (ETDEWEB)

    Rhead, S. D., E-mail:; Halpin, J. E.; Myronov, M.; Patchett, D. H.; Allred, P. S.; Wilson, N. R.; Leadley, D. R. [Department of Physics, University of Warwick, Coventry, CV4 7AL (United Kingdom); Shah, V. A. [Department of Physics, University of Warwick, Coventry, CV4 7AL (United Kingdom); Department of Engineering, University of Warwick, Coventry, CV4 7AL (United Kingdom); Kachkanov, V.; Dolbnya, I. P. [Diamond Light Source, Harwell Science and Innovation Campus, Didcot, Oxfordshire, OX11 0DE (United Kingdom); Reparaz, J. S. [ICN2 - Institut Catala de Nanociencia i Nanotecnologia, Campus UAB, 08193 Bellaterra (Barcelona) (Spain); Sotomayor Torres, C. M. [ICN2 - Institut Catala de Nanociencia i Nanotecnologia, Campus UAB, 08193 Bellaterra (Barcelona) (Spain)


    Scanning X-ray micro-diffraction has been used as a non-destructive probe of the local crystalline quality of a thin suspended germanium (Ge) membrane. A series of reciprocal space maps were obtained with ∼4 μm spatial resolution, from which detailed information on the strain distribution, thickness, and crystalline tilt of the membrane was obtained. We are able to detect a systematic strain variation across the membranes, but show that this is negligible in the context of using the membranes as platforms for further growth. In addition, we show evidence that the interface and surface quality is improved by suspending the Ge.

  4. Cells as strain-cued automata (United States)

    Cox, Brian N.; Snead, Malcolm L.


    We argue in favor of representing living cells as automata and review demonstrations that autonomous cells can form patterns by responding to local variations in the strain fields that arise from their individual or collective motions. An autonomous cell's response to strain stimuli is assumed to be effected by internally-generated, internally-powered forces, which generally move the cell in directions other than those implied by external energy gradients. Evidence of cells acting as strain-cued automata have been inferred from patterns observed in nature and from experiments conducted in vitro. Simulations that mimic particular cases of pattern forming share the idealization that cells are assumed to pass information among themselves solely via mechanical boundary conditions, i.e., the tractions and displacements present at their membranes. This assumption opens three mechanisms for pattern formation in large cell populations: wavelike behavior, kinematic feedback in cell motility that can lead to sliding and rotational patterns, and directed migration during invasions. Wavelike behavior among ameloblast cells during amelogenesis (the formation of dental enamel) has been inferred from enamel microstructure, while strain waves in populations of epithelial cells have been observed in vitro. One hypothesized kinematic feedback mechanism, "enhanced shear motility", accounts successfully for the spontaneous formation of layered patterns during amelogenesis in the mouse incisor. Directed migration is exemplified by a theory of invader cells that sense and respond to the strains they themselves create in the host population as they invade it: analysis shows that the strain fields contain positional information that could aid the formation of cell network structures, stabilizing the slender geometry of branches and helping govern the frequency of branch bifurcation and branch coalescence (the formation of closed networks). In simulations of pattern formation in

  5. Haemophilus ducreyi Cutaneous Ulcer Strains Diverged from Both Class I and Class II Genital Ulcer Strains: Implications for Epidemiological Studies.

    Directory of Open Access Journals (Sweden)

    Dharanesh Gangaiah


    Full Text Available Haemophilus ducreyi has emerged as a major cause of cutaneous ulcers (CU in yaws-endemic regions of the tropics in the South Pacific, South East Asia and Africa. H. ducreyi was once thought only to cause the genital ulcer (GU disease chancroid; GU strains belong to 2 distinct classes, class I and class II. Using whole-genome sequencing of 4 CU strains from Samoa, 1 from Vanuatu and 1 from Papua New Guinea, we showed that CU strains diverged from the class I strain 35000HP and that one CU strain expressed β-lactamase. Recently, the Center for Disease Control and Prevention released the genomes of 11 additional CU strains from Vanuatu and Ghana; however, the evolutionary relationship of these CU strains to previously-characterized CU and GU strains is unknown.We performed phylogenetic analysis of 17 CU and 10 GU strains. Class I and class II GU strains formed two distinct clades. The class I strains formed two subclades, one containing 35000HP and HD183 and the other containing the remainder of the class I strains. Twelve of the CU strains formed a subclone under the class I 35000HP subclade, while 2 CU strains formed a subclone under the other class I subclade. Unexpectedly, 3 of the CU strains formed a subclone under the class II clade. Phylogenetic analysis of dsrA-hgbA-ncaA sequences yielded a tree similar to that of whole-genome phylogenetic tree.CU strains diverged from multiple lineages within both class I and class II GU strains. Multilocus sequence typing of dsrA-hgbA-ncaA could be reliably used for epidemiological investigation of CU and GU strains. As class II strains grow relatively poorly and are relatively more susceptible to vancomycin than class I strains, these findings have implications for methods to recover CU strains. Comparison of contemporary CU and GU isolates would help clarify the relationship between these entities.

  6. Haemophilus ducreyi Cutaneous Ulcer Strains Diverged from Both Class I and Class II Genital Ulcer Strains: Implications for Epidemiological Studies. (United States)

    Gangaiah, Dharanesh; Spinola, Stanley M


    Haemophilus ducreyi has emerged as a major cause of cutaneous ulcers (CU) in yaws-endemic regions of the tropics in the South Pacific, South East Asia and Africa. H. ducreyi was once thought only to cause the genital ulcer (GU) disease chancroid; GU strains belong to 2 distinct classes, class I and class II. Using whole-genome sequencing of 4 CU strains from Samoa, 1 from Vanuatu and 1 from Papua New Guinea, we showed that CU strains diverged from the class I strain 35000HP and that one CU strain expressed β-lactamase. Recently, the Center for Disease Control and Prevention released the genomes of 11 additional CU strains from Vanuatu and Ghana; however, the evolutionary relationship of these CU strains to previously-characterized CU and GU strains is unknown. We performed phylogenetic analysis of 17 CU and 10 GU strains. Class I and class II GU strains formed two distinct clades. The class I strains formed two subclades, one containing 35000HP and HD183 and the other containing the remainder of the class I strains. Twelve of the CU strains formed a subclone under the class I 35000HP subclade, while 2 CU strains formed a subclone under the other class I subclade. Unexpectedly, 3 of the CU strains formed a subclone under the class II clade. Phylogenetic analysis of dsrA-hgbA-ncaA sequences yielded a tree similar to that of whole-genome phylogenetic tree. CU strains diverged from multiple lineages within both class I and class II GU strains. Multilocus sequence typing of dsrA-hgbA-ncaA could be reliably used for epidemiological investigation of CU and GU strains. As class II strains grow relatively poorly and are relatively more susceptible to vancomycin than class I strains, these findings have implications for methods to recover CU strains. Comparison of contemporary CU and GU isolates would help clarify the relationship between these entities.

  7. Failure strains and proposed limit strains for an reactor pressure vessel under severe accident conditions

    International Nuclear Information System (INIS)

    Krieg, R.


    The local failure strains of essential design elements of a reactor vessel are investigated. The size influence of the structure is of special interest. Typical severe accident conditions including elevated temperatures and dynamic loads are considered. The main part of work consists of test families with specimens under uniaxial and biaxial load. Within one test family the specimen geometry and the load conditions are similar, but the size is varied up to reactor dimensions. Special attention is given to geometries with a hole or a notch causing non-uniform stress and strain distributions typical for the reactor vessel. A key problem is to determine the local failure strain. Here suitable methods had to be developed including the so-called 'vanishing gap method', and the 'forging die method'. They are based on post-test geometrical measurements of the fracture surfaces and reconstructions of the related strain fields using finite element models. The results indicate that stresses versus dimensionless deformations are approximately size independent up to failure for specimens of similar geometry under similar load conditions. Local failure strains could be determined. The values are rather high and size dependent. Statistical evaluation allow the proposal of limit strains which are also size dependent. If these limit strains are not exceeded, the structures will not fracture

  8. Mechanical strength model for plastic bonded granular materials at high strain rates and large strains

    International Nuclear Information System (INIS)

    Browning, R.V.; Scammon, R.J.


    Modeling impact events on systems containing plastic bonded explosive materials requires accurate models for stress evolution at high strain rates out to large strains. For example, in the Steven test geometry reactions occur after strains of 0.5 or more are reached for PBX-9501. The morphology of this class of materials and properties of the constituents are briefly described. We then review the viscoelastic behavior observed at small strains for this class of material, and evaluate large strain models used for granular materials such as cap models. Dilatation under shearing deformations of the PBX is experimentally observed and is one of the key features modeled in cap style plasticity theories, together with bulk plastic flow at high pressures. We propose a model that combines viscoelastic behavior at small strains but adds intergranular stresses at larger strains. A procedure using numerical simulations and comparisons with results from flyer plate tests and low rate uniaxial stress tests is used to develop a rough set of constants for PBX-9501. Comparisons with the high rate flyer plate tests demonstrate that the observed characteristic behavior is captured by this viscoelastic based model. copyright 1998 American Institute of Physics

  9. Life Stress, Strain, and Deviance Across Schools: Testing the Contextual Version of General Strain Theory in China. (United States)

    Zhang, Jinwu; Liu, Jianhong; Wang, Xin; Zou, Anquan


    General Strain Theory delineates different types of strain and intervening processes from strain to deviance and crime. In addition to explaining individual strain-crime relationship, a contextualized version of general strain theory, which is called the Macro General Strain Theory, has been used to analyze how aggregate variables influence aggregate and individual deviance and crime. Using a sample of 1,852 students (Level 1) nested in 52 schools (Level 2), the current study tests the Macro General Strain Theory using Chinese data. The results revealed that aggregate life stress and strain have influences on aggregate and individual deviance, and reinforce the individual stress-deviance association. The current study contributes by providing the first Macro General Strain Theory test based on Chinese data and offering empirical evidence for the multilevel intervening processes from strain to deviance. Limitations and future research directions are discussed.

  10. High strain rate behaviour of polypropylene microfoams

    Directory of Open Access Journals (Sweden)

    Martínez A.B.


    Full Text Available Microcellular materials such as polypropylene foams are often used in protective applications and passive safety for packaging (electronic components, aeronautical structures, food, etc. or personal safety (helmets, knee-pads, etc.. In such applications the foams which are used are often designed to absorb the maximum energy and are generally subjected to severe loadings involving high strain rates. The manufacture process to obtain polymeric microcellular foams is based on the polymer saturation with a supercritical gas, at high temperature and pressure. This method presents several advantages over the conventional injection moulding techniques which make it industrially feasible. However, the effect of processing conditions such as blowing agent, concentration and microfoaming time and/or temperature on the microstructure of the resulting microcellular polymer (density, cell size and geometry is not yet set up. The compressive mechanical behaviour of several microcellular polypropylene foams has been investigated over a wide range of strain rates (0.001 to 3000 s−1 in order to show the effects of the processing parameters and strain rate on the mechanical properties. High strain rate tests were performed using a Split Hopkinson Pressure Bar apparatus (SHPB. Polypropylene and polyethylene-ethylene block copolymer foams of various densities were considered.

  11. Nature of interstitially induced lattice strains

    International Nuclear Information System (INIS)

    Emin, D.


    The addition of interstitial atoms to a metal lattice has been likened to the addition of extra billiard balls to an array of tangentially touching billiard balls. In such a picture the increased clustering of interstitials can lead to the buildup of larger and larger strain fields which ultimately are associated with the production of broken bonds. Simple models of the strain fields associated with the addition of particles to a lattice in which the force exerted between the added atoms and host atoms is finite have been studied. From these studies one can define situations in which the billiard-ball approach has qualitative validity and those in which it is inappropriate. Basically, those situations in which the displacements of the host atoms can be represented as involving acoustic phonons yield long-range strain fields analogous to those of the billiard-ball model with the radius of the extra billiard ball being determined by the stiffness of the host lattice and the forces between the added atom and the surrounding host atoms. If the displacements produced by the added atoms are represented as involving primarily optical phonons the displacement pattern is short-ranged and not described by the usual elasticity theory. For example, Vegard's law does not apply in these instances. Such concerns arise in considering the strains induced by interstitial helium in tritides

  12. Preliminary characterization of slow growing rhizobial strains ...

    African Journals Online (AJOL)



    May 18, 2016 ... number of nodules was equal to 5.6 nodules per plant for the strain RMB1 from Bousfer site. The intrinsic .... The salt tolerance of rhizobia was tested on YMA plates containing ..... through deep explorations searching for an.

  13. Ductile damage evolution and strain path dependency

    NARCIS (Netherlands)

    Tasan, C.C.; Hoefnagels, J.P.M.; Peerlings, R.H.J.; Geers, M.G.D.; Horn, ten C.H.L.J.; Vegter, H.; Cueto, E.; Chinesta, F.


    Forming limit diagrams are commonly used in sheet metal industry to define the safe forming regions. These diagrams are built to define the necking strains of sheet metals. However, with the rise in the popularity of advance high strength steels, ductile fracture through damage evolution has also

  14. Strain engineering of Dirac cones in graphyne

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Gaoxue; Kumar, Ashok; Pandey, Ravindra, E-mail: [Department of Physics, Michigan Technological University, Houghton, Michigan 49931 (United States); Si, Mingsu [Key Laboratory for Magnetism and Magnetic Materials of the Ministry of Education, Lanzhou University, Lanzhou 730000 (China)


    6,6,12-graphyne, one of the two-dimensional carbon allotropes with the rectangular lattice structure, has two kinds of non-equivalent anisotropic Dirac cones in the first Brillouin zone. We show that Dirac cones can be tuned independently by the uniaxial compressive strain applied to graphyne, which induces n-type and p-type self-doping effect, by shifting the energy of the Dirac cones in the opposite directions. On the other hand, application of the tensile strain results into a transition from gapless to finite gap system for the monolayer. For the AB-stacked bilayer, the results predict tunability of Dirac-cones by in-plane strains as well as the strain applied perpendicular to the plane. The group velocities of the Dirac cones show enhancement in the resistance anisotropy for bilayer relative to the case of monolayer. Such tunable and direction-dependent electronic properties predicted for 6,6,12-graphyne make it to be competitive for the next-generation electronic devices at nanoscale.

  15. Strains and Sprains Are a Pain (United States)

    ... lot of pressure on a muscle or you push it too far, such as when lifting a heavy object. Strains can be more likely to happen if you haven't warmed up first to get blood circulating to the muscles. They're also common for someone returning to a sport after the off-season. That first time playing ...

  16. Photoacclimation of cultured strains of the cyanobacterium

    NARCIS (Netherlands)

    Bañares-España, E.; Kromkamp, J.C.; López-Rodas, V.; Costas, E.; Flores-Moya, A.


    The cyanobacterium Microcystis aeruginosa forms blooms that can consist of colonies. We have investigated how M.aeruginosa acclimatizes to changing light conditions such as can occur during blooms. Three different strains were exposed to two irradiance levels: lower (LL) and higher (HL) than the

  17. Strain rate behavior of magnetorheological materials

    International Nuclear Information System (INIS)

    Seminuk, Kenneth; Joshi, Vasant; Gump, Jared; Stoltz, Chad; Forbes, Jerry


    Strain rate response of two Hydroxyl-terminated Polybutadiene/ Iron (HTPB/Fe) compositions under electromagnetic fields has been investigated using a Split Hopkinson Pressure bar arrangement equipped with aluminum bars. Two HTPB/Fe compositions were developed, the first without plasticizer and the second containing plasticizer. Samples were tested with and without the application of a 0.01 Tesla magnetic field. Strain gauge data taken from the Split Hopkinson Pressure Bar has been used to determine the extent of change in mechanical properties by inducing a mild electromagnetic field onto each sample. Raw data from strain gages was processed using commercial software (Signo) and Excel spreadsheet. It is of particular interest to determine whether the mechanical properties of binder systems can be manipulated by adding ferrous or Magnetostrictive particulates. Data collected from the Split Hopkinson Pressure bar indicate changes in the Mechanical Stress-Strain curves and suggest that the impedance of a binder system can be altered by means of a magnetic field.

  18. Role Strain in University Research Centers (United States)

    Boardman, Craig; Bozeman, Barry


    One way in which university faculty members' professional lives have become more complex with the advent of contemporary university research centers is that many faculty have taken on additional roles. The authors' concern in this article is to determine the extent to which role strain is experienced by university faculty members who are…

  19. Evolution and Strain Variation in BCG

    KAUST Repository

    Abdallah, Abdallah


    BCG vaccines were derived by in vitro passage, during the years 1908–1921, at the Pasteur Institute of Lille. Following the distribution of stocks of BCG to vaccine production laboratories around the world, it was only a few decades before different BCG producers recognized that there were variants of BCG, likely due to different passaging conditions in the different laboratories. This ultimately led to the lyophilization of stable BCG products in the 1950s and 1960s, but not before considerable evolution of the different BCG strains had taken place. The application of contemporary research methodologies has now revealed genomic, transcriptomic and proteomic differences between BCG strains. These molecular differences in part account for phenotypic differences in vitro between BCG strains, such as their variable secretion of antigenic proteins. Yet, the relevance of BCG variability for immunization policy remains elusive. In this chapter we present an overview of what is known about BCG evolution and its resulting strain variability, and provide some speculation as to the potential relevance for a vaccine given to over 100 million newborns each year.

  20. Strain Imaging Using Terahertz Waves and Metamaterials (United States)


    predictions. 14. SUBJECT TERMS Birefringence, Terahertz Waves, Metamaterials 15. NUMBER OF PAGES 16 16. PRICE CODE 17. SECURITY...opaque objects by using the principles of strain-induced birefringence. 4 III. CONCEPT To overcome the inability of visual light to penetrate ...opaque objects, terahertz radiation was investigated. Longer wavelength EM waves, such as radio waves, have excellent penetration ability but low image

  1. Effective stress coefficient for uniaxial strain condition

    DEFF Research Database (Denmark)

    Alam, M.M.; Fabricius, I.L.


    one dimensional rock mechanical deformation. We further investigated the effect of boundary condition on the stress dependency of effective stress coefficient and discussed its application in reservoir study. As stress field in the reservoirs are most unlikely to be hydrostatic, effective stress...... determined under uniaxial strain condition will be more relevant in reservoir studies. Copyright 2012 ARMA, American Rock Mechanics Association....

  2. Fibre optic strain sensor: examples of applications (United States)

    Kruszewski, J.; Beblowska, M.; Wrzosek, P.


    Construction of strain sensor for application in safety systems has been presented. The device consists of sensor's head and source and detector units. The head is made of polymer fiber bends. Designed sensor could be mounted in monitoring place (e.g. under a floor) and controlled by PC unit or could be used as a portable device for a valuable object protection.

  3. Falling balls and simple shearing strain

    International Nuclear Information System (INIS)

    Brun, J L; Pacheco, A F


    The problem of particles falling under gravity allows us to relate Hamiltonian mechanics to such different subjects as elasticity and fluid mechanics. It is with this in mind that mechanics gives us the opportunity of introducing, in a rather simple and unusual form, some concepts such as vorticity, the incompressibility condition or simple shear strain to physics students at the undergraduate level

  4. What is behind the plastic strain rate?

    NARCIS (Netherlands)

    Hütter, M.; Grmela, M.; Öttinger, H.C.


    The plastic strain rate plays a central role in macroscopic models on elasto-viscoplasticity. In order to discuss the concept behind this quantity, we propose, first, a kinetic toy model to describe the dynamics of sliding layers representative of plastic deformation of single crystalline metals.

  5. Preliminary characterization of Rhizobium strains isolated from ...

    African Journals Online (AJOL)



    Mar 18, 2008 ... residues for animal feed and helps to maintain soil fertility through .... A loopful of agar slopes of the strains assayed for vitamin production was ... B12 Assay Medium, amended with 2 mmol l-1 Ca-pantothenate, biotin and ...

  6. Strain absorbent modules for cavity filling

    Energy Technology Data Exchange (ETDEWEB)


    Strain absorbent modules made from weldmesh panels and helical steel binders can be used, together with timber packing, to support the roof and sides of cavities instead of softwood and hardwood nogs. A description of these modules and a series of load tests and underground trials carried out on the modules is given.

  7. Fano Factor in Strained Graphene Nanoribbon Nanodevices

    Institute of Scientific and Technical Information of China (English)

    Walid Soliman; Mina D.Asham; Adel H.Phillips


    We investigate the Fano factor in a strained armchair and zigzag graphene nanoribbon nanodevice under the effect of ac field in a wide range of frequencies at different temperatures (10 K T0 K).This nanodevice is modeled as follows:a graphene nanoribbon is connected to two metallic leads.These two metallic leads operate as a source and a drain.The conducting substance is the gate electrode in this three-terminal nanodevice.Another metallic gate is used to govern the electrostatics and the switching of the graphene nanoribbon channel The substances at the graphene nanoribbon/metal contact are controlled by the back gate.The photon-assisted tunneling probability is deduced by solving the Dirac eigenvalue differential equation in which the Fano factor is expressed in terms of this tunneling probability.The results show that for the investigated nanodevice,the Fano factor decreases as the frequency of the induced ac field increases,while it increases as the temperature increases.In general,the Fano factors for both strained armchair and zigzag graphene nanoribbons are different.This is due to the effect of the uniaxial strain.It is shown that the band structure parameters of graphene nanoribbons at the energy gap,the C-C bond length,the hopping integral,the Fermi energy and the width are modulated by uniaxial strain.This research gives us a promise of the present nanodevice being used for digital nanoelectronics and sensors.

  8. Highly Stretchable, Strain Sensing Hydrogel Optical Fibers. (United States)

    Guo, Jingjing; Liu, Xinyue; Jiang, Nan; Yetisen, Ali K; Yuk, Hyunwoo; Yang, Changxi; Khademhosseini, Ali; Zhao, Xuanhe; Yun, Seok-Hyun


    A core-clad fiber made of elastic, tough hydrogels is highly stretchable while guiding light. Fluorescent dyes are easily doped into the hydrogel fiber by diffusion. When stretched, the transmission spectrum of the fiber is altered, enabling the strain to be measured and also its location. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  9. Strained Si engineering for nanoscale MOSFETs

    International Nuclear Information System (INIS)

    Park, Jea-Gun; Lee, Gon-Sub; Kim, Tae-Hyun; Hong, Seuck-Hoon; Kim, Seong-Je; Song, Jin-Hwan; Shim, Tae-Hun


    We have revealed a strain relaxation mechanism for strained Si grown on a relaxed SiGe-on-insulator structure fabricated by the bonding, dislocation sink, or condensation method. Strain relaxation for both the bonding and dislocation sink methods was achieved by grading the Ge concentration; in contrast, the relaxation for the condensation method was achieved through Ge atom condensation during oxidation. In addition, we estimated the surface roughness and threading-dislocation pit density for relaxed SiGe layer fabricated by the bonding, dislocation sink, or condensation method. The surface roughness and threading-dislocation pit density for the bonding, dislocation sink, and condensation methods were 2.45, 0.46, and 0.40 nm and 5.0 x 10 3 , 9 x 10 3 , and 0, respectively. In terms of quality and cost-effectiveness, the condensation method was superior to the bonding and dislocation sink methods for forming strained Si on a relaxed SiGe-on-insulator structure

  10. Simple Numerical Simulation of Strain Measurement (United States)

    Tai, H.


    By adopting the basic principle of the reflection (and transmission) of a plane polarized electromagnetic wave incident normal to a stack of films of alternating refractive index, a simple numerical code was written to simulate the maximum reflectivity (transmittivity) of a fiber optic Bragg grating corresponding to various non-uniform strain conditions including photo-elastic effect in certain cases.

  11. High strain rate studies in rock

    International Nuclear Information System (INIS)

    Grady, D.


    Dynamic compression studies using high velocity impact are usually considered to involve a catastrophic process of indeterminate loading rate by which a material is brough to a shock compressed state. Although this is frequently the case, methods are also available to control the rate of strain during the shock compression process. One of the most accurate of these methods makes use of the anomalous nonlinear elastic property of glass to transform an initial shock or step wave input into a ramp wave of known amplitude and duration. Fused silica is the most carefully calibrated material for this purpose and, when placed between the test specimen and the impact projectile, can provide loading strain rates in the range of 10 4 /s to 10 6 /s for final stress states of approximately 3.9 GPa or less.Ramp wave compression experiments have been conducted on dolomite at strain rates of 3 x 10 4 /s. Both initial yielding and subsequent deformation at this strain rate agrees well with previous shock wave studies (epsilon-dotapprox.10 6 /s) and differs substantially from quasi-static measurements (epsilon-dotapprox.10 -4 /s). The ramp wave studies have also uncovered a pressure-induced phase transition in dolomite initiating at 4.0 GPa

  12. Characterizing large strain crush response of redwood

    International Nuclear Information System (INIS)

    Cramer, S.M.; Hermanson, J.C.


    Containers for the transportation of hazardous and radioactive materials incorporate redwood in impact limiters. Redwood is an excellent energy absorber, but only the most rudimentary information exists on its crush properties. The objectives of the study were to fill the information gap by collecting triaxial load-deformation data for redwood; to use these data to characterize redwood crush, assess current wood failure theories, provide developments toward a complete stress-strain theory for redwood; and to review the literature on strain-rate effects on redwood crush performance. The load-deformation responses of redwood at temperature conditions corresponding to ambient (70 degrees F), 150 degrees F, and -20 degrees F conditions were measured in approximately 100 confined compression tests for crush levels leading to material densification. Data analysis provided a more complete description of redwood crush performance and a basis for assessing proposed general orthotropic stress-strain relationships for redwood. A review of existing literature indicated that strain-rate effects cause at most a 20 percent increase in crush stress parallel to grain

  13. Characterization and monitoring of selected rhizobial strains ...

    African Journals Online (AJOL)



    Jun 18, 2007 ... Fax: +66-44-216345. fixing symbiosis with bacteria known as rhizobia. ... Rhizobial strains were cultured on Yeast-Malt extract agar contain- ing bromthymol blue ... Colony form-ing was observed every day as well as the ...

  14. Preliminary characterization of slow growing rhizobial strains ...

    African Journals Online (AJOL)



    May 18, 2016 ... strains had a very slow growth rate in yeast malt (YM) agar medium, forming colonies less than 1 mm in ... dominant genus of symbiotic nitrogen-fixing bacteria ... Single colonies were picked up and checked for purity by.

  15. High strain rate behaviour of polypropylene microfoams (United States)

    Gómez-del Río, T.; Garrido, M. A.; Rodríguez, J.; Arencón, D.; Martínez, A. B.


    Microcellular materials such as polypropylene foams are often used in protective applications and passive safety for packaging (electronic components, aeronautical structures, food, etc.) or personal safety (helmets, knee-pads, etc.). In such applications the foams which are used are often designed to absorb the maximum energy and are generally subjected to severe loadings involving high strain rates. The manufacture process to obtain polymeric microcellular foams is based on the polymer saturation with a supercritical gas, at high temperature and pressure. This method presents several advantages over the conventional injection moulding techniques which make it industrially feasible. However, the effect of processing conditions such as blowing agent, concentration and microfoaming time and/or temperature on the microstructure of the resulting microcellular polymer (density, cell size and geometry) is not yet set up. The compressive mechanical behaviour of several microcellular polypropylene foams has been investigated over a wide range of strain rates (0.001 to 3000 s-1) in order to show the effects of the processing parameters and strain rate on the mechanical properties. High strain rate tests were performed using a Split Hopkinson Pressure Bar apparatus (SHPB). Polypropylene and polyethylene-ethylene block copolymer foams of various densities were considered.

  16. How strained are carbomeric-cycloalkanes? (United States)

    Wodrich, Matthew D; Gonthier, Jérôme F; Steinmann, Stephan N; Corminboeuf, Clémence


    The ring strain energies of carbomeric-cycloalkanes (molecules with one or more acetylene spacer units placed into carbon single bonds) are assessed using a series of isodesmic, homodesmotic, and hyperhomodesmotic chemical equations. Isodesmic bond separation reactions and other equations derived from the explicitly defined hierarchy of homodesmotic equations are insufficient for accurately determining these values, since not all perturbing effects (i.e., conjugation and hyperconjugation) are fully balanced. A set of homodesmotic reactions is proposed, which succeeds in balancing all stereoelectronic effects present within the carbomeric rings, allowing for a direct assessment of the strain energies. Values calculated from chemical equations are validated using an increment/additivity approach. The ring strain energy decreases as acetylene units are added, manifesting from the net stabilization gained by opening the C-CH(2)-C angle around the methylene groups and the destabilization arising from bending the C-C identical withC angles of the spacer groups. This destabilization vanishes with increasing parent ring size (i.e., the angle distortion is less in the carbomeric-cyclobutanes than in the carbomeric-cyclopropanes), leading to strain energies near zero for carbo(n)-cyclopentanes and carbo(n)-cyclohexanes.

  17. Unsteady Aerodynamic Force Sensing from Measured Strain (United States)

    Pak, Chan-Gi


    A simple approach for computing unsteady aerodynamic forces from simulated measured strain data is proposed in this study. First, the deflection and slope of the structure are computed from the unsteady strain using the two-step approach. Velocities and accelerations of the structure are computed using the autoregressive moving average model, on-line parameter estimator, low-pass filter, and a least-squares curve fitting method together with analytical derivatives with respect to time. Finally, aerodynamic forces over the wing are computed using modal aerodynamic influence coefficient matrices, a rational function approximation, and a time-marching algorithm. A cantilevered rectangular wing built and tested at the NASA Langley Research Center (Hampton, Virginia, USA) in 1959 is used to validate the simple approach. Unsteady aerodynamic forces as well as wing deflections, velocities, accelerations, and strains are computed using the CFL3D computational fluid dynamics (CFD) code and an MSC/NASTRAN code (MSC Software Corporation, Newport Beach, California, USA), and these CFL3D-based results are assumed as measured quantities. Based on the measured strains, wing deflections, velocities, accelerations, and aerodynamic forces are computed using the proposed approach. These computed deflections, velocities, accelerations, and unsteady aerodynamic forces are compared with the CFL3D/NASTRAN-based results. In general, computed aerodynamic forces based on the lifting surface theory in subsonic speeds are in good agreement with the target aerodynamic forces generated using CFL3D code with the Euler equation. Excellent aeroelastic responses are obtained even with unsteady strain data under the signal to noise ratio of -9.8dB. The deflections, velocities, and accelerations at each sensor location are independent of structural and aerodynamic models. Therefore, the distributed strain data together with the current proposed approaches can be used as distributed deflection

  18. On strain and stress in living cells (United States)

    Cox, Brian N.; Smith, David W.


    Recent theoretical simulations of amelogenesis and network formation and new, simple analyses of the basic multicellular unit (BMU) allow estimation of the order of magnitude of the strain energy density in populations of living cells in their natural environment. A similar simple calculation translates recent measurements of the force-displacement relation for contacting cells (cell-cell adhesion energy) into equivalent volume energy densities, which are formed by averaging the changes in contact energy caused by a cell's migration over the cell's volume. The rates of change of these mechanical energy densities (energy density rates) are then compared to the order of magnitude of the metabolic activity of a cell, expressed as a rate of production of metabolic energy per unit volume. The mechanical energy density rates are 4-5 orders of magnitude smaller than the metabolic energy density rate in amelogenesis or bone remodeling in the BMU, which involve modest cell migration velocities, and 2-3 orders of magnitude smaller for innervation of the gut or angiogenesis, where migration rates are among the highest for all cell types. For representative cell-cell adhesion gradients, the mechanical energy density rate is 6 orders of magnitude smaller than the metabolic energy density rate. The results call into question the validity of using simple constitutive laws to represent living cells. They also imply that cells need not migrate as inanimate objects of gradients in an energy field, but are better regarded as self-powered automata that may elect to be guided by such gradients or move otherwise. Thus Ġel=d/dt 1/2 >[(C11+C12)ɛ02+2μγ02]=(C11+C12)ɛ0ɛ˙0+2μγ0γ˙0 or Ġel=ηEɛ0ɛ˙0+η‧Eγ0γ˙0 with 1.4≤η≤3.4 and 0.7≤η‧≤0.8 for Poisson's ratio in the range 0.2≤ν≤0.4 and η=1.95 and η‧=0.75 for ν=0.3. The spatial distribution of shear strains arising within an individual cell as cells slide past one another during amelogenesis is not known

  19. Recent advances in echocardiography: strain and strain rate imaging [version 1; referees: 3 approved

    Directory of Open Access Journals (Sweden)

    Oana Mirea


    Full Text Available Deformation imaging by echocardiography is a well-established research tool which has been gaining interest from clinical cardiologists since the introduction of speckle tracking. Post-processing of echo images to analyze deformation has become readily available at the fingertips of the user. New parameters such as global longitudinal strain have been shown to provide added diagnostic value, and ongoing efforts of the imaging societies and industry aimed at harmonizing methods will improve the technique further. This review focuses on recent advances in the field of echocardiographic strain and strain rate imaging, and provides an overview on its current and potential future clinical applications.

  20. Enzyme markers in inbred rat strains: genetics of new markers and strain profiles. (United States)

    Adams, M; Baverstock, P R; Watts, C H; Gutman, G A


    Twenty-six inbred strains of the laboratory rat (Rattus norvegicus) were examined for electrophoretic variation at an estimated 97 genetic loci. In addition to previously documented markers, variation was observed for the enzymes aconitase, aldehyde dehydrogenase, and alkaline phosphatase. The genetic basis of these markers (Acon-1, Ahd-2, and Akp-1) was confirmed. Linkage analysis between 35 pairwise comparisons revealed that the markers Fh-1 and Pep-3 are linked. The strain profiles of the 25 inbred strains at 11 electrophoretic markers are given.

  1. Informal eldercare and work-related strain. (United States)

    Trukeschitz, Birgit; Schneider, Ulrike; Mühlmann, Richard; Ponocny, Ivo


    In light of an aging workforce, reconciling informal eldercare and paid work becomes increasingly pertinent. This article investigates the association between informal eldercare and work-related strain and tests for both the "competing demands" and "expansion" hypotheses. The sample of 938 Austrian employees consisted of employees caring for older relatives and a control group of employees without eldercare obligations. We ran a Tobit regression model on work-related strain with different measures of informal eldercare as explanatory variables and controls for both personal and workplace characteristics. Accounting for different characteristics of eldercare within one estimation model revealed that informal eldercare was associated with work-related strain in 2 ways, that is, it increased with both care hours and subjective care burden. However, after controlling for these burdensome attributes of eldercare, the carer status as such was found to be negatively associated with work-related strain. In addition and independently of care commitments, work-related factors, such as advanced skills and job motivation, reduced work-related strain. This article lends support to both the "competing demands" and the "expansion" hypotheses. Commitment to eldercare can enhance work-related outcomes but entails work-related problems if care burden and time demands of eldercare are substantial. Thus, workers with eldercare responsibilities cannot be considered less productive from the outset. An individual assessment of their situation, considering the care and work setting, is required. Findings from this study support the design of workplace initiatives to uphold workers' productivity in general and bring specific attention to policies alleviating workers' eldercare burden.

  2. Strain rate effects for spallation of concrete (United States)

    Häussler-Combe, Ulrich; Panteki, Evmorfia; Kühn, Tino


    Appropriate triaxial constitutive laws are the key for a realistic simulation of high speed dynamics of concrete. The strain rate effect is still an open issue within this context. In particular the question whether it is a material property - which can be covered by rate dependent stress strain relations - or mainly an effect of inertia is still under discussion. Experimental and theoretical investigations of spallation of concrete specimen in a Hopkinson Bar setup may bring some evidence into this question. For this purpose the paper describes the VERD model, a newly developed constitutive law for concrete based on a damage approach with included strain rate effects [1]. In contrast to other approaches the dynamic strength increase is not directly coupled to strain rate values but related to physical mechanisms like the retarded movement of water in capillary systems and delayed microcracking. The constitutive law is fully triaxial and implemented into explicit finite element codes for the investigation of a wide range of concrete structures exposed to impact and explosions. The current setup models spallation experiments with concrete specimen [2]. The results of such experiments are mainly related to the dynamic tensile strength and the crack energy of concrete which may be derived from, e.g., the velocity of spalled concrete fragments. The experimental results are compared to the VERD model and two further constitutive laws implemented in LS-Dyna. The results indicate that both viscosity and retarded damage are required for a realistic description of the material behaviour of concrete exposed to high strain effects [3].

  3. Strain rate effects for spallation of concrete

    Directory of Open Access Journals (Sweden)

    Häussler-Combe Ulrich


    Full Text Available Appropriate triaxial constitutive laws are the key for a realistic simulation of high speed dynamics of concrete. The strain rate effect is still an open issue within this context. In particular the question whether it is a material property – which can be covered by rate dependent stress strain relations – or mainly an effect of inertia is still under discussion. Experimental and theoretical investigations of spallation of concrete specimen in a Hopkinson Bar setup may bring some evidence into this question. For this purpose the paper describes the VERD model, a newly developed constitutive law for concrete based on a damage approach with included strain rate effects [1]. In contrast to other approaches the dynamic strength increase is not directly coupled to strain rate values but related to physical mechanisms like the retarded movement of water in capillary systems and delayed microcracking. The constitutive law is fully triaxial and implemented into explicit finite element codes for the investigation of a wide range of concrete structures exposed to impact and explosions. The current setup models spallation experiments with concrete specimen [2]. The results of such experiments are mainly related to the dynamic tensile strength and the crack energy of concrete which may be derived from, e.g., the velocity of spalled concrete fragments. The experimental results are compared to the VERD model and two further constitutive laws implemented in LS-Dyna. The results indicate that both viscosity and retarded damage are required for a realistic description of the material behaviour of concrete exposed to high strain effects [3].

  4. Occupational stress and strain in the Royal Navy 2007. (United States)

    Bridger, R S; Brasher, K; Dew, A; Kilminster, S


    Previous surveys of psychological strain in the Naval Service (NS) have shown higher than expected levels of strain when compared to the general population. To repeat the survey last carried out in 2004 and to obtain further information on the nature of the occupational stressors associated with strain. General Health Questionnaire-12 strain rates and job/life stressors were measured using a Work and Well-Being Questionnaire. Models of strain were developed for male and female personnel in the Royal Navy (RN) and males in the Royal Marines (RM). The response rate was 57%. The psychological strain rate was 31.5% overall. Personnel suffering from strain tended to be 'overcommitted' to work, had low levels of commitment to the NS and had suffered stressful life events (SLEs) in the previous 12 months. Strain rates declined with age and rank in males, but not in females. Strain was significantly positively correlated with levels of overcommitment, effort-reward imbalance (ERI), role conflict, work-family conflict, organizational commitment and exposure to SLEs. Models of strain in the males and females in the RN and in the RM accounted for between 37 and 44% of the variance in strain. The survey provides evidence for both the demand control and ERI models-components of these models contribute independently to strain. High levels of commitment to the organization were associated with lower strain and exposure to SLEs to higher strain.

  5. Spacecraft Dynamic Characterization by Strain Energies Method (United States)

    Bretagne, J.-M.; Fragnito, M.; Massier, S.


    In the last years the significant increase in satellite broadcasting demand, with the wide band communication dawn, has given a great impulse to the telecommunication satellite market. The big demand is translated from operators (such as SES/Astra, Eutelsat, Intelsat, Inmarsat, EuroSkyWay etc.) in an increase of orders of telecom satellite to the world industrials. The largest part of these telecom satellite orders consists of Geostationary platforms which grow more and more in mass (over 5 tons) due to an ever longer demanded lifetime (up to 20 years), and become more complex due to the need of implementing an ever larger number of repeaters, antenna reflectors and feeds, etc... In this frame, the mechanical design and verification of these large spacecraft become difficult and ambitious at the same time, driven by the dry mass limitation objective. By the Finite Element Method (FEM), and on the basis of the telecom satellite heritage of a world leader constructor such as Alcatel Space Industries it is nowadays possible to model these spacecraft in a realistic and confident way in order to identify the main global dynamic aspects such as mode shapes, mass participation and/or dynamic responses. But on the other hand, one of the main aims consists in identifying soon in a program the most critical aspects of the system behavior in the launch dynamic environment, such as possible dynamic coupling between the different subsystems and secondary structures of the spacecraft (large deployable reflectors, thrusters, etc.). To this aim a numerical method has been developed in the frame of the Alcatel SPACEBUS family program, using MSC/Nastran capabilities and it is presented in this paper. The method is based on Spacecraft sub-structuring and strain energy calculation. The method mainly consists of two steps : 1) subsystem modal strain energy ratio (with respect to the global strain energy); 2) subsystem strain energy calculation for each mode according to the base driven

  6. Brucella abortus Strain 2308 Wisconsin Genome: Importance of the Definition of Reference Strains (United States)

    Suárez-Esquivel, Marcela; Ruiz-Villalobos, Nazareth; Castillo-Zeledón, Amanda; Jiménez-Rojas, César; Roop II, R. Martin; Comerci, Diego J.; Barquero-Calvo, Elías; Chacón-Díaz, Carlos; Caswell, Clayton C.; Baker, Kate S.; Chaves-Olarte, Esteban; Thomson, Nicholas R.; Moreno, Edgardo; Letesson, Jean J.; De Bolle, Xavier; Guzmán-Verri, Caterina


    Brucellosis is a bacterial infectious disease affecting a wide range of mammals and a neglected zoonosis caused by species of the genetically homogenous genus Brucella. As in most studies on bacterial diseases, research in brucellosis is carried out by using reference strains as canonical models to understand the mechanisms underlying host pathogen interactions. We performed whole genome sequencing analysis of the reference strain B. abortus 2308 routinely used in our laboratory, including manual curated annotation accessible as an editable version through a link at Comparison of this genome with two publically available 2308 genomes showed significant differences, particularly indels related to insertional elements, suggesting variability related to the transposition of these elements within the same strain. Considering the outcome of high resolution genomic techniques in the bacteriology field, the conventional concept of strain definition needs to be revised. PMID:27746773

  7. Brucella abortus strain 2308 Wisconsin genome: importance of the definition of reference strains

    Directory of Open Access Journals (Sweden)

    Marcela Suárez-Esquivel


    Full Text Available Brucellosis is a bacterial infectious disease affecting a wide range of mammals and a neglected zoonosis caused by species of the genetically homogenous genus Brucella. As in most studies on bacterial diseases, research in brucellosis is carried out by using reference strains as canonical models to understand the mechanisms underlying host pathogen interactions. We performed whole genome sequencing (WGS analysis of the reference strain Brucella abortus 2308 routinely used in our laboratory, including manual curated annotation accessible as an editable version at www.wikipedia.Comparison of this genome with two publically available 2308 genomes showed significant differences, particularly indels related to insertional elements, suggesting variability related to the transposition of these elements within the same strain. Considering the outcome of high resolution genomic techniques in the bacteriology field, the conventional concept of strain definition needs to be revised.

  8. Strain-dependent induction of cytokine profiles in the gut by orally administered Lactobacillus strains

    NARCIS (Netherlands)

    Maassen, C.B.M.; Holten-Neelen, C. van; Balk, F.; Bak-Glashouwer, M.-J.H. den; Leer, R.J.; Laman, J.D.; Boersma, W.J.A.; Claassen, E.


    Different Lactobacillus strains are frequently used in consumer food products. In addition, recombinant lactobacilli which contain novel expression vectors can now be used in immunotherapeutic applications such as oral vaccination strategies and in T cell tolerance induction approaches for

  9. A wide extent of inter-strain diversity in virulent and vaccine strains of alphaherpesviruses.

    Directory of Open Access Journals (Sweden)

    Moriah L Szpara


    Full Text Available Alphaherpesviruses are widespread in the human population, and include herpes simplex virus 1 (HSV-1 and 2, and varicella zoster virus (VZV. These viral pathogens cause epithelial lesions, and then infect the nervous system to cause lifelong latency, reactivation, and spread. A related veterinary herpesvirus, pseudorabies (PRV, causes similar disease in livestock that result in significant economic losses. Vaccines developed for VZV and PRV serve as useful models for the development of an HSV-1 vaccine. We present full genome sequence comparisons of the PRV vaccine strain Bartha, and two virulent PRV isolates, Kaplan and Becker. These genome sequences were determined by high-throughput sequencing and assembly, and present new insights into the attenuation of a mammalian alphaherpesvirus vaccine strain. We find many previously unknown coding differences between PRV Bartha and the virulent strains, including changes to the fusion proteins gH and gB, and over forty other viral proteins. Inter-strain variation in PRV protein sequences is much closer to levels previously observed for HSV-1 than for the highly stable VZV proteome. Almost 20% of the PRV genome contains tandem short sequence repeats (SSRs, a class of nucleic acids motifs whose length-variation has been associated with changes in DNA binding site efficiency, transcriptional regulation, and protein interactions. We find SSRs throughout the herpesvirus family, and provide the first global characterization of SSRs in viruses, both within and between strains. We find SSR length variation between different isolates of PRV and HSV-1, which may provide a new mechanism for phenotypic variation between strains. Finally, we detected a small number of polymorphic bases within each plaque-purified PRV strain, and we characterize the effect of passage and plaque-purification on these polymorphisms. These data add to growing evidence that even plaque-purified stocks of stable DNA viruses exhibit

  10. A wide extent of inter-strain diversity in virulent and vaccine strains of alphaherpesviruses. (United States)

    Szpara, Moriah L; Tafuri, Yolanda R; Parsons, Lance; Shamim, S Rafi; Verstrepen, Kevin J; Legendre, Matthieu; Enquist, L W


    Alphaherpesviruses are widespread in the human population, and include herpes simplex virus 1 (HSV-1) and 2, and varicella zoster virus (VZV). These viral pathogens cause epithelial lesions, and then infect the nervous system to cause lifelong latency, reactivation, and spread. A related veterinary herpesvirus, pseudorabies (PRV), causes similar disease in livestock that result in significant economic losses. Vaccines developed for VZV and PRV serve as useful models for the development of an HSV-1 vaccine. We present full genome sequence comparisons of the PRV vaccine strain Bartha, and two virulent PRV isolates, Kaplan and Becker. These genome sequences were determined by high-throughput sequencing and assembly, and present new insights into the attenuation of a mammalian alphaherpesvirus vaccine strain. We find many previously unknown coding differences between PRV Bartha and the virulent strains, including changes to the fusion proteins gH and gB, and over forty other viral proteins. Inter-strain variation in PRV protein sequences is much closer to levels previously observed for HSV-1 than for the highly stable VZV proteome. Almost 20% of the PRV genome contains tandem short sequence repeats (SSRs), a class of nucleic acids motifs whose length-variation has been associated with changes in DNA binding site efficiency, transcriptional regulation, and protein interactions. We find SSRs throughout the herpesvirus family, and provide the first global characterization of SSRs in viruses, both within and between strains. We find SSR length variation between different isolates of PRV and HSV-1, which may provide a new mechanism for phenotypic variation between strains. Finally, we detected a small number of polymorphic bases within each plaque-purified PRV strain, and we characterize the effect of passage and plaque-purification on these polymorphisms. These data add to growing evidence that even plaque-purified stocks of stable DNA viruses exhibit limited sequence

  11. Internal residual strain mapping in carburized chrome molybdenum steel after quenching by neutron strain scanning

    International Nuclear Information System (INIS)

    Sakaida, Yoshihisa; Serizawa, Takanobu; Manzanka, Michiya


    A hollow circular cylinder specimen with an annular U-notch of chrome molybdenum steel with 0.20 mass% C (SCM420) was carburized in carrier gas and quenched in oil bath. In order to determine the case depth, the specimen was cut off and carbon content and Vickers hardness gradients were measured experimentally near the carburized surface. The residual strain mapping in the interior of carburized cylinder was conducted nondestructively by neutron strain scanning. In this study, the neutron diffraction from Fe-211 plane was used for strain scanning. The neutron wavelength was tuned to 0.1654nm so that diffraction angle became about 90deg. Radial, hoop and axial residual strains were measured by scanning diffracting volume along the axial direction of cylinder specimen. Each residual strain was calculated from lattice spacing change. Unstressed lattice spacing was determined experimentally using reference coupon specimens that were cut from the interior of same carburized cylinder. As a result, the diffraction peak width at half height, FWHM, near the carburized surface was about 3.7 times wider than that of coupon specimens. On the other hand, the most peak widths in the interior equaled to that of coupon specimens. Peak width broadened slightly as the diffracting volume approached the carburized case layer. From the center to the quarter of cylinder specimen, the hoop and axial strains were tensile, and the radial one was compressive in the interior. From the quarter to the edge of the cylinder specimen, the hoop tensile strain increased, radial and axial strains changed to tensile and compressive, respectively. Therefore, the interior of the cylinder specimen was found to be deformed elastically to balance the existence of compressive residual stresses in the carburized case layer. (author)

  12. Generating strain signals under consideration of road surface profiles (United States)

    Putra, T. E.; Abdullah, S.; Schramm, D.; Nuawi, M. Z.; Bruckmann, T.


    The current study aimed to develop the mechanism for generating strain signal utilising computer-based simulation. The strain data, caused by the acceleration, were undertaken from a fatigue data acquisition involving car movements. Using a mathematical model, the measured strain signals yielded to acceleration data used to describe the bumpiness of road surfaces. The acceleration signals were considered as an external disturbance on generating strain signals. Based on this comparison, both the actual and simulated strain data have similar pattern. The results are expected to provide new knowledge to generate a strain signal via a simulation.

  13. Hole doped Dirac states in silicene by biaxial tensile strain

    KAUST Repository

    Kaloni, Thaneshwor P.; Cheng, Yingchun; Schwingenschlö gl, Udo


    The effects of biaxial tensile strain on the structure, electronic states, and mechanical properties of silicene are studied by ab-initio calculations. Our results show that up to 5% strain the Dirac cone remains essentially at the Fermi level, while higher strain induces hole doped Dirac states because of weakened Si–Si bonds. We demonstrate that the silicene lattice is stable up to 17% strain. It is noted that the buckling first decreases with the strain (up to 10%) and then increases again, which is accompanied by a band gap variation. We also calculate the Grüneisen parameter and demonstrate a strain dependence similar to that of graphene.

  14. Hole doped Dirac states in silicene by biaxial tensile strain

    KAUST Repository

    Kaloni, Thaneshwor P.


    The effects of biaxial tensile strain on the structure, electronic states, and mechanical properties of silicene are studied by ab-initio calculations. Our results show that up to 5% strain the Dirac cone remains essentially at the Fermi level, while higher strain induces hole doped Dirac states because of weakened Si–Si bonds. We demonstrate that the silicene lattice is stable up to 17% strain. It is noted that the buckling first decreases with the strain (up to 10%) and then increases again, which is accompanied by a band gap variation. We also calculate the Grüneisen parameter and demonstrate a strain dependence similar to that of graphene.

  15. MM98.83 Quantification of Combined Strain Paths

    DEFF Research Database (Denmark)

    Nielsen, Morten Sturgård; Lindegren, Maria; Wanheim, Tarras


    When working with processes where large plastic deformation occurs, a way of desribing the deformation process is to view the whole deformation history as a curve in the 6-dimensional shear strain normal strain space, henceforth called a strain history curve (SHC). This paper focuses on the SHC...... 3D-plasticity. Adirect use of the SHC, is to measure the yield surface at different points at a SHC, thus establishing data describing the importance of strain rotations or even strain reversals within a process. Two subcases for displaying SHC will be mentioned:The plane strain case and the single...

  16. Chromosomal duplication strains of Aspergillus nidulans and their instability

    International Nuclear Information System (INIS)

    Azevedo, J.L. de; Almeida Okino, L.M. de


    Strains of Aspergillus nidulans with chromosomal duplication were obtained after gamma irradiation followed by crossing of the translocated strains with normal strains. From 20 analysed colonies, 12 have shown translocations induced by irradiation. Segregants from four of these translocation strains crossed to normal strains have shown to be unstable although presenting normal morphology. Two segregants were genetically analysed. The first one has shown a duplication of part of linkage groups VIII and the second one presented a duplication of a segment of linkage group V. These new duplication strains in A. nidulans open new perspectives of a more detailed study of the instability phenomenon in this fungus. (Author) [pt

  17. Printed strain sensors for early damage detection in engineering structures (United States)

    Zymelka, Daniel; Yamashita, Takahiro; Takamatsu, Seiichi; Itoh, Toshihiro; Kobayashi, Takeshi


    In this paper, we demonstrate the analysis of strain measurements recorded using a screen-printed sensors array bonded to a metal plate and subjected to high strains. The analysis was intended to evaluate the capabilities of the printed strain sensors to detect abnormal strain distribution before actual defects (cracks) in the analyzed structures appear. The results demonstrate that the developed device can accurately localize the enhanced strains at the very early stage of crack formation. The promising performance and low fabrication cost confirm the potential suitability of the printed strain sensors for applications within the framework of structural health monitoring (SHM).

  18. Development of piping strain sensor for stress evaluation

    International Nuclear Information System (INIS)

    Takahama, Tsunemichi; Nishimura, Kazuma; Ninomiya, Seiichiro; Matsumoto, Yoshihiro; Harada, Yutaka


    In a small diameter piping, stresses are generated due to internal fluid or pump vibrations especially around the welding parts. Authors have successfully developed a pipe strain sensor which is able to measure such stresses. Unlike conventional methods using strain gages and adhesive bond, the sensor can measure the strain without putting adhesive bond on the piping surface. However, the strain sensor can provide measurements with a level of accuracy equivalent to that of conventional method using strain gages and adhesive bond. Accordingly, the strain sensor can significantly reduce the working time without any loss of the measurement accuracy. (author)

  19. Temperature and strain registration by fibre-optic strain sensor in the polymer composite materials manufacturing (United States)

    Matveenko; Kosheleva; Shardakov; Voronkov


    The presence of process-induced strains induced by various manufacturing and operational factors is one of the characteristics of polymer composite materials (PCM). Conventional methods of registration and evaluation of process-induced strains can be laborious, time-consuming and demanding in terms of technical applications. The employment of embedded fibre-optic strain sensors (FOSS) offers a real prospect of measuring residual strains. This paper demonstrates the potential for using embedded FOSS for recording technological strains in a PCM plate. The PCM plate is manufactured from prepreg, using the direct compression-moulding method. In this method, the prepared reinforcing package is placed inside a mould, heated, and then exposed to compaction pressure. The examined technology can be used for positioning FOSS between the layers of the composite material. Fibre-optic sensors, interacting with the material of the examined object, make it possible to register the evolution of the strain process during all stages of polymer-composite formation. FOSS data were recorded with interrogator ASTRO X 327. The obtained data were processed using specially developed algorithms.

  20. Variation in the strain anisotropy of Zircaloy with temperature and strain

    International Nuclear Information System (INIS)

    Hindle, E.D.; Worswick, D.


    The strong crystallographic texture which is developed during the fabrication of zirconium-based alloys causes pronounced anisotropy in their mechanical properties, particularly deformation. The tendency for circular-section tension specimens with a high concentration of basal poles in one direction to become elliptical when deformed in tension has been used in this study to provide quantitative data on the effects of both strain and temperature on strain anisotropy. Tension tests were carried out over a temperature range of 293 to 1193 K on specimens machined from Zircaloy-2 plate. The strain anisotropy was found to increase markedly at temperatures over 923 K, reaching a maximum in the region of 1070 K. The strain anisotropy increased with increasing strain in this temperature region. The study was extended to Zircaloy-4 pressurized-water reactor fuel cladding by carrying out tube swelling tests and evaluating the axial deformation produced. Although scatter in the test results was higher than that exhibited in the tension tests, the general trend in the data was similar. The effects of the strain anisotropy observed are discussed in relation to the effects of temperature on the ductility of Zircaloy fuel cladding tubes during postulated largebreak loss-of-coolant accidents

  1. An Embeddable Strain Sensor with 30 Nano-Strain Resolution Based on Optical Interferometry

    Directory of Open Access Journals (Sweden)

    Chen Zhu


    Full Text Available A cost-effective, robust and embeddable optical interferometric strain sensor with nanoscale strain resolution is presented in this paper. The sensor consists of an optical fiber, a quartz rod with one end coated with a thin gold layer, and two metal shells employed to transfer the strain and orient and protect the optical fiber and the quartz rod. The optical fiber endface, combining with the gold-coated surface, forms an extrinsic Fabry–Perot interferometer. The sensor was firstly calibrated, and the result showed that our prototype sensor could provide a measurement resolution of 30 nano-strain (nε and a sensitivity of 10.01 µε/µm over a range of 1000 µε. After calibration of the sensor, the shrinkage strain of a cubic brick of mortar in real time during the drying process was monitored. The strain sensor was compared with a commercial linear variable displacement transducer, and the comparison results in four weeks demonstrated that our sensor had much higher measurement resolution and gained more detailed and useful information. Due to the advantages of the extremely simple, robust and cost-effective configuration, it is believed that the sensor is significantly beneficial to practical applications, especially for structural health monitoring.

  2. Strain mapping near a triple junction in strained Ni-based alloy using EBSD and biaxial nanogauges

    Energy Technology Data Exchange (ETDEWEB)

    Clair, A. [Laboratoire Interdisciplinaire Carnot de Bourgogne, UMR 5209 CNRS, Universite de Bourgogne, 9 Avenue Alain Savary, BP 47870, 21078 Dijon Cedex (France); Foucault, M.; Calonne, O. [Areva ANP, Centre Technique Departement Corrosion-Chimie, 30 Bd de l' industrie, BP 181, 71205 Le Creusot (France); Lacroute, Y.; Markey, L.; Salazar, M.; Vignal, V. [Laboratoire Interdisciplinaire Carnot de Bourgogne, UMR 5209 CNRS, Universite de Bourgogne, 9 Avenue Alain Savary, BP 47870, 21078 Dijon Cedex (France); Finot, E., E-mail: [Laboratoire Interdisciplinaire Carnot de Bourgogne, UMR 5209 CNRS, Universite de Bourgogne, 9 Avenue Alain Savary, BP 47870, 21078 Dijon Cedex (France)


    Research highlights: > Surface strains measured using nanogauge were compared to the texture obtained by EBSD. > Statistics of the principal strain discern the grains according to the Schmid factor. > Strain hotspots were localized near a triple junction of alloy 600 under tensile loading. > Asymetrical profile of the GB strains is a criterion for surface cracking initiation. - Abstract: A key element for analyzing the crack initiation in strained polycrystalline alloys is the local quantification of the surface strain distribution according to the grain texture. Using electron backscattered diffraction, the local microstructure was determined to both localize a triple junction and deduce the local Schmid factors. Kernel average misorientation (KAM) was also used to map the areas of defect concentration. The maximum principal strain and the in-plane shear strain were quantified using the biaxial nanogauge. Distortions of the array of nanodots used as spot markers were analyzed near the triple junction. The crystallographic orientation and the surface strain were then investigated both statistically for each grain and locally at the grain boundaries. The superimposition of microstructure and strain maps allows the high strain gradient (reaching 3-fold the applied strain) to be localized at preferential grain boundaries near the triple junction. The Schmid factors and the KAM were compared to the maximum principal strain and the in-plane shear strain respectively. The polycrystalline deformation was attributable first to the rotation of some grains, followed by the elongation of all grains along their preferential activated slip systems.

  3. Graphene based strain sensor with LCP substrate (United States)

    Nie, M.; Yang, H. S.; Xia, Y. H.


    A flexible strain sensor constructed by an efficient, low-cost fabrication strategy is presented in this paper. It is assembled by adhering grid-like graphene on LCP substrate. Kinds of measurement setup have been designed to verify that the proposed flexible sensor device is suitable to be used in health monitoring system. From the experiment results, it can be proved that the sensor exhibits the following features: ultra-light, relatively good sensitivity, high reversibility, superior physical robustness, easy fabrication. With the great performance of this flexible strain sensor, it is considered to play an important role in body monitoring, structural health monitoring system, fatigue detection and healthcare systems in the near future.

  4. Electronic transport in torsional strained Weyl semimetals (United States)

    Soto-Garrido, Rodrigo; Muñoz, Enrique


    In a recent paper (Muñoz and Soto-Garrido 2017 J. Phys.: Condens. Matter 29 445302) we have studied the effects of mechanical strain and magnetic field on the electronic transport properties in graphene. In this article we extended our work to Weyl semimetals (WSM). We show that although the WSM are 3D materials, most of the analysis done for graphene (2D material) can be carried out. In particular, we studied the electronic transport through a cylindrical region submitted to torsional strain and external magnetic field. We provide exact analytical expressions for the scattering cross section and the transmitted electronic current. In addition, we show the node-polarization effect on the current and propose a recipe to measure the torsion angle from transmission experiments.

  5. Dynamic strain aging in Haynes 282 superalloy

    Directory of Open Access Journals (Sweden)

    Hörnqvist Magnus


    Full Text Available Haynes 282 is a newly introduced Ni-based superallony, developed to provide a combination of high-temperature mechanical properties, thermal stability and processability. The present contribution investigates the effect of dynamic strain aging (DSA on the deformation behaviour of Haynes 282 during monotonic and cyclic loading. It is shown that DSA (presumably related to carbon diffusion based on rough estimates of the activation energy completely dominates the development of the stress during cycling at intermediate temperatures, leading to extensive cyclic hardening and serrated yielding. However, no clear effects on the fatigue life or the resulting dislocation structure could be observed. The tensile properties were not severely affected, in spite of the presence of extensive serrated yielding, although a reduction in ductility was observed in the DSA temperature regime. During monotonic loading at lower strain rates indications of an additional DSA mechanism due to substitutional elements were observed.

  6. Transfer induced compressive strain in graphene

    DEFF Research Database (Denmark)

    Larsen, Martin Benjamin Barbour Spanget; Mackenzie, David; Caridad, Jose


    We have used spatially resolved micro Raman spectroscopy to map the full width at half maximum (FWHM) of the graphene G-band and the 2D and G peak positions, for as-grown graphene on copper catalyst layers, for transferred CVD graphene and for micromechanically exfoliated graphene, in order...... to characterize the effects of a transfer process on graphene properties. Here we use the FWHM(G) as an indicator of the doping level of graphene, and the ratio of the shifts in the 2D and G bands as an indicator of strain. We find that the transfer process introduces an isotropic, spatially uniform, compressive...... strain in graphene, and increases the carrier concentration....

  7. Gravitational waves from rotating strained neutron stars

    International Nuclear Information System (INIS)

    Jones, D I


    In this review we examine the dynamics and gravitational wave detectability of rotating strained neutron stars. The discussion is divided into two halves: triaxial stars and precessing stars. We summarize recent studies on how crustal strains and magnetic fields can sustain triaxiality, and suggest that Magnus forces connected with pinned superfluid vortices might contribute to deformation also. The conclusions that could be drawn following the successful gravitational wave detection of a triaxial star are discussed, and areas requiring further study identified. The latest ideas regarding free precession are then outlined, and the recent suggestion of Middleditch et al (Middleditch et al 2000 New Astronomy 5 243; 2000 Preprint astro-ph/0010044) that the remnant of SN1987A contains a freely precessing star, spinning down by gravitational wave energy loss, is examined critically. We describe what we would learn about neutron stars should the gravitational wave detectors prove this hypothesis to be correct

  8. SNIT: SNP identification for strain typing

    Directory of Open Access Journals (Sweden)

    Reifman Jaques


    Full Text Available Abstract With ever-increasing numbers of microbial genomes being sequenced, efficient tools are needed to perform strain-level identification of any newly sequenced genome. Here, we present the SNP identification for strain typing (SNIT pipeline, a fast and accurate software system that compares a newly sequenced bacterial genome with other genomes of the same species to identify single nucleotide polymorphisms (SNPs and small insertions/deletions (indels. Based on this information, the pipeline analyzes the polymorphic loci present in all input genomes to identify the genome that has the fewest differences with the newly sequenced genome. Similarly, for each of the other genomes, SNIT identifies the input genome with the fewest differences. Results from five bacterial species show that the SNIT pipeline identifies the correct closest neighbor with 75% to 100% accuracy. The SNIT pipeline is available for download at

  9. Strain-tunable quantum dot devices

    International Nuclear Information System (INIS)

    Rastelli, A.; Trotta, R.; Zallo, E.; Atkinson, P.; Magerl, E.; Ding, F.; Plumhof, J.D.; Kumar, S.; Doerr, K.; Schmidt, O.G.


    We introduce a new class of quantum dot-based devices, in which the semiconductor structures are integrated on top of piezoelectric actuators. This combination allows on one hand to study in detail the effects produced by variable strains (up to about 0.2%) on the excitonic emission of single quantum dots and on the other to manipulate their electronic- and optical properties to achieve specific requirements. In fact, by combining strain with electric fields we are able to obtain (i) independent control of emission energy and charge-state of a QD, (II) wavelength-tunable single-QD light-emitting diodes and (III) frequency-stabilized sources of single photons at predefined wavelengths. Possible future extensions and applications of this technology will be discussed.

  10. Strained coordinate methods in rotating stars. II

    International Nuclear Information System (INIS)

    Smith, B.L.


    It was shown in a previous paper (Smith, 1976) that the method of strained coordinates may be usefully employed in the determination of the structure of rotating polytropes. In the present work this idea is extended to Main-Sequence stars with conservative centrifugal fields. The structure variables, pressure, density and temperature are considered pure functions of an auxiliary coordinate s (the strained coordinate) and the governing equations written in a form that closely resembles the structure equations for spherical stars but with the correction factors that are functions of s. A systematic, order-by-order derivation of these factors is outlined and applied in detail to a Cowling-model star in uniform rotation. The techniques can be extended beyond first order and external boundary conditions are applied, as they should be, at the true surface of the star. Roche approximations are not needed. (Auth.)

  11. Piezoelectric effect in strained quantum wells

    International Nuclear Information System (INIS)

    Dang, L.S.; Andre, R.; Cibert, J.


    This paper describes some physical aspects of the piezoelectric effect which takes place in strained semiconductor heterostructures grown along a polar axis. First we show how piezoelectric fields can be accurately measured by optical spectroscopy. Then we discuss about the origin of the non-linear piezoelectric effect reported recently for CdTe, and maybe for InAs as well. Finally we compare excitonic effects in piezoelectric and non-piezoelectric quantum wells. (orig.)

  12. PNNL Stress/Strain Correlation for Zircaloy

    Energy Technology Data Exchange (ETDEWEB)

    Geelhood, Kenneth J.; Beyer, Carl E.; Luscher, Walter G.


    Pacific Northwest National Laboratory (PNNL) was tasked with incorporating cladding mechanical property data into the Nuclear Regulatory Commission (NRC) fuel codes, FRAPCON-31 and FRAPTRAN2, by the NRC Office of Nuclear Reactor Research. The objective of that task was to create a mechanical model that can calculate true stress, true strain, and the possible failure of the fuel rod cladding based on uniaxial test data.

  13. Strain mediated interaction of adatom dimers


    Kappus, Wolfgang


    An earlier model for substrate strain mediated interactions between monomer adatoms is extended to the interaction of monomers with dimers and the interaction of dimers. While monomers (sitting on high symmetric sites) are supposed to create isotropic stress on the substrate, dimers would create anisotropic stress caused by stretching their bond. Resulting interactions are strongly angle dependent and also reflect the elastic anisotropy of the substrate. The applicability of a continuum elast...

  14. Himalayan Strain Accumulation 100 ka Timescales (United States)

    Cannon, J. M.; Murphy, M. A.; Liu, Y.


    Crustal scale fault systems and tectonostratigraphic units in the Himalaya can be traced for 2500 km along strike. However regional studies have shown that there is variability in the location and rate of strain accumulation which appears to be driven by Main Himalayan Thrust (MHT) geometry and convergence obliquity. GPS illuminates the modern interseismic strain rate and the historical record of great earthquakes elucidates variations in strain accumulation over 103 years. To connect these patterns with the 106 year structural and thermochronometric geologic record we examine normalized river channel steepness (ksn), a proxy for rock uplift rate, which develops over 104 - 105 years. Here we present a ksn map of the Himalaya and compare it with bedrock geology, precipitation, the historic earthquake record, GPS, seismicity, and seismotectonic models. Our map shows significant along strike changes in the magnitude of channel steepness, the areal extent of swaths of high ksn channels, and their location with respect to the range front. Differences include the juxtaposition of two narrow (30 - 40 km) range parallel belts of high ksn in west Nepal and Bhutan coincident with MHT duplexes and belts of microseismcity, with a single broad (70 km) swath of high ksn and microseismicity in central and eastern Nepal. Separating west and central Nepal a band of low ksn crosses the range coincident with the West Nepal Fault (WNF) and the lowest rate of microseismicity in Nepal. To the west the orogen is obliquely convergent and has less high ksn channels, while the orthogonally convergent region to the east contains the highest concentration of oversteepened channels in the Himalaya supporting the idea that the WNF is a strain partitioning boundary. The syntaxes are characterized by locally high channel steepness surrounded by low to moderate ksn channels consistent with the hypothesis that rapid exhumation within the syntaxes is sustained by an influx of lower crust.

  15. Simulation of strain localization in polycrystals

    International Nuclear Information System (INIS)

    Deryugin, Ye.Ye.; Payuk, V.A.; Lasko, G.V.


    In the work simulation of plastic deformation evolution is presented for the case of polycrystals under external loading. Strain localization in polycrystal is simulated analytically following an unconventional method. The model is based on new progressive relaxation elements methods. Emphasis of the model is combining of discrete methods and continual approach. It makes possible to present local sites of plastic deformation analytically in a continuous medium and to calculate their respective no uniform stress field

  16. Canthaxanthin production with modified Mucor circinelloides strains. (United States)

    Papp, Tamás; Csernetics, Arpád; Nagy, Gábor; Bencsik, Ottó; Iturriaga, Enrique A; Eslava, Arturo P; Vágvölgyi, Csaba


    Canthaxanthin is a natural diketo derivative of β-carotene primarily used by the food and feed industries. Mucor circinelloides is a β-carotene-accumulating zygomycete fungus and one of the model organisms to study the carotenoid biosynthesis in fungi. In this study, the β-carotene ketolase gene (crtW) of the marine bacterium Paracoccus sp. N81106 fused with fungal promoter and terminator regions was integrated into the M. circinelloides genome to construct stable canthaxanthin-producing strains. Different transformation methods including polyethylene glycol-mediated transformation with linear DNA fragments, restriction enzyme-mediated integration and Agrobacterium tumefaciens-mediated transformation were tested to integrate the crtW gene into the Mucor genome. Mitotic stability, site of integration and copy number of the transferred genes were analysed in the transformants, and several stable strains containing the crtW gene in high copy number were isolated. Carotenoid composition of selected transformants and effect of culturing conditions, such as temperature, carbon sources and application of certain additives in the culturing media, on their carotenoid content were analysed. Canthaxanthin-producing transformants were able to survive at higher growth temperature than the untransformed strain, maybe due to the effect of canthaxanthin on the membrane fluidity and integrity. With the application of glucose, trehalose, dihydroxyacetone and L-aspartic acid as sole carbon sources in minimal medium, the crtW-expressing M. circinelloides strain, MS12+pCA8lf/1, produced more than 200 μg/g (dry mass) of canthaxanthin.

  17. Enterobacter Strains Might Promote Colon Cancer. (United States)

    Yurdakul, Dilşad; Yazgan-Karataş, Ayten; Şahin, Fikrettin


    Many studies have been performed to determine the interaction between bacterial species and cancer. However, there has been no attempts to demonstrate a possible relationship between Enterobacter spp. and colon cancer so far. Therefore, in the present study, it is aimed to investigate the effects of Enterobacter strains on colon cancer. Bacterial proteins were isolated from 11 Enterobacter spp., one Morganella morganii, and one Escherichia coli strains, and applied onto NCM460 (Incell) and CRL1790 (ATCC) cell lines. Cell viability and proliferation were determined in MTS assay. Flow Cytometry was used to detect CD24 level and apoptosis. Real-Time PCR studies were performed to determine NFKB and Bcl2 expression. Graphpad Software was used for statistical analysis. The results showed that proteins, isolated from the Enterobacter spp., have significantly increased cell viability and proliferation, while decreasing the apoptosis of the cell lines tested. The data in the present study indicated that Enterobacter strains might promote colon cancer. Moreover, Enterobacter spp. could be a clinically important factor for colon cancer initiation and progression. Studies can be extended on animal models in order to develop new strategies for treatment.

  18. Deformation twinning: Influence of strain rate

    Energy Technology Data Exchange (ETDEWEB)

    Gray, G.T. III


    Twins in most crystal structures, including advanced materials such as intermetallics, form more readily as the temperature of deformation is decreased or the rate of deformation is increased. Both parameters lead to the suppression of thermally-activated dislocation processes which can result in stresses high enough to nucleate and grow deformation twins. Under high-strain rate or shock-loading/impact conditions deformation twinning is observed to be promoted even in high stacking fault energy FCC metals and alloys, composites, and ordered intermetallics which normally do not readily deform via twinning. Under such conditions and in particular under the extreme loading rates typical of shock wave deformation the competition between slip and deformation twinning can be examined in detail. In this paper, examples of deformation twinning in the intermetallics TiAl, Ti-48Al-lV and Ni{sub 3}A as well in the cermet Al-B{sub 4}C as a function of strain rate will be presented. Discussion includes: (1) the microstructural and experimental variables influencing twin formation in these systems and twinning topics related to high-strain-rate loading, (2) the high velocity of twin formation, and (3) the influence of deformation twinning on the constitutive response of advanced materials.

  19. Ultrasound strain imaging using Barker code (United States)

    Peng, Hui; Tie, Juhong; Guo, Dequan


    Ultrasound strain imaging is showing promise as a new way of imaging soft tissue elasticity in order to help clinicians detect lesions or cancers in tissues. In this paper, Barker code is applied to strain imaging to improve its quality. Barker code as a coded excitation signal can be used to improve the echo signal-to-noise ratio (eSNR) in ultrasound imaging system. For the Baker code of length 13, the sidelobe level of the matched filter output is -22dB, which is unacceptable for ultrasound strain imaging, because high sidelobe level will cause high decorrelation noise. Instead of using the conventional matched filter, we use the Wiener filter to decode the Barker-coded echo signal to suppress the range sidelobes. We also compare the performance of Barker code and the conventional short pulse in simulation method. The simulation results demonstrate that the performance of the Wiener filter is much better than the matched filter, and Baker code achieves higher elastographic signal-to-noise ratio (SNRe) than the short pulse in low eSNR or great depth conditions due to the increased eSNR with it.

  20. Strain-based fracture assessment of pipelines

    Energy Technology Data Exchange (ETDEWEB)

    Olsoe, Erlend; Oestby, Erling; Nyhus, Baard [SINTEF, Trondheim (Norway); Skallerud, Bjoern; Holthe, Kjell [Norwegian University of Science and Technology (NTNU), Trondheim (Norway); Berg, Espen [LINKftr AS, Trondheim (Norway)


    The oil and gas industry moves into harsher regions and faces challenges with i.e. deep water, arctic conditions and seismic regions. Consequently, ensuring the integrity of pipelines becomes more challenging, and potential large deformation scenarios that can be attributed to the above mentioned areas have lead to a current strong focus on strain-based fracture assessment methods for pipelines. However, no widely established methods exist today. In this paper specific challenges related to development of such methods are discussed. Keywords are biaxial loading, crack driving force relations, ductile tearing resistance, and definition of strain capacity. The effect of the different features will be illustrated with both experimental and numerical simulation results. Experimental results presented will cover both large- and small-scale testing. A highly efficient and accurate line-spring based numerical fracture assessment method will be presented. A simplified scheme for a strain-based fracture assessment method will also be briefly outlined, and the extension of this method to also include partial safety factors is discussed. (author)

  1. Strain sensors for high field pulse magnets

    Energy Technology Data Exchange (ETDEWEB)

    Martinez, Christian [Los Alamos National Laboratory; Zheng, Yan [Los Alamos National Laboratory; Easton, Daniel [Los Alamos National Laboratory; Farinholt, Kevin M [Los Alamos National Laboratory; Park, Gyuhae [Los Alamos National Laboratory


    In this paper we present an investigation into several strain sensing technologies that are being considered to monitor mechanical deformation within the steel reinforcement shells used in high field pulsed magnets. Such systems generally operate at cryogenic temperatures to mitigate heating issues that are inherent in the coils of nondestructive, high field pulsed magnets. The objective of this preliminary study is to characterize the performance of various strain sensing technologies at liquid nitrogen temperatures (-196 C). Four sensor types are considered in this investigation: fiber Bragg gratings (FBG), resistive foil strain gauges (RFSG), piezoelectric polymers (PVDF), and piezoceramics (PZT). Three operational conditions are considered for each sensor: bond integrity, sensitivity as a function of temperature, and thermal cycling effects. Several experiments were conducted as part of this study, investigating adhesion with various substrate materials (stainless steel, aluminum, and carbon fiber), sensitivity to static (FBG and RFSG) and dynamic (RFSG, PVDF and PZT) load conditions, and sensor diagnostics using PZT sensors. This work has been conducted in collaboration with the National High Magnetic Field Laboratory (NHMFL), and the results of this study will be used to identify the set of sensing technologies that would be best suited for integration within high field pulsed magnets at the NHMFL facility.

  2. Genomic diversity of Bombyx mori nucleopolyhedrovirus strains. (United States)

    Xu, Yi-Peng; Cheng, Ruo-Lin; Xi, Yu; Zhang, Chuan-Xi


    Bombyx mori nucleopolyhedrovirus (BmNPV) is a baculovirus that selectively infects the domestic silkworm. In this study, six BmNPV strains were compared at the whole genome level. We found that the number of bro genes and the composition of the homologous regions (hrs) are the two primary areas of divergence within these genomes. When we compared the ORFs of these BmNPV variants, we noticed a high degree of sequence divergence in the ORFs that are not baculovirus core genes. This result is consistent with the results derived from phylogenetic trees and evolutionary pressure analyses of these ORFs, indicating that ORFs that are not core genes likely play important roles in the evolution of BmNPV strains. The evolutionary relationships of these BmNPV strains might be explained by their geographic origins or those of their hosts. In addition, the total number of hr palindromes seems to affect viral DNA replication in Bm5 cells. Copyright © 2013 Elsevier Inc. All rights reserved.

  3. Strain and Vibration in Mesenchymal Stem Cells

    Directory of Open Access Journals (Sweden)

    Brooke McClarren


    Full Text Available Mesenchymal stem cells (MSCs are multipotent cells capable of differentiating into any mesenchymal tissue, including bone, cartilage, muscle, and fat. MSC differentiation can be influenced by a variety of stimuli, including environmental and mechanical stimulation, scaffold physical properties, or applied loads. Numerous studies have evaluated the effects of vibration or cyclic tensile strain on MSCs towards developing a mechanically based method of differentiation, but there is no consensus between studies and each investigation uses different culture conditions, which also influence MSC fate. Here we present an overview of the response of MSCs to vibration and cyclic tension, focusing on the effect of various culture conditions and strain or vibration parameters. Our review reveals that scaffold type (e.g., natural versus synthetic; 2D versus 3D can influence cell response to vibration and strain to the same degree as loading parameters. Hence, in the efforts to use mechanical loading as a reliable method to differentiate cells, scaffold selection is as important as method of loading.

  4. Strain measurements during pressurized thermal shock experiment

    International Nuclear Information System (INIS)

    Tarso Vida Gomes, P. de; Julio Ricardo Barreto Cruz; Tanius Rodrigues Mansur; Denis Henrique Bianchi Scaldaferri; Miguel Mattar Neto


    For the life extension of nuclear power plants, the residual life of most of their components must be evaluated along all their operating time. Concerning the reactor pressure vessel, the pressurized thermal shock (PTS) is a very important event to be considered. For better understanding the effects of this kind of event, tests are made. The approach described here consisted of building a simplified in-scale physical model of the reactor pressure vessel, submitting it to the actual operating temperature and pressure conditions and provoking a thermal shock by means of cold water flow in its external surface. To conduct such test, the Nuclear Technology Development Center (CDTN) has been conducting several studies related to PTS and has also built a laboratory that has made possible the simulation of the PTS loading conditions. Several cracks were produced in the external surface of the reactor pressure vessel model. Strain gages were fixed by means of electrical discharge welding over the cracks regions in both external and internal surfaces. The temperature was monitored in 10 points across the vessel wall. The internal pressure was manually controlled and monitored using a pressure transducer. Two PTS experiments were conducted and this paper presents the strain measurement procedures applied to the reactor pressure vessel model, during the PTS, using strain gages experimental methodology. (authors)

  5. Shewanella strain isolated from black powder

    Energy Technology Data Exchange (ETDEWEB)

    Lutterbach, Marcia T.S.; Contador, Luciana S.; Oliveira, Ana Lucia C.; Galvao, Mariana M. [National Institute of Technology (INT), Rio de Janeiro, RJ (Brazil); Pimenta, Gutemberg S. [PETROBRAS, Rio de Janeiro, RJ (Brazil)


    Black powder is a term frequently used to refer to residues formed by various types of iron sulfides mixed with contaminants eventually present in the natural gas flow. According to some researchers, the occurrence of black powder in gas pipelines, besides its chemical corrosion origin, can be directly related to the sulfate-reducing bacteria (SRB) metabolism in this environment. A black powder sample was inoculated in a Post gate E medium modified with the addition of thioglycolate. The resulting positive culture was kept in the laboratory for four years until its use. A dilution technique was then performed aiming to isolate an SRB strain. The bacterial strain isolated and identified through DNA sequencing was not an SRB but rather a Shewanella sp. Compared to the sulfate-reducing bacteria group-traditionally considered the foremost responsible for microbially-influenced corrosion (MIC) - Shewanella is a facultative anaerobe and has a versatile metabolism. Shewanella is able to reduce ferric iron and sulfite, oxidize hydrogen gas, and produce hydrogen sulfide; therefore, these bacteria can be responsible for MIC and pit formation. The isolated Shewanella was used in a corrosion experiment, and the corrosion products were characterized by X-ray diffraction, identifying iron sulfides, iron oxides, and sulfur. Our results indicate that the strain isolated, S. putrefaciens, plays a key role in corrosion problems in gas pipelines. (author)

  6. Integrated strain array for cellular mechanobiology studies

    International Nuclear Information System (INIS)

    Simmons, C S; Sim, J Y; Baechtold, P; Chung, C; Borghi, N; Pruitt, B L; Gonzalez, A


    We have developed an integrated strain array for cell culture enabling high-throughput mechano-transduction studies. Biocompatible cell culture chambers were integrated with an acrylic pneumatic compartment and microprocessor-based control system. Each element of the array consists of a deformable membrane supported by a cylindrical pillar within a well. For user-prescribed waveforms, the annular region of the deformable membrane is pulled into the well around the pillar under vacuum, causing the pillar-supported region with cultured cells to be stretched biaxially. The optically clear device and pillar-based mechanism of operation enables imaging on standard laboratory microscopes. Straightforward fabrication utilizes off-the-shelf components, soft lithography techniques in polydimethylsiloxane and laser ablation of acrylic sheets. Proof of compatibility with basic biological assays and standard imaging equipment were accomplished by straining C2C12 skeletal myoblasts on the device for 6 h. At higher strains, cells and actin stress fibers realign with a circumferential preference

  7. Investigation of stress–strain models for confined high strength ...

    Indian Academy of Sciences (India)

    High strength concrete; confined concrete; stress–strain models; ... One of its advantages is the lessening column cross-sectional areas. It was ..... Ahmad S H, Shah S P 1982 Stress–strain curves of concrete confined by spiral reinforcement.

  8. Analysis of stress-strain relationships in silicon ribbon (United States)

    Dillon, O. W., Jr.


    An analysis of stress-strain relationships in silicon ribbon is presented. A model to present entire process, dynamical Transit Analysis is developed. It is found that knowledge of past-strain history is significant in modeling activities.

  9. Strain path and work-hardening behavior of brass

    International Nuclear Information System (INIS)

    Sakharova, N.A.; Fernandes, J.V.; Vieira, M.F.


    Plastic straining in metal forming usually includes changes of strain path, which are frequently not taken into account in the analysis of forming processes. Moreover, strain path change can significantly affect the mechanical behavior and microstructural evolution of the material. For this reason, a combination of several simple loading test sequences is an effective way to investigate the dislocation microstructure of sheet metals under such forming conditions. Pure tension and rolling strain paths and rolling-tension strain path sequences were performed on brass sheets. A study of mechanical behavior and microstructural evolution during the simple and the complex strain paths was carried out, within a wide range of strain values. The appearance and development of deformation twinning was evident. It was shown that strain path change promotes the onset of premature twinning. The work-hardening behavior is discussed in terms of the twinning and dislocation microstructure evolution, as revealed by transmission electron microscopy

  10. Long term strain behavior of PMMA based polymer optical fibers

    DEFF Research Database (Denmark)

    Bundalo, Ivan-Lazar; Nielsen, Kristian; Woyessa, Getinet


    We are reporting on the viscoelasticity of PMMA based Fiber Bragg Grating (FBG) strain sensors when exposed to repeated sequences of long term strain and relaxation with various duty-cycles. In terms of the FBG wavelength and how it follows the strain cycle, we have shown that in the small strain...... regime (up to 1%) an elastic-dominated fast relaxing range, which is followed by a mainly viscous relaxation, depends both on the strain level and on the strain duration. For a small ratio of the strain-relax durations, this fast relaxation range stays almost the same. However, with increasing strain...... duration, for the same relaxation time, this range will be shortened, which might influence the sensing capabilities of the fiber sensor....

  11. Fumonisin and Ochratoxin Production in Industrial Aspergillus niger Strains

    DEFF Research Database (Denmark)

    Frisvad, Jens Christian; Larsen, Thomas Ostenfeld; Thrane, Ulf


    as safe). However, A. niger has the potential to produce two groups of potentially carcinogenic mycotoxins: fumonisins and ochratoxins. In this study all available industrial and many non-industrial strains of A. niger (180 strains) as well as 228 strains from 17 related black Aspergillus species were...... examined for mycotoxin production. None of the related 17 species of black Aspergilli produced fumonisins. Fumonisins (B(2), B(4), and B(6)) were detected in 81% of A. niger, and ochratoxin A in 17%, while 10% of the strains produced both mycotoxins. Among the industrial strains the same ratios were 83......%, 33% and 26% respectively. Some of the most frequently used strains in industry NRRL 337, 3112 and 3122 produced both toxins and several strains used for citric acid production were among the best producers of fumonisins in pure agar culture. Most strains used for other biotechnological processes also...

  12. Influence of strain on dislocation core in silicon (United States)

    Pizzagalli, L.; Godet, J.; Brochard, S.


    First principles, density functional-based tight binding and semi-empirical interatomic potentials calculations are performed to analyse the influence of large strains on the structure and stability of a 60? dislocation in silicon. Such strains typically arise during the mechanical testing of nanostructures like nanopillars or nanoparticles. We focus on bi-axial strains in the plane normal to the dislocation line. Our calculations surprisingly reveal that the dislocation core structure largely depends on the applied strain, for strain levels of about 5%. In the particular case of bi-axial compression, the transformation of the dislocation to a locally disordered configuration occurs for similar strain magnitudes. The formation of an opening, however, requires larger strains, of about 7.5%. Furthermore, our results suggest that electronic structure methods should be favoured to model dislocation cores in case of large strains whenever possible.

  13. Influence of plastic strain on deformation-induced martensitic transformations

    NARCIS (Netherlands)

    Perdahcioglu, Emin Semih; Geijselaers, Hubertus J.M.; Groen, M.


    The effects of plastic strain on deformation-induced martensitic transformations have been investigated experimentally. Austenitic metastable stainless steel samples were heated to a temperature at which the transformation is suppressed and were plastically strained to different amounts. The

  14. Ultrasensitive, Stretchable Strain Sensors Based on Fragmented Carbon Nanotube Papers

    KAUST Repository

    Zhou, Jian; Yu, Hu; Xu, Xuezhu; Han, Fei; Lubineau, Gilles


    The development of strain sensors featuring both ultra high sensitivity and high stretchability is still a challenge. We demonstrate that strain sensors based on fragmented single-walled carbon nanotube (SWCNT) paper embedded in poly

  15. New rifamycins produced by a recombinant strain of Nocardia mediterranei. (United States)

    Schupp, T; Traxler, P; Auden, J A


    A recombinant strain of Nocardia mediterranei was found to produce a number of new rifamycins which are structurally related to rifamycin S, rifamycin W and rifamycin G. This strain was derived from two Nocardia mediterranei mutants by intraspecific recombination.

  16. Genome sequence of herpes simplex virus 1 strain KOS. (United States)

    Macdonald, Stuart J; Mostafa, Heba H; Morrison, Lynda A; Davido, David J


    Herpes simplex virus type 1 (HSV-1) strain KOS has been extensively used in many studies to examine HSV-1 replication, gene expression, and pathogenesis. Notably, strain KOS is known to be less pathogenic than the first sequenced genome of HSV-1, strain 17. To understand the genotypic differences between KOS and other phenotypically distinct strains of HSV-1, we sequenced the viral genome of strain KOS. When comparing strain KOS to strain 17, there are at least 1,024 small nucleotide polymorphisms (SNPs) and 172 insertions/deletions (indels). The polymorphisms observed in the KOS genome will likely provide insights into the genes, their protein products, and the cis elements that regulate the biology of this HSV-1 strain.

  17. Feather wastes digestion by new isolated strains Bacillus sp. in ...

    African Journals Online (AJOL)

    Feather wastes digestion by new isolated strains Bacillus sp. in Morocco. ... The most efficient isolated strain selected was compared with Bacillus subtilis ATCC 6633. Results showed ... African Journal of Biotechnology Vol.3(1) 2004: 67-70 ...

  18. Fluorene biodegradation potentials of Bacillus strains isolated from ...

    African Journals Online (AJOL)

    Fluorene biodegradation potentials of Bacillus strains isolated from tropical ... Bacillus strains, putatively identified as Bacillus subtilis BM1 and Bacillus amyloliquefaciens BR1 were ... African Journal of Biotechnology, Vol 13(14), 1554-1559 ...

  19. Fatigue and rutting strain analysis of flexible pavements designed ...

    African Journals Online (AJOL)


    The study was carried out with the layered elastic analysis software EVERSTRESS. Key words: Layered elastic analysis, fatigue, rutting, strains, design, flexible pavement, CBR. ..... Numerical Computational Stresses and Strains in Multi-Layer ...

  20. Introducing lattice strain to graphene encapsulated in hBN (United States)

    Tomori, Hikari; Hiraide, Rineka; Ootuka, Youiti; Watanabe, Kenji; Taniguchi, Takashi; Kanda, Akinobu

    Due to the characteristic lattice structure, lattice strain in graphene produces an effective gauge field. Theories tell that by controlling spatial variation of lattice strain, one can tailor the electronic state and transport properties of graphene. For example, under uniaxial local strain, graphene exhibits a transport gap at low energies, which is attractive for a graphene application to field effect devices. Here, we develop a method for encapsulating a strained graphene film in hexagonal boron-nitride (hBN). It is known that the graphene carrier mobility is significantly improved by the encapsulation of graphene in hBN, which has never been applied to strained graphene. We encapsulate graphene in hBN using the van der Waals assembly method. Strain is induced by sandwiching a graphene film between patterned hBN sheets. Spatial variation of strain is confirmed with micro Raman spectroscopy. Transport measurement of encapsulated strained graphene is in progress.

  1. Strain screen and haplotype association mapping of wheel running in inbred mouse strains. (United States)

    Lightfoot, J Timothy; Leamy, Larry; Pomp, Daniel; Turner, Michael J; Fodor, Anthony A; Knab, Amy; Bowen, Robert S; Ferguson, David; Moore-Harrison, Trudy; Hamilton, Alicia


    Previous genetic association studies of physical activity, in both animal and human models, have been limited in number of subjects and genetically homozygous strains used as well as number of genomic markers available for analysis. Expansion of the available mouse physical activity strain screens and the recently published dense single-nucleotide polymorphism (SNP) map of the mouse genome (approximately 8.3 million SNPs) and associated statistical methods allowed us to construct a more generalizable map of the quantitative trait loci (QTL) associated with physical activity. Specifically, we measured wheel running activity in male and female mice (average age 9 wk) in 41 inbred strains and used activity data from 38 of these strains in a haplotype association mapping analysis to determine QTL associated with activity. As seen previously, there was a large range of activity patterns among the strains, with the highest and lowest strains differing significantly in daily distance run (27.4-fold), duration of activity (23.6-fold), and speed (2.9-fold). On a daily basis, female mice ran further (24%), longer (13%), and faster (11%). Twelve QTL were identified, with three (on Chr. 12, 18, and 19) in both male and female mice, five specific to males, and four specific to females. Eight of the 12 QTL, including the 3 general QTL found for both sexes, fell into intergenic areas. The results of this study further support the findings of a moderate to high heritability of physical activity and add general genomic areas applicable to a large number of mouse strains that can be further mined for candidate genes associated with regulation of physical activity. Additionally, results suggest that potential genetic mechanisms arising from traditional noncoding regions of the genome may be involved in regulation of physical activity.

  2. Strain-induced changes to the electronic structure of germanium

    KAUST Repository

    Tahini, H. A.


    Density functional theory calculations (DFT) are used to investigate the strain-induced changes to the electronic structure of biaxially strained (parallel to the (001), (110) and (111) planes) and uniaxially strained (along the [001], [110] and [111] directions) germanium (Ge). It is calculated that a moderate uniaxial strain parallel to the [111] direction can efficiently transform Ge to a direct bandgap material with a bandgap energy useful for technological applications. © 2012 IOP Publishing Ltd.

  3. Strain-induced changes to the electronic structure of germanium

    KAUST Repository

    Tahini, H. A.; Chroneos, Alexander I.; Grimes, Robin W.; Schwingenschlö gl, Udo; Dimoulas, Athanasios Dimoulas


    Density functional theory calculations (DFT) are used to investigate the strain-induced changes to the electronic structure of biaxially strained (parallel to the (001), (110) and (111) planes) and uniaxially strained (along the [001], [110] and [111] directions) germanium (Ge). It is calculated that a moderate uniaxial strain parallel to the [111] direction can efficiently transform Ge to a direct bandgap material with a bandgap energy useful for technological applications. © 2012 IOP Publishing Ltd.

  4. Draft genome sequence of Agrobacterium rhizogenes strain NCPPB2659 (United States)

    This work reports the draft genome of Agrobacterium rhizogenes strain NCPPB2659 (also known as strain K599). The assembled genome contains 5,277,347 bp, and is composed of 1 circular chromosome, the Ri virulence plasmid, and 17 scaffolds pertaining to the linear chromosome. The wild type strain cau...

  5. Genetic variations among Mycoplasma bovis strains isolated from Danish cattle

    DEFF Research Database (Denmark)

    Kusiluka, L.J.M.; Kokotovic, Branko; Ojeniyi, B.


    The genetic heterogeneity of Mycoplasma bovis strains isolated in Denmark over a 17-year period was investigated. Forty-two field strains isolated from different geographic locations and specimens, including strains from 21 herds involved in two outbreaks of M. bovis-induced mastitis, and the type...

  6. Discrimination of citrus tristeza virus (CTV) strains using Mexican ...

    African Journals Online (AJOL)

    Two strains of citrus tristeza virus (CTV) were studied for six years in Yaounde in the forest zone of Cameroon. These strains, SNCL2 and SNCL4, were characterized on Lisbon lemon in Nyombe in the littoral zone of Cameroon. They were inoculated onto combinations of Mexican lime/citrange Troyer. The virulent strain ...

  7. Isolation and characterization of a new Pseudomonas-related strain ...

    African Journals Online (AJOL)

    % with Pseudomonas putida ()AB680847). The phylogenetic tree formed by 16S rDNA sequences from both strain SKDP-1 and its most related bacteria also proved strain SKDP-1 to be one member of the genus Pseudomonas. Strain SKDP-1 ...

  8. Analysis of bacterial strains from contaminated and non ...

    African Journals Online (AJOL)



    May 2, 2007 ... A total 18 strains were collected from non-contaminated and contaminated environments, and were purified. All purified strains were characterized for Gram reaction and biochemical analysis. Screening for bioplastic production was done by Sudan black staining. Strains isolated from non-contaminated.

  9. Corrosion induced strain monitoring through fibre optic sensors

    International Nuclear Information System (INIS)

    Grattan, S K T; Basheer, P A M; Taylor, S E; Zhao, W; Sun, T; Grattan, K T V


    The use of strain sensors is commonplace within civil engineering. Fibre optic strain sensors offer a number of advantages over the current electrical resistance type gauges. In this paper the use of fibre optic strain sensors and electrical resistance gauges to monitor the production of corrosion by-products has been investigated and reported

  10. Performance of rats orogastrically dosed with faecal strains of ...

    African Journals Online (AJOL)


    strains of Lactobacillus acidophilus and challenged ... Albino rats (Rattus norvegicus) were orogastrically dosed with faecal strains of Lactobacillus .... Chang et al. (2001) reported a similar observation in piglets fed probiotic strain, Lactobacillus reuteri BSA 131. Francisco et al. (1995) had earlier reported that selected ...

  11. Towards development of nanofibrous large strain flexible strain sensors with programmable shape memory properties (United States)

    Khalili, N.; Asif, H.; Naguib, H. E.


    Electrospun polymeric fibers can be used as strain sensors due to their large surface to weight/volume ratio, high porosity and pore interconnectivity. Large strain flexible strain sensors are used in numerous applications including rehabilitation, health monitoring, and sports performance monitoring where large strain detection should be accommodated by the sensor. This has boosted the demand for a stretchable, flexible and highly sensitive sensor able to detect a wide range of mechanically induced deformations. Herein, a physically cross-linked polylactic acid (PLA) and thermoplastic polyurethane (TPU) blend is made into nanofiber networks via electrospinning. The PLA/TPU weight ratio is optimized to obtain a maximum attainable strain of 100% while maintaining its mechanical integrity. The TPU/PLA fibers also allowed for their thermally activated recovery due to shape memory properties of the substrate. This novel feature enhances the sensor’s performance as it is no longer limited by its plastic deformation. Using spray coating method, a homogeneous layer of single-walled carbon nanotube is deposited onto the as-spun fiber mat to induce electrical conductivity to the surface of the fibers. It is shown that stretching and bending the sensor result in a highly sensitive and linear response with a maximum gauge factor of 33.

  12. Mumps Hoshino and Torii vaccine strains were distinguished from circulating wild strains. (United States)

    Sawada, Akihito; Yamaji, Yoshiaki; Nakayama, Tetsuo


    Aseptic meningitis and acute parotitis have been observed after mumps vaccination. Mumps outbreaks have been reported in Japan because of low vaccine coverage, and molecular differentiation is required to determine whether these cases are vaccine associated. RT-nested PCR was performed in the small hydrophobic gene region, and viruses were differentiated by restriction fragment length polymorphism assay. A total of 584 nucleotides were amplified. The PCR product of the Hoshino strain was cut into two fragments (313 and 271 nucleotides) by MfeI; that of the Torii strain was digested with EcoT22I, resulting in 332- and 252-nucleotide fragments. Both strains were genotype B and had an XbaI site, resulting in two fragments: 299 and 285 nucleotides. Current circulating wild types were cut only by XbaI or MfeI. However, the MfeI site of the wild types was different from that of the Hoshino strain, resulting in 451- and 133-nucleotide fragments. Using three restriction enzymes, two mumps vaccine strains were distinguished from wild types, and this separation was applied to the identification of vaccine-related adverse events.

  13. Relating high-temperature flow stress of AISI 316 stainless steel to strain and strain rate

    International Nuclear Information System (INIS)

    Matteazzi, S.; Paitti, G.; Boerman, D.


    The authors have performed an experimental determination of tensile stress-strain curves for different strain rates (4.67 x 10 - 5 , 4.67 x 10 - 2 s - 1 ) and for a variety of temperature conditions (773-1073 K) of AISI 316H stainless steel (annealed conditions) and also a computer analysis of the experimental curves using a fitting program which takes into consideration different constitutive relations describing the plastic flow behaviour of the metals. The results show that the materials tested are clearly affected by strain rate only at the highest temperature investigated (1073 K) and that the plastic strain is the more significant variable. Of the constitutive equations considered, Voce's relation gives the best fit for the true stress-time-strain curves. However, the Ludwik and Ludwigson equations also provide a description of the experimental data, whereas Hollomon's equation does not suitably characterize AISI 316H stainless steel and can be applied with some accuracy only at 1073 K. (author)

  14. Early detection of left ventricular dysfunction in asymptomatic diabetic patient using strain and strain rate echocardiographic imaging

    Directory of Open Access Journals (Sweden)

    Rania Gaber


    Conclusion: Type 2 diabetes mellitus deteriorate both LV systolic and diastolic performance. Strain and strain rate by tissue Doppler Imaging is superior to conventional Doppler in early detection and evaluation of systolic and diastolic dysfunction in type 2 diabetic patients.

  15. Clostridium difficile outbreak caused by NAP1/BI/027 strain and non-027 strains in a Mexican hospital

    Directory of Open Access Journals (Sweden)

    Rayo Morfin-Otero


    Conclusions: C. difficile NAP1/BI/027 strain and non-027 strains are established pathogens in our hospital. Accordingly, surveillance of C. difficile infections is now part of our nosocomial prevention program.

  16. Revealing differences in metabolic flux distributions between a mutant strain and its parent strain Gluconacetobacter xylinus CGMCC 2955.

    Directory of Open Access Journals (Sweden)

    Cheng Zhong

    Full Text Available A better understanding of metabolic fluxes is important for manipulating microbial metabolism toward desired end products, or away from undesirable by-products. A mutant strain, Gluconacetobacter xylinus AX2-16, was obtained by combined chemical mutation of the parent strain (G. xylinus CGMCC 2955 using DEC (diethyl sulfate and LiCl. The highest bacterial cellulose production for this mutant was obtained at about 11.75 g/L, which was an increase of 62% compared with that by the parent strain. In contrast, gluconic acid (the main byproduct concentration was only 5.71 g/L for mutant strain, which was 55.7% lower than that of parent strain. Metabolic flux analysis indicated that 40.1% of the carbon source was transformed to bacterial cellulose in mutant strain, compared with 24.2% for parent strain. Only 32.7% and 4.0% of the carbon source were converted into gluconic acid and acetic acid in mutant strain, compared with 58.5% and 9.5% of that in parent strain. In addition, a higher flux of tricarboxylic acid (TCA cycle was obtained in mutant strain (57.0% compared with parent strain (17.0%. It was also indicated from the flux analysis that more ATP was produced in mutant strain from pentose phosphate pathway (PPP and TCA cycle. The enzymatic activity of succinate dehydrogenase (SDH, which is one of the key enzymes in TCA cycle, was 1.65-fold higher in mutant strain than that in parent strain at the end of culture. It was further validated by the measurement of ATPase that 3.53-6.41 fold higher enzymatic activity was obtained from mutant strain compared with parent strain.

  17. Complete Genomic Sequences of H3N8 Equine Influenza Virus Strains Used as Vaccine Strains in Japan. (United States)

    Nemoto, Manabu; Yamanaka, Takashi; Bannai, Hiroshi; Tsujimura, Koji; Kokado, Hiroshi


    We sequenced the eight segments of influenza A virus strains A/equine/Ibaraki/1/2007 and A/equine/Yokohama/aq13/2010, which are strains of the Florida sublineage clades 1 and 2 of the H3N8 subtype equine influenza virus. These strains have been used as vaccine strains in Japan since 2016 in accordance with World Organization for Animal Health (OIE) recommendations. Copyright © 2018 Nemoto et al.

  18. Kinases of two strains of Mycoplasma hyopneumoniae and a strain of Mycoplasma synoviae: an overview

    Directory of Open Access Journals (Sweden)

    Alexandre Melo Bailão


    Full Text Available Mycoplasma synoviae and Mycoplasma hyopneumoniae are wall-less eubacteria belonging to the class of Mollicutes. These prokaryotes have a reduced genome size and reduced biosynthetic machinery. They cause great losses in animal production. M. synoviae is responsible for an upper respiratory tract disease of chickens and turkeys. M. hyopneumoniae is the causative agent of enzootic pneumonia in pigs. The complete genomes of these organisms showed 17 ORFs encoding kinases in M. synoviae and 15 in each of the M. hyopneumoniae strain. Four kinase genes were restricted to the avian pathogen while three were specific to the pig pathogen when compared to each other. All deduced kinases found in the non pathogenic strain (J[ATCC25934] were also found in the pathogenic M. hyopneumoniae strain. The enzymes were classified in nine families composing five fold groups.

  19. Differentiation of five strains of infectious bursal disease virus: Development of a strain-specific multiplex PCR

    DEFF Research Database (Denmark)

    Kusk, M.; Kabell, Susanne; Jørgensen, Poul Henrik


    and histopathology. Since these methods are laborious and have low specificity alternatives are needed. In the present study, we report the development of a strain-specific multiplex RT-PCR technique, which can detect and differentiate between field strains of IBDV and vaccine virus strains including a so-called hot...

  20. Different distribution patterns of ten virulence genes in Legionella reference strains and strains isolated from environmental water and patients. (United States)

    Zhan, Xiao-Yong; Hu, Chao-Hui; Zhu, Qing-Yi


    Virulence genes are distinct regions of DNA which are present in the genome of pathogenic bacteria and absent in nonpathogenic strains of the same or related species. Virulence genes are frequently associated with bacterial pathogenicity in genus Legionella. In the present study, an assay was performed to detect ten virulence genes, including iraA, iraB, lvrA, lvrB, lvhD, cpxR, cpxA, dotA, icmC and icmD in different pathogenicity islands of 47 Legionella reference strains, 235 environmental strains isolated from water, and 4 clinical strains isolated from the lung tissue of pneumonia patients. The distribution frequencies of these genes in reference or/and environmental L. pneumophila strains were much higher than those in reference non-L. pneumophila or/and environmental non-L. pneumophila strains, respectively. L. pneumophila clinical strains also maintained higher frequencies of these genes compared to four other types of Legionella strains. Distribution frequencies of these genes in reference L. pneumophila strains were similar to those in environmental L. pneumophila strains. In contrast, environmental non-L. pneumophila maintained higher frequencies of these genes compared to those found in reference non-L. pneumophila strains. This study illustrates the association of virulence genes with Legionella pathogenicity and reveals the possible virulence evolution of non-L. pneumophia strains isolated from environmental water.

  1. Repeated Strains, Social Control, Social Learning, and Delinquency: Testing an Integrated Model of General Strain Theory in China (United States)

    Bao, Wan-Ning; Haas, Ain; Chen, Xiaojin; Pi, Yijun


    In Agnew's general strain theory, repeated strains can generate crime and delinquency by reducing social control and fostering social learning of crime. Using a sample of 615 middle-and high-school students in China, this study examines how social control and social learning variables mediate the effect of repeated strains in school and at home on…

  2. Strain and strain rate by two-dimensional speckle tracking echocardiography in a maned wolf

    Directory of Open Access Journals (Sweden)

    Matheus M. Mantovani


    Full Text Available The measurement of cardiovascular features of wild animals is important, as is the measurement in pets, for the assessment of myocardial function and the early detection of cardiac abnormalities, which could progress to heart failure. Speckle tracking echocardiography (2D STE is a new tool that has been used in veterinary medicine, which demonstrates several advantages, such as angle independence and the possibility to provide the early diagnosis of myocardial alterations. The aim of this study was to evaluate the left myocardial function in a maned wolf by 2D STE. Thus, the longitudinal, circumferential and radial strain and strain rate were obtained, as well as, the radial and longitudinal velocity and displacement values, from the right parasternal long axis four-chamber view, the left parasternal apical four chamber view and the parasternal short axis at the level of the papillary muscles. The results of the longitudinal variables were -13.52±7.88, -1.60±1.05, 4.34±2.52 and 3.86±3.04 for strain (%, strain rate (1/s, displacement (mm and velocity (cm/s, respectively. In addition, the radial and circumferential Strain and Strain rate were 24.39±14.23, 1.86±0.95 and -13.69±6.53, -1.01±0.48, respectively. Thus, the present study provides the first data regarding the use of this tool in maned wolves, allowing a more complete quantification of myocardial function in this species.

  3. Hydrogen production by recombinant Escherichia coli strains (United States)

    Maeda, Toshinari; Sanchez‐Torres, Viviana; Wood, Thomas K.


    Summary The production of hydrogen via microbial biotechnology is an active field of research. Given its ease of manipulation, the best‐studied bacterium Escherichia coli has become a workhorse for enhanced hydrogen production through metabolic engineering, heterologous gene expression, adaptive evolution, and protein engineering. Herein, the utility of E. coli strains to produce hydrogen, via native hydrogenases or heterologous ones, is reviewed. In addition, potential strategies for increasing hydrogen production are outlined and whole‐cell systems and cell‐free systems are compared. PMID:21895995

  4. Capacitance high temperature strain transducer by Interatom

    International Nuclear Information System (INIS)

    Fortmann, M.


    Special strain transducers are necessary to perform structure mechanical experiments on real components under creep-fatigue load. The new development of the transducer was able to solve the problem. In the meantime, different characteristics of the transducer have been examined and many successful applications have been effected. Some important aspects are given in this report. Up to now the longest operation period has been 24000 h on a pipe at 630 0 C service temperature in a conventional power station. (orig./DG) [de

  5. Strain rate effects of AM60

    International Nuclear Information System (INIS)

    Rehkopf, J.D.; Krause, A.R.


    Magnesium is seeing increasing use in the automotive industry due to its high strength-to-weight ratio and its ability to be cast to tight dimensional tolerances. Presently, main applications include interior components such as instrument panels, steering wheels and seat frames. Consequently, there is a strong need for understanding the rate effect on the behaviour of magnesium under impact type loading. In this work the effect of strain rate on AM60 tensile behaviour was investigated through both high and cold temperature testing, at ranges relevant to the automotive environment. Microstructural analysis, presented in this paper, includes porosity, grain size and fracture surface analyses. (author)

  6. Strain of laser annealed silicon surfaces (United States)

    Nemanich, R. J.; Haneman, D.


    High resolution Raman scattering measurements have been carried out on pulse and continuous-wave laser annealed silicon samples with various surface preparations. These included polished and ion-bombarded wafers, and saw-cut crystals. The pulse annealing treatments were carried out in ultrahigh vacuum and in air. The residual strain was inferred from the frequency shift of the first-order Raman active mode of Si, and was detectable in the range 10-2-10-3 in all except the polished samples.

  7. Strain measurements in a rotary engine housing (United States)

    Lee, C. M.; Bond, T. H.; Addy, H. E.; Chun, K. S.; Lu, C. Y.


    The development of structural design tools for Rotary Combustion Engines (RCE) using Finite Element Modeling (FEM) requires knowledge about the response of engine materials to various service conditions. This paper describes experimental work that studied housing deformation as a result of thermal, pressure and mechanical loads. The measurement of thermal loads, clamping pressure, and deformation was accomplished by use of high-temperature strain gauges, thermocouples, and a high speed data acquisition system. FEM models for heat transfer stress analysis of the rotor housing will be verified and refined based on these experimental results.

  8. Application of a fiber optic grating strain sensor for the measurement of strain under irradiation environment

    International Nuclear Information System (INIS)

    Kaji, Yoshiyuki; Matsui, Yoshinori; Kita, Satoshi; Ide, Hiroshi; Tsukada, Takashi; Tsuji, Hirokazu


    In the Japan Atomic Energy Research Institute (JAERI), in-pile strain measurement techniques have been developed using the Japan Materials Testing Reactor (JMTR). In order to evaluate the performance of fiber optic grating sensors under irradiation environment, heat-up and performance tests at elevated temperatures before irradiation and in-pile tests were performed in JMTR. It was determined that it is possible to measure strain under irradiation environment below 1x10 23 n m -2 (E>1 MeV) by a fiber optic grating sensor, because in-pile temperature characteristics were in good agreement with out-of-pile test results

  9. Investigation of strain heterogeneities by laser scanning extensometry in strain ageing materials: application to zirconium alloys

    Energy Technology Data Exchange (ETDEWEB)

    Graff, S.; Forest, S.; Strudel, J.L. [Centre des Materiaux / UMR 7633, Ecole des Mines de Paris / CNRS, BP 87, 91003 Evry (France); Dierke, H.; Neuhauser, H. [Institut fur Physik der Kondensierten Materie, 38106 Braunschweig (Germany); Prioul, C. [MSSMAT, Ecole Centrale Paris, Grande Voie des Vignes, 92295 Chatenay-Malabry (France); Bechade, J.L. [SRMA, CEA Saclay, 91191 Gif sur Yvette (France)


    Laser scanning extensometry was used to detect and characterize propagating plastic instabilities such as the Luders bands at the millimeter scale. Spatio-temporal plastic heterogeneities are due to either static or dynamic strain ageing (SSA and DSA) phenomena. Regarding zirconium alloys, different type of heterogeneities were observed: their features strongly depended on mechanical test conditions. In one case, they appeared to be non propagating but preserved along the stress-strain curve and were associated with SSA effects such as stress peaks after relaxation periods or after unloading steps with waiting times. In other case, they appeared as non propagating but were not associated with SSA effects. (authors)

  10. Investigation of strain heterogeneities by laser scanning extensometry in strain ageing materials: application to zirconium alloys

    International Nuclear Information System (INIS)

    Graff, S.; Forest, S.; Strudel, J.L.; Dierke, H.; Neuhauser, H.; Prioul, C.; Bechade, J.L.


    Laser scanning extensometry was used to detect and characterize propagating plastic instabilities such as the Luders bands at the millimeter scale. Spatio-temporal plastic heterogeneities are due to either static or dynamic strain ageing (SSA and DSA) phenomena. Regarding zirconium alloys, different type of heterogeneities were observed: their features strongly depended on mechanical test conditions. In one case, they appeared to be non propagating but preserved along the stress-strain curve and were associated with SSA effects such as stress peaks after relaxation periods or after unloading steps with waiting times. In other case, they appeared as non propagating but were not associated with SSA effects. (authors)

  11. Sensitivity Enhancement of FBG-Based Strain Sensor. (United States)

    Li, Ruiya; Chen, Yiyang; Tan, Yuegang; Zhou, Zude; Li, Tianliang; Mao, Jian


    A novel fiber Bragg grating (FBG)-based strain sensor with a high-sensitivity is presented in this paper. The proposed FBG-based strain sensor enhances sensitivity by pasting the FBG on a substrate with a lever structure. This typical mechanical configuration mechanically amplifies the strain of the FBG to enhance overall sensitivity. As this mechanical configuration has a high stiffness, the proposed sensor can achieve a high resonant frequency and a wide dynamic working range. The sensing principle is presented, and the corresponding theoretical model is derived and validated. Experimental results demonstrate that the developed FBG-based strain sensor achieves an enhanced strain sensitivity of 6.2 pm/με, which is consistent with the theoretical analysis result. The strain sensitivity of the developed sensor is 5.2 times of the strain sensitivity of a bare fiber Bragg grating strain sensor. The dynamic characteristics of this sensor are investigated through the finite element method (FEM) and experimental tests. The developed sensor exhibits an excellent strain-sensitivity-enhancing property in a wide frequency range. The proposed high-sensitivity FBG-based strain sensor can be used for small-amplitude micro-strain measurement in harsh industrial environments.

  12. Strain characterization of FinFETs using Raman spectroscopy

    International Nuclear Information System (INIS)

    Kaleli, B.; Hemert, T. van; Hueting, R.J.E.; Wolters, R.A.M.


    Metal induced strain in the channel region of silicon (Si) fin-field effect transistor (FinFET) devices has been characterized using Raman spectroscopy. The strain originates from the difference in thermal expansion coefficient of Si and titanium-nitride. The Raman map of the device region is used to determine strain in the channel after preparing the device with the focused ion beam milling. Using the Raman peak shift relative to that of relaxed Si, compressive strain values up to – 0.88% have been obtained for a 5 nm wide silicon fin. The strain is found to increase with reducing fin width though it scales less than previously reported results from holographic interferometry. In addition, finite-element method (FEM) simulations have been utilized to analyze the amount of strain generated after thermal processing. It is shown that obtained FEM simulated strain values are in good agreement with the calculated strain values obtained from Raman spectroscopy. - Highlights: ► Strain is characterized in nanoscale devices with Raman spectroscopy. ► There is a fin width dependence of the originated strain. ► Strain levels obtained from this technique is in correlation with device simulations

  13. Clinical strains of acinetobacter classified by DNA-DNA hybridization

    International Nuclear Information System (INIS)

    Tjernberg, I.; Ursing, J.


    A collection of Acinetobacter strains consisting of 168 consecutive clinical strains and 30 type and reference strains was studied by DNA-DNA hybridization and a few phenotypic tests. The field strains could be allotted to 13 DNA groups. By means of reference strains ten of these could be identified with groups described by Bouvet and Grimont (1986), while three groups were new; they were given the numbers 13-15. The type strain of A. radioresistens- recently described by Nishimura et al. (1988) - was shown to be a member of DNA group 12, which comprised 31 clinical isolates. Of the 19 strains of A. junii, eight showed hemolytic acitivity on sheep and human blood agar and an additional four strains on human blood agar only. Strains of this species have previously been regarded as non-hemolytic. Reciprocal DNA pairing data for the reference strains of the DNA gropus were treated by UPGMA clustering. The reference strains for A. calcoaceticus, A. baumannii and DNA groups 3 and 13 formed a cluster with about 70% relatedness within the cluster. Other DNA groups joined at levels below 60%. (author)

  14. Clinical strains of acinetobacter classified by DNA-DNA hybridization

    Energy Technology Data Exchange (ETDEWEB)

    Tjernberg, I; Ursing, J [Department of Medical Microbiology, University of Lund, Malmoe General Hospital, Malmoe (Sweden)


    A collection of Acinetobacter strains consisting of 168 consecutive clinical strains and 30 type and reference strains was studied by DNA-DNA hybridization and a few phenotypic tests. The field strains could be allotted to 13 DNA groups. By means of reference strains ten of these could be identified with groups described by Bouvet and Grimont (1986), while three groups were new; they were given the numbers 13-15. The type strain of A. radioresistens- recently described by Nishimura et al. (1988) - was shown to be a member of DNA group 12, which comprised 31 clinical isolates. Of the 19 strains of A. junii, eight showed hemolytic acitivity on sheep and human blood agar and an additional four strains on human blood agar only. Strains of this species have previously been regarded as non-hemolytic. Reciprocal DNA pairing data for the reference strains of the DNA gropus were treated by UPGMA clustering. The reference strains for A. calcoaceticus, A. baumannii and DNA groups 3 and 13 formed a cluster with about 70% relatedness within the cluster. Other DNA groups joined at levels below 60%. (author).

  15. Probiotic attributes of autochthonous Lactobacillus rhamnosus strains of human origin. (United States)

    Pithva, Sheetal; Shekh, Satyamitra; Dave, Jayantilal; Vyas, Bharatkumar Rajiv Manuel


    The study was aimed at evaluating the probiotic potential of indigenous autochthonous Lactobacillus rhamnosus strains isolated from infant feces and vaginal mucosa of healthy female. The survival of the selected strains and the two reference strains (L. rhamnosus GG and L. casei Actimel) was 67-81 % at pH 2 and 70-80 % after passage through the simulated gastrointestinal fluid. These strains are able to grow in the presence of 4 % bile salt, 10 % NaCl, and 0.6 % phenol. The cell surface of L. rhamnosus strains is hydrophilic in nature as revealed by bacterial adhesion to hydrocarbons (BATH) assay. Despite this, L. rhamnosus strains showed mucin adherence, autoaggregation and coaggregation properties that are strain-specific. In addition, they produce bile salt hydrolase (BSH) and β-galactosidase activities. L. rhamnosus strains exhibit antimicrobial activity against food spoilage organisms and gastrointestinal pathogens, as well as Candida and Aspergillus spp. L. rhamnosus strains have similar antibiotic susceptibility pattern, and resistance to certain antibiotics is intrinsic or innate. The strains are neither haemolytic nor producer of biogenic amines such as histamine, putrescine, cadaverine and tyramine. Lyophilized cells of L. rhamnosus Fb exhibited probiotic properties demonstrating potential of the strain for technological suitability and in the preparation of diverse probiotic food formulations.

  16. Strain engineering on transmission carriers of monolayer phosphorene. (United States)

    Zhang, Wei; Li, Feng; Hu, Junsong; Zhang, Ping; Yin, Jiuren; Tang, Xianqiong; Jiang, Yong; Wu, Bozhao; Ding, Yanhuai


    The effects of uniaxial strain on the structure, band gap and transmission carriers of monolayer phosphorene were investigated by first-principles calculations. The strain induced semiconductor-metal as well as direct-indirect transitions were studied in monolayer phosphorene. The position of CBM which belonged to indirect gap shifts along the direction of the applied strain. We have concluded the change rules of the carrier effective mass when plane strains are applied. In band structure, the sudden decrease of band gap or the new formation of CBM (VBM) causes the unexpected change in carrier effective mass. The effects of zigzag and armchair strain on the effective electron mass in phosphorene are different. The strain along zigzag direction has effects on the electrons effective mass along both zigzag and armchair direction. By contrast, armchair-direction strain seems to affect only on the free electron mass along zigzag direction. For the holes, the effective masses along zigzag direction are largely affected by plane strains while the effective mass along armchair direction exhibits independence in strain processing. The carrier density of monolayer phosphorene at 300 K is calculated about [Formula: see text] cm -2 , which is greatly influenced by the temperature and strain. Strain engineering is an efficient method to improve the carrier density in phosphorene.

  17. A Review: Carbon Nanotube-Based Piezoresistive Strain Sensors

    Directory of Open Access Journals (Sweden)

    Waris Obitayo


    Full Text Available The use of carbon nanotubes for piezoresistive strain sensors has acquired significant attention due to its unique electromechanical properties. In this comprehensive review paper, we discussed some important aspects of carbon nanotubes for strain sensing at both the nanoscale and macroscale. Carbon nanotubes undergo changes in their band structures when subjected to mechanical deformations. This phenomenon makes them applicable for strain sensing applications. This paper signifies the type of carbon nanotubes best suitable for piezoresistive strain sensors. The electrical resistivities of carbon nanotube thin film increase linearly with strain, making it an ideal material for a piezoresistive strain sensor. Carbon nanotube composite films, which are usually fabricated by mixing small amounts of single-walled or multiwalled carbon nanotubes with selected polymers, have shown promising characteristics of piezoresistive strain sensors. Studies also show that carbon nanotubes display a stable and predictable voltage response as a function of temperature.

  18. Mechanism of Strain Rate Effect Based on Dislocation Theory

    International Nuclear Information System (INIS)

    Kun, Qin; Shi-Sheng, Hu; Li-Ming, Yang


    Based on dislocation theory, we investigate the mechanism of strain rate effect. Strain rate effect and dislocation motion are bridged by Orowan's relationship, and the stress dependence of dislocation velocity is considered as the dynamics relationship of dislocation motion. The mechanism of strain rate effect is then investigated qualitatively by using these two relationships although the kinematics relationship of dislocation motion is absent due to complicated styles of dislocation motion. The process of strain rate effect is interpreted and some details of strain rate effect are adequately discussed. The present analyses agree with the existing experimental results. Based on the analyses, we propose that strain rate criteria rather than stress criteria should be satisfied when a metal is fully yielded at a given strain rate. (condensed matter: structure, mechanical and thermal properties)

  19. KAJIAN KONSERVASI Pinus merkusii strain Tapanuli DI SUMATERA

    Directory of Open Access Journals (Sweden)

    Hendi Suhendi


    Full Text Available Di Indonesia, Pinus yang tumbuh secara alami hanyalah Pinus merkusii di Sumatera yang terdiri dari strain Tapanuli, strain Kerinci dan strain Aceh. Berdasarkan persebarannya, strain Tapanuli tidak banyak dijumpai karena tercampur dengan jenis-jenis kayu daun lebar. Secara alami, strain Tapanuli ditemukan di Cagar Alam Dolok Sipirok dan Cagar Alam Dolok Saut. Dalam bentuk hutan tanaman, strain Tapanuli dibuat oleh masyarakat atau rakyat dengan anakan alam dan diambil secara cabutan di Tegakan Benih Dolok Tusam, dan sekarang sudah habis ditebang karena digantikan oleh tanaman kopi. Di wilayah kerja Dinas Kehutanan Propinsi Sumatera Utara hampir tidak pernah didapatkan informasi tentang keberadaan strain Tapanuli. Konservasi in situ dalam bentuk Cagar Alam perlu dilengkapi dengan konservasi ex situ. Sebagai langkah awal konservasi, terlebih dahulu perlu dikaji permudaan alamnya. Di samping itu, analisis kebijakan berkaitan dengan pentingnya eksplorasi dengan metode sensus pada semua kawasan konservasi di Sumatera perlu dipertimbangkan, dan pertemuan formal antar pengambil kebijakan di Departemen Kehutanan perlu direkomendasikan

  20. Strain relaxation of germanium-tin (GeSn) fins (United States)

    Kang, Yuye; Huang, Yi-Chiau; Lee, Kwang Hong; Bao, Shuyu; Wang, Wei; Lei, Dian; Masudy-Panah, Saeid; Dong, Yuan; Wu, Ying; Xu, Shengqiang; Tan, Chuan Seng; Gong, Xiao; Yeo, Yee-Chia


    Strain relaxation of biaxially strained Ge1-xSnx layer when it is patterned into Ge1-xSnx fin structures is studied. Ge1-xSnx-on-insulator (GeSnOI) substrate was realized using a direct wafer bonding (DWB) technique and Ge1-xSnx fin structures were formed by electron beam lithography (EBL) patterning and dry etching. The strain in the Ge1-xSnx fins having fin widths (WFin) ranging from 1 μm down to 80 nm was characterized using micro-Raman spectroscopy. Raman measurements show that the strain relaxation increases with decreasing WFin. Finite element (FE) simulation shows that the strain component in the transverse direction relaxes with decreasing WFin, while the strain component along the fin direction remains unchanged. For various Ge1-xSnx fin widths, transverse strain relaxation was further extracted using micro-Raman spectroscopy, which is consistent with the simulation results.

  1. Food poisoning potential of Bacillus cereus strains from Norwegian dairies. (United States)

    Stenfors Arnesen, Lotte P; O'sullivan, Kristin; Granum, Per Einar


    Characteristics concerning diarrhoeal potential were investigated in B. cereus dairy strains. The thirty-nine strains, isolated from whipping cream, were tested for cytotoxicity after culturing at human body temperature as well as 25 degrees C and 32 degrees C. At 37 degrees C, none of the strains were highly cytotoxic. This observation suggests that those strains should be considered to pose a minor risk with regard to diarrhoeal food poisoning. However, some strains were moderately or highly cytotoxic when grown at 25 degrees C and 32 degrees C. While the majority of the strains were able to grow at refrigeration temperatures, only four B. weihenstephanensis strains were identified among them when subjected to discriminative PCR assays and growth temperatures which delimit this species.

  2. Graphene spin diode: Strain-modulated spin rectification

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Yunhua; Wang, B., E-mail:, E-mail: [Sino-French Institute of Nuclear Engineering and Technology, School of Physics and Engineering, State Key Laboratory of Optoelectronic Materials and Technologies, Sun Yat-sen University, Guangzhou 510275 (China); Liu, Yulan, E-mail:, E-mail: [School of Engineering, Sun Yat-sen University, Guangzhou 510275 (China)


    Strain effects on spin transport in a ferromagnetic/strained/normal graphene junction are explored theoretically. It is shown that the spin-resolved Fermi energy range can be controlled by the armchair direction strain because the strain-induced pseudomagnetic field suppresses the current. The spin rectification effect for the bias reversal occurs because of a combination of ferromagnetic exchange splitting and the broken spatial symmetry of the junction. In addition, the spin rectification performance can be tuned remarkably by manipulation of the strains. In view of this strain-modulated spin rectification effect, we propose that the graphene-based ferromagnetic/strained/normal junction can be used as a tunable spin diode.

  3. Mechanical control over valley magnetotransport in strained graphene

    Energy Technology Data Exchange (ETDEWEB)

    Ma, Ning, E-mail: [Department of Physics, MOE Key Laboratory of Advanced Transducers and Intelligent Control System, Taiyuan University of Technology, Taiyuan 030024 (China); Department of Applied Physics, MOE Key Laboratory for Nonequilibrium Synthesis and Modulation of Condensed Matter, Xi' an Jiaotong University, Xi' an 710049 (China); Zhang, Shengli, E-mail: [Department of Applied Physics, MOE Key Laboratory for Nonequilibrium Synthesis and Modulation of Condensed Matter, Xi' an Jiaotong University, Xi' an 710049 (China); Liu, Daqing, E-mail: [School of Mathematics and Physics, Changzhou University, Changzhou 213164 (China)


    Recent experiments report that the graphene exhibits Landau levels (LLs) that form in the presence of a uniform strain pseudomagnetic field with magnitudes up to hundreds of tesla. We further reveal that the strain removes the valley degeneracy in LLs, and leads to a significant valley polarization with inversion symmetry broken. This accordingly gives rise to the well separated valley Hall plateaus and Shubnikov–de Haas oscillations. These effects are absent in strainless graphene, and can be used to generate and detect valley polarization by mechanical means, forming the basis for the new paradigm “valleytronics” applications. - Highlights: • We explore the mechanical strain effects on the valley magnetotransport in graphene. • We analytically derive the dc collisional and Hall conductivities under strain. • The strain removes the valley degeneracy in Landau levels. • The strain causes a significant valley polarization with inversion symmetry broken. • The strain leads to the well separated valley Hall and Shubnikov–de Haas effects.

  4. Uniaxial tension test on Rubber at constant true strain rate

    Directory of Open Access Journals (Sweden)

    Sourne H.L.


    Full Text Available Elastomers are widely used for damping parts in different industrial contexts because of their remarkable dissipation properties. Indeed, they can undergo severe mechanical loading conditions, i.e., high strain rates and large strains. Nevertheless, the mechanical response of these materials can vary from purely rubber-like to glassy depending on the strain rate undergone. Classically, uniaxial tension tests are made in order to find a relation between the stress and the strain in the material at various strain rates. However, even if the strain rate is searched to be constant, it is the nominal strain rate that is considered. Here we develop a test at constant true strain rate, i.e. the strain rate that is experienced by the material. In order to do such a test, the displacement imposed by the machine is an exponential function of time. This test has been performed with a high speed hydraulic machine for strain rates between 0.01/s and 100/s. A specific specimen has been designed, yielding a uniform strain field (and so a uniform stress field. Furthermore, an instrumented aluminum bar has been used to take into account dynamic effects in the measurement of the applied force. A high speed camera enables the determination of strain in the sample using point tracking technique. Using this method, the stress-strain curve of a rubber-like material during a loading-unloading cycle has been determined, up to a stretch ratio λ = 2.5. The influence of the true strain rate both on stiffness and on dissipation of the material is then discussed.

  5. Substrate-induced strain in carbon nanodisks

    International Nuclear Information System (INIS)

    Osváth, Z.; Vértesy, Z.; Lábár, J.; Nemes-Incze, P.; Horváth, Z.E.; Biró, L.P.


    Graphitic nanodisks of typically 20–50 nm in thickness, produced by the so-called Kvaerner Carbon Black and Hydrogen Process were dispersed on gold substrate and investigated by atomic force microscopy (AFM), field emission scanning electron microscopy (FE-SEM), and confocal Raman spectroscopy. The roughness of the gold surface was drastically changed by annealing at 400 °C. AFM measurements show that this change in the surface roughness induces changes also in the topography of the nanodisks, as they closely follow the corrugation of the gold substrate. This leads to strained nanodisks, which is confirmed also by confocal Raman microscopy. We found that the FE-SEM contrast obtained from the disks depends on the working distance used during the image acquisition by In-lens detection, a phenomenon which we explain by the decrease in the amount of electrons reaching the detector due to diffraction. This process may affect the image contrast in the case of other layered materials, like hexagonal boron nitride, and other planar hybrid nanostructures, too. - Highlights: • Bending of carbon nanodisks is induced by the roughness of the gold substrate. • Confocal Raman microscopy shows a compressive strain induced in the nanodisks. • The electron microscopy contrast of nanodisks depends on the working distance

  6. Strain engineered pyrochlore at high pressure

    Energy Technology Data Exchange (ETDEWEB)

    Rittman, Dylan R.; Turner, Katlyn M.; Park, Sulgiye; Fuentes, Antonio F.; Park, Changyong; Ewing, Rodney C.; Mao, Wendy L.


    Strain engineering is a promising method for next-generation materials processing techniques. Here, we use mechanical milling and annealing followed by compression in diamond anvil cell to tailor the intrinsic and extrinsic strain in pyrochlore, Dy2Ti2O7 and Dy2Zr2O7. Raman spectroscopy, X-ray pair distribution function analysis, and X-ray diffraction were used to characterize atomic order over short-, medium-, and long-range spatial scales, respectively, under ambient conditions. Raman spectroscopy and X-ray diffraction were further employed to interrogate the material in situ at high pressure. High-pressure behavior is found to depend on the species and concentration of defects in the sample at ambient conditions. Overall, we show that defects can be engineered to lower the phase transformation onset pressure by ~50% in the ordered pyrochlore Dy2Zr2O7, and lower the phase transformation completion pressure by ~20% in the disordered pyrochlore Dy2Zr2O7. These improvements are achieved without significantly sacrificing mechanical integrity, as characterized by bulk modulus.

  7. Banana (Musa. spp.) strain HD-1 appraisal

    International Nuclear Information System (INIS)

    Longyan, G.; Xinguo, L.; Lingxia, W.; Xuefei, J.


    Being one of the important tropical and subtropical fruit trees, banana (Musa spp.) belongs to the family Musaceae and the order Scitaminae with two genera, Musa and Ensete. In a field survey, research team has discovered a potential banana mutant strain HD-1 with a sound economic value. The results of the finding are as follows: based on Simmonds classification, the pseudostem of banana strain HD-1 is relatively short and purplish red; its upright outward petiole groove has red edges and wraps its pseudostem loosely. Its ploidy is 3, AAA type. Karyotype analysis shows that the number of chromosomes is 33, the karyotype formula is 2n=3x=33=2L + 3 M2 + 4 M1 + 2 S, HD-1 is classified as 1B type. With the help of ISSR molecular markers, we find thatbanana HD-1 has the closest relationship with Pubei and Tianbao dwarf banana; the similarity coefficient is 0.81. In an artificial simulation tests of cold, drought and salt resistance environment changes of physiological and biochemical indexes indicate that HD-1 exhibits stronger defense capability than Brazil banana. By way of inoculation with injury of root dipping method, we respectively treat two kinds of banana seedlings inoculated Banana Fusarium wilt race 4 small species. The results show that their resistance evaluation scores are 3 and 4, disease levels are susceptible and high sensitivity respectively. We conclude that HD-1 has stronger resistance ability to Fusarium wilt than Brazil banana. (author)

  8. Physics of strained quantum well lasers

    CERN Document Server

    Loehr, John P


    When this publisher offered me the opportunity to \\\\Tite a book, some six years ago, I did not hesitate to say yes. I had just spent the last four years of graduate school struggling to understand the physics of strained quantum well lasers, and it seemed to me the whole experience was much more difficult that it should have been. For although many of the results I needed were easy to locate, the underlying physical premises and intervening steps were not. If only I had a book providing the derivations, I could have absorbed them and gone on my way. Such a book lies before you. It provides a unified and self-contained descrip­ tion of the essential physics of strained quantum well lasers, starting from first principles whenever feasible. The presentation I have chosen requires only the standard introductory background in quantum mechanics, solid state physics, and electromagnetics expected of entering graduate students in physics or elec­ trical engineering. A single undergraduate course in each of these su...

  9. Elastic constants from microscopic strain fluctuations (United States)

    Sengupta; Nielaba; Rao; Binder


    Fluctuations of the instantaneous local Lagrangian strain epsilon(ij)(r,t), measured with respect to a static "reference" lattice, are used to obtain accurate estimates of the elastic constants of model solids from atomistic computer simulations. The measured strains are systematically coarse-grained by averaging them within subsystems (of size L(b)) of a system (of total size L) in the canonical ensemble. Using a simple finite size scaling theory we predict the behavior of the fluctuations as a function of L(b)/L and extract elastic constants of the system in the thermodynamic limit at nonzero temperature. Our method is simple to implement, efficient, and general enough to be able to handle a wide class of model systems, including those with singular potentials without any essential modification. We illustrate the technique by computing isothermal elastic constants of "hard" and "soft" disk triangular solids in two dimensions from Monte Carlo and molecular dynamics simulations. We compare our results with those from earlier simulations and theory.

  10. Strain, Stress and Seismicity pattern in Switzerland (United States)

    Houlié, Nicolas; Woessner, Jochen; Villiger, Arturo; Deichmann, Nicholas; Rothacher, Markus; Giardini, Domenico; Geiger, Alain


    Switzerland lies across one of the most complex plate boundary in the world. With a 100 Ma of deformation history, and a wide diversity of deformation mechanism, it is an ideal place to study the link(s) between small strain rates measured at the surface and stress dissipated at depth. The link is of genuine interest for seismic hazard assessment as it provides an independent estimate for moment release within the seismogenic volume. We use geodetic (GPS velocities, shortening axes, strain maps) and seismic (anisotropy, P-axes, focal mechanisms) datasets in order to assess whether the stress accumulated at depth due to the continental collision reflects the deformation rates measured at the surface and correlates with the seismic activity as well as the stress directions deduced from earthquake focal mechanisms throughout the area - or not. While the deformation amplitudes of the area are small (less than 10-7 yr-1) in some areas of Switzerland, we can relate long- and short-term features of the tectonic processes occurring over the last 10+ Ma. Preliminary results suggest that while deformation rates measured by GPS are large in the Ticino compared to the Valais region - its seismic activity rate is lower. This implies other processes might play important roles in the generation of seismicity.

  11. Strain bidimensional na cardiopatia de Takotsubo Two-dimensional strain in Takotsubo cardiomyopathy

    Directory of Open Access Journals (Sweden)

    Carlos Bellini G. Gomes


    Full Text Available Este relato apresenta o seguimento tardio de um caso de cardiomiopatia de Takotsubo com boa evolução clínica e melhora da função sistólica global ventricular esquerda. Contudo, observou-se persistência de significativa disfunção sistólica regional longitudinal que foi avaliada por meio de nova técnica ecocardiográfica (speckle tracking, com as medidas do strain (S e strain rate (SR correspondentes. Ressaltamos a importância desse novo método para o acompanhamento dessa cardiopatia, pois permite identificar os pacientes que persistem com disfunção sistólica e que possivelmente serão beneficiados com a manutenção da terapêutica clínica.This report presents the late follow-up of a case of Takotsubo cardiomyopathy with good clinical outcome and improved left ventricular global systolic function. However, there was persistence of significant regional longitudinal systolic dysfunction evaluated using a new echocardiographic technique (speckle tracking, with corresponding measures of strain (S and strain rate (SR. We emphasize the importance of this new method to monitoring this cardiomyopathy, since it identifies patients with persistent systolic dysfunction who will possibly benefit from maintenance of clinical therapy

  12. Application of fiber optic grating strain sensor for measurement of strain under irradiation environment

    International Nuclear Information System (INIS)

    Kaji, Y.; Matsui, Y.; Kita, S.; Ide, H.; Tsukada, T.; Tsuji, H.


    In Japan Atomic Energy Research Institute (JAERI), in-pile strain measurement techniques have been developed using Japan Materials Testing Reactor (JMTR). In order to evaluate the performance of fiber optic grating sensor under irradiation environment, heat-up and performance tests at elevated temperature before irradiation and in-pile tests were performed in JMTR. (author)

  13. Physical nature of strain rate sensitivity of metals and alloys at high strain rates (United States)

    Borodin, E. N.; Gruzdkov, A. A.; Mayer, A. E.; Selyutina, N. S.


    The role of instabilities of plastic flow at plastic deformation of various materials is one of the important cross-disciplinary problems which is equally important in physics, mechanics and material science. The strain rate sensitivities under slow and high strain rate conditions of loading have different physical nature. In the case of low strain rate, the sensitivity arising from the inertness of the defect structures evolution can be expressed by a single parameter characterizing the plasticity mechanism. In our approach, this is the value of the characteristic relaxation time. In the dynamic case, there are additional effects of “high-speed sensitivity” associated with the micro-localization of the plastic flow near the stress concentrators. In the frames of mechanical description, this requires to introduce additional strain rate sensitivity parameters, which is realized in numerous modifications of Johnson–Cook and Zerilli–Armstrong models. The consideration of both these factors is fundamental for an adequate description of the problems of dynamic deformation of highly inhomogeneous metallic materials such as steels and alloys. The measurement of the dispersion of particle velocities on the free surface of a shock-loaded material can be regarded as an experimental expression of the effect of micro-localization. This is also confirmed by our results of numerical simulation of the propagation of shock waves in a two-dimensional formulation and analytical estimations.

  14. Genome Sequence of Campylobacter jejuni strain 327, a strain isolated from a turkey slaughterhouse

    DEFF Research Database (Denmark)

    Takamiya, Monica; Özen, Asli Ismihan; Rasmussen, Morten


    , catalase positive bacterium obtains energy from the metabolism of amino acids and Krebs cycle intermediates. Strain 327 was isolated from a turkey slaughter production line and is considered environmentally sensitive to food processing (cold, heat, drying) and storage conditions. The 327 whole genome...

  15. Acquirement of true stress-strain curve using true fracture strain obtained by tensile test and FE analysis

    International Nuclear Information System (INIS)

    Lee, Kyoung Yoon; Kim, Tae Hyung; Lee, Hyung Yil


    In this work, we predict a true fracture strain using load-displacement curves from tensile test and Finite Element Analysis (FEA), and suggest a method for acquiring true Stress-Strain (SS) curves by predicted fracture strain. We first derived the true SS curve up to necking point from load-displacement curve. As the beginning, the posterior necking part of true SS curve is linearly extrapolated with the slope at necking point. The whole SS curve is then adopted for FE simulation of tensile test. The Bridgman factor or suitable plate correction factors are applied to pre and post FEA. In the load-true strain curve from FEA, the true fracture strain is determined as the matching point to test fracture load. The determined true strain is validated by comparing with test fracture strain. Finally, we complete the true SS curve by combining the prior necking part and linear part, the latter of which connects necking and predicted fracture points.

  16. Acquirement of true stress-strain curve using true fracture strain obtained by tensile test and FE analysis

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Kyoung Yoon; Kim, Tae Hyung; Lee, Hyung Yil [Sogang University, Seoul (Korea, Republic of)


    In this work, we predict a true fracture strain using load-displacement curves from tensile test and Finite Element Analysis (FEA), and suggest a method for acquiring true Stress-Strain (SS) curves by predicted fracture strain. We first derived the true SS curve up to necking point from load-displacement curve. As the beginning, the posterior necking part of true SS curve is linearly extrapolated with the slope at necking point. The whole SS curve is then adopted for FE simulation of tensile test. The Bridgman factor or suitable plate correction factors are applied to pre and post FEA. In the load-true strain curve from FEA, the true fracture strain is determined as the matching point to test fracture load. The determined true strain is validated by comparing with test fracture strain. Finally, we complete the true SS curve by combining the prior necking part and linear part, the latter of which connects necking and predicted fracture points.

  17. Acquirement of True Stress-strain Curve Using True Fracture Strain Obtained by Tensile Test and FE Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Kyoung Yoon; Lee, Hyung Yil [Sogang University, Seoul (Korea, Republic of); Kim, Tae Hyung [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)


    In this work, we predict a true fracture strain using load-displacement curves from tensile test and finite element analysis (FEA), and suggest a method for acquiring true stress-strain (SS) curves by predicted fracture strain. We first derived the true SS curve up to necking point from load-displacement curve. As the beginning, the posterior necking part of true SS curve is linearly extrapolated with the slope at necking point. The whole SS curve is then adopted for FE simulation of tensile test. The Bridgman factor or suitable plate correction factors are applied to pre and post FEA. In the load-true strain curve from FEA, the true fracture strain is determined as the matching point to test fracture load. The determined true strain is validated by comparing with test fracture strain. Finally, we complete the true SS curve by combining the prior necking part and linear part, the latter of which connects necking and predicted fracture points.

  18. Strains and Stressors: An Analysis of Touchscreen Learning in Genetically Diverse Mouse Strains (United States)

    Graybeal, Carolyn; Bachu, Munisa; Mozhui, Khyobeni; Saksida, Lisa M.; Bussey, Timothy J.; Sagalyn, Erica; Williams, Robert W.; Holmes, Andrew


    Touchscreen-based systems are growing in popularity as a tractable, translational approach for studying learning and cognition in rodents. However, while mouse strains are well known to differ in learning across various settings, performance variation between strains in touchscreen learning has not been well described. The selection of appropriate genetic strains and backgrounds is critical to the design of touchscreen-based studies and provides a basis for elucidating genetic factors moderating behavior. Here we provide a quantitative foundation for visual discrimination and reversal learning using touchscreen assays across a total of 35 genotypes. We found significant differences in operant performance and learning, including faster reversal learning in DBA/2J compared to C57BL/6J mice. We then assessed DBA/2J and C57BL/6J for differential sensitivity to an environmental insult by testing for alterations in reversal learning following exposure to repeated swim stress. Stress facilitated reversal learning (selectively during the late stage of reversal) in C57BL/6J, but did not affect learning in DBA/2J. To dissect genetic factors underlying these differences, we phenotyped a family of 27 BXD strains generated by crossing C57BL/6J and DBA/2J. There was marked variation in discrimination, reversal and extinction learning across the BXD strains, suggesting this task may be useful for identifying underlying genetic differences. Moreover, different measures of touchscreen learning were only modestly correlated in the BXD strains, indicating that these processes are comparatively independent at both genetic and phenotypic levels. Finally, we examined the behavioral structure of learning via principal component analysis of the current data, plus an archival dataset, totaling 765 mice. This revealed 5 independent factors suggestive of “reversal learning,” “motivation-related late reversal learning,” “discrimination learning,” “speed to respond,” and

  19. Resonant tunneling measurements of size-induced strain relaxation (United States)

    Akyuz, Can Deniz

    Lattice mismatch strain available in such semiconductor heterostructures as Si/SiGe or GaAs/AlGaAs can be employed to alter the electronic and optoelectronic properties of semiconductor structures and devices. When deep submicron structures are fabricated from strained material, strained layers relax by sidewall expansion giving rise to size- and geometry-dependent strain gradients throughout the structure. This thesis describes a novel experimental technique to probe the size-induced strain relaxation by studying the tunneling current characteristics of strained p-type Si/SiGe resonant tunneling diodes. Our current-voltage measurements on submicron strained p-Si/SiGe double- and triple-barrier resonant tunneling structures as a function of device diameter, D, provide experimental access to both the average strain relaxation (which leads to relative shifts in the tunneling current peak positions) and strain gradients (which give rise to a fine structure in the current peaks due to inhomogeneous strain-induced lateral quantization). We find that strain relaxation is significant, with a large fraction of the strain energy relaxed on average in D ≤ 0.25 m m devices. Further, the in-plane potentials that arise from inhomogeneous strain gradients are large. In the D ˜ 0.2 m m devices, the corresponding lateral potentials are approximately parabolic exceeding ˜ 25 meV near the perimeter. These potentials create discrete hole states in double-barrier structures (single well), and coupled hole states in triple-barrier structures (two wells). Our results are in excellent agreement with finite-element strain calculations in which the strained layers are permitted to relax to a state of minimum energy by sidewall expansion. Size-induced strain relaxation will undoubtedly become a serious technological issue once strained devices are scaled down to the deep submicron regime. Interestingly, our calculations predict and our measurements are consistent with the appearance of

  20. Bacteriocin-like inhibitory activities of seven Lactobacillus delbrueckii subsp. bulgaricus strains against antibiotic susceptible and resistant Helicobacter pylori strains. (United States)

    Boyanova, L; Gergova, G; Markovska, R; Yordanov, D; Mitov, I


    The aim of the study was to detect anti-Helicobacter pylori activity of seven Lactobacillus delbrueckii subsp. bulgaricus (GLB) strains by four cell-free supernatant (CFS) types. Activity of non-neutralized and non-heat-treated (CFSs1), non-neutralized and heat-treated (CFSs2), pH neutralized, catalase-treated and non-heat-treated (CFSs3), or neutralized, catalase- and heat-treated (CFSs4) CFSs against 18 H. pylori strains (11 of which with antibiotic resistance) was evaluated. All GLB strains produced bacteriocin-like inhibitory substances (BLISs), the neutralized CFSs of two GLB strains inhibited >81% of test strains and those of four GLB strains were active against >71% of antibiotic resistant strains. Two H. pylori strains were BLIS resistant. The heating did not reduce the CFS activity. Briefly, all GLB strains evaluated produced heat-stable BLISs, although GLB and H. pylori strain susceptibility patterns exhibited differences. Bacteriocin-like inhibitory substance activity can be an advantage for the probiotic choice for H. pylori infection control. In this study, anti-Helicobacter pylori activity of seven Lactobacillus delbrueckii subsp. bulgaricus (GLB) strains was evaluated by four cell-free supernatant (CFS) types. The GLB strains produced heat-stable bacteriocin-like inhibitory substances (BLISs) with a strong anti-H. pylori activity and some neutralized, catalase- and heat-treated CFSs inhibited >83% of the test strains. Bacteriocin-like inhibitory substance production of GLB strains can render them valuable probiotics in the control of H. pylori infection. © 2017 The Society for Applied Microbiology.

  1. A piezoelectric transducer for measurement of dynamic strain in pipes

    Energy Technology Data Exchange (ETDEWEB)

    Lannes, Daniel P.; Gama, Antonio L. [Universidade Federal Fluminense (UFF), Niteroi, RJ (Brazil). Dept. de Engenharia Mecanica


    This work presents a new strain transducer developed mainly for the inspection and evaluation of piping systems with excessive vibration. Vibration is one of the most common causes of piping failures. These failures could be avoided if the vibration problems were identified and quickly evaluated. Procedures for evaluation of piping vibration are usually based on pipe velocity or displacement. Although simple and fast, these procedures do not provide precise information on the risk of piping fatigue failure. Through the measurement of pipe dynamic strains the risk of failure due to vibration can be determined more accurately. The measurement of strain is usually performed using the conventional strain gauge method. Although efficient and accurate, the implementation of the conventional strain gauge technique may become a difficult task in certain industrial scenarios. Motivated by the need of a simple and rapid method for pipe dynamic strain measurement, a piezoelectric dynamic strain transducer was developed. This work presents a description of the piezoelectric strain transducer and the preliminary results of pipe strain measurements. The transducer can be applied directly to the pipe through magnetic bases allowing for the quick measurement of the dynamic strains in many points of the pipe. The transducer signal can be read with the same commercial data collectors used for accelerometers. (author)

  2. Antimicrobial drug susceptibility of Neisseria meningitidis strains isolated from carriers

    Directory of Open Access Journals (Sweden)

    Dayamí García


    Full Text Available When it is necessary to determine the susceptibility of Neisseria meningitidis (Nm strains to antimicrobial drugs, it is important to consider that it should be analyzed in a double context. One of them related to the use of drugs in a specific medical treatment; and the other; to chemoprophylatic drugs, both with the same purpose: the accurate selection of the “in vivo” antimicrobial agent. This requires the study of the sensitivity and resistance of strains isolated in both carriers and patients. With the aim of further studying the behavior of the strains that currently circulate in Cuba, an antimicrobial drug susceptibility study was conducted in 90 strains isolated from carriers during the first half of 1998. The agar dilution method was used to determine the minimum inhibitory concentrations (MICs to: penicillin, ampicillin, rifampin, sulfadiazine, chloramphenicol, ciprofloxacin, ceftriaxone, cefotaxime. The study of the three latter drugs was done for the first time in our country. The search for β- lactamase-producer strains was also performed. There was a predominance of penicillin sensitive strains (82,2% with an intermediate sensitivity to ampicillin (57,8%, while 70% of the strains were sensitive to sulfadiazine. Regarding the rest of the antimicrobial drugs, 100% of the strains were sensitive. The paper shows the MICs for each drug as well as the phenotypic characteristics of the strains with the penicillin and sulfadiazine sensitivity and resistance patterns. No β-lactamase-producer strains were found.

  3. Curvature reduces bending strains in the quokka femur

    Directory of Open Access Journals (Sweden)

    Kyle McCabe


    Full Text Available This study explores how curvature in the quokka femur may help to reduce bending strain during locomotion. The quokka is a small wallaby, but the curvature of the femur and the muscles active during stance phase are similar to most quadrupedal mammals. Our hypothesis is that the action of hip extensor and ankle plantarflexor muscles during stance phase place cranial bending strains that act to reduce the caudal curvature of the femur. Knee extensors and biarticular muscles that span the femur longitudinally create caudal bending strains in the caudally curved (concave caudal side bone. These opposing strains can balance each other and result in less strain on the bone. We test this idea by comparing the performance of a normally curved finite element model of the quokka femur to a digitally straightened version of the same bone. The normally curved model is indeed less strained than the straightened version. To further examine the relationship between curvature and the strains in the femoral models, we also tested an extra-curved and a reverse-curved version with the same loads. There appears to be a linear relationship between the curvature and the strains experienced by the models. These results demonstrate that longitudinal curvature in bones may be a manipulable mechanism whereby bone can induce a strain gradient to oppose strains induced by habitual loading.

  4. Plastic strain caused by contraction of pores in polycrystalline graphites

    International Nuclear Information System (INIS)

    Ioka, Ikuo; Yoda, Shinichi; Konishi, Takashi.


    The effects of porosity on mechanical properties and deformation behavior of four isotropic polycrystalline graphites were studied. The pore size distributions of the graphites were measured using a conventional mercury penetration technique. The average pore radius of ISO-88 graphite was about one-tenth of that of ISEM-1, IG-11 or IG-15 graphites. Young's modulus of the graphites decreased with increasing porosity. The stress-strain curve of each graphite was measured in its lateral and axial directions. Young's modulus of graphite decreased with increasing load. The plastic strain at a given compressive load was calculated from the stress-strain curve and the initial gradient of the unloading curve at the load. The ratio of lateral plastic strain to axial plastic strain for the graphites was less than 0.5, indicating that the volume of the graphites decreased during compressive loading. By assuming that the volume change was caused by contraction of pores, plastic strain associated with contraction of pores was calculated from the axial plastic strain and lateral plastic strain by slips along the basal planes. The plastic strain increased with increasing axial plastic strain and porosity of graphite. (author)

  5. Phylogenetic analysis of Hungarian goose parvovirus isolates and vaccine strains. (United States)

    Tatár-Kis, Tímea; Mató, Tamás; Markos, Béla; Palya, Vilmos


    Polymerase chain reaction and sequencing were used to analyse goose parvovirus field isolates and vaccine strains. Two fragments of the genome were amplified. Fragment "A" represents a region of VP3 gene, while fragment "B" represents a region upstream of the VP3 gene, encompassing part of the VP1 gene. In the region of fragment "A" the deduced amino acid sequence of the strains was identical, therefore differentiation among strains could be done only at the nucleotide level, which resulted in the formation of three groups: Hungarian, West-European and Asian strains. In the region of fragment "B", separation of groups could be done by both nucleotide and deduced amino acid sequence level. The nucleotide sequences resulted in the same groups as for fragment "A" but with a different clustering pattern among the Hungarian strains. Within the "Hungarian" group most of the recent field isolates fell into one cluster, very closely related or identical to each other, indicating a very slow evolutionary change. The attenuated strains and field isolates from 1979/80 formed a separate cluster. When vaccine strains and field isolates were compared, two specific amino acid differences were found that can be considered as possible markers for vaccinal strains. Sequence analysis of fragment "B" seems to be a suitable method for differentiation of attenuated vaccine strains from virulent strains. Copyright 2004 Houghton Trust Ltd

  6. Broiler genetic strain and sex effects on meat characteristics. (United States)

    López, K P; Schilling, M W; Corzo, A


    A randomized complete block design within a factorial arrangement of treatments was used to evaluate the effect of strain and sex on carcass characteristics, meat quality, and sensory acceptability. Two broiler strains were reared: a commercially available strain (strain A) and a strain currently in the test phase (strain B) that has been genetically selected to maximize breast yield. Broilers were harvested in a pilot scale processing plant using commercial prototype equipment at 42 d of age. Carcasses were deboned at 4 h postmortem. The left half of each breast was evaluated for pH, color, cooking loss, shear force, and proximate analysis. The right side of each breast was used for consumer acceptability testing. Thigh meat was evaluated for proximate composition. No interactions were observed throughout the study. Male broilers had a higher (P dressing percentage and breast meat yield when compared with females. Broilers from strain B presented a higher (P dressing percentage than those broilers corresponding to the commercially available broiler strain. At 24 h postmortem, female broilers presented a lower ultimate pH and higher Commission internationale de l'éclairage yellowness values (ventral side of the pectoralis major) when compared with male broilers. On average, no differences existed (P > 0.05) among treatments with respect to pH decline, cooking loss, shear values, and proximate composition. In addition, no differences (P > 0.05) existed among breast meat from the different strains with respect to consumer acceptability of appearance, texture, flavor, and overall acceptability, but breast meat from strain B was slightly preferred (P < 0.05) over that of strain A with respect to aroma. However, breast meat from both strains received scores in the range of "like slightly to like moderately." Overall data suggest that all treatments yielded high quality breast and thigh meat and strain cross did not present variability in terms of consumer acceptability.

  7. High strain rate deformation of layered nanocomposites. (United States)

    Lee, Jae-Hwang; Veysset, David; Singer, Jonathan P; Retsch, Markus; Saini, Gagan; Pezeril, Thomas; Nelson, Keith A; Thomas, Edwin L


    Insight into the mechanical behaviour of nanomaterials under the extreme condition of very high deformation rates and to very large strains is needed to provide improved understanding for the development of new protective materials. Applications include protection against bullets for body armour, micrometeorites for satellites, and high-speed particle impact for jet engine turbine blades. Here we use a microscopic ballistic test to report the responses of periodic glassy-rubbery layered block-copolymer nanostructures to impact from hypervelocity micron-sized silica spheres. Entire deformation fields are experimentally visualized at an exceptionally high resolution (below 10 nm) and we discover how the microstructure dissipates the impact energy via layer kinking, layer compression, extreme chain conformational flattening, domain fragmentation and segmental mixing to form a liquid phase. Orientation-dependent experiments show that the dissipation can be enhanced by 30% by proper orientation of the layers.

  8. Social relations: network, support and relational strain

    DEFF Research Database (Denmark)

    Due, P; Holstein, B; Lund, Rikke


    We introduce a conceptual framework with social relations as the main concept and the structure and the function of social relations as subconcepts. The structure of social relations covers aspects of formal relations and social network. The function of social relations covers social support......,011. The postal questionnaires were answered by a random sample in each of the age groups. The results show marked age and gender differences in both the structure and the function of social relations. The social network, measured as weekly contacts, weakens with age and so does instrumental support. Emotional...... support is unrelated to this decline in contact frequency and appears to be at the same level for younger and older individuals. Relational strain, measured as conflicts, declines with age for all kinds of social relations. The weakening of the social network with age does not seem to affect the level...

  9. Strain gradient effects on cyclic plasticity

    DEFF Research Database (Denmark)

    Niordson, Christian Frithiof; Legarth, Brian Nyvang


    Size effects on the cyclic shear response are studied numerically using a recent higher order strain gradient visco-plasticity theory accounting for both dissipative and energetic gradient hardening. Numerical investigations of the response under cyclic pure shear and shear of a finite slab between...... rigid platens have been carried out, using the finite element method. It is shown for elastic–perfectly plastic solids how dissipative gradient effects lead to increased yield strength, whereas energetic gradient contributions lead to increased hardening as well as a Bauschinger effect. For linearly...... hardening materials it is quantified how dissipative and energetic gradient effects promote hardening above that of conventional predictions. Usually, increased hardening is attributed to energetic gradient effects, but here it is found that also dissipative gradient effects lead to additional hardening...

  10. High strain rate deformation of layered nanocomposites (United States)

    Lee, Jae-Hwang; Veysset, David; Singer, Jonathan P.; Retsch, Markus; Saini, Gagan; Pezeril, Thomas; Nelson, Keith A.; Thomas, Edwin L.


    Insight into the mechanical behaviour of nanomaterials under the extreme condition of very high deformation rates and to very large strains is needed to provide improved understanding for the development of new protective materials. Applications include protection against bullets for body armour, micrometeorites for satellites, and high-speed particle impact for jet engine turbine blades. Here we use a microscopic ballistic test to report the responses of periodic glassy-rubbery layered block-copolymer nanostructures to impact from hypervelocity micron-sized silica spheres. Entire deformation fields are experimentally visualized at an exceptionally high resolution (below 10 nm) and we discover how the microstructure dissipates the impact energy via layer kinking, layer compression, extreme chain conformational flattening, domain fragmentation and segmental mixing to form a liquid phase. Orientation-dependent experiments show that the dissipation can be enhanced by 30% by proper orientation of the layers.

  11. Relation between job strain and myocardial infarction

    DEFF Research Database (Denmark)

    Netterstrøm, B; Nielsen, F E; Kristensen, T S


    OBJECTIVES: To study the influence of different job related and socioeconomic factors for development of myocardial infarction (MI). METHOD: The study was a case-control study of 76 male wage earners who had been admitted to hospital with MI. As a control group 176 male wage earners not admitted......, the isostrain model. RESULTS: The most significant findings were consistent with Karasek's job strain model in that mean with a high degree of demand combined with a low degree of control at work had a significantly increased odds ratio (OR) 95% confidence interval (95% CI) of 2.1 (1.2 to 3.8) for MI after...... adjustment for age compared with men with a low degree of demand and a high degree of control at work. Further adjustment for smoking, socioeconomic status, employment sector, job category, and social network did not affect the OR substantially (OR 2.3 (1.2 to 4.4)). Other factors significantly associated...

  12. Global Strain in Severe Aortic Valve Stenosis

    DEFF Research Database (Denmark)

    Dahl, Jordi S; Videbæk, Lars; Poulsen, Mikael K


    Score, history with ischemic heart disease and ejection fraction. CONCLUSIONS: -In patients with symptomatic severe aortic stenosis undergoing AVR reduced GLS provides important prognostic information beyond standard risk factors. Clinical Trial Registration-URL: Unique identifier......BACKGROUND: -Global longitudinal systolic strain (GLS) is often reduced in aortic stenosis despite normal ejection fraction. The importance of reduced preoperative GLS on long-term outcome after aortic valve replacement (AVR) is unknown. METHODS AND RESULTS: -A total of 125 patients with severe...... and mortality. In a stepwise cox model with forward selection GLS was the sole independent predictor HR=1.13 (95% confidence interval 1.02-1.25), p=0.04. Comparing the overall log likelihood χ(2) of the predictive power of the multivariable model containing GLS was statistically superior to models based on Euro...

  13. Associations between Mycobacterium tuberculosis Strains and Phenotypes (United States)

    Brown, Timothy; Nikolayevskyy, Vladyslav; Velji, Preya


    To inform development of tuberculosis (TB) control strategies, we characterized a total of 2,261 Mycobacterium tuberculosis complex isolates by using multiple phenotypic and molecular markers, including polymorphisms in repetitive sequences (spoligotyping and variable-number tandem repeats [VNTRs]) and large sequence and single-nucleotide polymorphisms. The Beijing family was strongly associated with multidrug resistance (p = 0.0001), and VNTR allelic variants showed strong associations with spoligotyping families: >5 copies at exact tandem repeat (ETR) A, >2 at mycobacterial interspersed repetitive unit 24, and >3 at ETR-B associated with the East African–Indian and M. bovis strains. All M. tuberculosis isolates were differentiated into 4 major lineages, and a maximum parsimony tree was constructed suggesting a more complex phylogeny for M. africanum. These findings can be used as a model of pathogen global diversity. PMID:20113558

  14. Ultrafast strain engineering in complex oxide heterostructures

    Energy Technology Data Exchange (ETDEWEB)

    Popovich, Paul; Caviglia, Andrea; Hu, Wanzheng; Bromberger, Hubertus; Singla, Rashmi; Mitrano, Matteo; Hoffmann, Matthias C.; Kaiser, Stefan; Foerst, Michael [Max-Planck Research Group for Structural Dynamics - Center for Free Electron Laser Science, University of Hamburg (Germany); Scherwitzl, Raoul; Zubko, Pavlo; Gariglio, Sergio; Triscone, Jean-Marc [Departement de Physique de la Matiere Condensee, University of Geneva, 24 Quai Ernest-Ansermet, 1211 Geneve 4, Geneva (Switzerland); Cavalleri, Andrea [Max-Planck Research Group for Structural Dynamics - Center for Free Electron Laser Science, University of Hamburg (Germany); Department of Physics, Clarendon Laboratory, University of Oxford (United Kingdom)


    The mechanical coupling between the substrate and the thin film is expected to be effective on the ultrafast timescale, and could be exploited for the dynamic control of materials properties. Here, we demonstrate that a large-amplitude mid-infrared field, made resonant with a stretching mode of the substrate, can switch the electronic properties of a thin film across an interface. Exploiting dynamic strain propagation between different components of a heterostructure, insulating antiferromagnetic NdNiO{sub 3} is driven through a prompt, five-order-of-magnitude increase of the electrical conductivity, with resonant frequency and susceptibility that is controlled by choice of the substrate material. Vibrational phase control, extended here to a wide class of heterostructures and interfaces, may be conductive to new strategies for electronic phase control at THz repetition rates.

  15. Strain driven fast osseointegration of implants

    Directory of Open Access Journals (Sweden)

    Wiesmann Hans-Peter


    Full Text Available Abstract Background Although the bone's capability of dental implant osseointegration has clinically been utilised as early as in the Gallo-Roman population, the specific mechanisms for the emergence and maintenance of peri-implant bone under functional load have not been identified. Here we show that under immediate loading of specially designed dental implants with masticatory loads, osseointegration is rapidly achieved. Methods We examined the bone reaction around non- and immediately loaded dental implants inserted in the mandible of mature minipigs during the presently assumed time for osseointegration. We used threaded conical titanium implants containing a titanium2+ oxide surface, allowing direct bone contact after insertion. The external geometry was designed according to finite element analysis: the calculation showed that physiological amplitudes of strain (500–3,000 ustrain generated through mastication were homogenously distributed in peri-implant bone. The strain-energy density (SED rate under assessment of a 1 Hz loading cycle was 150 Jm-3 s-1, peak dislocations were lower then nm. Results Bone was in direct contact to the implant surface (bone/implant contact rate 90% from day one of implant insertion, as quantified by undecalcified histological sections. This effect was substantiated by ultrastructural analysis of intimate osteoblast attachment and mature collagen mineralisation at the titanium surface. We detected no loss in the intimate bone/implant bond during the experimental period of either control or experimental animals, indicating that immediate load had no adverse effect on bone structure in peri-implant bone. Conclusion In terms of clinical relevance, the load related bone reaction at the implant interface may in combination with substrate effects be responsible for an immediate osseointegration state.

  16. Pile Model Tests Using Strain Gauge Technology (United States)

    Krasiński, Adam; Kusio, Tomasz


    Ordinary pile bearing capacity tests are usually carried out to determine the relationship between load and displacement of pile head. The measurement system required in such tests consists of force transducer and three or four displacement gauges. The whole system is installed at the pile head above the ground level. This approach, however, does not give us complete information about the pile-soil interaction. We can only determine the total bearing capacity of the pile, without the knowledge of its distribution into the shaft and base resistances. Much more information can be obtained by carrying out a test of instrumented pile equipped with a system for measuring the distribution of axial force along its core. In the case of pile model tests the use of such measurement is difficult due to small scale of the model. To find a suitable solution for axial force measurement, which could be applied to small scale model piles, we had to take into account the following requirements: - a linear and stable relationship between measured and physical values, - the force measurement accuracy of about 0.1 kN, - the range of measured forces up to 30 kN, - resistance of measuring gauges against aggressive counteraction of concrete mortar and against moisture, - insensitivity to pile bending, - economical factor. These requirements can be fulfilled by strain gauge sensors if an appropriate methodology is used for test preparation (Hoffmann [1]). In this paper, we focus on some aspects of the application of strain gauge sensors for model pile tests. The efficiency of the method is proved on the examples of static load tests carried out on SDP model piles acting as single piles and in a group.

  17. Taxonomic and Strain-Specific Identification of the Probiotic Strain Lactobacillus rhamnosus 35 within the Lactobacillus casei Group▿ (United States)

    Coudeyras, Sophie; Marchandin, Hélène; Fajon, Céline; Forestier, Christiane


    Lactobacilli are lactic acid bacteria that are widespread in the environment, including the human diet and gastrointestinal tract. Some Lactobacillus strains are regarded as probiotics because they exhibit beneficial health effects on their host. In this study, the long-used probiotic strain Lactobacillus rhamnosus 35 was characterized at a molecular level and compared with seven reference strains from the Lactobacillus casei group. Analysis of rrn operon sequences confirmed that L. rhamnosus 35 indeed belongs to the L. rhamnosus species, and both temporal temperature gradient gel electrophoresis and ribotyping showed that it is closer to the probiotic strain L. rhamnosus ATCC 53103 (also known as L. rhamnosus GG) than to the species type strain. In addition, L. casei ATCC 334 gathered in a coherent cluster with L. paracasei type strains, unlike L. casei ATCC 393, which was closer to L. zeae; this is evidence of the lack of relatedness between the two L. casei strains. Further characterization of the eight strains by pulsed-field gel electrophoresis repetitive DNA element-based PCR identified distinct patterns for each strain, whereas two isolates of L. rhamnosus 35 sampled 40 years apart could not be distinguished. By subtractive hybridization using the L. rhamnosus GG genome as a driver, we were able to isolate five L. rhamnosus 35-specific sequences, including two phage-related ones. The primer pairs designed to amplify these five regions allowed us to develop rapid and highly specific PCR-based identification methods for the probiotic strain L. rhamnosus 35. PMID:18326671

  18. Genomic and gene variation in Mycoplasma hominis strains

    DEFF Research Database (Denmark)

    Christiansen, Gunna; Andersen, H; Birkelund, Svend


    DNAs from 14 strains of Mycoplasma hominis isolated from various habitats, including strain PG21, were analyzed for genomic heterogeneity. DNA-DNA filter hybridization values were from 51 to 91%. Restriction endonuclease digestion patterns, analyzed by agarose gel electrophoresis, revealed...... no identity or cluster formation between strains. Variation within M. hominis rRNA genes was analyzed by Southern hybridization of EcoRI-cleaved DNA hybridized with a cloned fragment of the rRNA gene from the mycoplasma strain PG50. Five of the M. hominis strains showed identical hybridization patterns....... These hybridization patterns were compared with those of 12 other mycoplasma species, which showed a much more complex band pattern. Cloned nonribosomal RNA gene fragments of M. hominis PG21 DNA were analyzed, and the fragments were used to demonstrate heterogeneity among the strains. A monoclonal antibody against...

  19. Prevalence of job strain among Indian foundry shop floor workers. (United States)

    Mohan, G Madhan; Elangovan, S; Prasad, P S S; Krishna, P Rama; Mokkapati, Anil Kumar


    Global competition in manufacturing sector demand higher productivity levels. In this context, workers in this sector are set with high output targets, leading to job strain. In addition to the strain, hazardous conditions also prevail in some of the manufacturing processes like foundry activities. This paper attempts to appraise the prevalence of job strain among foundry shop floor workers in India with the help of Demands-Control model [8]. In this study, data was collected through a survey using 49-item Job Content Questionnaire (JCQ) [9], a widely used and well-validated test for job strain. Then the data was subjected to statistical analysis after ascertaining the reliability. This survey has revealed that 25% of workers in foundry were experiencing high job strain. Hazardous working conditions, limited decision making authority, etc. appear to be the main contributing factors for the higher levels of strain.

  20. Strain Engineering to Modify the Electrochemistry of Energy Storage Electrodes (United States)

    Muralidharan, Nitin; Carter, Rachel; Oakes, Landon; Cohn, Adam P.; Pint, Cary L.


    Strain engineering has been a critical aspect of device design in semiconductor manufacturing for the past decade, but remains relatively unexplored for other applications, such as energy storage. Using mechanical strain as an input parameter to modulate electrochemical potentials of metal oxides opens new opportunities intersecting fields of electrochemistry and mechanics. Here we demonstrate that less than 0.1% strain on a Ni-Ti-O based metal-oxide formed on superelastic shape memory NiTi alloys leads to anodic and cathodic peak potential shifts by up to ~30 mV in an electrochemical cell. Moreover, using the superelastic properties of NiTi to enable strain recovery also recovers the electrochemical potential of the metal oxide, providing mechanistic evidence of strain-modified electrochemistry. These results indicate that mechanical energy can be coupled with electrochemical systems to efficiently design and optimize a new class of strain-modulated energy storage materials. PMID:27283872

  1. Strain effect on the phase diagram of Ba-122

    Energy Technology Data Exchange (ETDEWEB)

    Iida, Kazumasa [IFW Dresden (Germany); Nagoya University (Japan); Grinenko, Vadim; Kurth, Fritz; Efremov, Dmitriy; Drechsler, Stefan-Ludwig; Engelmann, Jan; Aswartham, Saicharan; Wurmehl, Sabine; Moench, Ingolf; Huehne, Ruben [IFW Dresden (Germany); Langer, Marco; Erbe, Manuela; Haenisch, Jens; Holzapfel, Bernhard [IFW Dresden (Germany); Karlsruhe Institute of Technology (KIT) (Germany); Ichinose, Ataru; Tsukada, Ichiro [Central Research Institute of Electric Power Industry, Nagasaka (Japan); Ahrens, Eike [TU Dresden (Germany); Ikuta, Hiroshi [Nagoya University (Japan)


    Thin films offer a possibility for tuning superconducting (SC) properties without external pressure or chemical doping. In-plane strain controls the Neel temperature of the antiferromagnetic (AF) transition and the SC transition temperature or even induce superconductivity in the parent compound. We studied the electronic and magnetic properties of Co, Ru, and P doped Ba-122 thin films in different strain states. We have found that the strain shifts nearly rigidly the whole phase diagram including the AF region and the SC dome in the direction of higher or lower substitution levels depending on the direction of strain (i.e. compressive or tensile). In particular, we found that the strain affects the band structure similarly as Co doping despite that the crystal structure changes differently. As a result tensile or compressive strain acts as additional el or h doping, respectively.

  2. Comparative genomic analyses of Mycoplasma hyopneumoniae pathogenic 168 strain and its high-passaged attenuated strain (United States)


    Background Mycoplasma hyopneumoniae is the causative agent of porcine enzootic pneumonia (EP), a mild, chronic pneumonia of swine. Despite presenting with low direct mortality, EP is responsible for major economic losses in the pig industry. To identify the virulence-associated determinants of M. hyopneumoniae, we determined the whole genome sequence of M. hyopneumoniae strain 168 and its attenuated high-passage strain 168-L and carried out comparative genomic analyses. Results We performed the first comprehensive analysis of M. hyopneumoniae strain 168 and its attenuated strain and made a preliminary survey of coding sequences (CDSs) that may be related to virulence. The 168-L genome has a highly similar gene content and order to that of 168, but is 4,483 bp smaller because there are 60 insertions and 43 deletions in 168-L. Besides these indels, 227 single nucleotide variations (SNVs) were identified. We further investigated the variants that affected CDSs, and compared them to reported virulence determinants. Notably, almost all of the reported virulence determinants are included in these variants affected CDSs. In addition to variations previously described in mycoplasma adhesins (P97, P102, P146, P159, P216, and LppT), cell envelope proteins (P95), cell surface antigens (P36), secreted proteins and chaperone protein (DnaK), mutations in genes related to metabolism and growth may also contribute to the attenuated virulence in 168-L. Furthermore, many mutations were located in the previously described repeat motif, which may be of primary importance for virulence. Conclusions We studied the virulence attenuation mechanism of M. hyopneumoniae by comparative genomic analysis of virulent strain 168 and its attenuated high-passage strain 168-L. Our findings provide a preliminary survey of CDSs that may be related to virulence. While these include reported virulence-related genes, other novel virulence determinants were also detected. This new information will form

  3. Genotypic comparison of Pantoea agglomerans plant and clinical strains

    Directory of Open Access Journals (Sweden)

    Frey Jürg E


    Full Text Available Abstract Background Pantoea agglomerans strains are among the most promising biocontrol agents for a variety of bacterial and fungal plant diseases, particularly fire blight of apple and pear. However, commercial registration of P. agglomerans biocontrol products is hampered because this species is currently listed as a biosafety level 2 (BL2 organism due to clinical reports as an opportunistic human pathogen. This study compares plant-origin and clinical strains in a search for discriminating genotypic/phenotypic markers using multi-locus phylogenetic analysis and fluorescent amplified fragment length polymorphisms (fAFLP fingerprinting. Results Majority of the clinical isolates from culture collections were found to be improperly designated as P. agglomerans after sequence analysis. The frequent taxonomic rearrangements underwent by the Enterobacter agglomerans/Erwinia herbicola complex may be a major problem in assessing clinical associations within P. agglomerans. In the P. agglomerans sensu stricto (in the stricter sense group, there was no discrete clustering of clinical/biocontrol strains and no marker was identified that was uniquely associated to clinical strains. A putative biocontrol-specific fAFLP marker was identified only in biocontrol strains. The partial ORF located in this band corresponded to an ABC transporter that was found in all P. agglomerans strains. Conclusion Taxonomic mischaracterization was identified as a major problem with P. agglomerans, and current techniques removed a majority of clinical strains from this species. Although clear discrimination between P. agglomerans plant and clinical strains was not obtained with phylogenetic analysis, a single marker characteristic of biocontrol strains was identified which may be of use in strain biosafety determinations. In addition, the lack of Koch's postulate fulfilment, rare retention of clinical strains for subsequent confirmation, and the polymicrobial nature of P

  4. Genetic recombination in auxotrophic strains of Phanerochaete chrysosporium

    International Nuclear Information System (INIS)

    Krejci, R.


    Four auxotrophic strains of ligninolytic basidiomycete Phanerochaete chrysosporium were obtained by UV mutagenesis. The heterokaryotic mycelium formed by complementation of different auxotrophic isolates was able to fruit and produce basidiospores. Prototrophic strains and strains with a recombined set of parental nutritional requirements were isolated from the basidiospore progeny of the heterokaryons. Genetic recombination hence takes place in fruit bodies produced by the heterokaryotic mycelium. (author). 3 tabs., 13 refs

  5. Health-promoting properties exhibited by Lactobacillus helveticus strains. (United States)

    Skrzypczak, Katarzyna; Gustaw, Waldemar; Waśko, Adam


    Many strains belonging to lactobacilli exert a variety of beneficial health effects in humans and some of the bacteria are regarded as probiotic microorganisms. Adherence and capabilities of colonization by Lactobacillus strains of the intestinal tract is a prerequisite for probiotic strains to exhibit desired functional properties. The analysis conducted here aimed at screening strains of Lactobacillus helveticus possessing a health-promoting potential. The molecular analysis performed, revealed the presence of a slpA gene encoding the surface S-layer protein SlpA (contributing to the immunostimulatory activity of L. helveticus M 92 probiotic strain) in all B734, DSM, T80, and T105 strains. The product of gene amplification was also identified in a Bifidobacterium animalis ssp. lactis BB12 probiotic strain. SDS-PAGE of a surface protein extract demonstrated the presence of a protein with a mass of about 50 kDa in all strains, which refers to the mass of the S-layer proteins. These results are confirmed by observations carried with transmission electron microscopy, where a clearly visible S-layer was registered in all the strains analyzed. The in vitro study results obtained indicate that the strongest adhesion capacity to epithelial cells (HT-29) was demonstrated by L. helveticus B734, while coaggregation with pathogens was highly diverse among the tested strains. The percentage degree of coaggregation was increasing with the incubation time. After 5 h of incubation, the strongest ability to coaggregate with Escherichia coli was expressed by T104. The T80 strain demonstrated a significant ability to co-aggregate with Staphylococcus aureus, while DSM with Bacillus subtilis. For B734, the highest values of co-aggregation coefficient was noted in samples with Salmonella. The capability of autoaggregation, antibiotic susceptibility, resistance to increasing salt concentrations, and strain survival in simulated small intestinal juice were also analyzed.

  6. Low-temperature strain gauges based on silicon whiskers

    Directory of Open Access Journals (Sweden)

    Druzhinin A. A.


    Full Text Available To create low-temperature strain gauges based on p-type silicon whiskers tensoresistive characteristics of these crystals in 4,2—300 K temperature range were studied. On the basis of p-type Si whiskers with different resistivity the strain gauges for different materials operating at cryogenic temperatures with extremely high gauge factor at 4,2 K were developed, as well as strain gauges operating at liquid helium temperatures in high magnetic fields.

  7. "Behaviour changes in Permethrin-resistant strain of Anopheles Stephensi "

    Directory of Open Access Journals (Sweden)

    Vatandoost H


    Full Text Available Behaviour studies indicated that the permethrin resistant strin of An. Stephensi was 3-fold resistant to knock-down compared with the susceptible strain. The resistant strain was however 3-fold less irritable to permethrin and less responsive than the susceptible strain to the movement of an aspirator. If reduced irritability and reduced responsiveness to catch are consequences of the changes in the nervous system, then such a form of resistance may be disadvantageous to mosquitoes in natural populations.

  8. Measuring autogenous strain of concrete with corrugated moulds

    DEFF Research Database (Denmark)

    Tian, Qian; Jensen, Ole Mejlhede


    A reliable technique to quantify autogenous strain is a prerequisite to numerical modeling in stress calculations for high performance concrete. The introducing of a special kind of corrugated tube mould helps to transforming volume strain measurement into liner strain measurement in horizontal...... direction for fluid concrete, which not only realizes the continuous monitoring of the autogenous shrinkage since casting, but also effectively eliminates the disturbance resulting from gravity, temperature variation and mould restraint on measuring results. Based on this measuring technique, this paper...

  9. Strain-tuning of edge magnetism in zigzag graphene nanoribbons. (United States)

    Yang, Guang; Li, Baoyue; Zhang, Wei; Ye, Miao; Ma, Tianxing


    Using the determinant quantum Monte-Carlo method, we elucidate the strain tuning of edge magnetism in zigzag graphene nanoribbons. Our intensive numerical results show that a relatively weak Coulomb interaction may induce a ferromagnetic-like behaviour with a proper strain, and the edge magnetism can be enhanced greatly as the strain along the zigzag edge increases, which provides another way to control graphene magnetism even at room temperature.

  10. EDITORIAL: Excelling under strain: band engineering in nanomaterials Excelling under strain: band engineering in nanomaterials (United States)

    Demming, Anna


    A little stress or strain has been known to improve the performance of athletes, actors and of course nanomaterials alike. In fact strain in silicon is now a major engineering tool for improving the performance of devices, and is ubiquitously used in device design and fabrication. Strain engineering alters a material's band structure, a model of electron behaviour that describes how as atoms come together in a solid, their discrete electron orbitals overlap to ultimately give rise to bands of allowed energy levels. In a strained crystal lattice of silicon or silicon germanium the distance between atoms in the lattice is greater than usual and the bands of allowed energy levels change. This July marks 100 years since Bohr submitted his paper 'On the constitution of atoms and molecules' [1] where he describes the structure of the atom in terms of discrete allowed energy levels. The paper was a seminal contribution to the development of quantum mechanics and laid the initial theoretical precepts for band gap engineering in devices. In this issue Nrauda and a collaboration of researchers in Europe and Australia study the growth of defect-free SiGe islands on pre-patterned silicon [2]. They analyse the strain in the islands and determine at what point lattice dislocations set in with a view to informing implementation of strain engineering in devices. The effects of strain on band structure in silicon and germanium were already studied and reported in the 1950s [3, 4]. Since then the increasing focus on nanoscale materials and the hunger for control of electronic properties has prompted further study of strain effects. The increased surface area to volume ratio in nanostructures changes the strain behaviour with respect to bulk materials, and this can also be exploited for handling and fine tuning strain to manipulate material properties. It is perhaps no surprise that graphene, one of the most high-profile materials in current nanotechnology research, has attracted

  11. Step width alters iliotibial band strain during running. (United States)

    Meardon, Stacey A; Campbell, Samuel; Derrick, Timothy R


    This study assessed the effect of step width during running on factors related to iliotibial band (ITB) syndrome. Three-dimensional (3D) kinematics and kinetics were recorded from 15 healthy recreational runners during overground running under various step width conditions (preferred and at least +/- 5% of their leg length). Strain and strain rate were estimated from a musculoskeletal model of the lower extremity. Greater ITB strain and strain rate were found in the narrower step width condition (p running, especially in persons whose running style is characterized by a narrow step width, may be beneficial in the treatment and prevention of running-related ITB syndrome.

  12. Strain ageing in welds of nuclear pressure vessels

    International Nuclear Information System (INIS)

    Otterberg, R.; Karlsson, C.


    Static and dynamic strain ageing have been investigated on submerged-arc welds and repair welds from plates of the pressure vessel steel A 533B. The results permit the determination of the worst strain ageing conditions existing in a nuclear pressure vessel. Static strain ageing was investigated by means of data from tension tests, hardness measurements and Charpy-V impact properties for prestrained and aged material for ageing temperatures from room temperature to 350 deg C and ageing times up to 1000h. Dynamic strain ageing was investigated by tensile tests up to 350 deg C at different strain rates. At the most static strain ageing was found to increase the impact transition temperature from -75 deg C in the as-received condition to -55 deg C after prestraining and ageing for the plate material, from -35 to -10 deg C for the submerged arc weld and from -90 to -40 deg C for the repair weld. Approximately 10 deg C of the deleterious effect is due to the effect of ageing for the two former materials whereas the corresponding figure for the repair weld amounts to 35 deg C. The dynamic strain ageing is strongest at very low strain rates at temperatures just below 300 deg C. The effect of strain ageing can be reduced by stress relief heat treatment or by other means decreasing the content of nitrogen in solution. (author)

  13. Strain induced optical properties of BaReO3 (United States)

    Kumavat, Sandip R.; Kansara, Shivam; Gupta, Sanjeev K.; Sonvane, Yogesh


    Here, we have performed strain induce optical properties of BaReO3 by using density functional theory (DFT). We noticed that after applying intrinsic and extrinsic strain to the BaReO3, it shows the metallic behavior. We also studied optical properties, which show good activity in the ultraviolet region. The results show that after applying intrinsic and extrinsic strain to BaReO3 the absorption peaks are shifted towards the high UV region of the spectrum. Thus, we concluded that, BaReO3 material with extrinsic strain can be useful for high frequency UV device and optoelectronic devices.

  14. Nuclear magnetic resonance probe head design for precision strain control

    International Nuclear Information System (INIS)

    Kissikov, T.; Sarkar, R.; Bush, B. T.; Lawson, M.; Canfield, P. C.; Curro, N. J.


    Here, we present the design and construction of an NMR probe to investigate single crystals under strain at cryogenic temperatures. The probe head incorporates a piezoelectric-based apparatus from Razorbill Instruments that enables both compressive and tensile strain tuning up to strain values on the order of 0.3% with a precision of 0.001%. 75 As NMR in BaFe 2 As 2 reveals large changes to the electric field gradient and indicates that the strain is homogeneous to within 16% over the volume of the NMR coil.

  15. Isolation and identification of a novel radio-resistant strain

    International Nuclear Information System (INIS)

    Zhang Zhidong; Mao Jun; Wang Wei; Tang Qiyong; Shi Yuhu


    A novel radio-resistant strain named RL2 was studied polyphasically, which was isolated from the soils in the Gurban-Tunggut Desert, Xinjiang. The strain is Gam-positive, sphere-shaped and pink pigmented; The DNA (G+C) contents of RL2 is 71.62mo1%; The 16S rDNA genes of RL2 and D. radiodurans type strain DSM20539 shows a high level of similarity (97.2%). According to phenotypic characteristics and phylogenetic analysis, it can be suggested that the strain RL2 has been identified as Deinococcus. sp and it may be a novel species. (authors)

  16. Biodegradation of endosulfan by mixed bacteria culture strains of ...

    African Journals Online (AJOL)

    Biodegradation of endosulfan by mixed bacteria culture strains of Pseudomonas aeruginosa and Staphylococcus aureus. Nsidibeabasi Calvin Nwokem, Calvin Onyedika Nwokem, Casmir Emmanuel Gimba, Beatrice Nkiruka Iwuala ...

  17. Strain gradient plasticity effects in whisker-reinforced metals

    DEFF Research Database (Denmark)

    Niordson, Christian Frithiof


    A metal reinforced by fibers in the micron range is studied using the strain gradient plasticity theory of Fleck and Hutchinson (2001). Cell-model analyzes are used to study the influence of the material length parameters numerically. Different higher order boundary conditions are considered...... at the fiber-matrix interface. The results are presented as overall stress-strain curves for the whisker-reinforced metal, and also contour plots of effective plastic strain are shown. The strain gradient plasticity theory predicts a significant stiffening effect when compared to conventional models...

  18. Fuel-pin cladding transient failure strain criterion

    International Nuclear Information System (INIS)

    Bard, F.E.; Duncan, D.R.; Hunter, C.W.


    A criterion for cladding failure based on accumulated strain was developed for mixed uranium-plutonium oxide fuel pins and used to interpret the calculated strain results from failed transient fuel pin experiments conducted in the Transient Reactor Test (TREAT) facility. The new STRAIN criterion replaced a stress-based criterion that depends on the DORN parameter and that incorrectly predicted fuel pin failure for transient tested fuel pins. This paper describes the STRAIN criterion and compares its prediction with those of the stress-based criterion

  19. Strain scaling law for flux pinning in practical superconductors

    International Nuclear Information System (INIS)

    Ekin, J.W.


    Detailed experimental data are reported on the critical current and pinning force density of a number of different Nb 3 Sn conductors measured over an extensive range of magnetic fields and strain. Strain scaling in terms of the upper-critical field as scaling parameter is tested and a strain scaling relation formulated. This is compared with the data and its application to practical conductors described. The relation between this strain scaling law and the usual temperature scaling law is discussed and an empirical expression is obtained unifying the two. (U.K.)

  20. Controllable spin-charge transport in strained graphene nanoribbon devices

    Energy Technology Data Exchange (ETDEWEB)

    Diniz, Ginetom S., E-mail:; Guassi, Marcos R. [Institute of Physics, University of Brasília, 70919-970, Brasília-DF (Brazil); Qu, Fanyao [Institute of Physics, University of Brasília, 70919-970, Brasília-DF (Brazil); Department of Physics, The University of Texas at Austin, Austin, Texas 78712 (United States)


    We theoretically investigate the spin-charge transport in two-terminal device of graphene nanoribbons in the presence of a uniform uniaxial strain, spin-orbit coupling, exchange field, and smooth staggered potential. We show that the direction of applied strain can efficiently tune strain-strength induced oscillation of band-gap of armchair graphene nanoribbon (AGNR). It is also found that electronic conductance in both AGNR and zigzag graphene nanoribbon (ZGNR) oscillates with Rashba spin-orbit coupling akin to the Datta-Das field effect transistor. Two distinct strain response regimes of electronic conductance as function of spin-orbit couplings magnitude are found. In the regime of small strain, conductance of ZGNR presents stronger strain dependence along the longitudinal direction of strain. Whereas for high values of strain shows larger effect for the transversal direction. Furthermore, the local density of states shows that depending on the smoothness of the staggered potential, the edge states of AGNR can either emerge or be suppressed. These emerging states can be determined experimentally by either spatially scanning tunneling microscope or by scanning tunneling spectroscopy. Our findings open up new paradigms of manipulation and control of strained graphene based nanostructure for application on novel topological quantum devices.

  1. Modeling of a Surface Acoustic Wave Strain Sensor (United States)

    Wilson, W. C.; Atkinson, Gary M.


    NASA Langley Research Center is investigating Surface Acoustic Wave (SAW) sensor technology for harsh environments aimed at aerospace applications. To aid in development of sensors a model of a SAW strain sensor has been developed. The new model extends the modified matrix method to include the response of Orthogonal Frequency Coded (OFC) reflectors and the response of SAW devices to strain. These results show that the model accurately captures the strain response of a SAW sensor on a Langasite substrate. The results of the model of a SAW Strain Sensor on Langasite are presented

  2. Survival of Lactobacillus rhamnosus strains in the upper gastrointestinal tract. (United States)

    Pitino, Iole; Randazzo, Cinzia Lucia; Mandalari, Giuseppina; Lo Curto, Alberto; Faulks, Richard Martin; Le Marc, Yvan; Bisignano, Carlo; Caggia, Cinzia; Wickham, Martin Sean John


    In the present study six probiotic Lactobacillus rhamnosus strains were investigated for their ability to survive in the human upper gastrointestinal tract through a dynamic gastric model of digestion. MRS broth was used as delivery vehicle and survival was investigated during in vitro gastric and gastric plus duodenal digestion. Results highlighted that all tested strains showed good survival rate during both gastric and duodenal digestion. In particular, three strains exhibited a great survival showing a recovery percentage in the range between 117 and 276%. In agreement with survival data, high lactic acid production was detected for all strains, confirming their metabolic activity during digestion. Copyright © 2010 Elsevier Ltd. All rights reserved.

  3. Design and Construction of Strain Gauge Interface Pressure ...

    African Journals Online (AJOL)

    Design and Construction of Strain Gauge Interface Pressure Transducer for Measurement of Static and Dynamic Interface Pressure Applied by Pressure Garments and its Relationship to Deep Vein Thrombosis.

  4. Strain-Level Diversity of Secondary Metabolism in Streptomyces albus (United States)

    Seipke, Ryan F.


    Streptomyces spp. are robust producers of medicinally-, industrially- and agriculturally-important small molecules. Increased resistance to antibacterial agents and the lack of new antibiotics in the pipeline have led to a renaissance in natural product discovery. This endeavor has benefited from inexpensive high quality DNA sequencing technology, which has generated more than 140 genome sequences for taxonomic type strains and environmental Streptomyces spp. isolates. Many of the sequenced streptomycetes belong to the same species. For instance, Streptomyces albus has been isolated from diverse environmental niches and seven strains have been sequenced, consequently this species has been sequenced more than any other streptomycete, allowing valuable analyses of strain-level diversity in secondary metabolism. Bioinformatics analyses identified a total of 48 unique biosynthetic gene clusters harboured by Streptomyces albus strains. Eighteen of these gene clusters specify the core secondary metabolome of the species. Fourteen of the gene clusters are contained by one or more strain and are considered auxiliary, while 16 of the gene clusters encode the production of putative strain-specific secondary metabolites. Analysis of Streptomyces albus strains suggests that each strain of a Streptomyces species likely harbours at least one strain-specific biosynthetic gene cluster. Importantly, this implies that deep sequencing of a species will not exhaust gene cluster diversity and will continue to yield novelty. PMID:25635820

  5. Large strain cyclic behavior of metastable austenic stainless steel

    International Nuclear Information System (INIS)

    Geijselaers, H.J.M.; Hilkhuijsen, P.; Bor, T.C.; Boogaard, A.H. van den


    Metastable austenitic stainless steel will transform to martensite when subjected to mechanical working. In this research an austenitic stainless steel has been subjected to large amplitude strain paths containing a strain reversal. During the tests, apart from the stress and the strain also magnetic induction was measured. From the in situ magnetic induction measurements an estimate of the stress partitioning among the phases is determined. When the strain path reversal is applied at low strains, a classical Bauschinger effect is observed. When the strain reversal is applied at higher strains, a higher flow stress is measured after the reversal compared to the flow stress before reversal. Also a stagnation of the transformation is observed, meaning that a higher strain as well as a higher stress than before the strain path change is required to restart the transformation after reversal. The observed behavior can be explained by a model in which for the martensitic transformation a stress induced transformation model is used. The constitutive behavior of both the austenite phase and the martensite is described by a Chaboche model to account for the Bauschinger effect. Mean-field homogenization of the material behavior of the individual phases is employed to obtain a constitutive behavior of the two-phase composite. The overall applied stress, the stress in the martensite phase and the observed transformation behavior during cyclic shear are very well reproduced by the model simulations

  6. Large strain cyclic behavior of metastable austenic stainless steel

    Energy Technology Data Exchange (ETDEWEB)

    Geijselaers, H.J.M., E-mail:; Hilkhuijsen, P.; Bor, T.C.; Boogaard, A.H. van den


    Metastable austenitic stainless steel will transform to martensite when subjected to mechanical working. In this research an austenitic stainless steel has been subjected to large amplitude strain paths containing a strain reversal. During the tests, apart from the stress and the strain also magnetic induction was measured. From the in situ magnetic induction measurements an estimate of the stress partitioning among the phases is determined. When the strain path reversal is applied at low strains, a classical Bauschinger effect is observed. When the strain reversal is applied at higher strains, a higher flow stress is measured after the reversal compared to the flow stress before reversal. Also a stagnation of the transformation is observed, meaning that a higher strain as well as a higher stress than before the strain path change is required to restart the transformation after reversal. The observed behavior can be explained by a model in which for the martensitic transformation a stress induced transformation model is used. The constitutive behavior of both the austenite phase and the martensite is described by a Chaboche model to account for the Bauschinger effect. Mean-field homogenization of the material behavior of the individual phases is employed to obtain a constitutive behavior of the two-phase composite. The overall applied stress, the stress in the martensite phase and the observed transformation behavior during cyclic shear are very well reproduced by the model simulations.

  7. Isolation, identification and characterization of regional indigenous Saccharomyces cerevisiae strains

    Directory of Open Access Journals (Sweden)

    Hana Šuranská


    Full Text Available Abstract In the present work we isolated and identified various indigenous Saccharomyces cerevisiae strains and screened them for the selected oenological properties. These S. cerevisiae strains were isolated from berries and spontaneously fermented musts. The grape berries (Sauvignon blanc and Pinot noir were grown under the integrated and organic mode of farming in the South Moravia (Czech Republic wine region. Modern genotyping techniques such as PCR-fingerprinting and interdelta PCR typing were employed to differentiate among indigenous S. cerevisiae strains. This combination of the methods provides a rapid and relatively simple approach for identification of yeast of S. cerevisiae at strain level. In total, 120 isolates were identified and grouped by molecular approaches and 45 of the representative strains were tested for selected important oenological properties including ethanol, sulfur dioxide and osmotic stress tolerance, intensity of flocculation and desirable enzymatic activities. Their ability to produce and utilize acetic/malic acid was examined as well; in addition, H2S production as an undesirable property was screened. The oenological characteristics of indigenous isolates were compared to a commercially available S. cerevisiae BS6 strain, which is commonly used as the starter culture. Finally, some indigenous strains coming from organically treated grape berries were chosen for their promising oenological properties and these strains will be used as the starter culture, because application of a selected indigenous S. cerevisiae strain can enhance the regional character of the wines.

  8. Biodiversity of Lactobacillus sanfranciscensis strains isolated from five sourdoughs. (United States)

    Kitahara, M; Sakata, S; Benno, Y


    Five different sourdoughs were investigated for the composition of lactic acid bacteria (LAB) and the biodiversity of Lactobacillus sanfranciscensis strains. A total of 57 strains were isolated from five sourdoughs. Isolated strains were all identified by the 16S rDNA sequence and species-specific primers for L. sanfranciscensis. Results of identification showed that LAB strains were L. sanfranciscensis, Lactobacillus plantarum, Lactobacillus paralimentarius, Lactobacillus fermentum, Lactobacillus pontis, Lactobacillus casei, Weisella confusa and Pediococcus pentosaceus. A total of 21 strains were identified as L. sanfranciscensis and these isolates were detected in all five sourdoughs. Ribotyping was applied to investigate the relationship between intraspecies diversity of L. sanfranciscensis and sourdough. A total of 22 strains of L. sanfranciscensis including L. sanfranciscensis JCM 5668T were compared by ribotyping. The dendrogram of 21 ribotyping patterns showed four clusters, and L. sanfranciscensis JCM 5668T was independent of the others. The different biotypes of L. sanfranciscensis were present in two sourdoughs compared with other three sourdoughs. The LAB compositions of five sourdoughs were different and the relationship between intraspecies diversity of L. sanfranciscensis strains and five sourdoughs was shown by ribotyping. This study demonstrated that ribotyping was useful for distinguishing L. sanfranciscensis strains. A further important result is that the intra-species diversity of L. sanfranciscensis strains seems to be related to the sourdough preparation.

  9. Identification of Diarrheagenic Escherichia coli Strains from Avian Organic Fertilizers

    Directory of Open Access Journals (Sweden)

    Juan Puño-Sarmiento


    Full Text Available The Brazilian poultry industry generates large amounts of organic waste, such as chicken litter, which is often used in agriculture. Among the bacteria present in organic fertilizer are members of the Enterobacteriaceae family. The objective of this study was to detect the presence of diarrheagenic Escherichia coli (DEC strains in avian organic fertilizer, and assess the potential damage they can cause in humans due to antimicrobial resistance. The presence of DEC pathotypes and phylogenetic groups were detected by multiplex-PCR. Phenotypic assays, such as tests for adhesion, cytotoxicity activity, biofilm formation and especially antimicrobial susceptibility, were performed. Fifteen DEC strains from 64 E. coli were isolated. Among these, four strains were classified as enteropathogenic (EPEC; 6.2%, three strains as Shiga toxin-producing (STEC; 4.7%, 10 strains as enteroaggregative (EAEC; 12.5%, but two of these harbored the eaeA gene too. The low number of isolated strains was most likely due to the composting process, which reduces the number of microorganisms. These strains were able to adhere to HEp-2 and HeLa cells and produce Shiga-toxins and biofilms; in addition, some of the strains showed antimicrobial resistance, which indicates a risk of the transfer of resistance genes to human E. coli. These results showed that DEC strains isolated from avian organic fertilizers can cause human infections.

  10. Identification of diarrheagenic Escherichia coli strains from avian organic fertilizers. (United States)

    Puño-Sarmiento, Juan; Gazal, Luis Eduardo; Medeiros, Leonardo P; Nishio, Erick K; Kobayashi, Renata K T; Nakazato, Gerson


    The Brazilian poultry industry generates large amounts of organic waste, such as chicken litter, which is often used in agriculture. Among the bacteria present in organic fertilizer are members of the Enterobacteriaceae family. The objective of this study was to detect the presence of diarrheagenic Escherichia coli (DEC) strains in avian organic fertilizer, and assess the potential damage they can cause in humans due to antimicrobial resistance. The presence of DEC pathotypes and phylogenetic groups were detected by multiplex-PCR. Phenotypic assays, such as tests for adhesion, cytotoxicity activity, biofilm formation and especially antimicrobial susceptibility, were performed. Fifteen DEC strains from 64 E. coli were isolated. Among these, four strains were classified as enteropathogenic (EPEC; 6.2%), three strains as Shiga toxin-producing (STEC; 4.7%), 10 strains as enteroaggregative (EAEC; 12.5%), but two of these harbored the eaeA gene too. The low number of isolated strains was most likely due to the composting process, which reduces the number of microorganisms. These strains were able to adhere to HEp-2 and HeLa cells and produce Shiga-toxins and biofilms; in addition, some of the strains showed antimicrobial resistance, which indicates a risk of the transfer of resistance genes to human E. coli. These results showed that DEC strains isolated from avian organic fertilizers can cause human infections.

  11. Mead production: selection and characterization assays of Saccharomyces cerevisiae strains. (United States)

    Pereira, Ana Paula; Dias, Teresa; Andrade, João; Ramalhosa, Elsa; Estevinho, Letícia M


    Mead is a traditional drink, which results from the alcoholic fermentation of diluted honey carried out by yeasts. However, when it is produced in a homemade way, mead producers find several problems, namely, the lack of uniformity in the final product, delayed and arrested fermentations, and the production of "off-flavours" by the yeasts. These problems are usually associated with the inability of yeast strains to respond and adapt to unfavourable and stressful growth conditions. The main objectives of this work were to evaluate the capacity of Saccharomyces cerevisiae strains, isolated from honey of the Trás-os-Montes (Northeast Portugal), to produce mead. Five strains from honey, as well as one laboratory strain and one commercial wine strain, were evaluated in terms of their fermentation performance under ethanol, sulphur dioxide and osmotic stress. All the strains showed similar behaviour in these conditions. Two yeasts strains isolated from honey and the commercial wine strain were further tested for mead production, using two different honey (a dark and a light honey), enriched with two supplements (one commercial and one developed by the research team), as fermentation media. The results obtained in this work show that S. cerevisiae strains isolated from honey, are appropriate for mead production. However it is of extreme importance to take into account the characteristics of the honey, and supplements used in the fermentation medium formulation, in order to achieve the best results in mead production.

  12. Study on strain transfer of embedded fiber Bragg grating sensors (United States)

    Wu, Rujun; Zheng, Bailin; Fu, Kunkun; He, Pengfei; Tan, Yuegang


    In this study, a theoretical model of embedded fiber Bragg grating sensors was developed to provide predictions of the strain transfer rate and average strain transfer rate without the assumption that the host material is subjected to uniform axial stress. Further, a finite element (FE) analysis was performed to validate the present model. It was shown that the theoretical results with the present model are in good agreement with those by FE analysis. Finally, the parametric analysis was used to quantitatively investigate the effect of the parameters of the adhesive layer and host material on the strain transfer rate and average strain transfer rate.

  13. The Cyclic Stress-Strain Curve of Polycrystals

    DEFF Research Database (Denmark)

    Pedersen, Ole Bøcker; Rasmussen, K. V.; Winter, A. T.


    The internal stresses implied by the Sachs model are estimated for individual PSBs at low plastic strain amplitudes and for homogeneously sheared grains at higher plastic strain amplitudes. The analysis shows that the Sachs model can account semi-quantitatively for experimentally measured cyclic...... stress-strain curves for copper. A similar approximative analysis of the Taylor model cannot account for the data. An interesting feature of the Sachs model is that, although it is assumed that the flow condition is entirely controlled by the PSBs. the predicted cyclic stress-strain curve displays...

  14. Complete Genome Sequence of Escherichia coli Strain WG5

    DEFF Research Database (Denmark)

    Imamovic, Lejla; Misiakou, Maria-Anna; van der Helm, Eric


    Escherichia coli strain WG5 is a widely used host for phage detection, including somatic coliphages employed as standard ISO method 10705-1 (2000). Here, we present the complete genome sequence of a commercial E. coli WG5 strain.......Escherichia coli strain WG5 is a widely used host for phage detection, including somatic coliphages employed as standard ISO method 10705-1 (2000). Here, we present the complete genome sequence of a commercial E. coli WG5 strain....

  15. Lattice strain measurements on sandstones under load using neutron diffraction (United States)

    Frischbutter, A.; Neov, D.; Scheffzük, Ch.; Vrána, M.; Walther, K.


    Neutron diffraction methods (both time-of-flight- and angle-dispersive diffraction) are applied to intracrystalline strain measurements on geological samples undergoing uniaxial increasing compressional load. The experiments were carried out on Cretaceous sandstones from the Elbezone (East Germany), consisting of >95% quartz which are bedded but without crystallographic preferred orientation of quartz. From the stress-strain relation the Young's modulus for our quartz sample was determined to be (72.2±2.9) GPa using results of the neutron time-of-flight method. The influence of different kinds of bedding in sandstones (laminated and convolute bedding) could be determined. We observed differences of factor 2 (convolute bedding) and 3 (laminated bedding) for the elastic stiffness, determined with angle dispersive neutron diffraction (crystallographic strain) and with strain gauges (mechanical strain). The data indicate which geological conditions may influence the stress-strain behaviour of geological materials. The influence of bedding on the stress-strain behaviour of a laminated bedded sandstone was indicated by direct residual stress measurements using neutron time-of-flight diffraction. The measurements were carried out six days after unloading the sample. Residual strain was measured for three positions from the centre to the periphery and within two radial directions of the cylinder. We observed that residual strain changes from extension to compression in a different manner for two perpendicular directions of the bedding plane.

  16. 5-Fluorouracil-resistant strain of Methanobacterium thermoautortrophicum

    International Nuclear Information System (INIS)

    Nagle, D.P. Jr.; Teal, R.; Eisenbraun, A.


    Growth of Methanobacterium thermoautotrophicum Marburg is inhibited by the pyrimidine, 5-fluorouracil (FU). It was shown previously that methanogenesis is not inhibited to the same extent as growth. A spontaneously occurring FU-resistant strain (RTAE-1) was isolated from a culture of strain Marburg. The growth of both strains was inhibited by 5-fluorodeoxyuridine but not 5-fluorocytosine, and the wild type was more susceptible to inhibition by 5-azauracil and 6-azauracil than was strain RTAE-1. The cellular targets for the pyrimidine analogs are not known. When the accumulation of 14 C-labeled uracil or FU by the two strains was compared, the wilt type took up 15-fold more radiolabel per cell than did the FU-resistant strain. In the wild type, radiolabel from uracil was incorporated into the soluble pool, RNA, and DNA. The metabolism of uracil appeared to involve a uracil phosphoribosyltransferase activity. Strain Marburg extracts contained this enzyme, whereas FU-resistant strain RTAE-1 extracts had less than 1/10 as much activity. Although it is possible that a change in permeability to the compounds plays a role in the stable resistance of strain RTAE-1, the fact that it lacks the ability to metabolize pyrimidines to nucleotides is sufficient to account for its phenotype

  17. 5-Fluorouracil-resistant strain of Methanobacterium thermoautotrophicum. (United States)

    Nagle, D P; Teal, R; Eisenbraun, A


    Growth of Methanobacterium thermoautotrophicum Marburg is inhibited by the pyrimidine, 5-fluorouracil (FU). It was shown previously that methanogenesis is not inhibited to the same extent as growth. A spontaneously occurring FU-resistant strain (RTAE-1) was isolated from a culture of strain Marburg. The growth of both strains was inhibited by 5-fluorodeoxyuridine but not 5-fluorocytosine, and the wild type was more susceptible to inhibition by 5-azauracil and 6-azauracil than was strain RTAE-1. The cellular targets for the pyrimidine analogs are not known. When the accumulation of 14C-labeled uracil or FU by the two strains was compared, the wild type took up 15-fold more radiolabel per cell than did the FU-resistant strain. In the wild type, radiolabel from uracil was incorporated into the soluble pool, RNA, and DNA. The metabolism of uracil appeared to involve a uracil phosphoribosyltransferase activity. Strain Marburg extracts contained this enzyme, whereas FU-resistant strain RTAE-1 extracts had less than 1/10 as much activity. Although it is possible that a change in permeability to the compounds plays a role in the stable resistance of strain RTAE-1, the fact that it lacks the ability to metabolize pyrimidines to nucleotides is sufficient to account for its phenotype.

  18. The effect of strain rate on the viscoplastic behavior of isotactic polypropylene at finite strains

    DEFF Research Database (Denmark)

    Drozdov, Aleksey D.; Christiansen, Jesper de Claville


    prior to testing. A constitutive model is developed for the viscoplastic behavior of isotactic polypropylene at finite strains. A semicrystalline polymer is treated as equivalent heterogeneous network of chains bridged by permanent junctions (physical cross-links and entanglements). The network...... is thought of as an ensemble of meso-regions connected with each other by links (lamellar blocks). In the sub-yield region of deformations, junctions between chains in meso-domains slide with respect to their reference positions (which reflects sliding of nodes in the amorphous phase and fine slip...... responses of non-annealed and annealed specimens: (i) necking of samples not subjected to thermal treatment precedes coarse slip and fragmentation of lamellar blocks, whereas cold-drawing of annealed specimens up to a longitudinal strain of 80% does not induce spatial heterogeneity of their deformation; (ii...

  19. Expanding the Strained Alkyne Toolbox: Generation and Utility of Oxygen-Containing Strained Alkynes. (United States)

    Shah, Tejas K; Medina, Jose M; Garg, Neil K


    We report synthetic methodology that permits access to two oxacyclic strained intermediates, the 4,5-benzofuranyne and the 3,4-oxacyclohexyne. In situ trapping of these intermediates affords an array of heterocyclic scaffolds by the formation of one or more new C-C or C-heteroatom bonds. Experimentally determined regioselectivities were consistent with predictions made using the distortion/interaction model and were also found to be greater compared to selectivities seen in the case of trapping experiments of the corresponding N-containing intermediates. These studies demonstrate the synthetic versatility of oxacyclic arynes and alkynes for the synthesis of functionalized heterocycles, while further expanding the scope of the distortion/interaction model. Moreover, these efforts underscore the value of harnessing strained heterocyclic intermediates as a unique approach to building polycyclic heteroatom-containing frameworks.

  20. Evaluation of Brucella abortus strain RB51 and strain 19 in pronghorn antelope (United States)

    Elzer, P.H.; Smith, J.; Roffe, T.; Kreeger, T.; Edwards, J.; Davis, D.


    Free-roaming elk and bison in the Greater Yellowstone Area remain the only wildlife reservoirs for Brucella abortus in the United States, and the large number of animals and a lack of holding facilities make it unreasonable to individually vaccinate each animal. Therefore, oral delivery is being proposed as a possible option to vaccinate these wild ungulates. One of the main problems associated with oral vaccination is the potential exposure of nontarget species to the vaccines. The purpose of this study was to determine the effects of two Brucella vaccines, strain 19 (S19) and the rough strain RB51 (SRB51), in pregnant pronghorn antelope. We conclude that S19 and SRB51 rarely colonize maternal and fetal tissues of pregnant pronghorn and were not associated with fetal death. Oral delivery of either vaccine at this dose appears to be nonhazardous to pregnant pronghorn.

  1. International Clostridium difficile animal strain collection and large diversity of animal associated strains

    DEFF Research Database (Denmark)

    Janezic, Sandra; Zidaric, Valerija; Pardon, Bart


    Background: Clostridium difficile is an important cause of intestinal infections in some animal species and animals might be a reservoir for community associated human infections. Here we describe a collection of animal associated C. difficile strains from 12 countries based on inclusion criteria...... of one strain (PCR ribotype) per animal species per laboratory. Results: Altogether 112 isolates were collected and distributed into 38 PCR ribotypes with agarose based approach and 50 PCR ribotypes with sequencer based approach. Four PCR ribotypes were most prevalent in terms of number of isolates...... as well as in terms of number of different host species: 078 (14.3% of isolates; 4 hosts), 014/020 (11.6%; 8 hosts); 002 (5.4%; 4 hosts) and 012 (5.4%; 5 hosts). Two animal hosts were best represented; cattle with 31 isolates (20 PCR ribotypes; 7 countries) and pigs with 31 isolates (16 PCR ribotypes; 10...

  2. High strain and strain-rate behaviour of PTFE/aluminium/tungsten mixtures

    International Nuclear Information System (INIS)

    Addiss, John; Walley, Stephen; Proud, William; Cai Jing; Nesterenko, Vitali


    Conventional drop-weight techniques were modified to accommodate low-amplitude force transducer signals from low-strength, cold isostatically pressed 'heavy' composites of polytetrafluoroethylene, aluminum and tungsten (W). The failure strength, strain and the post-critical behavior of failed samples were measured for samples of different porosity and tungsten grain size. Unusual phenomenon of significantly higher strength (55 MPa) of porous composites (density 5.9 g/cm 3 ) with small W particles ( 3 ) with larger W particles (44 μm) at the same volume content of components was observed. This is attributed to force chains created by a network of small W particles. Interrupted tests at different levels of strain revealed the mechanisms of fracture under dynamic compression

  3. Draft genome sequences of eight bacteria isolated from the indoor environment: Staphylococcus capitis strain H36, S. capitis strain H65, S. cohnii strain H62, S. hominis strain H69, Microbacterium sp. strain H83, Mycobacterium iranicum strain H39, Plantibacter sp. strain H53, and Pseudomonas oryzihabitans strain H72. (United States)

    Lymperopoulou, Despoina S; Coil, David A; Schichnes, Denise; Lindow, Steven E; Jospin, Guillaume; Eisen, Jonathan A; Adams, Rachel I


    We report here the draft genome sequences of eight bacterial strains of the genera Staphylococcus , Microbacterium, Mycobacterium, Plantibacter, and Pseudomonas . These isolates were obtained from aerosol sampling of bathrooms of five residences in the San Francisco Bay area. Taxonomic classifications as well as the genome sequence and gene annotation of the isolates are described. As part of the "Built Environment Reference Genome" project, these isolates and associated genome data provide valuable resources for studying the microbiology of the built environment.

  4. Comparative genomic and functional analysis of 100 Lactobacillus rhamnosus strains and their comparison with strain GG.

    Directory of Open Access Journals (Sweden)

    François P Douillard

    Full Text Available Lactobacillus rhamnosus is a lactic acid bacterium that is found in a large variety of ecological habitats, including artisanal and industrial dairy products, the oral cavity, intestinal tract or vagina. To gain insights into the genetic complexity and ecological versatility of the species L. rhamnosus, we examined the genomes and phenotypes of 100 L. rhamnosus strains isolated from diverse sources. The genomes of 100 L. rhamnosus strains were mapped onto the L. rhamnosus GG reference genome. These strains were phenotypically characterized for a wide range of metabolic, antagonistic, signalling and functional properties. Phylogenomic analysis showed multiple groupings of the species that could partly be associated with their ecological niches. We identified 17 highly variable regions that encode functions related to lifestyle, i.e. carbohydrate transport and metabolism, production of mucus-binding pili, bile salt resistance, prophages and CRISPR adaptive immunity. Integration of the phenotypic and genomic data revealed that some L. rhamnosus strains possibly resided in multiple niches, illustrating the dynamics of bacterial habitats. The present study showed two distinctive geno-phenotypes in the L. rhamnosus species. The geno-phenotype A suggests an adaptation to stable nutrient-rich niches, i.e. milk-derivative products, reflected by the alteration or loss of biological functions associated with antimicrobial activity spectrum, stress resistance, adaptability and fitness to a distinctive range of habitats. In contrast, the geno-phenotype B displays adequate traits to a variable environment, such as the intestinal tract, in terms of nutrient resources, bacterial population density and host effects.

  5. Comparative Genomic and Functional Analysis of 100 Lactobacillus rhamnosus Strains and Their Comparison with Strain GG (United States)

    Pietilä, Taija E.; Järvinen, Hanna M.; Messing, Marcel; Randazzo, Cinzia L.; Paulin, Lars; Laine, Pia; Ritari, Jarmo; Caggia, Cinzia; Lähteinen, Tanja; Brouns, Stan J. J.; Satokari, Reetta; von Ossowski, Ingemar; Reunanen, Justus; Palva, Airi; de Vos, Willem M.


    Lactobacillus rhamnosus is a lactic acid bacterium that is found in a large variety of ecological habitats, including artisanal and industrial dairy products, the oral cavity, intestinal tract or vagina. To gain insights into the genetic complexity and ecological versatility of the species L. rhamnosus, we examined the genomes and phenotypes of 100 L. rhamnosus strains isolated from diverse sources. The genomes of 100 L. rhamnosus strains were mapped onto the L. rhamnosus GG reference genome. These strains were phenotypically characterized for a wide range of metabolic, antagonistic, signalling and functional properties. Phylogenomic analysis showed multiple groupings of the species that could partly be associated with their ecological niches. We identified 17 highly variable regions that encode functions related to lifestyle, i.e. carbohydrate transport and metabolism, production of mucus-binding pili, bile salt resistance, prophages and CRISPR adaptive immunity. Integration of the phenotypic and genomic data revealed that some L. rhamnosus strains possibly resided in multiple niches, illustrating the dynamics of bacterial habitats. The present study showed two distinctive geno-phenotypes in the L. rhamnosus species. The geno-phenotype A suggests an adaptation to stable nutrient-rich niches, i.e. milk-derivative products, reflected by the alteration or loss of biological functions associated with antimicrobial activity spectrum, stress resistance, adaptability and fitness to a distinctive range of habitats. In contrast, the geno-phenotype B displays adequate traits to a variable environment, such as the intestinal tract, in terms of nutrient resources, bacterial population density and host effects. PMID:23966868

  6. Draft genome sequences of eight bacteria isolated from the indoor environment: Staphylococcus capitis strain H36, S. capitis strain H65, S. cohnii strain H62, S. hominis strain H69, Microbacterium sp. strain H83, Mycobacterium iranicum strain H39, Plantibacter sp. strain H53, and Pseudomonas oryzihabitans strain H72


    Lymperopoulou, Despoina S.; Coil, David A.; Schichnes, Denise; Lindow, Steven E.; Jospin, Guillaume; Eisen, Jonathan A.; Adams, Rachel I.


    We report here the draft genome sequences of eight bacterial strains of the genera Staphylococcus, Microbacterium, Mycobacterium, Plantibacter, and Pseudomonas. These isolates were obtained from aerosol sampling of bathrooms of five residences in the San Francisco Bay area. Taxonomic classifications as well as the genome sequence and gene annotation of the isolates are described. As part of the ?Built Environment Reference Genome? project, these isolates and associated genome data provide val...

  7. Effects of gauge volume on pseudo-strain induced in strain measurement using time-of-flight neutron diffraction

    International Nuclear Information System (INIS)

    Suzuki, Hiroshi; Harjo, Stefanus; Abe, Jun; Xu, Pingguang; Aizawa, Kazuya; Akita, Koichi


    Spurious or pseudo-strains observed in time-of-flight (TOF) neutron diffraction due to neutron attenuation, surface-effects and a strain distribution within the gauge volume were investigated. Experiments were carried out on annealed and bent ferritic steel bars to test these effects. The most representative position in the gauge volume corresponds to the neutron-weighted center of gravity (ncog), which takes into account variations in intensity within the gauge volume due to neutron attenuation and/or absence of material in the gauge volume. The average strain in the gauge volume was observed to be weighted towards the ncog position but following an increase in the size of the gauge volume the weighted average strain was changed because of the change in the ncog position when a strain gradient appeared within the gauge volume. On the other hand, typical pseudo-strains, which are well known, did appear in through-surface strain measurements when the gauge volume was incompletely filled by the sample. Tensile pseudo-strains due to the surface-effect increased near the sample surface and exhibited a similar trend regardless of the size of the gauge volume, while the pseudo-strains increased faster for the smaller gauge volume. Furthermore, a pseudo-strain due to a change in the ncog position was observed even when the gauge volume was perfectly filled in the sample, and it increased with an increase in the size of the gauge volume. These pseudo-strains measured were much larger than those simulated by the conventional modeling, whereas they were simulated by taking into account an incident neutron beam divergence additionally in the model. Therefore, the incident divergence of the incident neutron beam must be carefully designed to avoid pseudo-strains in time-of-flight neutron diffractometry

  8. Systems and Methods for Implementing Bulk Metallic Glass-Based Strain Wave Gears and Strain Wave Gear Components (United States)

    Hofmann, Douglas C. (Inventor); Wilcox, Brian (Inventor)


    Bulk metallic glass-based strain wave gears and strain wave gear components. In one embodiment, a strain wave gear includes: a wave generator; a flexspline that itself includes a first set of gear teeth; and a circular spline that itself includes a second set of gear teeth; where at least one of the wave generator, the flexspline, and the circular spline, includes a bulk metallic glass-based material.

  9. A biogeochemical model of Lake Pusiano (North Italy and its use in the predictability of phytoplankton blooms: first preliminary results

    Directory of Open Access Journals (Sweden)

    Alessandro OGGIONI


    Full Text Available This study reports the first preliminary results of the DYRESM-CAEDYM model application to a mid size sub-alpine lake (Lake Pusiano North Italy. The in-lake modelling is a part of a more general project called Pusiano Integrated Lake/Catchment project (PILE whose final goal is to understand the hydrological and trophic relationship between lake and catchment, supporting the restoration plan of the lake through field data analysis and numerical models. DYRESM is a 1D-3D hydrodynamics model for predicting the vertical profile of temperature, salinity and density. CAEDYM is multi-component ecological model, used here as a phytoplankton-zooplankton processes based model, which includes algorithms to simulate the nutrient cycles within the water column as well as the air-water gas exchanges and the water-sediments fluxes. The first results of the hydrodynamics simulations underline the capability of the model to accurately simulate the surface temperature seasonal trend and the thermal gradient whereas, during summer stratification, the model underestimates the bottom temperature of around 2 °C. The ecological model describes the epilimnetic reactive phosphorus (PO4 depletion (due to the phytoplankton uptake and the increase in PO4 concentrations in the deepest layers of the lake (due to the mineralization processes and the sediments release. In terms of phytoplankton dynamics the model accounts for the Planktothrix rubescens dominance during the whole season, whereas it seems to underestimate the peak in primary production related to both the simulated algal groups (P. rubescens and the rest of the other species aggregated in a single class. The future aims of the project are to complete the model parameterization and to connect the in-lake and the catchment modelling in order to gain an integrated view of the lake-catchment ecosystem as well as to develop a three dimensional model of the lake.

  10. Genetic analysis of Saccharomyces cerevisiae strains isolated from palm wine in eastern Nigeria. Comparison with other African strains. (United States)

    Ezeronye, O U; Legras, J-L


    To study the yeast diversity of Nigerian palm wines by comparison with other African strains. Twenty-three Saccharomyces cerevisiae strains were obtained from palm wine samples collected at four locations in eastern Nigeria, and characterized using different molecular techniques: internal transcribed spacer restriction fragment length polymorphism and sequence analysis, pulsed field gel electrophoresis, inter delta typing and microsatellite multilocus analysis. These techniques revealed that palm wine yeasts represent a group of closely related strains that includes other West African isolates (CBS400, NCYC110, DVPG6044). Population analysis revealed an excess of homozygote strains and an allelic richness similar to wine suggestive of local domestication. Several other African yeast strains were not connected to this group. Ghana sorghum beer strains and other African strains (DBVPG1853 and MUCL28071) displayed strikingly high relatedness with European bread, beer or wine strains, and the genome of strain MUCL30909 contained African and wine-type alleles, indicating its hybrid origin. Nigerian palm wine yeast represents a local specific yeast flora, whereas a European origin or hybrid was suspected for several other Africa isolates. This study presents the first genetic characterization of an autochthonous African palm wine yeast population and confirms the idea that human intervention has favoured yeast migration.

  11. Material Properties Test to Determine Ultimate Strain and True Stress-True Strain Curves for High Yield Steels

    Energy Technology Data Exchange (ETDEWEB)

    K.R. Arpin; T.F. Trimble


    This testing was undertaken to develop material true stress-true strain curves for elastic-plastic material behavior for use in performing transient analysis. Based on the conclusions of this test, the true stress-true strain curves derived herein are valid for use in elastic-plastic finite element analysis for structures fabricated from these materials. In addition, for the materials tested herein, the ultimate strain values are greater than those values cited as the limits for the elastic-plastic strain acceptance criteria for transient analysis.

  12. The Genetically Remote Pathogenic Strain NVH391-98 of the Bacillus cereus Group Represents the Cluster of Thermophilic Strains

    Energy Technology Data Exchange (ETDEWEB)

    Auger, Sandrine; Galleron, Nathalie; Bidnenko, Elena; Ehrlich, S. Dusko; Lapidus, Alla; Sorokin, Alexei


    Bacteria of the Bacillus cereus group are known to cause food poisoning. A rare phylogenetically remote strain, NVH391-98, was recently characterized to encode a particularly efficient cytotoxin K presumably responsible for food poisoning. This pathogenic strain and its close relatives can be phenotypically distinguished from other strains of the B. cereus group by the inability to grow at temperatures below 17 degrees C and by the ability to grow at temperatures from 48 to 53 degrees C. A temperate phage, phBC391A2, residing in the genome of NVH391-98 allows us to distinguish the three known members of this thermophilic strain cluster.

  13. Origin of the Strain Sensitivity for an Organic Heptazole Thin-Film and Its Strain Gauge Application (United States)

    Bae, Heesun; Jeon, Pyo Jin; Park, Ji Hoon; Lee, Kimoon


    The authors report on the origin of the strain sensitivity for an organic C26H16N2 (heptazole) thinfilm and its application for the detection of tensile strain. From the electrical characterization on the thin-film transistor adopting a heptazole channel, heptazole film exhibits p-channel conduction with a relatively low value of field-effect mobility (0.05 cm2/Vs), suggesting a hopping conduction behavior via hole carriers. By analyzing the strain and temperature dependences of the electrical conductivity, we reveal that the electrical conduction for a heptazole thin-film is dominated by the variable range hopping process with quite a large energy separation (224.9 meV) between the localized states under a relatively long attenuation length (10.46 Å). This indicates that a change in the inter-grain spacing that is much larger than the attenuation length is responsible for the reversible modification of electrical conductivity depending on strain for the heptazole film. By utilizing our heptazole thin-film both as a strain sensitive passive resistor and an active semiconducting channel layer, we can achieve a strain gauge device exhibiting reversible endurance for tensile strains up to 2.12%. Consequently, this study advances the understanding of the fundamental strain sensing mechanism in a heptazole thin-film toward finding a promise material with a strain gauge for applications as potential flexible devices and/or wearable electronics.

  14. Intraspecies diversity of Lactobacillus sakei response to oxidative stress and variability of strain performance in mixed strains challenges. (United States)

    Guilbaud, Morgan; Zagorec, Monique; Chaillou, Stéphane; Champomier-Vergès, Marie-Christine


    Lactobacillus sakei is a meat-borne lactic acid bacterium species exhibiting a wide genomic diversity. We have investigated the diversity of response to various oxidative compounds, between L. sakei strains, among a collection representing the genomic diversity. We observed various responses to the different compounds as well as a diversity of response depending on the aeration conditions used for cell growth. A principal component analysis revealed two main phenotypic groups, partially correlating with previously described genomic clusters. We designed strains mixes composed of three different strains, in order to examine the behavior of each strain, when cultured alone or in the presence of other strains. The strains composing the mixtures were chosen as diverse as possible, i.e. exhibiting diverse responses to oxidative stress and belonging to different genomic clusters. Growth and survival rates of each strain were monitored under various aeration conditions, with or without heme supplementation. The results obtained suggest that some strains may act as "helper" or "burden" strains depending on the oxidative conditions encountered during incubation. This study confirms that resistance to oxidative stress is extremely variable within the L. sakei species and that this property should be considered when investigating starter performance in the complex meat bacterial ecosystems. Copyright © 2011 Elsevier Ltd. All rights reserved.

  15. Molecular characterization of the probiotic strain Bacillus cereus var. toyoi NCIMB 40112 and differentiation from food poisoning strains. (United States)

    Klein, Günter


    Bacillus cereus var. toyoi strain NCIMB 40112 (Toyocerin), a probiotic authorized in the European Union as feed additive for swine, bovines, poultry, and rabbits, was characterized by DNA fingerprinting applying pulsed-field gel electrophoresis and multilocus sequence typing and was compared with reference strains (of clinical and environmental origins). The probiotic strain was clearly characterized by pulsed-field gel electrophoresis using the restriction enzymes Apa I and Sma I resulting in unique DNA patterns. The comparison to the clinical reference strain B. cereus DSM 4312 was done with the same restriction enzymes, and again a clear differentiation of the two strains was possible by the resulting DNA patterns. The use of the restriction enzymes Apa I and Sma I is recommended for further studies. Furthermore, multilocus sequence typing analysis revealed a sequence type (ST 111) that was different from all known STs of B. cereus strains from food poisoning incidents. Thus, a strain characterization and differentiation from food poisoning strains for the probiotic strain was possible. Copyright ©, International Association for Food Protection

  16. Strain Rate Effect on Tensile Behavior for a High Specific Strength Steel: From Quasi-Static to Intermediate Strain Rates

    Directory of Open Access Journals (Sweden)

    Wei Wang


    Full Text Available The strain rate effect on the tensile behaviors of a high specific strength steel (HSSS with dual-phase microstructure has been investigated. The yield strength, the ultimate strength and the tensile toughness were all observed to increase with increasing strain rates at the range of 0.0006 to 56/s, rendering this HSSS as an excellent candidate for an energy absorber in the automobile industry, since vehicle crushing often happens at intermediate strain rates. Back stress hardening has been found to play an important role for this HSSS due to load transfer and strain partitioning between two phases, and a higher strain rate could cause even higher strain partitioning in the softer austenite grains, delaying the deformation instability. Deformation twins are observed in the austenite grains at all strain rates to facilitate the uniform tensile deformation. The B2 phase (FeAl intermetallic compound is less deformable at higher strain rates, resulting in easier brittle fracture in B2 particles, smaller dimple size and a higher density of phase interfaces in final fracture surfaces. Thus, more energy need be consumed during the final fracture for the experiments conducted at higher strain rates, resulting in better tensile toughness.

  17. Analysis of strain distribution and critical current of superconductors based on a strain-critical current measurement system

    International Nuclear Information System (INIS)

    Liu Fang; Wu Yu; Long Feng


    Based on Pacman device which is widely used to investigate the axial strain dependence of the critical current in superconductors, the finite element analysis method is employed to carry out the force analysis of the spring and the superconducting strand, thereby the axial and lateral strain distributions of the superconducting strand are obtained. According to the two extreme assumptions(low inter-filament resistance and high inter-filament resistance), the effects of the strain homogeneity at the cross section of the superconductor on the critical current is analyzed combined with the Nb 3 Sn deviatoric strain-critical current scaling law. (authors)

  18. Enterococcus faecium strains characterization through polymorphism study of VNTR loci

    Directory of Open Access Journals (Sweden)

    Belteghi, C.,


    Full Text Available Enterococci are commensally bacteria of the gastrointestinal and female genital tract in humans and some mammals and birds, and one of the significant causes of hospital-acquired infections, especially in immuno-compromised patients. Genetic fingerprinting (DNA fingerprinting is a tool for identifying, marking and prevention of infectious agents dissemination. SSR (short sequence repeat are known to suffer frequent variations in the number of repetitive units.MLVA (multiple locus variable number tandem repeats analysis is a variant of genetic fingerprinting, in epidemiological studies on the pathogenetic Enterococcus faecium. Our study included laboratory Enterococcus faecium strains or isolated from clinical cases or from the environment (2003-2008. All analyzed strains of Enterococcus faecium were sensitive to vancomycin, except BM4147, and resistant to oxacilin. Strains isolated from the birds’ samples have shown a smaller resistance profile than those of human origin. 33 Enterococus faecium strains were analyzed by PCR amplification. 27 MT (VNTR profiles were obtained: six in the case of the strains isolated from birds, 15 in the case of the strains isolated form humans, 4 in the case of the collection strains and 2 in the case of the strains isolated from water samples. Among the strains isolated from humans and those isolated from animals, identical profiles were not recorded. Within the strains isolated from clinical cases, and those isolated from birds, circulating genotypes were noted, which can be considered as epidemical. The strains used as probiotics proved to be different from those circulating in birds. All MLVA profiles codes compared with those published on line in the UMC Utrecht database proved to be different. Results obtained in this study support the usefulness of the polymorphic VNTR analysis, as genetic marker, inepidemiological investigations.

  19. Fumonisin and Ochratoxin Production in Industrial Aspergillus niger Strains (United States)

    Frisvad, Jens C.; Larsen, Thomas O.; Thrane, Ulf; Meijer, Martin; Varga, Janos; Samson, Robert A.; Nielsen, Kristian F.


    Aspergillus niger is perhaps the most important fungus used in biotechnology, and is also one of the most commonly encountered fungi contaminating foods and feedstuffs, and occurring in soil and indoor environments. Many of its industrial applications have been given GRAS status (generally regarded as safe). However, A. niger has the potential to produce two groups of potentially carcinogenic mycotoxins: fumonisins and ochratoxins. In this study all available industrial and many non-industrial strains of A. niger (180 strains) as well as 228 strains from 17 related black Aspergillus species were examined for mycotoxin production. None of the related 17 species of black Aspergilli produced fumonisins. Fumonisins (B2, B4, and B6) were detected in 81% of A. niger, and ochratoxin A in 17%, while 10% of the strains produced both mycotoxins. Among the industrial strains the same ratios were 83%, 33% and 26% respectively. Some of the most frequently used strains in industry NRRL 337, 3112 and 3122 produced both toxins and several strains used for citric acid production were among the best producers of fumonisins in pure agar culture. Most strains used for other biotechnological processes also produced fumonisins. Strains optimized through random mutagenesis usually maintained their mycotoxin production capability. Toxigenic strains were also able to produce the toxins on media suggested for citric acid production with most of the toxins found in the biomass, thereby questioning the use of the remaining biomass as animal feed. In conclusion it is recommended to use strains of A. niger with inactive or inactivated gene clusters for fumonisins and ochratoxins, or to choose isolates for biotechnological uses in related non-toxigenic species such as A. tubingensis, A. brasiliensis, A vadensis or A. acidus, which neither produce fumonisins nor ochratoxins. PMID:21853139

  20. Role Strain in Collegiate Athletic Training Approved Clinical Instructors (United States)

    Henning, Jolene M; Weidner, Thomas G


    Context: Certified athletic trainers who serve as Approved Clinical Instructors (ACIs) in the collegiate setting are balancing various roles (eg, patient care and related administrative tasks, clinical education). Whether this balancing act is associated with role strain in athletic trainers has not been examined. Objective: To examine the degree of, and contributing factors (eg, socialization experiences, professional and employment demographics, job congruency) to, role strain in collegiate ACIs. Design: Cross-sectional survey design. Setting: Geographically stratified random sample of ACIs affiliated with accredited athletic training education programs at National Collegiate Athletic Association (NCAA) Division I, II, and III institutions. Patients or Other Participants: 118 collegiate ACIs (47 head athletic trainers, 45 assistant athletic trainers, 26 graduate assistant athletic trainers). Main Outcome Measure(s): The Athletic Training ACI Role Strain Inventory, which measures total degree of role strain, 7 subscales of role strain, socialization experiences, professional and employment characteristics, and congruency in job responsibilities. Results: A total of 49% (n  =  58) of the participants experienced a moderate to high degree of role strain. Role Overload was the highest contributing subscale to total role strain. No differences were noted between total role strain and role occupant groups, NCAA division, or sex. Graduate assistant athletic trainers experienced a greater degree of role incompetence than head athletic trainers did (P  =  .001). Division II ACIs reported a greater degree of inter-role conflict than those in Division I (P  =  .02). Female ACIs reported a greater degree of role incompetence than male ACIs (P  =  .01). Those ACIs who stated that the ACI training provided by their institution did not adequately prepare them for the role as an ACI experienced greater role strain (P < .001). Conclusions: The ACIs in the

  1. Cardiac biplane strain imaging: initial in vivo experience (United States)

    Lopata, R. G. P.; Nillesen, M. M.; Verrijp, C. N.; Singh, S. K.; Lammens, M. M. Y.; van der Laak, J. A. W. M.; van Wetten, H. B.; Thijssen, J. M.; Kapusta, L.; de Korte, C. L.


    In this study, first we propose a biplane strain imaging method using a commercial ultrasound system, yielding estimation of the strain in three orthogonal directions. Secondly, an animal model of a child's heart was introduced that is suitable to simulate congenital heart disease and was used to test the method in vivo. The proposed approach can serve as a framework to monitor the development of cardiac hypertrophy and fibrosis. A 2D strain estimation technique using radio frequency (RF) ultrasound data was applied. Biplane image acquisition was performed at a relatively low frame rate (dogs with an aortic stenosis. Initial results reveal the feasibility of measuring large radial, circumferential and longitudinal cumulative strain (up to 70%) at a frame rate of 100 Hz. Mean radial strain curves of a manually segmented region-of-interest in the infero-lateral wall show excellent correlation between the measured strain curves acquired in two perpendicular planes. Furthermore, the results show the feasibility and reproducibility of assessing radial, circumferential and longitudinal strains simultaneously. In this preliminary study, three beagles developed an elevated pressure gradient over the aortic valve (Δp: 100-200 mmHg) and myocardial hypertrophy. One dog did not develop any sign of hypertrophy (Δp = 20 mmHg). Initial strain (rate) results showed that the maximum strain (rate) decreased with increasing valvular stenosis (-50%), which is in accordance with previous studies. Histological findings corroborated these results and showed an increase in fibrotic tissue for the hearts with larger pressure gradients (100, 200 mmHg), as well as lower strain and strain rate values.

  2. Cardiac biplane strain imaging: initial in vivo experience

    Energy Technology Data Exchange (ETDEWEB)

    Lopata, R G P; Nillesen, M M; Thijssen, J M; De Korte, C L [Clinical Physics Laboratory, Radboud University Nijmegen Medical Centre, Nijmegen (Netherlands); Verrijp, C N; Lammens, M M Y; Van der Laak, J A W M [Department of Pathology, Radboud University Nijmegen Medical Centre, Nijmegen (Netherlands); Singh, S K; Van Wetten, H B [Department of Cardiothoracic Surgery, Radboud University Nijmegen Medical Centre, Nijmegen (Netherlands); Kapusta, L [Pediatric Cardiology, Department of Pediatrics, Radboud University Nijmegen Medical Centre, Nijmegen (Netherlands)], E-mail:


    In this study, first we propose a biplane strain imaging method using a commercial ultrasound system, yielding estimation of the strain in three orthogonal directions. Secondly, an animal model of a child's heart was introduced that is suitable to simulate congenital heart disease and was used to test the method in vivo. The proposed approach can serve as a framework to monitor the development of cardiac hypertrophy and fibrosis. A 2D strain estimation technique using radio frequency (RF) ultrasound data was applied. Biplane image acquisition was performed at a relatively low frame rate (<100 Hz) using a commercial platform with an RF interface. For testing the method in vivo, biplane image sequences of the heart were recorded during the cardiac cycle in four dogs with an aortic stenosis. Initial results reveal the feasibility of measuring large radial, circumferential and longitudinal cumulative strain (up to 70%) at a frame rate of 100 Hz. Mean radial strain curves of a manually segmented region-of-interest in the infero-lateral wall show excellent correlation between the measured strain curves acquired in two perpendicular planes. Furthermore, the results show the feasibility and reproducibility of assessing radial, circumferential and longitudinal strains simultaneously. In this preliminary study, three beagles developed an elevated pressure gradient over the aortic valve ({delta}p: 100-200 mmHg) and myocardial hypertrophy. One dog did not develop any sign of hypertrophy ({delta}p = 20 mmHg). Initial strain (rate) results showed that the maximum strain (rate) decreased with increasing valvular stenosis (-50%), which is in accordance with previous studies. Histological findings corroborated these results and showed an increase in fibrotic tissue for the hearts with larger pressure gradients (100, 200 mmHg), as well as lower strain and strain rate values.

  3. Cardiac biplane strain imaging: initial in vivo experience

    International Nuclear Information System (INIS)

    Lopata, R G P; Nillesen, M M; Thijssen, J M; De Korte, C L; Verrijp, C N; Lammens, M M Y; Van der Laak, J A W M; Singh, S K; Van Wetten, H B; Kapusta, L


    In this study, first we propose a biplane strain imaging method using a commercial ultrasound system, yielding estimation of the strain in three orthogonal directions. Secondly, an animal model of a child's heart was introduced that is suitable to simulate congenital heart disease and was used to test the method in vivo. The proposed approach can serve as a framework to monitor the development of cardiac hypertrophy and fibrosis. A 2D strain estimation technique using radio frequency (RF) ultrasound data was applied. Biplane image acquisition was performed at a relatively low frame rate (<100 Hz) using a commercial platform with an RF interface. For testing the method in vivo, biplane image sequences of the heart were recorded during the cardiac cycle in four dogs with an aortic stenosis. Initial results reveal the feasibility of measuring large radial, circumferential and longitudinal cumulative strain (up to 70%) at a frame rate of 100 Hz. Mean radial strain curves of a manually segmented region-of-interest in the infero-lateral wall show excellent correlation between the measured strain curves acquired in two perpendicular planes. Furthermore, the results show the feasibility and reproducibility of assessing radial, circumferential and longitudinal strains simultaneously. In this preliminary study, three beagles developed an elevated pressure gradient over the aortic valve (Δp: 100-200 mmHg) and myocardial hypertrophy. One dog did not develop any sign of hypertrophy (Δp = 20 mmHg). Initial strain (rate) results showed that the maximum strain (rate) decreased with increasing valvular stenosis (-50%), which is in accordance with previous studies. Histological findings corroborated these results and showed an increase in fibrotic tissue for the hearts with larger pressure gradients (100, 200 mmHg), as well as lower strain and strain rate values.

  4. Emergent Strain Stiffening in Interlocked Granular Chains (United States)

    Dumont, Denis; Houze, Maurine; Rambach, Paul; Salez, Thomas; Patinet, Sylvain; Damman, Pascal


    Granular chain packings exhibit a striking emergent strain-stiffening behavior despite the individual looseness of the constitutive chains. Using indentation experiments on such assemblies, we measure an exponential increase in the collective resistance force F with the indentation depth z and with the square root of the number N of beads per chain. These two observations are, respectively, reminiscent of the self-amplification of friction in a capstan or in interleaved books, as well as the physics of polymers. The experimental data are well captured by a novel model based on these two ingredients. Specifically, the resistance force is found to vary according to the universal relation log F ˜μ √{N }Φ11 /8z /b , where μ is the friction coefficient between two elementary beads, b is their size, and Φ is the volume fraction of chain beads when semidiluted in a surrounding medium of unconnected beads. Our study suggests that theories normally confined to the realm of polymer physics at a molecular level can be used to explain phenomena at a macroscopic level. This class of systems enables the study of friction in complex assemblies, with practical implications for the design of new materials, the textile industry, and biology.

  5. Strain-induced generation of silicon nanopillars

    International Nuclear Information System (INIS)

    Bollani, Monica; Osmond, Johann; Nicotra, Giuseppe; Spinella, Corrado; Narducci, Dario


    Silicon metal-assisted chemical etching (MACE) is a nanostructuring technique exploiting the enhancement of the silicon etch rate at some metal–silicon interfaces. Compared to more traditional approaches, MACE is a high-throughput technique, and it is one of the few that enables the growth of vertical 1D structures of virtually unlimited length. As such, it has already found relevant technological applications in fields ranging from energy conversion to biosensing. Yet, its implementation has always required metal patterning to obtain nanopillars. Here, we report how MACE may lead to the formation of porous silicon nanopillars even in the absence of gold patterning. We show how the use of inhomogeneous yet continuous gold layers leads to the generation of a stress field causing spontaneous local delamination of the metal—and to the formation of silicon nanopillars where the metal disruption occurs. We observed the spontaneous formation of nanopillars with diameters ranging from 40 to 65 nm and heights up to 1 μm. Strain-controlled generation of nanopillars is consistent with a mechanism of silicon oxidation by hole injection through the metal layer. Spontaneous nanopillar formation could enable applications of this method to contexts where ordered distributions of nanopillars are not required, while patterning by high-resolution techniques is either impractical or unaffordable. (paper)

  6. Microtexture of Strain in electroplated copper interconnects

    International Nuclear Information System (INIS)

    Spolenak, R.; Barr, D.L.; Gross, M.E.; Evans-Lutterodt, K.; Brown, W.L.; Tamura, N.; MacDowell, A.A.; Celestre, R.S.; Padmore, H.A.; Valek, B.C.; Bravman, J.C.; Flinn, P.; Marieb, T.; Keller, R.R.; Batterman, B.W.; Patel, J.R.


    The microstructure of narrow metal conductors in the electrical interconnections on IC chips has often been identified as of major importance in the reliability of these devices. The stresses and stress gradients that develop in the conductors as a result of thermal expansion differences in the materials and of electromigration at high current densities are believed to be strongly dependent on the details of the grain structure. The present work discusses new techniques based on microbeam x-ray diffraction (MBXRD) that have enabled measurement not only of the microstructure of totally encapsulated conductors but also of the local stresses in them on a micron and submicron scale. White x-rays from the Advanced Light Source were focused to a micron spot size by Kirkpatrick-Baez mirrors. The sample was stepped under the micro-beam and Laue images obtained at each sample location using a CCD area detector. Microstructure and local strain were deduced from these images. Cu lines with widths ranging from 0.8 mm to 5 mm and thickness of 1 mm were investigated. Comparisons are made between the capabilities of MBXRD and the well established techniques of broad beam XRD, electron back scatter diffraction (EBSD) and focused ion beam imagining (FIB)

  7. Job strain and the risk of depression: is reporting biased?

    DEFF Research Database (Denmark)

    Kolstad, Henrik; Hansen, Åse Marie; Kærgaard, Anette


    It is unknown whether the relation between job strain and depression reflects causal characteristics of the working environment or reporting bias. The authors investigated reporting bias by analyzing individual versus work-unit measures of job strain and the risk of depressive symptoms (n = 287) ...

  8. Characterization Of Biaxial Strain Of Poly(L-Lactide) Tubes

    DEFF Research Database (Denmark)

    Løvdal, Alexandra Liv Vest; Andreasen, Jens Wenzel; Mikkelsen, Lars Pilgaard


    Poly(L-lactide) (PLLA) in its L-form has promising mechanical properties. Being a semi-crystalline polymer, it can be subjected to strain-induced crystallization at temperatures above Tg and can thereby become oriented. Following a simultaneous (SIM) biaxial strain process or a sequential (SEQ...

  9. Auxetic Mechanical Metamaterials to Enhance Sensitivity of Stretchable Strain Sensors. (United States)

    Jiang, Ying; Liu, Zhiyuan; Matsuhisa, Naoji; Qi, Dianpeng; Leow, Wan Ru; Yang, Hui; Yu, Jiancan; Chen, Geng; Liu, Yaqing; Wan, Changjin; Liu, Zhuangjian; Chen, Xiaodong


    Stretchable strain sensors play a pivotal role in wearable devices, soft robotics, and Internet-of-Things, yet these viable applications, which require subtle strain detection under various strain, are often limited by low sensitivity. This inadequate sensitivity stems from the Poisson effect in conventional strain sensors, where stretched elastomer substrates expand in the longitudinal direction but compress transversely. In stretchable strain sensors, expansion separates the active materials and contributes to the sensitivity, while Poisson compression squeezes active materials together, and thus intrinsically limits the sensitivity. Alternatively, auxetic mechanical metamaterials undergo 2D expansion in both directions, due to their negative structural Poisson's ratio. Herein, it is demonstrated that such auxetic metamaterials can be incorporated into stretchable strain sensors to significantly enhance the sensitivity. Compared to conventional sensors, the sensitivity is greatly elevated with a 24-fold improvement. This sensitivity enhancement is due to the synergistic effect of reduced structural Poisson's ratio and strain concentration. Furthermore, microcracks are elongated as an underlying mechanism, verified by both experiments and numerical simulations. This strategy of employing auxetic metamaterials can be further applied to other stretchable strain sensors with different constituent materials. Moreover, it paves the way for utilizing mechanical metamaterials into a broader library of stretchable electronics. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  10. From Measurements Errors to a New Strain Gauge Design

    DEFF Research Database (Denmark)

    Mikkelsen, Lars Pilgaard; Zike, Sanita; Salviato, Marco


    Significant over-prediction of the material stiffness in the order of 1-10% for polymer based composites has been experimentally observed and numerical determined when using strain gauges for strain measurements instead of non-contact methods such as digital image correlation or less stiff method...

  11. Emotional distress and strain in relatives of patients with severe ...

    African Journals Online (AJOL)

    The levels of emotional distress and strain were examined in two groups of relatives of psychiatric patients using standard instruments. The dementia group had more GHQ - 30 cases than the schizophrenic group. Even though the schizophrenic relatives had higher distress and strain scores than the dementia relatives, ...

  12. Effect of biosurfactant from two strains of Pseudomonas on ...

    African Journals Online (AJOL)

    Two Pseudomonas strains isolated from oil-contaminated soil which produce biosurfactant were studied. The biosurfactant containing broth formed stable emulsions with liquid light paraffin, cooking medium vegetable oil and toluene. The strains under study produce extra cellular biosurfactant in the culture media.

  13. Inoculation effects of two South African cyanobacteria strains on ...

    African Journals Online (AJOL)

    Two South African cyanobacteria strains (coded 3g and 7e) of the genus Nostoc were evaluated for improvement of the aggregate stability of a silty loam soil with low organic C content and compared with Nostoc strain 9v isolated from a Tanzanian soil. The soil was either cropped with maize or non-cropped and inoculated ...

  14. 38 CFR 4.58 - Arthritis due to strain. (United States)


    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Arthritis due to strain... FOR RATING DISABILITIES Disability Ratings The Musculoskeletal System § 4.58 Arthritis due to strain. With service incurred lower extremity amputation or shortening, a disabling arthritis, developing in...

  15. Conduction gap in graphene strain junctions: direction dependence

    International Nuclear Information System (INIS)

    Nguyen, M Chung; Nguyen, V Hung; Dollfus, P; Nguyen, Huy-Viet


    It has been shown in a recent study (Nguyen et al 2014 Nanotechnology 25 165201) that unstrained/strained graphene junctions are promising candidates to improve the performance of graphene transistors which is usually hindered by the gapless nature of graphene. Although the energy bandgap of strained graphene still remains zero, the shift of Dirac points in the k-space due to strain-induced deformation of graphene lattice can lead to the appearance of a finite conduction gap of several hundred meV in strained junctions with a strain of only a few per cent. However, since it depends essentially on the magnitude of the Dirac point shift, this conduction gap strongly depends on the direction of applied strain and the transport direction. In this work, a systematic study of conduction-gap properties with respect to these quantities is presented and the results are carefully analyzed. Our study provides useful information for further investigations to exploit graphene-strained junctions in electronic applications and strain sensors. (paper)

  16. Isolation and characterization of lipase-producing Bacillus strains ...

    African Journals Online (AJOL)

    Bacillus strains (B1 - B5) producing extra cellular lipase were isolated from the soil sample of coconut oil industry. The strains were identified by morphological and biochemical characters. Growth of the organisms and lipase production were measured with varying pH (4 - 9) temperature (27, 37 and 47ºC) and various ...

  17. Characterization of Bacillus thuringiensis strains from Jordan and ...

    African Journals Online (AJOL)

    Eight serotypes with Bacillus thuringiensis israelensis being the most common. Out of the twenty-six isolated strains, five strains (serotype: kenyae, kurstaki, kurstaki HD1 and thuringiensis) that produced bipyramid crystal proteins were toxic to the lepidoptera larvae of Ephestia kuehniella Zeller. The SDS-PAGE protein ...

  18. Degradation of 4-fluorophenol by Arthrobacter sp strain IF1

    NARCIS (Netherlands)

    Ferreira, Maria Isabel M.; Marchesi, Julian R.; Janssen, Dick B.

    A Gram-positive bacterial strain capable of aerobic biodegradation of 4-fluorophenol (4-FP) as the sole source of carbon and energy was isolated by selective enrichment from soil samples collected near an industrial site. The organism, designated strain IF1, was identified as a member of the genus

  19. Evaluation of antifungal activity from Bacillus strains against ...

    African Journals Online (AJOL)

    In this study, 30 bacterial strains isolated from marine biofilms were screened for their antifungal activity against Rhizoctonia solani by dual culture assay. Two bacterial strains, Bacillus subtilis and Bacillus cereus, showed a clear antagonism against R. solani on potato dextrose agar (PDA) medium. The antagonistic activity ...

  20. Response of single polymers to localized step strains

    NARCIS (Netherlands)

    Panja, D.


    In this paper, the response of single three-dimensional phantom and self-avoiding polymers to localized step strains are studied for two cases in the absence of hydrodynamic interactions: (i) Polymers tethered at one end with the strain created at the point of tether, and (ii) free polymers with the

  1. Changes occurring in plain, straining and winter yoghurt during the ...

    African Journals Online (AJOL)

    In this study, winter yoghurt, straining yoghurt and yoghurt samples produced from homogenized and non-homogenized sheep and a mixture of sheep and cows milks were evaluated during the storage periods. Winter yoghurt, straining yoghurt and yoghurt samples were stored in sterile jars in the refrigerator (4°C).

  2. Twinning in copper deformed at high strain rates

    Indian Academy of Sciences (India)

    Abstract. Copper samples having varying microstructures were deformed at high strain rates using a split-. Hopkinson pressure bar. Transmission electron microscopy results show deformation twins present in samples that were both annealed and strained, whereas samples that were annealed and left unstrained, as well ...

  3. Manumycin from a new Streptomyces strain shows antagonistic ...

    African Journals Online (AJOL)

    Manumycin from a new Streptomyces strain shows antagonistic effect against methicillin-resistant Staphylococcus aureus (MRSA)/vancomycin-resistant enterococci (VRE) strains from Korean Hospitals. Yun Hee Choi, Seung Sik Cho, Jaya Ram Simkhada, Chi Nam Seong, Hyo Jeong Lee, Hong Seop Moon, Jin Cheol Yoo ...

  4. Strain gauge measurement uncertainties on hydraulic turbine runner blade

    International Nuclear Information System (INIS)

    Arpin-Pont, J; Gagnon, M; Tahan, S A; Coutu, A; Thibault, D


    Strains experimentally measured with strain gauges can differ from those evaluated using the Finite Element (FE) method. This difference is due mainly to the assumptions and uncertainties inherent to each method. To circumvent this difficulty, we developed a numerical method based on Monte Carlo simulations to evaluate measurement uncertainties produced by the behaviour of a unidirectional welded gauge, its position uncertainty and its integration effect. This numerical method uses the displacement fields of the studied part evaluated by an FE analysis. The paper presents a study case using in situ data measured on a hydraulic turbine runner. The FE analysis of the turbine runner blade was computed, and our numerical method used to evaluate uncertainties on strains measured at five locations with welded strain gauges. Then, measured strains and their uncertainty ranges are compared to the estimated strains. The uncertainty ranges obtained extended from 74 με to 165 με. Furthermore, the biases observed between the median of the uncertainty ranges and the FE strains varied from −36 to 36 με. Note that strain gauge measurement uncertainties depend mainly on displacement fields and gauge geometry.

  5. Gender, General Strain Theory, Negative Emotions, and Disordered Eating (United States)

    Piquero, Nicole Leeper; Fox, Kristan; Piquero, Alex R.; Capowich, George; Mazerolle, Paul


    Much of the prior work on General Strain Theory (GST) has focused on how strain and negative emotions interrelate to produce criminal--especially violent--activity. Very little research has extended GST to examine other types of non-criminal, negative behavior, such as self-harming behaviors associated with disordered eating, a traditionally…

  6. Study of probiotic potential of four wild Lactobacillus rhamnosus strains. (United States)

    Tuo, Yanfeng; Zhang, Weiqin; Zhang, Lanwei; Ai, Lianzhong; Zhang, Yingchun; Han, Xue; Yi, Huaxi


    The four wild Lactobacillus rhamnosus strains were examined in vitro for resistance to simulated gastro and intestinal juices, adhesion to HT-29 cells, antagonistic activity against enteric pathogens and immunomodulating activity. The strains L. rhamnosus SB5L, J5L and IN1L were able to survive in simulated gastro juice while the strain L. rhamnosus SB31L lost viability exposed to simulated gastro juice for 3 h. The four strains had high viability in simulated small intestinal juice with little loss (<1.0 cycle reduction). The strains SB5L, J5L and IN1L antagonized against Escherichia coli ATCC 25922, Salmonella enterica serovar Typhimurium ATCC 14028, Shigella sonnei ATCC 25931. The strain L. rhamnosus IN1L had the highest adhesive capability to HT-29 cells in vitro (251 bacteria cells per 100 HT-29 cells) compared to the other three L. rhamnosus strains. The live bacteria, cell wall and DNA of the four L. rhamnosus induced the secretion of pro-inflammatory cytokines IL-12 (p70), IFN-γ and TNF-α by human peripheral blood mononuclear cells (PBMCs). The levels of IL-12 (p70), IFN-γ and TNF-α produced by stimulated PBMCs were significantly higher (P < 0.05) than those of the control. Those data indicated that the four L. rhamnosus strains have the potential as the probiotic for human being use, although further studies are still needed. Crown Copyright © 2013. Published by Elsevier Ltd. All rights reserved.

  7. Triacetic acid lactone production in industrial Saccharomyces yeast strains (United States)

    Triacetic acid lactone (TAL) is a potential platform chemical that can be produced in yeast. To evaluate the potential for industrial yeast strains to produce TAL, the g2ps1 gene encoding 2-pyrone synthase was transformed into thirteen industrial yeast strains of varied genetic background. TAL produ...

  8. Assessment of mechanical strain in the intact plantar fascia. (United States)

    Clark, Ross A; Franklyn-Miller, Andrew; Falvey, Eanna; Bryant, Adam L; Bartold, Simon; McCrory, Paul


    A method of measuring tri-axial plantar fascia strain that is minimally affected by external compressive force has not previously been reported. The purpose of this study was to assess the use of micro-strain gauges to examine strain in the different axes of the plantar fascia. Two intact limbs from a thawed, fresh-frozen cadaver were dissected, and a combination of five linear and one three-way rosette gauges were attached to the fascia of the foot and ankle. Strain was assessed during two trials, both consisting of an identical controlled, loaded dorsiflexion. An ICC analysis of the results revealed that the majority of gauge placement sites produced reliable measures (ICC>0.75). Strain mapping of the plantar fascia indicates that the majority of the strain is centrally longitudinal, which provides supportive evidence for finite element model analysis. Although micro-strain gauges do possess the limitation of calibration difficulty, they provide a repeatable measure of fascial strain and may provide benefits in situations that require tri-axial assessment or external compression.

  9. MM98.36 Strain Paths in Extrusion

    DEFF Research Database (Denmark)

    Lindegren, Maria; Wiwe, Birgitte; Wanheim, Tarras


    The extrusion process has been investigated for different geometries, in order to study the strain path of different material elements during their movements through the plastic zone. This is done by using the FEM code DEFORM and physical simulation with wax togehter with the coefficient method. ....... Calculations of strain paths have also been performed by ABAQUS....

  10. ANSYS Simulation of Residual Strains in Butt-welded Joints

    Directory of Open Access Journals (Sweden)

    A. Atroshenko


    Full Text Available The effect of thermal-strain cycle on residual strains in thin-walled circular seams of cylindrical shells using TIG butt welds was studied. Estimates were calculated using numerical modelling. The structure was made of corrosion-resistant austenitic steels.

  11. Evaluation of Lactobacillus strains for selected probiotic properties. (United States)

    Turková, Kristýna; Mavrič, Anja; Narat, Mojca; Rittich, Bohuslav; Spanová, Alena; Rogelj, Irena; Matijašić, Bojana Bogovič


    Eleven strains of Lactobacillus collected in the Culture Collection of Dairy Microorganisms (CCDM) were evaluated for selected probiotic properties such as survival in gastrointestinal fluids, antimicrobial activity, and competition with non-toxigenic Escherichia coli O157:H7 for adhesion on Caco-2 cells. The viable count of lactobacilli was reduced during 3-h incubation in gastric fluid followed by 3-h incubation in intestinal fluid. All strains showed antimicrobial activity and the three most effective strains inhibited the growth of at least 16 indicator strains. Antimicrobial metabolites of seven strains active against Lactobacillus and Clostridium indicator strains were found to be sensitive to proteinase K and trypsin, which indicates their proteinaceous nature. The degree of competitive inhibition of non-toxigenic E. coli O157:H7 adhesion on the surface of Caco-2 cells was strain-dependent. A significant decrease (P strains were selected for additional studies of antimicrobial activity, i.e., Lactobacillus gasseri CCDM 215, Lactobacillus acidophilus CCDM 149, and Lactobacillus helveticus CCDM 82.

  12. Potential application of Saccharomyces cerevisiae strains for the ...

    African Journals Online (AJOL)

    This paper aimed at evaluating the fermentation behavior of selected Saccharomyces cerevisiae strains in banana pulp and they were compared with commercial yeast (baker's yeast) for subsequent production of distilled spirits. Five types of microorganisms were used: Four yeast strains obtained from accredited ...

  13. AFLP analysis of genetic diversity in main cultivated strains of ...

    African Journals Online (AJOL)

    Ganoderma mushroom is one of the most prescribed traditional medicines, which has been used for medicinal purposes for centuries particularly in China, Japan, Korea and other Asian countries. In this article, the different strains of Ganoderma spp. used in production and their genetic relations of the closely related strains ...

  14. Strain sensitivity of band gaps of Sn-containing semiconductors

    DEFF Research Database (Denmark)

    Li, Hong; Castelli, Ivano Eligio; Thygesen, Kristian Sommer


    Tuning of band gaps of semiconductors is a way to optimize materials for applications within photovoltaics or as photocatalysts. One way to achieve this is through applying strain to the materials. We investigate the effect of strain on a range of Sn-containing semiconductors using density...

  15. Crack Propagation in Plane Strain under Variable Amplitude Loading

    DEFF Research Database (Denmark)

    Ricardo, Luiz Carlos Hernandes


    . In this paper procedures to determine the crack opening and closure by finite elements analyses in plane strain will be presented. The objective of this paper is also provide a review of retardation models under variable spectrum loading considering plane strain constraint as well as their correlation...

  16. Growth performance of three commercial strains of turkey ...

    African Journals Online (AJOL)

    At 16 weeks of age correlation values for body parts against body weight were mostly negative across the treatment groups. It was evident from the results of this study that any of the turkey strains can be reared for meat without emphasis on plumage except at the discretion of the farmer. Keywords: Turkeys, Strains, Growth ...

  17. Strain measurement on a compact nuclear reactor steam generator

    International Nuclear Information System (INIS)

    Scaldaferri, Denis Henrique Bianchi; Gomes, Paulo de Tarso Vida; Mansur, Tanius Rodrigues; Pozzo, Renato del; Mola, Jairo


    This work presents the strain measurement procedures applied to a compact nuclear reactor steam generator, during a hydrostatic test, using strain gage technology. The test was divided in two steps: primary side test and secondary side test. In the primary side test twelve points for strain measurement using rectangular rosettes, three points (two external and one internal) for temperature measurement using special strain gages and one point for pressure measurement using a pressure transducer were monitored. In the secondary side test 18 points for strain measurement using rectangular rosettes, four points (two external and two internal) for temperature measurement using special strain gages and one point for pressure measurement using a pressure transducer were monitored. The measurement points on both internal and external pressurizer walls were established from pre-calculated stress distribution by means of numerical approach (finite elements modeling). Strain values using a quarter Wheatstone bridge circuit were obtained. Stress values, from experimental strain were determined, and to numerical calculation results were compared. (author)

  18. An embeddable optical strain gauge based on a buckled beam. (United States)

    Du, Yang; Chen, Yizheng; Zhu, Chen; Zhuang, Yiyang; Huang, Jie


    We report, for the first time, a low cost, compact, and novel mechanically designed extrinsic Fabry-Perot interferometer (EFPI)-based optical fiber sensor with a strain amplification mechanism for strain measurement. The fundamental design principle includes a buckled beam with a coated gold layer, mounted on two grips. A Fabry-Perot cavity is produced between the buckled beam and the endface of a single mode fiber (SMF). A ceramic ferrule is applied for supporting and orienting the SMF. The principal sensor elements are packaged and protected by two designed metal shells. The midpoint of the buckled beam will experience a deflection vertically when the beam is subjected to a horizontally/axially compressive displacement. It has been found that the vertical deflection of the beam at midpoint can be 6-17 times larger than the horizontal/axial displacement, which forms the basis of a strain amplification mechanism. The user-configurable buckling beam geometry-based strain amplification mechanism enables the strain sensor to achieve a wide range of strain measurement sensitivities. The designed EFPI was used to monitor shrinkage of a square brick of mortar. The strain was measured during the drying/curing stage. We envision that it could be a good strain sensor to be embedded in civil materials/structures under a harsh environment for a prolonged period of time.

  19. An embeddable optical strain gauge based on a buckled beam (United States)

    Du, Yang; Chen, Yizheng; Zhu, Chen; Zhuang, Yiyang; Huang, Jie


    We report, for the first time, a low cost, compact, and novel mechanically designed extrinsic Fabry-Perot interferometer (EFPI)-based optical fiber sensor with a strain amplification mechanism for strain measurement. The fundamental design principle includes a buckled beam with a coated gold layer, mounted on two grips. A Fabry-Perot cavity is produced between the buckled beam and the endface of a single mode fiber (SMF). A ceramic ferrule is applied for supporting and orienting the SMF. The principal sensor elements are packaged and protected by two designed metal shells. The midpoint of the buckled beam will experience a deflection vertically when the beam is subjected to a horizontally/axially compressive displacement. It has been found that the vertical deflection of the beam at midpoint can be 6-17 times larger than the horizontal/axial displacement, which forms the basis of a strain amplification mechanism. The user-configurable buckling beam geometry-based strain amplification mechanism enables the strain sensor to achieve a wide range of strain measurement sensitivities. The designed EFPI was used to monitor shrinkage of a square brick of mortar. The strain was measured during the drying/curing stage. We envision that it could be a good strain sensor to be embedded in civil materials/structures under a harsh environment for a prolonged period of time.

  20. Study on kinetic of strain-aging in zircaloy-4

    International Nuclear Information System (INIS)

    Gomes, P.A.


    The strain-aging in zircaloy-4 has been investigated in this work and a study of the general problems involving this phenomenon has been realized in Zirconium and its alloys. It has been verified that a yield point appears in the Zircaloy-4, when it is submitted to strain-aging treatment between the temperatures 200 0 C and 400 0 C. (author)