WorldWideScience

Sample records for plain srs sc

  1. Petrology and Geochemistry of Neoproterozoic Arc Plutons Beneath the Atlantic Coastal Plain, SRS, SC

    Energy Technology Data Exchange (ETDEWEB)

    Maryak, M.

    1998-10-21

    In this report is presented first a brief review of the regional geologic setting of the Savannah River Site, descriptions of the plutonic rock units sampled here, whole rock geochemical data on the plutonic igneous rocks, and finally, a discussion of how the crystalline basement rocks of the Savannah River Site formed and how they may correlate with other terranes exposed in the Piedmont of the Carolinas, Georgia, and Virginia.

  2. SRS ECOLOGY ENVIRONMENTAL INFORMATION DOCUMENT

    Energy Technology Data Exchange (ETDEWEB)

    Wike, L; Doug Martin, D; Eric Nelson, E; Nancy Halverson, N; John Mayer, J; Michael Paller, M; Rodney Riley, R; Michael Serrato, M

    2006-03-01

    The SRS Ecology Environmental Information Document (EEID) provides a source of information on the ecology of Savannah River Site (SRS). The SRS is a U.S. Department of Energy (DOE)--owned property on the upper Atlantic Coastal Plain of South Carolina, centered approximately 40 kilometers (25 miles) southeast of Augusta, Georgia. The entire site was designated a National Environmental Research Park in 1972 by the Atomic Energy Commission, the predecessor of DOE. This document summarizes and synthesizes ecological research and monitoring conducted on the three main types of ecosystems found at SRS: terrestrial, wetland and aquatic. It also summarizes the available information on the threatened and endangered species found on the Savannah River Site. SRS is located along the Savannah River and encompasses an area of 80,267 hectares (310 square miles) in three South Carolina counties. It contains diverse habitats, flora, and fauna. Habitats include upland terrestrial areas, wetlands, streams, reservoirs, and the adjacent Savannah River. These diverse habitats support a variety of plants and animals, including many commercially or recreationally valuable species and several rare, threatened, or endangered species. Soils are the basic terrestrial resource, influencing the development of terrestrial biological communities. Many different soils exist on the SRS, from hydric to well-drained, and from sand to clay. In general, SRS soils are predominantly well-drained loamy sands.

  3. SRS ecology: Environmental information document

    Energy Technology Data Exchange (ETDEWEB)

    Wike, L.D.; Shipley, R.W.; Bowers, J.A. [and others

    1993-09-01

    The purpose of this Document is to provide a source of ecological information based on the exiting knowledge gained from research conducted at the Savannah River Site. This document provides a summary and synthesis of ecological research in the three main ecosystem types found at SRS and information on the threatened and endangered species residing there.

  4. Assessment of SRS ambient air monitoring network

    Energy Technology Data Exchange (ETDEWEB)

    Abbott, K. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Jannik, T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-08-03

    Three methodologies have been used to assess the effectiveness of the existing ambient air monitoring system in place at the Savannah River Site in Aiken, SC. Effectiveness was measured using two metrics that have been utilized in previous quantification of air-monitoring network performance; frequency of detection (a measurement of how frequently a minimum number of samplers within the network detect an event), and network intensity (a measurement of how consistent each sampler within the network is at detecting events). In addition to determining the effectiveness of the current system, the objective of performing this assessment was to determine what, if any, changes could make the system more effective. Methodologies included 1) the Waite method of determining sampler distribution, 2) the CAP88- PC annual dose model, and 3) a puff/plume transport model used to predict air concentrations at sampler locations. Data collected from air samplers at SRS in 2015 compared with predicted data resulting from the methodologies determined that the frequency of detection for the current system is 79.2% with sampler efficiencies ranging from 5% to 45%, and a mean network intensity of 21.5%. One of the air monitoring stations had an efficiency of less than 10%, and detected releases during just one sampling period of the entire year, adding little to the overall network intensity. By moving or removing this sampler, the mean network intensity increased to about 23%. Further work in increasing the network intensity and simulating accident scenarios to further test the ambient air system at SRS is planned

  5. Assessment of SRS ambient air monitoring network

    Energy Technology Data Exchange (ETDEWEB)

    Abbott, K. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Jannik, T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-08-03

    Three methodologies have been used to assess the effectiveness of the existing ambient air monitoring system in place at the Savannah River Site in Aiken, SC. Effectiveness was measured using two metrics that have been utilized in previous quantification of air-monitoring network performance; frequency of detection (a measurement of how frequently a minimum number of samplers within the network detect an event), and network intensity (a measurement of how consistent each sampler within the network is at detecting events). In addition to determining the effectiveness of the current system, the objective of performing this assessment was to determine what, if any, changes could make the system more effective. Methodologies included 1) the Waite method of determining sampler distribution, 2) the CAP88- PC annual dose model, and 3) a puff/plume transport model used to predict air concentrations at sampler locations. Data collected from air samplers at SRS in 2015 compared with predicted data resulting from the methodologies determined that the frequency of detection for the current system is 79.2% with sampler efficiencies ranging from 5% to 45%, and a mean network intensity of 21.5%. One of the airmonitoring stations had an efficiency of less than 10%, and detected releases during just one sampling period of the entire year, adding little to the overall network intensity. By moving or removing this sampler, the mean network intensity increased to about 23%. Further work in increasing the network intensity and simulating accident scenarios to further test the ambient air system at SRS is planned

  6. SRS environmental air surveillance program 1954-2015: General trends

    Energy Technology Data Exchange (ETDEWEB)

    Abbott, K. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Jannik, T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-06-02

    The radiological monitoring program at SRS was established under the DuPont Company in June 1951 and was used as a measurement of the effectiveness of plant controls and as an authoritative record of environmental conditions surrounding the plant. It also served as a method of demonstrating compliance with applicable federal regulations and guidance. This document serves as a general summary of changes made specifically to the environmental air monitoring program since its inception, and a discussion of the general trends seen in the air monitoring program at SRS from 1954 to 2015. Initially, the environmental air surveillance program focused not only on releases from SRS but also on fallout from various weapons testing performed through the end of 1978. Flypaper was used to measure the amount of fallout in the atmosphere during this period, and was present at each of the 10 monitoring stations. By 1959, all site stacks were included in the air monitoring program to determine their contribution to the airborne radioactivity onsite, and the number of air surveillance samplers rose to 18. This trend of an increased number of sampling locations continued to a peak of 35 sampling locations before shifting to a downward trend in the mid-1990s. In 1962, 4 outer-range samplers were placed in Savannah and Macon, GA, and in Greenville and Columbia, SC. Until 1976, air samplers were simply placed around the perimeter of the various operation locations (after 1959, this included stacks to determine their contribution to the airborne radioactivity), with the intent of creating as representative a distribution as possible of the air surrounding operations.

  7. Genome-centric evaluation of Burkholderia sp. strain SRS-W-2-2016 resistant to high concentrations of uranium and nickel isolated from the Savannah River Site (SRS, USA

    Directory of Open Access Journals (Sweden)

    Ashish Pathak

    2017-06-01

    Full Text Available Savannah River Site (SRS, an approximately 800-km2 former nuclear weapons production facility located near Aiken, SC remains co-contaminated by heavy metals and radionuclides. To gain a better understanding on microbially-mediated bioremediation mechanisms, several bacterial strains resistant to high concentrations of Uranium (U and Nickel (Ni were isolated from the Steeds Pond soils located within the SRS site. One of the isolated strains, designated as strain SRS-W-2-2016, grew robustly on both U and Ni. To fully understand the arsenal of metabolic functions possessed by this strain, a draft whole genome sequence (WGS was obtained, assembled, annotated and analyzed. Genome-centric evaluation revealed the isolate to belong to the Burkholderia genus with close affiliation to B. xenovorans LB400, an aggressive polychlorinated biphenyl-degrader. At a coverage of 90×, the genome of strain SRS-W-2-2016 consisted of 8,035,584 bases with a total number of 7071 putative genes assembling into 191 contigs with an N50 contig length of 134,675 bases. Several gene homologues coding for resistance to heavy metals/radionuclides were identified in strain SRS-W-2-2016, such as a suite of outer membrane efflux pump proteins similar to nickel/cobalt transporter regulators, peptide/nickel transport substrate and ATP-binding proteins, permease proteins, and a high-affinity nickel-transport protein. Also noteworthy were two separate gene fragments in strain SRS-W-2-2016 homologous to the spoT gene; recently correlated with bacterial tolerance to U. Additionally, a plethora of oxygenase genes were also identified in the isolate, potentially involved in the breakdown of organic compounds facilitating the strain's successful colonization and survival in the SRS co-contaminated soils. The WGS project of Burkholderia sp. strain SRS-W-2-2016 is available at DDBJ/ENA/GenBank under the accession #MSDV00000000.

  8. SRS Geology/Hydrogeology Environmental Information Document

    Energy Technology Data Exchange (ETDEWEB)

    Denham, M.E.

    1999-08-31

    The purpose of the Savannah River Site Geology and Hydrogeology Environmental Information Document (EID) is to provide geologic and hydrogeologic information to serve as a baseline to evaluate potential environmental impacts. This EID is based on a summary of knowledge accumulated from research conducted at the Savannah River Site (SRS) and surrounding areas.

  9. Roadmap to the SRS computing architecture

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, A.

    1994-07-05

    This document outlines the major steps that must be taken by the Savannah River Site (SRS) to migrate the SRS information technology (IT) environment to the new architecture described in the Savannah River Site Computing Architecture. This document proposes an IT environment that is {open_quotes}...standards-based, data-driven, and workstation-oriented, with larger systems being utilized for the delivery of needed information to users in a client-server relationship.{close_quotes} Achieving this vision will require many substantial changes in the computing applications, systems, and supporting infrastructure at the site. This document consists of a set of roadmaps which provide explanations of the necessary changes for IT at the site and describes the milestones that must be completed to finish the migration.

  10. RADIOIODINE GEOCHEMISTRY IN THE SRS SUBSURFACE ENVIRONMENT

    Energy Technology Data Exchange (ETDEWEB)

    Kaplan, D.; Emerson, H.; Powell, B.; Roberts, K.; Zhang, S.; Xu, C.; Schwer, K.; Li, H.; Ho, Y.; Denham, M.; Yeager, C.; Santschi, P.

    2013-05-16

    Iodine-129 is one of the key risk drivers for several Savannah River Site (SRS) performance assessments (PA), including that for the Low-Level Waste Disposal Facility in E-Area. In an effort to reduce the uncertainty associated with the conceptual model and the input values used in PA, several studies have recently been conducted dealing with radioiodine geochemistry at the SRS. The objective of this report was to review these recent studies and evaluate their implications on SRS PA calculations. For the first time, these studies measured iodine speciation in SRS groundwater and provided technical justification for assuming the presence of more strongly sorbing species (iodate and organo-iodine), and measured greater iodine sediment sorption when experiments included these newly identified species; specifically they measured greater sorption coefficients (K{sub d} values: the concentration ratio of iodine on the solid phase divided by the concentration in the aqueous phase). Based on these recent studies, new best estimates were proposed for future PA calculations. The new K{sub d} values are greater than previous recommended values. These proposed K{sub d} values reflect a better understanding of iodine geochemistry in the SRS subsurface environment, which permits reducing the associated conservatism included in the original estimates to account for uncertainty. Among the key contributing discoveries supporting the contention that the K{sub d} values should be increased are that: 1) not only iodide (I{sup -}), but also the more strongly sorbing iodate (IO{sub 3}{sup -}) species exists in SRS groundwater (average total iodine = 15% iodide, 42% iodate, and 43% organoiodine), 2) when iodine was added as iodate, the measured K{sub d} values were 2 to 6 times greater than when the iodine was added as iodide, and perhaps most importantly, 3) higher desorption (10 to 20 mL/g) than (ad)sorption (all previous studies) K{sub d} values were measured. The implications of this

  11. Luminescent studies of impurity doped SrS phosphors

    Indian Academy of Sciences (India)

    Vijay Singh; Manoj Tiwari; T K Gundu Rao; S J Dhoble

    2005-02-01

    SrS phosphors activated with Ce and Dy ions were prepared by solid-state diffusion method. Photoluminescent study was carried out on SrS : Ce, SrS : Dy and SrS : Dy, Ce. Thermoluminescence and electron spin resonance studies were also carried out on SrS : Dy phosphor. The thermoluminescence glow curve shows a peak at around 142°C. Irradiated SrS : Dy exhibits an ESR line due to a defect centre. Thermal annealing behaviour indicates that this centre correlates with the TL peak at 142°C. The centre is characterized by an isotropic g-value of 2.0039 and is assigned to a + centre.

  12. SRS stainless steel beneficial reuse program

    Energy Technology Data Exchange (ETDEWEB)

    Boettinger, W.L.

    1997-02-01

    The US Department of Energy`s (DOE) Savannah River Site (SRS) has thousands of tons of stainless steel radioactive scrap metal (RSNI). Much of the metal is volumetrically contaminated. There is no {open_quotes}de minimis{close_quotes} free release level for volumetric material, and therefore no way to recycle the metal into the normal commercial market. If declared waste, the metal would qualify as low level radioactive waste (LLW) and ultimately be dispositioned through shallow land buried at a cost of millions of dollars. The metal however could be recycled in a {open_quotes}controlled release{close_quote} manner, in the form of containers to hold other types of radioactive waste. This form of recycle is generally referred to as {open_quotes}Beneficial Reuse{close_quotes}. Beneficial reuse reduces the amount of disposal space needed and reduces the need for virgin containers which would themselves become contaminated. Stainless steel is particularly suited for long term storage because of its resistance to corrosion. To assess the practicality of stainless steel RSM recycle the SRS Benficial Reuse Program began a demonstration in 1994, funded by the DOE Office of Science and Technology. This paper discusses the experiences gained in this program.

  13. Comparison of Srs-24 And Srs-22 Scores in Thirty Eight Adolescent Idiopathic Scoliosis Patients Who Had Undergone Surgical Correction

    Directory of Open Access Journals (Sweden)

    CYW Chan

    2009-05-01

    Full Text Available Adolescent idiopathic scoliosis is a spinal deformity that affects patients’ self image and confidence. Surgery is offered when the curvature is greater than 50 degrees based on the likelihood of curvature progression. Outcome measures for scoliosis correction can be described in terms of radiological improvement or improvement of health related quality of life scores. The Scoliosis Research Society 22 (SRS-22 and Scoliosis Research Society 24 (SRS-24 questionnaires are widely accepted and used to characterize clinical results. Therefore, this prospective study of 38 patients aims to investigate how the SRS-24 and SRS-22 questionnaires compare to each other in terms of scoring when the same group of patients is evaluated. The SRS-22 questionnaire tends to give an inflated value in the overall score, pain and self image domain compared to the SRS-24 questionnaire.

  14. RADIOLYTIC HYDROGEN GENERATION INSAVANNAH RIVER SITE (SRS) HIGH LEVEL WASTETANKS COMPARISON OF SRS AND HANFORDMODELING PREDICTIONS

    Energy Technology Data Exchange (ETDEWEB)

    Crawford, C; Ned Bibler, N

    2009-04-15

    In the high level waste tanks at the Savannah River Site (SRS), hydrogen is produced continuously by interaction of the radiation in the tank with water in the waste. Consequently, the vapor spaces of the tanks are purged to prevent the accumulation of H{sub 2} and possible formation of a flammable mixture in a tank. Personnel at SRS have developed an empirical model to predict the rate of H{sub 2} formation in a tank. The basis of this model is the prediction of the G value for H{sub 2} production. This G value is the number of H{sub 2} molecules produced per 100 eV of radiolytic energy absorbed by the waste. Based on experimental studies it was found that the G value for H{sub 2} production from beta radiation and from gamma radiation were essentially equal. The G value for H{sub 2} production from alpha radiation was somewhat higher. Thus, the model has two equations, one for beta/gamma radiation and one for alpha radiation. Experimental studies have also indicated that both G values are decreased by the presence of nitrate and nitrite ions in the waste. These are the main scavengers for the precursors of H{sub 2} in the waste; thus the equations that were developed predict G values for hydrogen production as a function of the concentrations of these two ions in waste. Knowing the beta/gamma and alpha heat loads in the waste allows one to predict the total generation rate for hydrogen in a tank. With this prediction a ventilation rate can be established for each tank to ensure that a flammable mixture is not formed in the vapor space in a tank. Recently personnel at Hanford have developed a slightly different model for predicting hydrogen G values. Their model includes the same precursor for H{sub 2} as the SRS model but also includes an additional precursor not in the SRS model. Including the second precursor for H{sub 2} leads to different empirical equations for predicting the G values for H{sub 2} as a function of the nitrate and nitrite concentrations in

  15. WASTE MANAGEMENT AT SRS - MAKING IT HAPPEN

    Energy Technology Data Exchange (ETDEWEB)

    Heenan, T. F.; Kelly, S.

    2002-02-25

    The past five years have witnessed a remarkable transition in the pace and scope of waste management activities at SRS. At the start of the new M&O contract in 1996, little was being done with the waste generated at the site apart from storing it in readiness for future treatment and disposal. Large volumes of legacy waste, particularly TRU and Low Level Waste, had accumulated over many years of operation of the site's nuclear facilities, and the backlog was increasing. WSRC proposed the use of the talents of the ''best in class'' partners for the new contract which, together with a more commercial approach, was expected to deliver more results without a concomitant increase in cost. This paper charts the successes in the Solid Waste arena and analyzes the basis for success.

  16. 75 FR 32158 - Information Collection; SRS Publications Evaluation Card

    Science.gov (United States)

    2010-06-07

    ...; ] DEPARTMENT OF AGRICULTURE Forest Service Information Collection; SRS Publications Evaluation Card AGENCY... organizations on the extension, with no revision, of a currently approved information collection, SRS Publications Evaluation Card. DATES: Comments must be received in writing on or before August 6, 2010 to...

  17. Significance of Soft Zone Sediments at the SRS

    Energy Technology Data Exchange (ETDEWEB)

    Aadland, R.K.

    2000-02-03

    The purpose of this report is to provide information on the origin, extent and stability of ''soft zones'' in the carbonate bearing strata at the Savannah River Site (SRS). As part of this study, a comprehensive historical compendium of how soft zones have been addressed during the past 47 years at SRS is reviewed.

  18. S-C Mylonites

    NARCIS (Netherlands)

    Lister, G.S.; Snoke, A.W.

    1984-01-01

    Two types of foliations are commonly developed in mylonites and mylonitic rocks: (a) S-surfaces related to the accumulation of finite strain and (b) C-surfaces related to displacement discontinuities or zones of relatively high shear strain. There are two types of S-C mylonites. Type I S-C mylonites

  19. Plains Traveler

    Science.gov (United States)

    2006-01-01

    10 April 2006 This Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) image shows a dust devil traveling across a plain west-southwest of Schiaparelli Crater, in far eastern Sinus Meridiani. The dust devil is casting a shadow toward the northeast, just south (below) of an egg-shaped crater. Location near: 6.4oS, 349.3oW Image width: 3 km (1.9 mi) Illumination from: lower left Season: Southern Summer

  20. Utopia Plain

    Science.gov (United States)

    2006-01-01

    5 March 2006 This Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) image shows a dark-toned, cratered plain in southwest Utopia Planitia. Large, light-toned, windblown ripples reside on the floors of many of the depressions in the scene, including a long, linear, trough. Location near: 30.3oN, 255.3oW Image width: 3 km (1.9 mi) Illumination from: lower left Season: Northern Winter

  1. SRS: Site ranking system for hazardous chemical and radioactive waste

    Energy Technology Data Exchange (ETDEWEB)

    Rechard, R.P.; Chu, M.S.Y.; Brown, S.L.

    1988-05-01

    This report describes the rationale and presents instructions for a site ranking system (SRS). SRS ranks hazardous chemical and radioactive waste sites by scoring important and readily available factors that influence risk to human health. Using SRS, sites can be ranked for purposes of detailed site investigations. SRS evaluates the relative risk as a combination of potentially exposed population, chemical toxicity, and potential exposure of release from a waste site; hence, SRS uses the same concepts found in a detailed assessment of health risk. Basing SRS on the concepts of risk assessment tends to reduce the distortion of results found in other ranking schemes. More importantly, a clear logic helps ensure the successful application of the ranking procedure and increases its versatility when modifications are necessary for unique situations. Although one can rank sites using a detailed risk assessment, it is potentially costly because of data and resources required. SRS is an efficient approach to provide an order-of-magnitude ranking, requiring only readily available data (often only descriptive) and hand calculations. Worksheets are included to make the system easier to understand and use. 88 refs., 19 figs., 58 tabs.

  2. Breeding bird populations and habitat associations within the Savannah River Site (SRS).

    Energy Technology Data Exchange (ETDEWEB)

    Gauthreaux, Sidney, A.; Steven J. Wagner.

    2005-06-29

    Gauthreaux, Sidney, A., and Steven J. Wagner. 2005. Breeding bird populations and habitat associations within the Savannah River Site (SRS). Final Report. USDA Forest Service, Savannah River, Aiken, SC. 48 pp. Abstract: During the 1970's and 1980's a dramatic decline occurred in the populations of Neotropical migratory birds, species that breed in North America and winter south of the border in Central and South America and in the Caribbean. In 1991 an international initiative was mounted by U. S. governmental land management agencies, nongovernmental conservation agencies, and the academic and lay ornithological communities to understand the decline of Neotropical migratory birds in the Americas. In cooperation with the USDA Forest Service - Savannah River (FS - SR) we began 1992 a project directed to monitoring population densities of breeding birds using the Breeding Bird Census (BBC) methodology in selected habitats within the Savannah River Site SRS. In addition we related point count data on the occurrence of breeding Neotropical migrants and other bird species to the habitat data gathered by the Forest Inventory and Analysis (FIA) program of the USDA Forest Service and data on habitat treatments within forest stands.

  3. Revisiting Plain Language.

    Science.gov (United States)

    Mazur, Beth

    2000-01-01

    Discusses the plain language movement and its origins. Reviews past and current resources related to plain language writing. Examines criticism of the movement while examining past and current plain language literature, with particular attention to the information design field. (SR)

  4. Design of SC walls and slabs for impulsive loading

    Energy Technology Data Exchange (ETDEWEB)

    Varma, Amit H. [Purdue Univ., West Lafayette, IN (United States)

    2015-11-11

    Reinforced concrete (RC) structures have historically been the preferred choice for blast resistant structures because of their mass and the ductility provided by steel reinforcement. Steel-plate composite (SC) walls are a viable alternative to RC for protecting the infrastructure against explosive threats. SC structures consist of two steel faceplates with a plain concrete core between them. The steel faceplates are anchored to the concrete using stud anchors and connected to each other using tie bars. SC structures provide mass from the concrete infill and ductility from the continuous external steel faceplates. This dissertation presents findings and recommendations from experimental and analytical investigations of the performance of SC walls subjected to far-field blast loads.

  5. Repeat Courses of Stereotactic Radiosurgery (SRS), Deferring Whole-Brain Irradiation, for New Brain Metastases After Initial SRS

    Energy Technology Data Exchange (ETDEWEB)

    Shultz, David B.; Modlin, Leslie A.; Jayachandran, Priya; Von Eyben, Rie; Gibbs, Iris C. [Department of Radiation Oncology, Stanford University School of Medicine, Stanford, California (United States); Choi, Clara Y.H. [Department of Radiation Oncology, Stanford University School of Medicine, Stanford, California (United States); Department of Radiation Oncology, Santa Clara Valley Medical Center, San Jose, California (United States); Chang, Steven D.; Harsh, Griffith R.; Li, Gordon; Adler, John R. [Department of Neurosurgery, Stanford University School of Medicine, Stanford, California (United States); Hancock, Steven L. [Department of Radiation Oncology, Stanford University School of Medicine, Stanford, California (United States); Soltys, Scott G., E-mail: sgsoltys@stanford.edu [Department of Radiation Oncology, Stanford University School of Medicine, Stanford, California (United States)

    2015-08-01

    Purpose: To report the outcomes of repeat stereotactic radiosurgery (SRS), deferring whole-brain radiation therapy (WBRT), for distant intracranial recurrences and identify factors associated with prolonged overall survival (OS). Patients and Methods: We retrospectively identified 652 metastases in 95 patients treated with 2 or more courses of SRS for brain metastases, deferring WBRT. Cox regression analyzed factors predictive for OS. Results: Patients had a median of 2 metastases (range, 1-14) treated per course, with a median of 2 courses (range, 2-14) of SRS per patient. With a median follow-up after first SRS of 15 months (range, 3-98 months), the median OS from the time of the first and second course of SRS was 18 (95% confidence interval [CI] 15-24) and 11 months (95% CI 6-17), respectively. On multivariate analysis, histology, graded prognostic assessment score, aggregate tumor volume (but not number of metastases), and performance status correlated with OS. The 1-year cumulative incidence, with death as a competing risk, of local failure was 5% (95% CI 4-8%). Eighteen (24%) of 75 deaths were from neurologic causes. Nineteen patients (20%) eventually received WBRT. Adverse radiation events developed in 2% of SRS sites. Conclusion: Multiple courses of SRS, deferring WBRT, for distant brain metastases after initial SRS, seem to be a safe and effective approach. The graded prognostic assessment score, updated at each course, and aggregate tumor volume may help select patients in whom the deferral of WBRT might be most beneficial.

  6. Comparison of Srs-24 And Srs-22 Scores in Thirty Eight Adolescent Idiopathic Scoliosis Patients Who Had Undergone Surgical Correction

    OpenAIRE

    CYW Chan; LB Saw; Kwan MK

    2009-01-01

    Adolescent idiopathic scoliosis is a spinal deformity that affects patients’ self image and confidence. Surgery is offered when the curvature is greater than 50 degrees based on the likelihood of curvature progression. Outcome measures for scoliosis correction can be described in terms of radiological improvement or improvement of health related quality of life scores. The Scoliosis Research Society 22 (SRS-22) and Scoliosis Research Society 24 (SRS-24) questionnaires are widely accepted and ...

  7. SC tuning fork

    CERN Multimedia

    The tuning fork used to modulate the radiofrequency system of the synchro cyclotron (SC) from 1957 to 1973. This piece is an unused spare part. The SC was the 1st accelerator built at CERN. It operated from August 1957 until it was closed down at the end of 1990. In the SC the magnetic field did not change with time, and the particles were accelerated in successive pulses by a radiofrequency voltage of some 20kV which varied in frequency as they spiraled outwards towards the extraction radius. The frequency varied from 30MHz to about 17Mz in each pulse. The tuning fork vibrated at 55MHz in vacuum in an enclosure which formed a variable capacitor in the tuning circuit of the RF system, allowing the RF to vary over the appropriate range to accelerate protons from the centre of the macine up to 600Mev at extraction radius. In operation the tips of the tuning fork blade had an amplitude of movement of over 1 cm. The SC accelerator underwent extensive improvements from 1973 to 1975, including the installation of a...

  8. SC2 dee

    CERN Multimedia

    1974-01-01

    Checking the positioning of the dee before its introduction into the vacuum chamber of SC2. The dee is mounted on a large cover plate which also carries the dee liner and the pump manifold. The dummy dee is fixed to the pole faces within the vacuum chamber.

  9. Technical Review of SRS Dose Reconstrruction Methods Used By CDC

    Energy Technology Data Exchange (ETDEWEB)

    Simpkins, Ali, A

    2005-07-20

    At the request of the Centers for Disease Control and Prevention (CDC), a subcontractor Advanced Technologies and Laboratories International, Inc.(ATL) issued a draft report estimating offsite dose as a result of Savannah River Site operations for the period 1954-1992 in support of Phase III of the SRS Dose Reconstruction Project. The doses reported by ATL differed than those previously estimated by Savannah River Site SRS dose modelers for a variety of reasons, but primarily because (1) ATL used different source terms, (2) ATL considered trespasser/poacher scenarios and (3) ATL did not consistently use site-specific parameters or correct usage parameters. The receptors with the highest dose from atmospheric and liquid pathways were within about a factor of four greater than dose values previously reported by SRS. A complete set of technical comments have also been included.

  10. SRS Software Verification Pre Operational and Startup Test

    Energy Technology Data Exchange (ETDEWEB)

    HILL, L.F.

    2000-10-18

    This document defines testing for the software used to control the Sodium Removal System (SRS). The testing is conducted off-line from the. physical plant by using a simulator built-in to the software. This provides verification of proper software operation prior to performing the operational acceptance tests with the actual plant hardware.

  11. Results of Macroinvertebrate Sampling Conducted at 33 SRS Stream Locations, July--August 1993

    Energy Technology Data Exchange (ETDEWEB)

    Specht, W.L.

    1994-12-01

    In order to assess the health of the macroinvertebrate communities of SRS streams, the macroinvertebrate communities at 30 stream locations on SRS were sampled during the summer of 1993, using Hester-Dendy multiplate samplers. In addition, three off-site locations in the Upper Three Runs drainage were sampled in order to assess the potential for impact from off-site activities. In interpreting the data, it is important to recognize that these data were from a single set of collections. Macroinvertebrate communities often undergo considerable temporal variation, and are also greatly influenced by such factors as water depth, water velocity, and available habitat. These stations were selected with the intent of developing an on-going sampling program at a smaller number of stations, with the selection of the stations to be based largely upon the results of this preliminary sampling program. When stations within a given stream showed similar results, fewer stations would be sampled in the future. Similarly, if a stream appeared to be perturbed, additional stations or chemical analyses might be added so that the source of the perturbation could be identified. In general, unperturbed streams will contain more taxa than perturbed streams, and the distribution of taxa among orders or families will differ. Some groups of macroinvertebrates, such as Ephemeroptera (mayflies), Plecoptera (stoneflies) and Trichoptera (caddisflies), which are collectively called EPT taxa, are considered to be relatively sensitive to most kinds of stream perturbation; therefore a reduced number of EPT taxa generally indicates that the stream has been subject to chemical or physical stressors. In coastal plain streams, EPT taxa are generally less dominant than in streams with rocky substrates, while Chironomidae (midges) are more abundant. (Abstract Truncated)

  12. Waste Package Data Processing by Direct Upload to the SRS Waste Information System

    Energy Technology Data Exchange (ETDEWEB)

    Casella, V.R.

    2002-06-20

    Hundreds of waste packages are generated each month at the Westinghouse Savannah River Site (SRS), Aiken, SC. Most of these waste packages are compactable, low level waste (LLW) either in 55-gallon drums or B-25 boxes, and TRU waste is put in DOT Type A 55-gallon drums. Several methods are used for assay of the waste package contents, including direct assay, dose-to-curie measurements, and smear-to-curie measurements. These assays generate many thousands of data that must be entered manually into the SRS Waste Information Tracking System (WITS) by a Generation Certification Official, even though much of this data is already available electronically. Since spreadsheets are routinely used to collect data for manual entry into WITS, direct data upload would greatly improve data entry. WITS was originally written as an interactive program, requiring each data item to be entered individually with subsequent tests being performed on each data entry to ensure that acceptance criteria were me t. An error message was displayed if the acceptance criteria were not met, and either corrected data had to be re-entered or a deviation had to be approved by WITS personnel. This system did not allow batch data entry, where essentially all the data could be entered, and then all of this data were evaluated against the acceptance criteria. A WITS user interface has been written for batch data entry for over twenty waste generators. This interface accepts all the data for a waste package, and an error report is generated listing non-conforming data. This interface allows direct uploads of electronic data for waste packages by dumping this data into Microsoft Excel spreadsheets that are formatted for direct data entry into WITS. Therefore, programs can be written to transfer any electronic data to the WITS interface spreadsheet for direct uploads of waste data. The whole process is now much less labor intensive, more cost effective, and more accurate.

  13. Evaluation of Background Mercury Concentrations in the SRS Groundwater System

    Energy Technology Data Exchange (ETDEWEB)

    Looney, B.B.

    1999-03-03

    Mercury analyses associated with the A-01 Outfall have highlighted the importance of developing an understanding of mercury in the Savannah River Site groundwater system and associated surface water streams. This activity is critical based upon the fact that the EPA Ambient Water Quality Criteria (AWQC) for this constituent is 0.012mg/L, a level that is well below conventional detection limits of 0.1 to 0.2 mg/L. A first step in this process is obtained by utilizing the existing investment in groundwater mercury concentrations (20,242 records) maintained in the SRS geographical information management system (GIMS) database. Careful use of these data provides a technically defensible initial estimate for total recoverable mercury in background and contaminated SRS wells.

  14. Methodology of dose calculation for the SRS SAR

    Energy Technology Data Exchange (ETDEWEB)

    Price, J.B.

    1991-07-01

    The Savannah River Site (SRS) Safety Analysis Report (SAR) covering K reactor operation assesses a spectrum of design basis accidents. The assessment includes estimation of the dose consequences from the analyzed accidents. This report discusses the methodology used to perform the dose analysis reported in the SAR and also includes the quantified doses. Doses resulting from postulated design basis reactor accidents in Chapter 15 of the SAR are discussed, as well as an accident in which three percent of the fuel melts. Doses are reported for both atmospheric and aqueous releases. The methodology used to calculate doses from these accidents as reported in the SAR is consistent with NRC guidelines and industry standards. The doses from the design basis accidents for the SRS reactors are below the limits set for commercial reactors by the NRC and also meet industry criteria. A summary of doses for various postulated accidents is provided.

  15. Health effects of SRS non-radiological air emissions

    Energy Technology Data Exchange (ETDEWEB)

    Stewart, J.

    1997-06-16

    This report examines the potential health effects of non radiological emissions to the air resulting from operations at the Savannah River Site (SRS). The scope of this study was limited to the 55 air contaminants for which the US Environmental Protection Agency (EPA) has quantified risk by determining unit risk factors (excess cancer risks) and/or reference concentrations (deleterious non cancer risks). Potential health impacts have been assessed in relation to the maximally exposed individual. This is a hypothetical person who resides for a lifetime at the SRS boundary. The most recent (1994) quality assured SRS emissions data available were used. Estimated maximum site boundary concentrations of the air contaminants were calculated using air dispersion modeling and 24-hour and annual averaging times. For the emissions studied, the excess cancer risk was found to be less than the generally accepted risk level of 1 in 100,000 and, in most cases, was less than 1 in 1,000,000. Deleterious non cancer effects were also found to be very unlikely.

  16. THERMAL MODELING ANALYSIS OF SRS 70 TON CASK

    Energy Technology Data Exchange (ETDEWEB)

    Lee, S.; Jordan, J.; Hensel, S.

    2011-03-08

    The primary objective of this work was to perform the thermal calculations to evaluate the Material Test Reactor (MTR) fuel assembly temperatures inside the SRS 70-Ton Cask loaded with various bundle powers. MTR fuel consists of HFBR, MURR, MIT, and NIST. The MURR fuel was used to develop a bounding case since it is the fuel with the highest heat load. The results will be provided for technical input for the SRS 70 Ton Cask Onsite Safety Assessment. The calculation results show that for the SRS 70 ton dry cask with 2750 watts total heat source with a maximum bundle heat of 670 watts and 9 bundles of MURR bounding fuel, the highest fuel assembly temperatures are below about 263 C. Maximum top surface temperature of the plastic cover is about 112 C, much lower than its melting temperature 260 C. For 12 bundles of MURR bounding fuel with 2750 watts total heat and a maximum fuel bundle of 482 watts, the highest fuel assembly temperatures are bounded by the 9 bundle case. The component temperatures of the cask were calculated by a three-dimensional computational fluid dynamics approach. The modeling calculations were performed by considering daily-averaged solar heat flux.

  17. PC-Based Applications Programming on the SRS Control System.

    Science.gov (United States)

    Martlew, Brian; Owen, Hywel; Pugh, Martin; Rawlinson, Bill; Smith, Susan

    1997-05-01

    The CERN PC-based ISOLDE control system has been installed at the SRS electron storage ring at Daresbury Laboratory. The use of Windows NT for the control consoles together with PC and VME front-end computers running under several operating systems has resulted in a flexible and reliable system for accelerator control. The implementation and philosophy of control application programs, based around a suite of Microsoft Visual Basic and Excel programs, is described. In particular, the use of Excel to provide adaptable programs online allows rapid generation of new control functions; orbit correction and servoing at the application level are described as examples of this.

  18. Savannah River Region: Transition between the Gulf and Atlantic Coastal Plains. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Zullo, V.A.; Harris, W.B.; Price, V. [eds.

    1990-12-31

    The focus of the this conference of Coastal Plains geologists was on the Savannah River region of Georgia and South Carolina, and particularly on the geology of the US Department of Energy`s 300 square mile Savannah River Site (SRS) in western South Carolina. Current geological studies indicate that the Mesozoic-Cenozoic section in the Savannah River region is transitional between that of the Gulf Coastal Plain to the southwest and that of the Atlantic Coastal Plain to the northeast. With the transitional aspect of the region as its theme, the first session was devoted to overviews of Cretaceous and Paleogene geology in the Gulf and Atlantic Coastal Plains. Succeeding presentations and resulting discussions dealt with more specific problems in structural, lithostratigraphic, hydrological, biostratigraphic, and cyclostratigraphic analysis, and of correlation to standard stratigraphic frameworks. For these conference proceedings, individual papers have been processed separately for the Energy Data Base.

  19. Monitor of SC beam profiles

    CERN Multimedia

    1977-01-01

    A high-resolution secondary emission grid for the measurement of SC beam profiles. Modern techniques of metal-ceramic bonding, developed for micro-electronics, have been used in its construction. (See Annual Report 1977 p. 105 Fig. 12.)

  20. First coil for the SC

    CERN Multimedia

    CERN PhotoLab

    1955-01-01

    The coils for the SC magnet were stored in the large hangar of the Cointrin Airport (to make sure that they would be available before snow and ice would block the roads and canals from Belgium, where they were built).

  1. Survival, nesting success, and habitat selection in wild turkey populations in the Upper Coastal Plain of South Carolina.

    Energy Technology Data Exchange (ETDEWEB)

    Moore, William F.

    2007-07-01

    ABSRACT. We compared survival rates between hunted and unhunted wild turkey (Meleagris gallopavo) gobblers in the upper coastal plain of South Carolina to assess the impact of spring gobbler-only hunts on populations. Gobblers were captured on the Savannah River Site (SRS), which contains long-established populations that have never been hunted, and on Crackerneck Wildlife Management Area and Ecological reserve (CWMA), which has held spring hunts since 1983. In January-March of 1998-2000, 46 gobblers were captured on SRS and 19 were captured no CWMA. Each turkey was fitted with a backpack radio transmitter and monitored 3 times per week.

  2. Localization of recombination proteins and Srs2 reveals anti-recombinase function in vivo

    DEFF Research Database (Denmark)

    Burgess, Rebecca C; Lisby, Michael; Altmannova, Veronika

    2009-01-01

    Homologous recombination (HR), although an important DNA repair mechanism, is dangerous to the cell if improperly regulated. The Srs2 "anti-recombinase" restricts HR by disassembling the Rad51 nucleoprotein filament, an intermediate preceding the exchange of homologous DNA strands. Here, we...... cytologically characterize Srs2 function in vivo and describe a novel mechanism for regulating the initiation of HR. We find that Srs2 is recruited separately to replication and repair centers and identify the genetic requirements for recruitment. In the absence of Srs2 activity, Rad51 foci accumulate......, and surprisingly, can form in the absence of Rad52 mediation. However, these Rad51 foci do not represent repair-proficient filaments, as determined by recombination assays. Antagonistic roles for Rad52 and Srs2 in Rad51 filament formation are also observed in vitro. Furthermore, we provide evidence that Srs2...

  3. Pump spectral linewidth influence on stimulated Brillouin scattering (SBS) and stimulated Raman scattering (SRS) and self-termination behavior of SRS in liquids

    Energy Technology Data Exchange (ETDEWEB)

    He, Guang S.; Kuzmin, Andrey; Prasad, Paras N. [The Institute for Lasers, Photonics and Biophotonics, State University of New York, Buffalo, NY (United States)

    2016-12-15

    The threshold, temporal behavior, and conversion efficiency of stimulated Brillouin scattering (SBS) and stimulated Raman scattering (SBS) in three liquids (benzene, hexane, and dimethyl sulfoxide) and two crystals (calcite and barium nitrate) have been investigated under three largely different spectral linewidth conditions. Pumped with 532-nm and nanosecond duration laser pulses of ≤ 0.01 cm{sup -1} linewidth, only SBS can be generated in all tested liquids with a high nonlinear reflectivity. However when the pump spectral linewidth is ∝0.07 cm{sup -1} or ∝0.8 cm{sup -1}, both SBS and SRS can be observed in benzene while only SRS can be generated in dimethyl sulfoxide; in all these cases SRS is the dominant contribution to the stimulated scattering but the efficiency values are drastically decreased due to the self-termination behavior of SRS in liquids, which arises from the thermal self-defocusing of both pump beam and SRS beam owing to Stokes-shift related opto-heating effect. In contrast, for SRS process in the two crystals, the thermal self-defocusing influence is negligible benefitting from their much greater thermal conductivity, and a higher conversion efficiency of SRS generation can be retained under all three pump conditions. (copyright 2016 by WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  4. Dismantlement and decontamination of a plutonium-238 facility at SRS

    Energy Technology Data Exchange (ETDEWEB)

    Smith, R.H. Jr.; Hootman, H.E.

    1994-01-01

    There has been very little, documented decontamination and decommissioning (D&D) experience on which to project cleanup costs and schedules for plutonium facilities at SRS and other DOE sites. A portion of the HB-Line, a plutonium-238 processing facility at SRS, has been undergoing D&D intermittently since 1984. Although this cleanup effort was not originally intended to quantify results, some key data have been project has demonstrated effective methods of accumulated, and the performing D&D work, and has demonstrated cleanup equipment and techniques under conditions of high contamination. Plutonium facilities where D&D is already underway provide an opportunity for` timely field testing of characterization, size reduction, and decontamination techniques. Some data are presented here; however, more specific tests and data may be obtained during the remainder of this project. This project has been recommended as a candidate test facility for a DOE planned ``Integrated D&D Demonstration`` managed by EM-50 to develop and demonstrate technology for D&D and surplus facilities deactivation. Both the remainder of this project and the Integrated D&D Demonstration Program can benefit from a joint effort, and the, overall costs should be reduced.

  5. Srs2 and Mus81-Mms4 Prevent Accumulation of Toxic Inter-Homolog Recombination Intermediates.

    Directory of Open Access Journals (Sweden)

    Kenji Keyamura

    2016-07-01

    Full Text Available Homologous recombination is an evolutionally conserved mechanism that promotes genome stability through the faithful repair of double-strand breaks and single-strand gaps in DNA, and the recovery of stalled or collapsed replication forks. Saccharomyces cerevisiae ATP-dependent DNA helicase Srs2 (a member of the highly conserved UvrD family of helicases has multiple roles in regulating homologous recombination. A mutation (srs2K41A resulting in a helicase-dead mutant of Srs2 was found to be lethal in diploid, but not in haploid, cells. In diploid cells, Srs2K41A caused the accumulation of inter-homolog joint molecule intermediates, increased the levels of spontaneous Rad52 foci, and induced gross chromosomal rearrangements. Srs2K41A lethality and accumulation of joint molecules were suppressed by inactivating Rad51 or deleting the Rad51-interaction domain of Srs2, whereas phosphorylation and sumoylation of Srs2 and its interaction with sumoylated proliferating cell nuclear antigen (PCNA were not required for lethality. The structure-specific complex of crossover junction endonucleases Mus81 and Mms4 was also required for viability of diploid, but not haploid, SRS2 deletion mutants (srs2Δ, and diploid srs2Δ mus81Δ mutants accumulated joint molecule intermediates. Our data suggest that Srs2 and Mus81-Mms4 have critical roles in preventing the formation of (or in resolving toxic inter-homolog joint molecules, which could otherwise interfere with chromosome segregation and lead to genetic instability.

  6. Commercial Submersible Mixing Pump For SRS Tank Waste Removal - 15223

    Energy Technology Data Exchange (ETDEWEB)

    Hubbard, Mike [Savannah River Remediation, LLC., Aiken, SC (United States); Herbert, James E. [Savannah River Remediation, LLC., Aiken, SC (United States); Scheele, Patrick W. [Savannah River Remediation, LLC., Aiken, SC (United States)

    2015-01-12

    The Savannah River Site Tank Farms have 45 active underground waste tanks used to store and process nuclear waste materials. There are 4 different tank types, ranging in capacity from 2839 m3 to 4921 m3 (750,000 to 1,300,000 gallons). Eighteen of the tanks are older style and do not meet all current federal standards for secondary containment. The older style tanks are the initial focus of waste removal efforts for tank closure and are referred to as closure tanks. Of the original 51 underground waste tanks, six of the original 24 older style tanks have completed waste removal and are filled with grout. The insoluble waste fraction that resides within most waste tanks at SRS requires vigorous agitation to suspend the solids within the waste liquid in order to transfer this material for eventual processing into glass filled canisters at the Defense Waste Processing Facility (DWPF). SRS suspends the solid waste by use of recirculating mixing pumps. Older style tanks generally have limited riser openings which will not support larger mixing pumps, since the riser access is typically 58.4 cm (23 inches) in diameter. Agitation for these tanks has been provided by four long shafted standard slurry pumps (SLP) powered by an above tank 112KW (150 HP) electric motor. The pump shaft is lubricated and cooled in a pressurized water column that is sealed from the surrounding waste in the tank. Closure of four waste tanks has been accomplished utilizing long shafted pump technology combined with heel removal using multiple technologies. Newer style waste tanks at SRS have larger riser openings, allowing the processing of waste solids to be accomplished with four large diameter SLPs equipped with 224KW (300 HP) motors. These tanks are used to process the waste from closure tanks for DWPF. In addition to the SLPs, a 224KW (300 HP) submersible mixer pump (SMP) has also been developed and deployed within older style tanks. The SMPs are product cooled and

  7. Methodology for Estimating Ingestion Dose for Emergency Response at SRS

    CERN Document Server

    Simpkins, A A

    2002-01-01

    At the Savannah River Site (SRS), emergency response models estimate dose for inhalation and ground shine pathways. A methodology has been developed to incorporate ingestion doses into the emergency response models. The methodology follows a two-phase approach. The first phase estimates site-specific derived response levels (DRLs) which can be compared with predicted ground-level concentrations to determine if intervention is needed to protect the public. This phase uses accepted methods with little deviation from recommended guidance. The second phase uses site-specific data to estimate a 'best estimate' dose to offsite individuals from ingestion of foodstuffs. While this method deviates from recommended guidance, it is technically defensibly and more realistic. As guidance is updated, these methods also will need to be updated.

  8. The beam transport system in the SRS-1200

    CERN Document Server

    Ivashchenko, V E

    2002-01-01

    In NSC KIPT the synchrotron radiation source SRS-1200 for the Ukrainian national synchrotron center (Kiev) is developed. An injector for a storage ring is the electron linear accelerator with energy 180 MeV. For compactness of a complex LUE-180 dispose under a storage ring. The transport system provides transport of electron beam from linear accelerator without losses and injection him in the storage ring. The calculations of the performances of transport systems with five-lens and three-lens variants of translation line, and also with use 42 and 45-th of degree rectangular and sector bending magnets were carried out. As a result of the comparative analysis the five-lens symmetric variant of translation line with 42-th degree sector bending magnets was chosen. In the report the basic results of calculations, parameters and performances of transport system of electron beam are submitted.

  9. Colloid and ionic tracer migration within SRS sediments: Final summary

    Energy Technology Data Exchange (ETDEWEB)

    Strom, R.N. [Westinghouse Savannah River Co., Aiken, SC (United States); Seaman, J.C.; Bertsch, P.M. [Savannah River Ecology Lab., Aiken, SC (United States). Div. of Biogeochemistry; Miller, W.P. [Georgia Univ., Athens, GA (United States). Environmental Soil Science

    1996-04-09

    The generation of a stable colloidal suspension in geologic materials has a number of environmental implications. Mobile colloids may act as vectors for the transport of adsorbed contaminants through soils and within aquifers and can cause serious problems related to well monitoring and formation permeability in an injections well system. Colloid-facilitated transport has been implicated in the migration of contaminants from seepage basins on the Department of Energy`s Savannah River Site (SRS) at a rate greater than was predicted in two- phase transport models. From 1955 to 1988, seepage basins overlying the water-table aquifer received acidic wastes containing high levels of Na+ and nitric acid, as well as trace radionuclides and metals from the nuclear materials processing facilities. Numerical simulations predicted that metal contaminants would not reach the water table, but measurable quantities of these contaminants have been detected in monitoring wells down gradient from the basins. Lack of agreement between predicted and observed contaminant migration in this and other studies has been attributed to both local non equilibrium situation, preferential flow paths within the geologic material, and to transport of the contaminant in association with a mobile solid phase, i.e. dispersed colloids. Additionally, the association of contaminants with a mobile colloidal phase has important ramifications for groundwater sampling on SRS intended to evaluate the potential environmental hazards of a given contaminant. As part of the F- and H-Area reclamation project, the Department of Energy has proposed the capture and treatment of the contaminant plume followed by reinjection of the treated water into the water table and upper confined aquifers. (Abstract Truncated)

  10. Questionário SRS-30 para adolescentes portadores de escoliose idiopática Cuestionario SRS-30 para adolescentes portadores de escoliosis idiopática SRS-30 Questionnaire for adolescents with idiophatic scoliosis

    Directory of Open Access Journals (Sweden)

    Gustavo Carriço de Oliveira

    2010-06-01

    Full Text Available INTRODUÇÃO: a medição da qualidade de vida relacionada à saúde é uma prática comum na avaliação de doenças da coluna vertebral. O questionário SRS-30 (versão procedente do instrumento Scoliosis Research Society-22 é um instrumento válido para a avaliação clínica de pacientes portadores de escoliose idiopática nos Estados Unidos. Entretanto, sua adaptação em outros idiomas é necessária para uso multinacional. OBJETIVO: analisar os domínios e itens do questionário SRS-30 para adolescentes. Discutir a aplicação do questionário da Scoliosis Research Society (SRS em diversas versões. DESENHO DE ESTUDO: revisão narrativa da literatura sobre um questionário para mensurar a qualidade de vida relacionada à saúde e suas versões em diferentes idiomas. MÉTODOS: Foi conduzida uma revisão narrativa da literatura em relação à tradução e validação dos questionários SRS-22, SRS-24 e SRS-30. RESULTADOS: oito publicações descrevendo a tradução e validação do questionário SRS nos idiomas espanhol, japonês, turco, chinês, italiano e alemão foram identificadas na literatura. Nenhum artigo sobre o questionário SRS-30 na versão brasileira foi localizado na literatura. O conteúdo dos itens de cada domínio se refere tanto a dados concretos e fáceis de precisar como também às experiências subjetivas das pessoas e às reações emocionais diante de determinados fatos. A maioria dos instrumentos que avaliam qualidade de vida foi desenvolvida no idioma inglês e existe a necessidade da adaptação destes questionários para o uso em países cuja língua oficial não seja o inglês. CONCLUSÕES: questionários que avaliam qualidade de vida relacionada à saúde devem sofrer adaptações culturais para manter a validade interna do instrumento. Para isso, urge outro desenho de estudo para a validação do questionário SRS-30 em português brasileiro para que se determine sua validade em comparação aos question

  11. Stereotactic Radiosurgery (SRS and Stereotactic Body Radiation Therapy (SBRT Cost-Effectiveness Results

    Directory of Open Access Journals (Sweden)

    Akash eBijlani

    2013-04-01

    Full Text Available Objective: To describe and synthesize the current stereotactic radiosurgery (SRS and stereotactic body radiation therapy (SBRT cost-effectiveness research to date across several common SRS and SBRT applications. Methods: This review was limited to comparative economic evaluations of SRS, SBRT and alternative treatments (e.g., other radiotherapy techniques or surgery. Based on PubMed searches using the terms, stereotactic, stereotactic radiosurgery, stereotactic radiotherapy, stereotactic body radiotherapy, stereotactic body radiation therapy, stereotactic ablative radiotherapy, economic evaluation, quality adjusted life year (QALY, cost, cost effectiveness, cost utility and cost analysis, published studies of cost-effectiveness and health economics were obtained. Included were articles in peer-reviewed journals that presented a comparison of costs between treatment alternatives from January 1997 to November 2012. Papers were excluded if they did not present cost calculations, therapeutic cost comparisons, or health economic endpoints. Results: Clinical outcomes and costs of SRS and SBRT were compared to other therapies for treatment of cancer in the brain, spine, lung, prostate and pancreas. Treatment outcomes for SRS and SBRT are usually superior or comparable, and cost-effective, relative to alternative techniques. Conclusion: Based on the review of current SRS and SBRT clinical and health economic literature, from a patient perspective, SRS and SBRT provide patients a clinically-effective treatment option, while from the payer and provider perspective, SRS and SBRT demonstrate cost-savings.

  12. Justification for Continued Operation of the SRS Saltstone Facility (Z-Area)

    Energy Technology Data Exchange (ETDEWEB)

    Wagner, W.A.

    1999-01-20

    Saltstone Production and Disposal Facilities (Z-Area) are a part of the Defense Waste Processing Facilities (DWPF). Z-Area facilities are just one segment of an integrated waste management and disposal system located at the Savannah River Site (SRS). The bases for the Justification of Continuing Operations (JCO) of the Saltstone Production and Disposal Facilities (Z-Area) at SRS are provided.

  13. The Plains of Venus

    Science.gov (United States)

    Sharpton, V. L.

    2013-12-01

    Volcanic plains units of various types comprise at least 80% of the surface of Venus. Though devoid of topographic splendor and, therefore often overlooked, these plains units house a spectacular array of volcanic, tectonic, and impact features. Here I propose that the plains hold the keys to understanding the resurfacing history of Venus and resolving the global stratigraphy debate. The quasi-random distribution of impact craters and the small number that have been conspicuously modified from the outside by plains-forming volcanism have led some to propose that Venus was catastrophically resurfaced around 725×375 Ma with little volcanism since. Challenges, however, hinge on interpretations of certain morphological characteristics of impact craters: For instance, Venusian impact craters exhibit either radar dark (smooth) floor deposits or bright, blocky floors. Bright floor craters (BFC) are typically 100-400 m deeper than dark floor craters (DFC). Furthermore, all 58 impact craters with ephemeral bright ejecta rays and/or distal parabolic ejecta patterns have bright floor deposits. This suggests that BFCs are younger, on average, than DFCs. These observations suggest that DFCs could be partially filled with lava during plains emplacement and, therefore, are not strictly younger than the plains units as widely held. Because the DFC group comprises ~80% of the total crater population on Venus the recalculated emplacement age of the plains would be ~145 Ma if DFCs are indeed volcanically modified during plains formation. Improved image and topographic data are required to measure stratigraphic and morphometric relationships and resolve this issue. Plains units are also home to an abundant and diverse set of volcanic features including steep-sided domes, shield fields, isolated volcanoes, collapse features and lava channels, some of which extend for 1000s of kilometers. The inferred viscosity range of plains-forming lavas, therefore, is immense, ranging from the

  14. Rotary condenser for SC2

    CERN Multimedia

    1975-01-01

    During 1975 the SC2 performance was improved among other things by redesigning some of the elements of the ROTCO (Annual Report 1975, p. 55). The photo shows an interior wiew of the housing of the rotary condenser and of the sixteen sets of shaped stator blades.

  15. Cloning and Expression of Neospora caninum SRS2 Gene%新孢子虫 SRS2基因的克隆及原核表达

    Institute of Scientific and Technical Information of China (English)

    邢小勇; 王权; 温峰琴; 郝宝成; 项海涛; 胡永浩

    2012-01-01

      To construct recombinant plasmid expressing Neospora caninum SRS2,the SRS2 gene from a Neospora caninum strain was amplified by PCR with a pair of primers designed according to the sequence in GenBank.A 998 bp gene was amplified and cloned into the vector PET-32a.The expression of SRS2 protein was induced by IPTG .SDS-PAGE analysis indicated that the expressed recombinant protein of SRS2 was about 54 kD.The Western blot analysis confirmed the recombinant protein was recognized by positive serum anti- Neospora caninum.The study provided a foundation for further study on the diagnosis and vaccine of neosporosis.%  为构建表达新孢子虫重组蛋白 SRS2原核表达系统,本研究以新孢子虫基因组为模板 PCR 扩增 SRS2蛋白部分基因,获得大小约为998bp 的目的片段,并克隆到大肠杆菌 PET-32a 载体中,IPTG 诱导重组大肠杆菌,通过 SDS-PAGE 和免疫印迹分析表达产物并鉴定其生物学活性。经 SDS-PAGE 分析,表达的重组 SRS2蛋白分子量约为54kD,免疫印迹结果表明,表达的重组蛋白与牛抗新孢子虫阳性血清反应形成一条特异性蛋白条带。本实验为进一步研究诊断和治疗新孢子虫病奠定了基础。

  16. Planetary plains: subsidence and warping

    Science.gov (United States)

    Kochemasov, G.

    A common feature of all celestial bodies is their tectonic dichotomy best studied, naturally, at Earth [1]. Here there is an opposition of the eastern continental hemisphere and the western oceanic one. The first one is uplifted and cracked, the second one subsided, squeezed and warped. The next excellent example of dichotomy is at Mars where the subsided northern hemisphere is opposed by the highly uplifted southern one. The enigmatic two-face Iapetus now with help of Cassini SC presents a more clear picture: the leading dark hemisphere is opposed by the trailing light one. The light hemisphere is built mainly of water ice, the dark one of some more dense material. Bean-shaped asteroids with one convex and another concave hemispheres are best exemplified by Ida. Examples of dichotomic asteroids, satellites, planets and stars could be extended. Ubiquity of this phenomenon was expressed as the 1st theorem of the planetary wave tectonics [2 & others]: "Celestial bodies are dichotomic". A reason of this phenomenon is in action of inertia-gravity waves occurring in any celestial body because of its movement in non-round but elliptical (parabolic) orbit with periodically changing accelerations. The inertia-gravity standing waves warp rotating bodies (but all bodies rotate !) in 4 ortho- and diagonal interfering directions and in several harmonic wave-lengths. The fundamental wave1 produces ubiquitous tectonic dichotomy (2πR-structure): an opposition of two hemispheres with different planetary radii. To keep angular momenta of two hemispheres equal (otherwise a body will fall apart) the lower subsiding one is constructed of denser material than the higher one. Normally in terrestrial planets lowlands are filled with dense basalts, highlands are built by lighter lithologies. A subsidence means diminishing radius, otherwise, the larger surface must be fit into a smaller space. It is possible only if an original infilling is warped. At Earth cosmic altimetry shows complex

  17. CEMENTITIOUS GROUT FOR CLOSING SRS HIGH LEVEL WASTE TANKS - #12315

    Energy Technology Data Exchange (ETDEWEB)

    Langton, C.; Burns, H.; Stefanko, D.

    2012-01-10

    In 1997, the first two United States Department of Energy (US DOE) high level waste tanks (Tanks 17-F and 20-F: Type IV, single shell tanks) were taken out of service (permanently closed) at the Savannah River Site (SRS). In 2012, the DOE plans to remove from service two additional Savannah River Site (SRS) Type IV high-level waste tanks, Tanks 18-F and 19-F. These tanks were constructed in the late 1950's and received low-heat waste and do not contain cooling coils. Operational closure of Tanks 18-F and 19-F is intended to be consistent with the applicable requirements of the Resource Conservation and Recovery Act (RCRA) and the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) and will be performed in accordance with South Carolina Department of Health and Environmental Control (SCDHEC). The closure will physically stabilize two 4.92E+04 cubic meter (1.3 E+06 gallon) carbon steel tanks and isolate and stabilize any residual contaminants left in the tanks. The closure will also fill, physically stabilize and isolate ancillary equipment abandoned in the tanks. A Performance Assessment (PA) has been developed to assess the long-term fate and transport of residual contamination in the environment resulting from the operational closure of the F-Area Tank Farm (FTF) waste tanks. Next generation flowable, zero-bleed cementitious grouts were designed, tested, and specified for closing Tanks 18-F and 19-F and for filling the abandoned equipment. Fill requirements were developed for both the tank and equipment grouts. All grout formulations were required to be alkaline with a pH of 12.4 and chemically reduction potential (Eh) of -200 to -400 to stabilize selected potential contaminants of concern. This was achieved by including Portland cement and Grade 100 slag in the mixes, respectively. Ingredients and proportions of cementitious reagents were selected and adjusted, respectively, to support the mass placement strategy developed by

  18. Feasibility of using the Vero SBRT system for intracranial SRS.

    Science.gov (United States)

    Burghelea, Manuela; Verellen, Dirk; Gevaert, Thierry; Depuydt, Tom; Poels, Kenneth; Simon, Viorica; De Ridder, Mark

    2014-01-06

    The Vero SBRT system was benchmarked in a planning study against the Novalis SRS system for quality of delivered dose distributions to intracranial lesions and assessing the Vero system's capacity for SRS. A total of 27 patients with one brain lesion treated on the Novalis system, with 3 mm leaf width MLC and C-arm gantry, were replanned for Vero, with a 5 mm leaf width MLC mounted on an O-ring gantry allowing rotations around both the horizontal and vertical axis. The Novalis dynamic conformal arc (DCA) planning included vertex arcs, using 90° couch rotation. These vertex arcs cannot be reproduced with Vero due to the mechanical limitations of the O-ring gantry. Alternative class solutions were investigated for the Vero. Additionally, to distinguish between the effect of MLC leaf width and different beam arrangements on dose distributions, the Vero class solutions were also applied for Novalis. In addition, the added value of noncoplanar IMRT was investigated in this study. Quality of the achieved dose distributions was expressed in the conformity index (CI) and gradient index (GI), and compared using a paired Student's t-test with statistical significance for p-values ≤ 0.05. For lesions larger than 5 cm3, no statistical significant difference in conformity was observed between Vero and Novalis, but for smaller lesions, the dose distributions showed a significantly better conformity for the Novalis (ΔCI = 13.74%, p = 0.0002) mainly due to the smaller MLC leaf width. Using IMRT on Vero reduces this conformity difference to nonsignificant levels. The cutoff for achieving a GI around 3, characterizing a sharp dose falloff outside the target volume was 4 cm3 for Novalis and 7 cm3 for Vero using DCA technique. Using noncoplanar IMRT, this threshold was reduced to 3 cm3 for the Vero system. The smaller MLC and the presence of the vertex fields allow the Novalis system to better conform the dose around the lesion and to obtain steeper dose falloff outside the lesion

  19. Improving the measurement of health-related quality of life in adolescent with idiopathic scoliosis: the SRS-7, a Rasch-developed short form of the SRS-22 questionnaire.

    Science.gov (United States)

    Caronni, Antonio; Zaina, Fabio; Negrini, Stefano

    2014-04-01

    Scoliosis Research Society-22 (SRS-22) questionnaire was developed to evaluate health-related quality of life (HRQL) in adolescent idiopathic scoliosis (AIS) patients. Rasch analysis (RA) is a statistical procedure which turns questionnaire ordinal scores into interval measures. Measures from Rasch-compatible questionnaires can be used, similar to body temperature or blood pressure, to quantify disease severity progression and treatment efficacy. Purpose of the current work is to present Rasch analysis (RA) of the SRS-22 questionnaire and to develop an SRS-22 Rasch-approved short form. 300 SRS-22 were randomly collected from 2447 consecutive IS adolescents at their first evaluation (229 females; 13.9 ± 1.9 years; 26.9 ± 14.7 Cobb°) in a scoliosis outpatient clinic. RA showed both disordered thresholds and overall misfit of the SRS-22. Sixteen items were re-scored and two misfitting items (6 and 14) removed to obtain a Rasch-compatible questionnaire. Participants HRQL measured too high with the rearranged questionnaire, indicating a severe SRS-22 ceiling effect. RA also highlighted SRS-22 multidimensionality, with pain/function not merging with self-image/mental health items. Item 3 showed differential item functioning (DIF) for both curve and hump amplitude. A 7-item questionnaire (SRS-7) was prepared by selecting single items from the original SRS-22. SRS-7 showed fit to the model, unidimensionality and no DIF. Compared with the SRS-22, the short form scale shows better targeting of the participants' population. RA shows that SRS-22 has poor clinimetric properties; moreover, when used with AIS at first evaluation, SRS-22 is affected by a severe ceiling effect. SRS-7, an SRS-22 7-item short form questionnaire, provides an HRQL interval measure better tailored to these participants.

  20. Control of collective FSBS and backscatter SRS through plasma composition

    Science.gov (United States)

    Rose, Harvey; Lushnikov, Pavel

    2005-10-01

    Nominal NIF parameters are near the collective forward SBS (FSBS) threshold (P. M. Lushnikov and H. A. Rose, Phys. Rev. Lett. 92, 255003 (2004), ``L&R''). It will be shown that being on this instability edge can be used as a control lever: a small amount of high Z dopant may lead to qualitative change in FSBS regime at fixed laser intensity, possibly reducing backscatter instability losses (Such results have already been observed, but absent SSD, a key aspect of our theory: R. M. Stevenson et al., Phys. Plasmas 11, 2709 (2004); L. J. Suter et al., 2738, ib.). Ponderomotive FSBS regimes are determined by the parameter I=F^2( vosc / vosc ve . - ve )^2( ne / ne nc . - nc ) / ( ne / ne nc . - nc ) ν . - ν, with ν the dimensionless ion acoustic damping coefficient and F the optic f/#. Analytical results will be presented which show a decrease of I1pt's threshold value through the addition of high Z dopant to low Z plasma, owing to increased thermal contribution to FSBS. Alternatively, one may raise the threshold by managing the value of νby, e.g., adding He to SiO2. For nominal NIF parameters, a range of He fraction in SiO2 plasma is predicted to suppress backscatter SRS while maintaining control of forward SBS.

  1. 2010 ARRA Lidar: Hampton County (SC)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Provide high density LiDAR elevation data map of Hampton County, SC. Provide Bare Earth DEM (vegetation removal) of Hampton County, SC.

  2. Magnetic moment of {sup 48}Sc

    Energy Technology Data Exchange (ETDEWEB)

    Ohtsubo, T., E-mail: tohtsubo@np.gs.niigata-u.ac.jp; Kawamura, Y.; Ohya, S. [Niigata University, Department of Physics (Japan); Izumikawa, T. [Niigata University, Radioisotope Center (Japan); Nishimura, K. [Toyama University, Faculty of Engineering (Japan); Muto, S. [Neutron Science Laboratory, KEK (Japan); Shinozuka, T. [Tohoku University, Cyclotron and Radioisotope Center (Japan)

    2007-11-15

    Nuclear magnetic resonances were measured for {sup 48}Sc and {sup 44m}Sc oriented at 8 mK in an Fe host metal. The magnetic hyperfine splitting frequencies at an external magnetic field of 0.2 T were determined to be 63.22(11) MHz and 64.81(1) MHz for {sup 48}Sc and {sup 44m}Sc, respectively. With the known magnetic moment of {mu}({sup 44m}Sc)=+3.88 (1) {mu}{sub N}, the magnetic moment of {sup 48}Sc is deduced as {mu}({sup 44}Sc)=+3.785(12) {mu}{sub N}. The measured magnetic moment of {sup 48}Sc is discussed in terms of the shell model using the effective interactions.

  3. Xemilofiban: SC 54684A, xemlofiban.

    Science.gov (United States)

    2003-01-01

    Xemilofiban [SC 54684, SC 54684A (HCl), xemlofiban], a glycoprotein IIb/IIIa antagonist, is an orally available prodrug of a non-peptide mimetic of the tetrapeptide RGDF. It is converted to the active metabolite, SC 54701 (the free base form of SC 54701A). Development was initiated by Searle (Monsanto). Searle became part of Pharmacia Corporation, which was acquired by, and merged into, Pfizer in April 2003. Searle had co-development and co-marketing agreements with Sankyo in Japan; these have been discontinued. In January 2003, Pharmacia donated the intellectual property for xemilofiban to Western Michigan University. In February 2003, Western Michigan University granted an exclusive worldwide licence of xemilofiban to VDDI Pharmaceuticals (formerly Virtual Drug Development Inc.). Xemilofiban was in a phase III clinical trial, the Evaluation of Xemilofiban in Controlling Thrombotic Events (EXCITE) trial, with Searle (Monsanto) in the US and Europe for the treatment of thrombosis in patients with unstable angina pectoris and acute myocardial infarction undergoing angioplasty. However, as xemilofiban demonstrated no significant clinical benefit, Searle discontinued its development. In Japan, Sankyo discontinued the development of xemilofiban for thrombosis at phase II following Searle's decision to drop the project. VDDI Pharmaceuticals plans to develop xemilofiban in cardiovascular disorders following on from the phase III studies completed by Pharmacia; a restructured dosing schedule and narrowed patient selection will be used. VDDI has research facilities worldwide and will utilise facilities in Ireland for the European clinical development programme; research facilities in the Southwest Michigan Innovation Center are planned while the head office of VDDI is based in Tennessee. Xemilofiban is in phase III development for the treatment of cardiovascular disease in conjunction with percutaneous coronary intervention.

  4. Materials Characterization of High-Temperature Epoxy Resins: SC-79 and SC-15/SC-79 Blend

    Science.gov (United States)

    2011-03-01

    Army composite applications. SC-15 is a toughened commercial vacuum-assisted resin transfer molding ( VARTM ) resin produced by Applied Poleramic Inc...very well in VARTM processes and has good damage resistance in structural and ballistic applications. However, the relatively low glass transition...low-viscosity, two-phase toughened, cycloaliphatic amine–cured commercial VARTM resin system designed to be easy to handle and have a long processing

  5. Mountain-Plains Curriculum.

    Science.gov (United States)

    Mountain-Plains Education and Economic Development Program, Inc., Glasgow AFB, MT.

    The document lists the Mountain-Plains curriculum by job title (where applicable), including support courses. The curriculum areas covered are mathematics skills, communication skills, office education, lodging services, food services, marketing and distribution, welding support, automotive, small engines, career guidance, World of Work, health…

  6. Optical Properties of Rare Earth Doped SrS Phosphor: A Review

    Science.gov (United States)

    Khare, Ayush; Mishra, Shubhra; Kshatri, D. S.; Tiwari, Sanjay

    2016-10-01

    Rare earth (RE) doped SrS phosphor has attracted a lot of attention on a wide range of photo-, cathodo-, thermo-, and electroluminescent applications. Upon doping with different RE elements (e.g., Ce, Pr, Eu, Yb), the luminescence from SrS can be varied over the entire visible region by appropriately choosing the composition of the strontium sulfide host. The main applications include flat panel displays and SrS-based powder electroluminescence (EL) for back lights. Sulfide materials known for providing Eu2+ based red emission band and preferred as a color conversion material in white light emitting diodes are discussed. Especially, the applications of RE doped SrS are described in light of their utility as conversion and storage phosphors. The effect of energy level splitting, EL efficiency, post-annealing, milling time, and impurity on luminescence properties for SrS are also discussed.

  7. Optical Properties of Rare Earth Doped SrS Phosphor: A Review

    Science.gov (United States)

    Khare, Ayush; Mishra, Shubhra; Kshatri, D. S.; Tiwari, Sanjay

    2017-02-01

    Rare earth (RE) doped SrS phosphor has attracted a lot of attention on a wide range of photo-, cathodo-, thermo-, and electroluminescent applications. Upon doping with different RE elements (e.g., Ce, Pr, Eu, Yb), the luminescence from SrS can be varied over the entire visible region by appropriately choosing the composition of the strontium sulfide host. The main applications include flat panel displays and SrS-based powder electroluminescence (EL) for back lights. Sulfide materials known for providing Eu2+ based red emission band and preferred as a color conversion material in white light emitting diodes are discussed. Especially, the applications of RE doped SrS are described in light of their utility as conversion and storage phosphors. The effect of energy level splitting, EL efficiency, post-annealing, milling time, and impurity on luminescence properties for SrS are also discussed.

  8. Seismic Hazard Characterization at the DOE Savannah River Site (SRS): Status report

    Energy Technology Data Exchange (ETDEWEB)

    Savy, J.B.

    1994-06-24

    The purpose of the Seismic Hazard Characterization project for the Savannah River Site (SRS-SHC) is to develop estimates of the seismic hazard for several locations within the SRS. Given the differences in the geology and geotechnical characteristics at each location, the estimates of the seismic hazard are to allow for the specific local conditions at each site. Characterization of seismic hazard is a critical factor for the design of new facilities as well as for the review and potential retrofit of existing facilities at SRS. The scope of the SRS seismic hazard characterization reported in this document is limited to the Probabilistic Seismic Hazard Analysis (PSHA). The goal of the project is to provide seismic hazard estimates based on a state-of-the-art method which is consistent with developments and findings of several ongoing studies which are deemed to bring improvements in the state of the seismic hazard analyses.

  9. Autonomous Sampling Platform Development: Radiological Contamination Mapping at SRS

    Energy Technology Data Exchange (ETDEWEB)

    Moya, Nicholas [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Whiteside, Tad [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-07-01

    From 1961 to 1964, radioactive elements were released from the Savannah River Site into local bodies of water via cooling water charges from the reactors on site. In 1983, the extent of the radioactive contamination was first studied, and elements such as 137Cs, 90Sr, 238Pu, 241Am, 244Cm, and tritium were found to have seeped from local bodies of water into sediment and the surrounding flora and fauna. The current method of tracking and monitoring radioactive contamination at the SRS is to gather samples and conduct measurements in a laboratory. A cheaper, and safer, method to conduct such measurements would be to automate the process by using an autonomous boat that can travel to locations, conduct measurements, and return home all without human intervention. To introduce this idea, the construction of an autonomous boat prototype was completed to demonstrate the practicality and feasibility of such an idea. The prototype travels to a set of waypoints, stops at each waypoint, and returns when all waypoints have been reached. It does this by employing a simple battery-powered boat with an Arduino controller that steers the boat using a steering algorithm incorporated into a Proportional Integral Derivative (PID) function. A total of three tests were conducted at two different bodies of water; and after working out some hardware problems, the boat drone was able to successfully steer and reach all programmed waypoints. With the prototype complete, the next steps to realizing the final product of the boat drone will include adopting a processing unit with higher-bit architecture, using a bigger boat with a more powerful trolling motor, and incorporating a solar panel for continuous power and round-the-clock performance.

  10. Autonomous Sampling Platform Development: Radiological Contamination Mapping at SRS

    Energy Technology Data Exchange (ETDEWEB)

    Moya, Nicholas [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Whiteside, Tad [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-07-01

    From 1961 to 1964, radioactive elements were released from the Savannah River Site into local bodies of water via cooling water charges from the reactors on site. In 1983, the extent of the radioactive contamination was first studied and elements such as 137Cs, 90Sr, 238Pu, 241Am, 244Cm, and tritium were found to have seeped from local bodies of water into sediment and the surrounding flora and fauna. The current method of tracking and monitoring radioactive contamination at the SRS is to gather samples and conduct measurements in a laboratory. A cheaper, and safer, method to conduct such measurements would be to automate the process by using an autonomous boat that can travel to locations, conduct measurements, and return home all without human intervention. To introduce this idea, the construction of an autonomous boat prototype was completed to demonstrate the practicality and feasibility of such an idea. The prototype travels to a set of waypoints, stops at each waypoint, and returns when all waypoints have been reached. It does this by employing a simple battery-powered boat with an Arduino controller that steers the boat using a steering algorithm incorporated into a Proportional Integral Derivative (PID) function. A total of three tests were conducted at two different bodies of water and after working out some hardware problems, the boat drone was able to successfully steer and reach all programmed waypoints. With the prototype complete, the next steps to realizing the final product of the boat drone will include adopting a processing unit with higher bit architecture, using a bigger boat with a more powerful trolling motor, and incorporating a solar panel for continuous power and round-the-clock performance.

  11. SU-E-T-630: Commissioning for SRS Planning Systems

    Energy Technology Data Exchange (ETDEWEB)

    Pella, S [South Florida Radiation Oncology and Florida Atlantic University, Boca Raton, FL (United States); Smith, C; Leventouri, T [Florida Atlantic University, Boca Raton, FL (United States); Bacala, A [Florida Atlantic University, Boca Raton, FL (United States); Mindanao State University-Iligan Institute of, Iligan City (Philippines)

    2014-06-15

    Purpose: This study will try to find optimal procedures to collect small fields beam data for commissioning in treatment planning systems (TPS), and to provide a protocol to collect output factors for very small field sizes: 0.5 cm × 0.5 cm to 4.0 cm × 4.0 cm.This will help in determining the correct beam configuration methods in TPS planning intensity modulated radiation therapy (IMRT), and stereotactic radiosurgery SRS using mini multileaf collimation (mMLC). Methods: Data has been collected for a mMLC linear accelerator (linac) Novalis from 0.5 cm × 0.5 cm to 10 cm × 10 cm (its maximum field size). The TPS chosen is BrainLab, Eclipse and Cyberknife. The beam data collected was modeled and imported in the TPS. Verification plans were generated in solid water to confirm the goodness of the data. 3D and IMRT plans on regular CT scans were generated and verified using Mapcheck. All 3D plans with field sizes above 4 cm × 4 cm verified excellent using a distance to agreement of 2 mm and a 2% tolerance. IMRT plans gave an error of -8%. New scans with new detectors have been taken, new field sizes were introduced, and focus has been applied on determining the dosimetric leaf gap. Results: Although this is still a work in progress, this study brings several issues to light: the importance of the correct technique in beam data collection from the correct watertank to the correct detectors. Readings for rectangular fields have to be taken especially for fields which one side is under 4 cm. Conclusion: The use of equivalent square fields will not provide correct readings for the fields with large differences between the length and the width.

  12. Ground motion following selection of SRS design basis earthquake and associated deterministic approach

    Energy Technology Data Exchange (ETDEWEB)

    1991-03-01

    This report summarizes the results of a deterministic assessment of earthquake ground motions at the Savannah River Site (SRS). The purpose of this study is to assist the Environmental Sciences Section of the Savannah River Laboratory in reevaluating the design basis earthquake (DBE) ground motion at SRS during approaches defined in Appendix A to 10 CFR Part 100. This work is in support of the Seismic Engineering Section's Seismic Qualification Program for reactor restart.

  13. A SRS2 homolog from Arabidopsis thaliana disrupts recombinogenic DNA intermediates and facilitates single strand annealing.

    Science.gov (United States)

    Blanck, Sandra; Kobbe, Daniela; Hartung, Frank; Fengler, Karin; Focke, Manfred; Puchta, Holger

    2009-11-01

    Genetic and biochemical analyses of SRS2 homologs in fungi indicate a function in the processing of homologous recombination (HR) intermediates. To date, no SRS2 homologs have been described and analyzed in higher eukaryotes. Here, we report the first biochemical characterization of an SRS2 homolog from a multicellular eukaryote, the plant Arabidopsis thaliana. We studied the basic properties of AtSRS2 and were able to show that it is a functional 3'- to 5'-helicase. Furthermore, we characterized its biochemical function on recombinogenic intermediates and were able to show the unwinding of nicked Holliday junctions (HJs) and partial HJs (PX junctions). For the first time, we demonstrated strand annealing activity for an SRS2 homolog and characterized its strand pairing activity in detail. Our results indicate that AtSRS2 has properties that enable it to be involved in different steps during the processing of recombination intermediates. On the one hand, it could be involved in the unwinding of an elongating invading strand from a donor strand, while on the other hand, it could be involved in the annealing of the elongated strand at a later step.

  14. A Comparative Analysis Among the SRS M&M, NIS, and KID Databases for the Adolescent Idiopathic Scoliosis.

    Science.gov (United States)

    Lee, Nathan J; Guzman, Javier Z; Kim, Jun; Skovrlj, Branko; Martin, Christopher T; Pugely, Andrew J; Gao, Yubo; Caridi, John M; Mendoza-Lattes, Sergio; Cho, Samuel K

    2016-11-01

    Retrospective cohort analysis. A growing number of publications have utilized the Scoliosis Research Society (SRS) Morbidity and Mortality (M&M) database, but none have compared it to other large databases. The objective of this study was to compare SRS complications with those in administrative databases. The Nationwide Inpatient Sample (NIS) and Kid's Inpatient Database (KID) captured a greater number of overall complications while the SRS M&M data provided a greater incidence of spine-related complications following adolescent idiopathic scoliosis (AIS) surgery. Chi-square was used to obtain statistical significance, with p databases were analyzed for AIS patients who underwent fusion. Comparable variables were queried in all three databases, including patient demographics, surgical variables, and complications. Patients undergoing AIS in the SRS database were slightly older (SRS 14.4 years vs. NIS 13.8 years, p database. The SRS database reported fewer overall complications (SRS 3.9% vs. NIS 7.3%, p databases. In contrast, SRS reported higher spine-specific complication rates. Mortality rates were similar between SRS versus NIS (p = .280) and SRS versus KID (p = .08) databases. There are similarities and differences between the three databases. These discrepancies are likely due to the varying data-gathering methods each organization uses to collect their morbidity data. Level IV. Copyright © 2016 Scoliosis Research Society. Published by Elsevier Inc. All rights reserved.

  15. Assessing autistic traits: cross-cultural validation of the social responsiveness scale (SRS).

    Science.gov (United States)

    Bölte, Sven; Poustka, Fritz; Constantino, John N

    2008-12-01

    The Social Responsiveness Scale (SRS) is a quantitative measure of autistic traits in 4- to 18-year-olds, which has been used in behavior-genetic, epidemiological and intervention studies. The US standardization demonstrated a single-factor structure and good to excellent psychometric properties. The cross-cultural validity of the German adaptation of the parent-report SRS in a sample of N=1,436 children and adolescents: 838 typically developing and 527 clinical participants (160 with autism spectrum disorders (ASDs)) was examined. Internal consistency (0.91-0.97), test-retest reliability (0.84-0.97), interrater reliability (0.76 and 0.95) and convergent validity with the Autism Diagnostic Observation Schedule as well as the Autism Diagnostic Interview-Revised and Social Communication Questionnaire (0.35-0.58) were satisfactory to good. The SRS total score discriminated between ASD and other mental disorders. SRS scores proved to be sufficiently independent of general psychopathology. Principal component analyses yielded single-factor solutions for the normative and clinical subsamples. In addition, construct validity was ensured by consistent correlations with the Vineland Adaptive Behavior Scales, the Child Behavior Checklist and the Junior Temperament and Character Inventory. Normative SRS total scores for girls and boys as well as values for ASD were lower in the German sample, while scores for conduct disorder and attention deficit hyperactivity/conduct disorder combined were higher. Generally, cross-cultural validity of the SRS seems to be sufficiently assured for a large European sample. However, some discrepancies regarding SRS normative and clinical raw score distributions, reliability and validity findings are critically discussed.

  16. Questionário SRS-30 para adolescentes portadores de escoliose idiopática Cuestionario SRS-30 para adolescentes portadores de escoliosis idiopática SRS-30 Questionnaire for adolescents with idiophatic scoliosis

    OpenAIRE

    2010-01-01

    INTRODUÇÃO: a medição da qualidade de vida relacionada à saúde é uma prática comum na avaliação de doenças da coluna vertebral. O questionário SRS-30 (versão procedente do instrumento Scoliosis Research Society-22) é um instrumento válido para a avaliação clínica de pacientes portadores de escoliose idiopática nos Estados Unidos. Entretanto, sua adaptação em outros idiomas é necessária para uso multinacional. OBJETIVO: analisar os domínios e itens do questionário SRS-30 para adolescentes. Dis...

  17. Main: 3SC2 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 3SC2 小麦 Bread Wheat Triticum aestivum Serine Carboxypeptidase Ii Chains A And B Nam... 1WHS; X-ray; A=6-260, B=266-418.|PDB; 1WHT; X-ray; A=5-260, B=266-418.|PDB; 3SC2; X-ray; A=1-259, B=266-417...WHDAPRSMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQALVLFQYFLQGKPMPGQTKNAT wheat_3SC2.jpg ...

  18. Academic Training - Pulsed SC Magnets

    CERN Multimedia

    Françoise Benz

    2006-01-01

    2005-2006 ACADEMIC TRAINING PROGRAMME LECTURE SERIES 2, 3, June 29, 30, 31 May, 1, 2 June 11:00-12:00 - Auditorium, bldg 500 Pulsed SC Magnets by M. Wilson Lecture 1. Introduction to Superconducting Materials Type 1,2 and high temperature superconductors; their critical temperature, field & current density. Persistent screening currents and the critical state model. Lecture 2. Magnetization and AC Loss How screening currents cause irreversible magnetization and hysteresis loops. Field errors caused by screening currents. Flux jumping. The general formulation of ac loss in terms of magnetization. AC losses caused by screening currents. Lecture 3. Twisted Wires and Cables Filamentary composite wires and the losses caused by coupling currents between filaments, the need for twisting. Why we need cables and how the coupling currents in cables contribute more ac loss. Field errors caused by coupling currents. Lecture 4. AC Losses in Magnets, Cooling and Measurement Summary of all loss mech...

  19. SU-E-T-757: TMRs Calculated From PDDs Versus the Direct Measurements for Small Field SRS Cones

    Energy Technology Data Exchange (ETDEWEB)

    Li, H; Zhong, H; Song, K; Qin, Y; Snyder, K; Gordon, J; Chetty, I [Henry Ford Health System, Detroit, MI (United States); Wen, N [Henry Ford Health System, West Bloomfield, MI (United States)

    2015-06-15

    Purpose: To investigate the variation of TMR for SRS cones obtained by TMR scanning, calculation from PDDs, and point measurements. The obtained TMRs were also compared to the representative data from the vendor. Methods: TMRs for conical cones of 4, 5, 7.5, 10, 12.5, 15, and 17.5 mm diameter (jaws set to 5×5 cm) were obtained for 6X FFF and 10X FFF energies on a Varian Edge linac. TMR scanning was performed with a Sun Nuclear 3D scanner and Edge detector at 100 cm SDD. TMR point measurements were measured with a Wellhofer tank and Edge detector, at multiple depths from 0.5 to 20 cm and 100 cm SDD. PDDs for converting to TMR were scanned with a Wellhofer system and SFD detector. The formalism of converting PDD to TMR, given in Khan’s book (4th Edition, p.161) was applied. Sp values at dmax were obtained by measuring Scp and Sc of the cones (jaws set to 5×5 cm) using the Edge detector, and normalized to the 10×10 cm field. Results: Along the central axis beyond dmax, the RMS and maximum percent difference of TMRs obtained with different methods were as follows: (a) 1.3% (max=3.5%) for the calculated TMRs from PDDs versus direct scanning; (b) 1.2% (max=3.3%) for direct scanning versus point measurement; (c) 1.8% (max=5.1%) for the calculated versus point measurements; (d) 1.0% (max=3.6%) for direct scanning versus vendor data; (e) 1.6% (max=7.2%) for the calculated versus vendor data. Conclusion: The overall accuracy of TMRs calculated from PDDs was comparable with that of direct scanning. However, the uncertainty at depths greater than 20 cm, increased up to 5% when compared to point measurements. This issue must be considered when developing a beam model for small field SRS planning using cones.

  20. Hydrothermal preparation and persistence characteristics of nanosized phosphor SrS: Eu2+, Dy3+

    Institute of Scientific and Technical Information of China (English)

    DUAN Xiaoxia; HUANG Shihua; YOU Fangtian; KANG Kai

    2009-01-01

    Nanosized long-persistent phosphors SrS: Eu2+, Dy3+ were prepared by the hydrothermal method. The samples were characterized by X-ray powder diffraction, transmission electron microscopy, and charge-coupled device spectrometry. The persistence characteristic was studied using the decay curves. The results showed that the emission intensity decreased sharply with temperature increasing, although the particle size increased. The S2- vacancies caused by oxidization served as shallow traps, and Dy3+ served as deep traps in SrS: Eu2+, Dy3+. The afterglow intensity of SrS: Eu2+, Dy3+ was higher than that of SrS: Eu2+ prepared at the same temperature. However, the minimization span of initial afterglow with temperature for the former sample was larger than that for the latter. Binary-doped phosphor decayed more slowly than the singly doped one. The afterglow of SrS: Eu2+, Dy3+ decayed more quickly with the increase of sintering temperature.

  1. Review of seismicity and ground motion studies related to development of seismic design at SRS

    Energy Technology Data Exchange (ETDEWEB)

    Stephenson, D.E. [Westinghouse Savannah River Co., Aiken, SC (United States); Acree, J.R. [Westinghouse Environmental and Geotechnical Services, Inc., Columbia, SC (United States)

    1992-08-01

    The NRC response spectra developed in Reg. Guide 1.60 is being used in the studies related to restarting of the existing Savannah River Site (SRS) reactors. Because it envelopes all the other site specific spectra which have been developed for SRS, it provides significant conservatism in the design and analysis of the reactor systems for ground motions of this value or with these probability levels. This spectral shape is also the shape used for the design of the recently licensed Vogtle Nuclear Station, located south of the Savannah River from the SRS. This report provides a summary of the data base used to develop the design basis earthquake. This includes the seismicity, rates of occurrence, magnitudes, and attenuation relationships. A summary is provided for the studies performed and methodologies used to establish the design basis earthquake for SRS. The ground motion response spectra developed from the various studies are also summarized. The seismic hazard and PGA`s developed for other critical facilities in the region are discussed, and the SRS seismic instrumentation is presented. The programs for resolving outstanding issues are discussed and conclusions are presented.

  2. Local Impact Simulation of SC Wall Structures using Aircraft Engine Projectile

    Energy Technology Data Exchange (ETDEWEB)

    Chung, Chulhun; Lee, Jungwhee; Lee, Hanjoo [Dankook Univ., Yongin (Korea, Republic of); Jung, Raeyoung; Hyun, Changhun [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

    2013-05-15

    SC wall structure developed for nuclear power plant buildings consists of plain concrete and two steel plates on both surface of the concrete, while RC structure consists of re bar and concrete. SC structure has higher scabbing resistance than RC structure due to the action of steel plate on the rear side of impact. Therefore SC structure is known as more effective structure from the viewpoint of aircraft crash than RC structure. However, most of the recent researches and experiments about local impact damage deal with RC structures, and the effect of re bar and steel plate is not considered reasonably. Although Walter et al. and Make-work et al. suggested a formula for evaluating perforation depth of steel plate covered RC walls, most of the previous researches about SC structure are focused on perforation and scabbing due to the impact of hard projectile, rather than soft projectile such as an aircraft. In this research a soft projectile, i. e. aircraft engine, is utilized for impact simulation of RC and SC walls. To evaluate local damage of SC wall structures, parametric study with the variables of wall thickness and steel ratio of the cover plate is performed, and the results are compared with those of RC structures. Since scabbing was prevented by the steel plates, penetration mode of damage was observed in SC walls while scabbing damage was occurred in RC walls. It is confirmed that the rear steel plate not only contains concrete debris, but also reduces the internal damage of the concrete walls. Penetration depth of SC walls did not largely vary due to the increasing steel ratio, and similar results to RC walls were observed when the wall thickness is larger than a certain value since the impact resistance of SC wall is mainly governed by the thickness of concrete part. Therefore, it is expected that similar level of impact resistance to RC structure can be produced with the minimum thickness of steel plates of SC structure. According to these results, SC

  3. 46 CFR 7.70 - Folly Island, SC to Hilton Head Island, SC.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Folly Island, SC to Hilton Head Island, SC. 7.70 Section... BOUNDARY LINES Atlantic Coast § 7.70 Folly Island, SC to Hilton Head Island, SC. (a) A line drawn from the southernmost extremity of Folly Island to latitude 32°35′ N. longitude 79°58.2′ W. (Stono Inlet Lighted...

  4. Paleoclimatic, paleovegetational and provenance change in the Ganga Plain during the late Quaternary

    Indian Academy of Sciences (India)

    Shailesh Agrawal; Prasanta Sanyal; Melinda K Bera; Jitendra K Dash; Srinivasan Balakrishnan

    2013-08-01

    Present study aims at reconstructing the paleomonsoonal rainfall, paleovegetation and provenance change during the late Quaternary. Towards this, Bhognipur core, collected from the southern Ganga Plain, have been sampled for soil carbonate (SC) and soil. The 18O values of SC (18OSC) range from −7.6 to −4.9‰. The variations in 18OSC values suggest that during the late Quaternary, the monsoon intensified during MIS 3 and MIS 1 and the maximum lowering of rainfall intensity is observed during MIS 2. The 13C value of SC (13CSC), organic matter dispersed in the soil (13CSOM) and occluded in the carbonate nodules (13CNOM) ranges from −4.1 to +1.4‰, −25.6 to −16.3‰, and −27.7 to −25.0‰, respectively, implies mixed C3–C4 vegetation over the Ganga Plain. Variations in 13CSOM and 13CNOM values at same depth imply preservation problem of pristine organic matter signature. Therefore, it is important to assess the preservation of residual organic matter before using it for paleovegetational reconstruction. The monsoon-vegetation relationship indicates that relative abundances of C3–C4 vegetation were mainly driven by variations in monsoonal rainfall intensity. Using 87Sr/86Sr in SC, we show that the Himalayan river was supplying sediments in the southern part of the Ganga Plain during MIS 3.

  5. Utilization of SRS pond ash in controlled low strength material. Technical report

    Energy Technology Data Exchange (ETDEWEB)

    Langton, C.A.; Rajendran, N.

    1995-12-01

    Design mixes for Controlled Low Strength Material (CLSM) were developed which incorporate pond ashes (fly ashes) from the A-Area Ash Pile, the old F-Area Ash Basin and the D-Area Ash Basin. CLSM is a pumpable, flowable, excavatable backfill used in a variety of construction applications at SRS. Results indicate that CLSM which meets all of the SRS design specifications for backfill, can be made with the A-, D-, and F-Area pond ashes. Formulations for the design mixes are provided in this report. Use of the pond ashes may result in a cost savings for CLSM used at SRS and will utilize a by-product waste material, thereby decreasing the amount of material requiring disposal.

  6. pF3D Simulations of SBS and SRS in NIF Hohlraum Experiments

    Science.gov (United States)

    Langer, Steven; Strozzi, David; Amendt, Peter; Chapman, Thomas; Hopkins, Laura; Kritcher, Andrea; Sepke, Scott

    2016-10-01

    We present simulations of stimulated Brillouin scattering (SBS) and stimulated Raman scattering (SRS) for NIF experiments using high foot pulses in cylindrical hohlraums and for low foot pulses in rugby-shaped hohlraums. We use pF3D, a massively-parallel, paraxial-envelope laser plasma interaction code, with plasma profiles obtained from the radiation-hydrodynamics codes Lasnex and HYDRA. We compare the simulations to experimental data for SBS and SRS power and spectrum. We also show simulated SRS and SBS intensities at the target chamber wall and report the fraction of the backscattered light that passes through and misses the lenses. Work performed under the auspices of the U.S. Department of Energy by LLNL under Contract DE-AC52-07NA27344. Release number LLNL-ABS-697482.

  7. SRS-A leukotrienes decrease the activity of human respiratory cilia

    DEFF Research Database (Denmark)

    Bisgaard, H; Pedersen, M

    1987-01-01

    , yet less so within cell samples from the cell scrapings. We, therefore, evaluated the effect of the test solutions relative to the spontaneous decrease found during simultaneous perfusion with control solution of samples from the same cell scrapings. LTC4, 3-300 nmol/l, caused a highly significantly...... dose-related decrease in the ciliary beat frequency by up to approximately 20% as compared to the corresponding control solution. The effect of LTC4 was significantly inhibited by the SRS-A receptor antagonist FPL 55712 (10 mumol/l), but not by indomethacin (10 mumol/l). LTD4, 300 nmol/l, also...... decreased the ciliary beat frequency. LTB4, which is a leukotriene, although without the sulphidopeptide side chain of the SRS-A leukotrienes, did not affect the ciliary beat frequency in a concentration of 100 nmol/l. This would seem to confirm the structure specificity of the elucidated effect of the SRS...

  8. A Comprehensive Analysis of the SRS-Schwab Adult Spinal Deformity Classification and Confounding Variables

    DEFF Research Database (Denmark)

    Hallager, Dennis Winge; Hansen, Lars Valentin; Dragsted, Casper Rokkjær

    2016-01-01

    confounding variables. SUMMARY OF BACKGROUND DATA: The SRS-Schwab Adult Spinal Deformity Classification includes sagittal modifiers considered important for HRQOL and the clinical impact of the classification has been validated in patients from the International Spine Study Group database; however, equivocal...... results were reported for the Pelvic Tilt modifier and potential confounding variables were not evaluated. METHODS: Between March 2013 and May 2014, all adult spinal deformity patients from our outpatient clinic with sufficient radiographs were prospectively enrolled. Analyses of HRQOL variance and post...... hoc analyses were performed for each SRS-Schwab modifier. Age, history of spine surgery, and aetiology of spinal deformity were considered potential confounders and their influence on the association between SRS-Schwab modifiers and aggregated Oswestry Disability Index (ODI) scores was evaluated...

  9. rotor of the SC rotating condenser

    CERN Multimedia

    1974-01-01

    The rotor of the rotating condenser was installed instead of the tuning fork as the modulating element of the radiofrequency system, when the SC accelerator underwent extensive improvements between 1973 to 1975 (see object AC-025). The SC was the first accelerator built at CERN. It operated from August 1957 until it was closed down at the end of 1990.

  10. Radiation Protection Section (SC/SL/RP)

    CERN Multimedia

    2006-01-01

    We should like to inform you that the Radiation Protection Section (SC/SL/RP) located on the Prévessin site has moved from Building 865 (ground floor) to new premises in Wing A of Building 892 (second floor). Telephone numbers remain the same. SC/SL/RP section

  11. Cs3ScCl6

    Directory of Open Access Journals (Sweden)

    Matthew D. Ward

    2014-06-01

    Full Text Available Crystals of tricaesium scandium(III hexachloride were obtained as a side product from the reaction of U, SnCl2, Sc, and S in a CsCl flux at 1073 K. Cs3ScCl6 crystallizes in the Rb3YCl6 structure type. The asymmetric unit comprises three Cs sites, two Sc sites, and six Cl sites, all of which have site symmetry 1, except for the two Sc sites that have site symmetries of 2 and -1, respectively. The structure is composed of isolated [ScCl6]3− octahedra that are surrounded by Cs+ cations. Two Cs+ cations have interactions with eight Cl− anions, while the third has interactions with ten Cl− anions.

  12. The influence of Savannah River discharge and changing SRS cooling water requirements on the potential entrainment of ichthyoplankton at the SRS Savannah River intakes

    Energy Technology Data Exchange (ETDEWEB)

    Paller, M.H.

    1992-08-01

    Entrainment (i.e., withdrawal of fish larvae and eggs in cooling water) at the SRS Savannah River intakes is greatest when periods of high river water usage coincide with low river dischargeduring the spawning season. American shad and striped bass are the two species of greatest concern because of their recreational and/or commercial importance and because they produce drifting eggs and larvae vulnerable to entrainment. In the mid-reaches of the Savannah River, American shad and striped bass spawn primarily during April and May. An analysis of Savannah River discharge during April and May 1973--1989 indicated the potential for entrainment of 4--18% of the American shad and striped bass larvae and eggs that drifted past the SRS. This analysis assumed the concurrent operation of L-, K-, and P-Reactors. Additional scenarios investigated were: (1) shutting down L- and P-Reactors, and operating K-Reactor with a recycle cooling tower; and (2) shutting down L- and P-Reactors, eliminating minimum flows to Steel Creek, and operating K-Reactor with a recycle cooling tower. The former scenario reduced potential entrainment to 0.7--3.3%, and the latter scenario reduced potential entrainment to 0.20.8%. Thus, the currently favored scenario of operating K-Reactor with a cooling tower and not operating L- and P-Reactors represents a significant lessening of the impact of SRS operations.

  13. srsLTE: An Open-Source Platform for LTE Evolution and Experimentation

    OpenAIRE

    2016-01-01

    Testbeds are essential for experimental evaluation as well as for product development. In the context of LTE networks, existing testbed platforms are limited either in functionality and/or extensibility or are too complex to modify and customise. In this work we present srsLTE, an open-source platform for LTE experimentation designed for maximum modularity and code reuse and fully compliant with LTE Release 8. We show the potential of the srsLTE library by extending the baseline code to allow...

  14. Thermodynamic Modeling of the SRS Evaporators: Part II. The 3H System

    Energy Technology Data Exchange (ETDEWEB)

    Jantzen, C.M.

    2001-10-02

    Accumulations of two solid phases have formed scale deposits in the Savannah River Site 2H Evaporator system since late 1996. The aluminosilicate scale deposits caused the evaporator pot to become inoperable in October 1999. Accumulations of the diuranate phase have caused criticality concerns in the SRS 2H Evaporator. In order to ensure that similar deposits are not and will not form in the SRS 3H Evaporator, thermodynamically derived activity diagrams specific to the feeds processed from Tanks 30 and 32 are evaluated in this report.

  15. Specific yield, High Plains aquifer

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This raster data set represents specific-yield ranges in the High Plains aquifer of the United States. The High Plains aquifer underlies 112.6 million acres (176,000...

  16. Cloning and Prokaryotic Expression of NcSRS2 Gene of Neospora caninum%犬新孢子虫NcSRS2基因片段的克隆及原核表达

    Institute of Scientific and Technical Information of China (English)

    丁德; 贾立军; 其木格; 薛书江; 张守发

    2008-01-01

    以含有犬新孢子虫NcSRS2基因的质粒pMD18-NcSRS2为模板,应用PCR方法扩增NcSRS2基因,将该基因片段克隆至原核表达栽体pGEX-4T-2,构建了重组表达质粒pGEX-NcSRS2,转化大肠杆菌BL21中并诱导表达.结果显示,克隆的基因片段长1100bp,SDS-PAGE、Western blotting分析显示,重组质粒pGEX-NcSRS2在大肠杆菌中得到了高效表达.

  17. Paleolimnological reconstruction of Holocene environments in wetland ponds of the Upper Atlantic Coastal Plain

    Energy Technology Data Exchange (ETDEWEB)

    Gaiser, E.E.; Taylor, B.E. [Univ. of Georgia, Athens, GA (United States)

    1995-06-01

    The paleohydrology and paleoecology of Carolina bays and upland wetland ponds on the Savannah River Site (SRS), Aiken, South Carolina are being investigated to reconstruct environmental changes brought about by long-term variation in the climate of the Upper Atlantic Coastal Plain. Cores were taken in transacts through Flamingo Bay, a temporary pond on the SRS, to determine the vertical and horizontal sediment particle size and diatom, plant phytolith and sponge spicule microfossils. Stratigraphic data were used to construct a 3-dimensional map of the basin. In conjunction with archaeological data from the rim of the pond, physical stratigraphic data indicate a decrease in pond size and depth during the past 10,000 years. In order to infer past ecological settings from the fossil record, a survey to determine microhabitat requirements of regional diatom flora was undertaken in 43 temporary ponds throughout the coastal plain of South Carolina. The relationships between diatom assemblages and environmental variables were assessed using canonical correspondence analysis. Variables contributing significantly to the diatom-environment relationship included surface core location (near shore or pelagic), water depth, hydroperiod, microhabitat substrate, and sampling date, in order of decreasing influence. Strong relationships of diatom assemblages to drought frequency within and among basins provides a reliable basis for water level reconstruction in upland temporary ponds.

  18. Mitigation bank promotes research on restoring Coastal Plain depression wetlands (South Carolina).

    Energy Technology Data Exchange (ETDEWEB)

    Barton, Christopher D.; DeSteven, Diane; Kilgo, John C.

    2004-12-31

    Barton, Christopher, D., Diane DeSteven and John C. Kilgo. 2004. Mitigation bank promotes research on restoring Coastal Plain depression wetlands (South Carolina). Ecol. Rest. 22(4):291-292. Abstract: Carolina bays and smaller depression wetlands support diverse plant communities and provide critical habitat for semi-aquatic fauna throughout the Coastal Plain region of the southeastern United States. Historically, many depression wetlands were altered or destroyed by surface ditching, drainage, and agricultural or silviculture uses. These important habitats are now at further risk of alteration and loss following a U.S. Supreme Court decision in 2001 restricting federal regulation of isolated wetlands. Thus, there is increased attention towards protecting intact sites and developing methods to restore others. The U.S. Department of Energy's (DOE) 312-mi2 (800-km2) Savannah River Site (SRS) in west-central South Carolina includes about 350 Carolina bays and bay-like wetland depressions, of which about two-thirds were degraded or destroyed prior to federal acquisition of the land. Although some of the altered wetlands have recovered naturally, others still have active active drainage ditches and contain successional forests typical of drained sites. In 1997, DOE established a wetland mitigation bank to compensate for unavoidable wetland impacts on the SRS. This effort provided an opportunity fir a systematic research program to investigate wetland restoration techniques and ecological responses. Consequently, research and management staffs from the USDA Forest Service, Westinghouse Savannah River Corporation, the Savannah River Technology Center, the Savannah River Ecology Laboratory (SREL) and several universities developed a collaborative project to restore degraded depression wetlands on the SRS. The mitigation project seeks cost-effective methods to restore the hydrology and vegetation typical of natural depression wetlands, and so enhance habitats for

  19. SC-FDMA for mobile communications

    CERN Document Server

    Abd El-Samie, Fathi E

    2013-01-01

    SC-FDMA for Mobile Communications examines Single-Carrier Frequency Division Multiple Access (SC-FDMA). Explaining this rapidly evolving system for mobile communications, it describes its advantages and limitations and outlines possible solutions for addressing its current limitations. The book explores the emerging trend of cooperative communication with SC-FDMA and how it can improve the physical layer security. It considers the design of distributed coding schemes and protocols for wireless relay networks where users cooperate to send their data to the destination. Supplying you with the re

  20. 75 FR 17765 - Termination of Environmental Impact Statement (EIS) for the Special Resource Study (SRS) for...

    Science.gov (United States)

    2010-04-07

    ...'s Order 2 (Park Planning) and Director's Order 12 (Conservation Planning, Environmental Impact Analysis, and Decision- making), the NPS is terminating the EIS process for the SRS for Castle Nugent Farms... INFORMATION CONTACT: John Barrett, Planning Team Leader, Castle Nugent Farms Special Resource Study, NPS...

  1. SRS analyses of direct-drive ICF experiments at the National Ignition Facility

    Science.gov (United States)

    Michel, P.; Rosenberg, M.; Myatt, J.; Solodov, A.; Seka, W.; Chapman, T.; Hohenberger, M.; Masse, L.; Goyon, C.; Turnbull, D.; Regan, S.; Moody, J. D.

    2016-10-01

    A series of planar target experiments was recently conducted at the National Ignition Facility (NIF) to study the laser-plasma interactions processes responsible for the production of suprathermal electrons, and their scaling from experiments at the Omega facility to full-scale ICF experiments at the MJ level on the NIF. We will present experimental analyses and simulations of Stimulated Raman Scattering (SRS) in these planar target experiments. Our work indicates the presence of purely backscattered SRS refracted off nearly one-dimensional density gradients, as well as more complicated features such as side-scatter and scattering from non-1D features (e.g. edges) in the target. Simulations using ray- and paraxial-wave- based simulation codes are used to extrapolate the hot electron fraction from the SRS measurements, and point to SRS being the primary mechanism for the generation of suprathermal electrons in these experiments. We will also present analyses of spherical implosions experiments and provide extrapolations and implications for future full-scale direct-drive experiments at NIF. This work was performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory under Contract DE-AC52-07NA27344.

  2. Maxdose-SR and popdose-SR routine release atmospheric dose models used at SRS

    Energy Technology Data Exchange (ETDEWEB)

    Jannik, G. T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Trimor, P. P. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2017-07-28

    MAXDOSE-SR and POPDOSE-SR are used to calculate dose to the offsite Reference Person and to the surrounding Savannah River Site (SRS) population respectively following routine releases of atmospheric radioactivity. These models are currently accessed through the Dose Model Version 2014 graphical user interface (GUI). MAXDOSE-SR and POPDOSE-SR are personal computer (PC) versions of MAXIGASP and POPGASP, which both resided on the SRS IBM Mainframe. These two codes follow U.S. Nuclear Regulatory Commission (USNRC) Regulatory Guides 1.109 and 1.111 (1977a, 1977b). The basis for MAXDOSE-SR and POPDOSE-SR are USNRC developed codes XOQDOQ (Sagendorf et. al 1982) and GASPAR (Eckerman et. al 1980). Both of these codes have previously been verified for use at SRS (Simpkins 1999 and 2000). The revisions incorporated into MAXDOSE-SR and POPDOSE-SR Version 2014 (hereafter referred to as MAXDOSE-SR and POPDOSE-SR unless otherwise noted) were made per Computer Program Modification Tracker (CPMT) number Q-CMT-A-00016 (Appendix D). Version 2014 was verified for use at SRS in Dixon (2014).

  3. SRS-A leukotrienes decrease the activity of human respiratory cilia

    DEFF Research Database (Denmark)

    Bisgaard, H; Pedersen, M

    1987-01-01

    We have studied the effects of the slow reacting substance of anaphylaxis (SRS-A) constituents leukotrienes (LT) C4 and D4 on the ciliary activity of human respiratory cells. The ciliary beat frequency on human nasal cells harvested by cell scraping from the inferior turbinate was measured in a b...

  4. A RECOMMENDED PASQUILL-GIFFORD STABILITY CLASSIFICATION METHOD FOR SAFETY BASIS ATMOSPHERIC DISPERSION MODELING AT SRS

    Energy Technology Data Exchange (ETDEWEB)

    Hunter, C.

    2012-03-28

    Several of the most common methods for estimating Pasquill-Gifford (PG) stability (turbulence) class were evaluated for use in modeling the radiological consequences of SRS accidental releases using the MELCOR Accident Consequence Code System, Ver. 2 (MACCS2). Evaluation criteria included: (1) the ability of the method to represent diffusion characteristics above a predominantly forested landscape at SRS, (2) suitability of the method to provide data consistent with the formulation of the MACCS2 model, and (3) the availability of onsite meteorological data to support implementation of the method The evaluation resulted in a recommendation that PG stability classification for regulatory applications at SRS should be based on measurements of the standard deviation of the vertical component of wind direction fluctuations, {sigma}{sub e}, collected from the 61-m level of the SRS meteorological towers, and processed in full accordance with EPA-454/R-99-005 (EPA, 2000). This approach provides a direct measurement that is fundamental to diffusion and captures explicitly the turbulence generated by both mechanical and buoyant forces over the characteristic surface (forested) of SRS. Furthermore, due to the potentially significant enhancement of horizontal fluctuations in wind direction from the occurrence of meander at night, the use of {sigma}{sub e} will ensure a reasonably conservative estimate of PG stability class for use in dispersion models that base diffusion calculations on a single value of PG stability class. Furthermore, meteorological data bases used as input for MACCS2 calculations should contain hourly data for five consecutive annual periods from the most recent 10 years.

  5. z206sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z206SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  6. z107sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z107SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  7. z206sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z206SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  8. z107sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z107SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  9. Bandwidth challenge teams at SC2003 conference

    CERN Multimedia

    2003-01-01

    Results from the fourth annual High-Performance Bandwidth Challenge, held in conjunction with SC2003, the international conference on high-performance computing and networking which occurred last week in Phoenix, AZ (1 page).

  10. Recrystallization of Al-Sc alloys

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Toropova, L.S.; Bykov, Yu.G.; Ber, L.B.

    Scandium effect on the temperature range of aluminium recrystallization was investigated. Al-Sc alloys were studied under cold rolled and hot pressed conditions. It is found that the temperature range of Al-Sc alloy recrystallization depends on ScAl/sub 3/ particle dispersion during recrystallization heats. During heating in quenched alloys at 200-300 deg C decomposition occurs which prevents recrystallization, In the alloys with scandium contents less 0.2% decomposition and recrystallization processes pass simultaneously. In quenched alloys with scandium contents over 0.2% and in aged alloys the initiation and subsequent development of recrystallization are determined by the processes of coalescence and solution of ScAl/sub 3/ phase particles.

  11. Southeastern Coastal Plain aquifer system

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This data set represents the extent of the Southeastern Coastal Plain aquifer system in Kentucky, Tennessee, Mississippi, Alabama, Georgia, and South Carolina.

  12. Sc3N and Sc2C2 encapsulated B40: Smarter than its carbon analogue

    Science.gov (United States)

    Shah, Esha V.; Roy, Debesh R.

    2016-10-01

    A detailed comparative investigation on the recently synthesised B40 and C40 along with their metal nitride (Sc3N)and carbide (Sc2C2) encapsulated endohedral fullerenes, is performed under density functional theory for the first time. The structures, electronic, thermodynamic and magnetic properties of all the considered compounds are explored in detail. The present study identifies borospherene (B40) and its encapsulated nitride (Sc3N@B40) and carbide (Sc2C2@B40) endohedral borofullerenes as the better candidates for future novel nano-applications compared to their carbon bucky ball analogues.

  13. DEMOGRAPHIC VULNERABILITIES IN TECUCI PLAIN

    Directory of Open Access Journals (Sweden)

    Iulian Adrian ŞORCARU

    2013-06-01

    Full Text Available The study focuses on analyzing and mapping 8 indicators considered to best reflect the demographic vulnerability in Tecuci Plain in the year 2010 and proposes a model of aggregation which finally allows us to distinguish three major types of demographic vulnerability (low, medium and high. Mapping the final values also shows significant disparities in the territorial administrative units that broadly overlap the plain, the most vulnerable being Tecuci city and the peripheral communes, towards Vrancea and Vaslui Counties.

  14. SRS BEDROCK PROBABILISTIC SEISMIC HAZARD ANALYSIS (PSHA) DESIGN BASIS JUSTIFICATION (U)

    Energy Technology Data Exchange (ETDEWEB)

    (NOEMAIL), R

    2005-12-14

    This represents an assessment of the available Savannah River Site (SRS) hard-rock probabilistic seismic hazard assessments (PSHAs), including PSHAs recently completed, for incorporation in the SRS seismic hazard update. The prior assessment of the SRS seismic design basis (WSRC, 1997) incorporated the results from two PSHAs that were published in 1988 and 1993. Because of the vintage of these studies, an assessment is necessary to establish the value of these PSHAs considering more recently collected data affecting seismic hazards and the availability of more recent PSHAs. This task is consistent with the Department of Energy (DOE) order, DOE O 420.1B and DOE guidance document DOE G 420.1-2. Following DOE guidance, the National Map Hazard was reviewed and incorporated in this assessment. In addition to the National Map hazard, alternative ground motion attenuation models (GMAMs) are used with the National Map source model to produce alternate hazard assessments for the SRS. These hazard assessments are the basis for the updated hard-rock hazard recommendation made in this report. The development and comparison of hazard based on the National Map models and PSHAs completed using alternate GMAMs provides increased confidence in this hazard recommendation. The alternate GMAMs are the EPRI (2004), USGS (2002) and a regional specific model (Silva et al., 2004). Weights of 0.6, 0.3 and 0.1 are recommended for EPRI (2004), USGS (2002) and Silva et al. (2004) respectively. This weighting gives cluster weights of .39, .29, .15, .17 for the 1-corner, 2-corner, hybrid, and Greens-function models, respectively. This assessment is judged to be conservative as compared to WSRC (1997) and incorporates the range of prevailing expert opinion pertinent to the development of seismic hazard at the SRS. The corresponding SRS hard-rock uniform hazard spectra are greater than the design spectra developed in WSRC (1997) that were based on the LLNL (1993) and EPRI (1988) PSHAs. The

  15. SU-F-T-647: Linac-Based Stereotactic Radiosurgery (SRS) in the Treatment of Trigeminal Neuralgia: Detailed Description of SRS Procedural Technique and Reported Clinical Outcomes

    Energy Technology Data Exchange (ETDEWEB)

    Pokhrel, D; Sood, S; Badkul, R; Jiang, H; Stepp, T; Camarata, P; Wang, F [University of Kansas Hospital, Kansas City, KS (United States)

    2016-06-15

    Purpose: SRS is an effective non-invasive alternative treatment modality with minimal-toxicity used to treat patients with medically/surgically refractory trigeminal neuralgia root(TNR) or those who may not tolerate surgical intervention. We present our linac-based SRS procedure for TNR treatment and simultaneously report our clinical outcomes. Methods: Twenty-eight TNR-patients treated with frame-based SRS at our institution (2009–2015) with a single-fraction point-dose of 60-80Gy to TNR were included in this IRB-approved study. Experienced neurosurgeon and radiation oncologist delineated the TNR on 1.0mm thin 3D-FIESTA-MRI that was co-registered with 0.7mm thin planning-CT. Treatment plans were generated in iPlan (BrainLAB) with a 4-mm diameter cone using 79 arcs with differential-weighting for Novalis-TX 6MV-SRS(1000MU/min) beam and optimized to minimize brainstem dose. Winston-Lutz test was performed before each treatment delivery with sub-millimeter isocenter accuracy. Quality assurance of frame placement was maintained by helmet-bobble-measurement before simulation-CT and before patient setup at treatment couch. OBI-CBCT scan was performed for patient setup verification without applying shifts. On clinical follow up, treatment response was assessed using Barrow Neurological Institute Pain Intensity Score(BNI-score:I–V). Results: 26/28 TNR-patients (16-males/10-females) who were treated with following single-fraction point-dose to isocenter: 80Gy(n=22),75Gy(n=1),70Gy(n=2) and 60Gy(n=1, re-treatment) were followed up. Median follow-up interval was 8.5-months (ranged:1–48.5months). Median age was 70-yr (ranged:43–93-yr). Right/left TNR ratio was 15/11. Delivered total # of average MUs was 19034±1204. Average beam-on-time: 19.0±1.3min. Brainstem max-dose and dose to 0.5cc were 13.3±2.4Gy (ranged:8.1–16.5Gy) and 3.6±0.4Gy (ranged:3.0–4.9Gy). On average, max-dose to optic-apparatus was ≤1.2Gy. Mean value of max-dose to eyes/lens was 0.26Gy/0.11Gy

  16. Sc20C60: a volleyballene

    Science.gov (United States)

    Wang, Jing; Ma, Hong-Man; Liu, Ying

    2016-06-01

    An exceptionally stable hollow cage containing 20 scandium atoms and 60 carbon atoms has been identified. This Sc20C60 molecular cluster has a Th point group symmetry and a volleyball-like shape that we refer to below as ``Volleyballene''. Electronic structure analysis shows that the formation of delocalized π bonds between Sc atoms and the neighboring pentagonal rings made of carbon atoms is crucial for stabilizing the cage structure. A relatively large HOMO-LUMO gap (~1.4 eV) was found. The results of vibrational frequency analysis and molecular dynamics simulations both demonstrate that this Volleyballene molecule is exceptionally stable.An exceptionally stable hollow cage containing 20 scandium atoms and 60 carbon atoms has been identified. This Sc20C60 molecular cluster has a Th point group symmetry and a volleyball-like shape that we refer to below as ``Volleyballene''. Electronic structure analysis shows that the formation of delocalized π bonds between Sc atoms and the neighboring pentagonal rings made of carbon atoms is crucial for stabilizing the cage structure. A relatively large HOMO-LUMO gap (~1.4 eV) was found. The results of vibrational frequency analysis and molecular dynamics simulations both demonstrate that this Volleyballene molecule is exceptionally stable. Electronic supplementary information (ESI) available: Sc20C60: a Volleyballene_SI. See DOI: 10.1039/c5nr07784b

  17. High-sensitivity chemical imaging for biomedicine by SRS microscopy (Conference Presentation)

    Science.gov (United States)

    Min, Wei

    2017-02-01

    Innovations in spectroscopy principles and microscopy technology have significantly impacted modern biology and medicine. While most of the contemporary bio-imaging modalities harness electronic transition, nuclear spin or radioactivity, vibrational spectroscopy has not been widely used yet. Here we will discuss an emerging chemical imaging platform, stimulated Raman scattering (SRS) microscopy, which can enhance the otherwise feeble spontaneous Raman eight orders of magnitude by virtue of stimulated emission. When coupled with stable isotopes (e.g., deuterium and 13C) or bioorthogonal chemical moieties (e.g., alkynes), SRS microscopy is well suited for probing in vivo metabolic dynamics of small bio-molecules which cannot be labeled by bulky fluorophores. Physical principle of the underlying optical spectroscopy and exciting biomedical applications such as imaging lipid metabolism, protein synthesis, DNA replication, protein degradation, RNA synthesis, glucose uptake, drug trafficking and tumor metabolism will be presented.

  18. ENVIRONMENTAL ASSESSMENT FOR THE NPDES STORM WATER COMPLIANCE ALTERNATIVES AT THE SRS

    Energy Technology Data Exchange (ETDEWEB)

    Shedrow, C

    2006-11-01

    The U.S. Department of Energy (DOE) prepared this environmental assessment (EA) to evaluate the potential environmental impacts associated with proposed and alternative actions to achieve water quality permit compliance at 38 storm water outfalls located at the Savannah River Site (SRS) (Figure 1-1). Effluent monitoring data indicates that some of these outfalls may not presently comply with new National Pollutant Discharge Elimination System (NPDES) Storm Water General Permit effluent standards that became effective July 1, 2005 (SCR000000). The NPDES permit requires that best management practices (BMPs) be implemented and maintained, as necessary, to ensure that storm water discharges at SRS do not cause or contribute to the contravention of applicable state water quality standards (WQS).

  19. Questionário SRS-30 para adolescentes portadores de escoliose idiopática

    OpenAIRE

    Gustavo Carriço de Oliveira; Robert Meves; Osmar Avanzi

    2010-01-01

    INTRODUÇÃO: a medição da qualidade de vida relacionada à saúde é uma prática comum na avaliação de doenças da coluna vertebral. O questionário SRS-30 (versão procedente do instrumento Scoliosis Research Society-22) é um instrumento válido para a avaliação clínica de pacientes portadores de escoliose idiopática nos Estados Unidos. Entretanto, sua adaptação em outros idiomas é necessária para uso multinacional. OBJETIVO: analisar os domínios e itens do questionário SRS-30 para adolescentes. Dis...

  20. High temperature vitrification of surrogate Savannah River Site (SRS) mixed waste materials

    Energy Technology Data Exchange (ETDEWEB)

    Applewhite-Ramsey, A.; Schumacher, R.F.; Spatz, T.L. [Westinghouse Savannah River Co., Aiken, SC (United States); Newsom, R.A.; Circeo, L.J. [Georgia Inst. of Technology, Atlanta, GA (United States); Danjaji, M.B. [Clark Atlanta Univ., Atlanta, GA (United States)

    1995-11-01

    The Savannah River Technology Center (SRTC) has been funded through the DOE Office of Technology Development (DOE-OTD) to investigate high-temperature vitrification technologies for the treatment of diverse low-level and mixed wastes. High temperature vitrification is a likely candidate for processing heterogeneous solid wastes containing low levels of activity. Many SRS wastes fit into this category. Plasma torch technology is one high temperature vitrification method. A trial demonstration of plasma torch processing is being performed at the Georgia Institute of Technology on surrogate SRS wastes. This effort is in cooperation with the Engineering Research and Development Association of Georgia Universities (ERDA) program. The results of phase 1 of these plasma torch trials will be presented.

  1. The threshold reduction of SRS in deuterium by multi-pass configuration

    Science.gov (United States)

    Liu, Dong; Cai, Xianglong; Li, Zhonghui; Xia, Xusheng; Zhou, Dongjian; Li, Gang; Cai, Hongxing; Guo, Jingwei; Jin, Yuqi

    2016-11-01

    Stimulated Raman scattering (SRS) in compressed D2 gas pumped with nanosecond laser radiation at 1064 nm in a multi-pass configuration has been studied. The influence of D2 pressure and pass number on Raman thresholds and the conversion efficiencies for the first Stokes (S1) and second Stokes (S2) components has been investigated. It is shown that multi-pass configuration is very efficient for the substantial reducing of SRS thresholds for both S1 and S2 components and increasing their conversion efficiencies. In our work, the S1 threshold is approximately one order of magnitude lower than that reported in previous studies; the S1 conversion efficiency reached (56.1±4.4)% at pump energy of 33 mJ. The lowest S2 threshold in the experiment is 15 mJ (with a peak power of 3 MW), and the S2 conversion efficiency reaches (32.9±3.8)%.

  2. MAXDOSE-SR: A routine release atmospheric dose model used at SRS

    Energy Technology Data Exchange (ETDEWEB)

    Simpkins, A.A.

    2000-02-09

    MAXDOSE-SR is a PC version of the dosimetry code MAXIGASP, which was used to calculate doses to the maximally exposed offsite individual for routine atmospheric releases of radioactive material at the Savannah River Site (SRS). Complete code description, verification of models, and user's manual have been included in this report. Minimal input is required to run the program, and site specific parameters are used when possible.

  3. SRS SLUDGE BATCH QUALIFICATION AND PROCESSING; HISTORICAL PERSPECTIVE AND LESSONS LEARNED

    Energy Technology Data Exchange (ETDEWEB)

    Cercy, M.; Peeler, D.; Stone, M.

    2013-09-25

    This report provides a historical overview and lessons learned associated with the SRS sludge batch (SB) qualification and processing programs. The report covers the framework of the requirements for waste form acceptance, the DWPF Glass Product Control Program (GPCP), waste feed acceptance, examples of how the program complies with the specifications, an overview of the Startup Program, and a summary of continuous improvements and lessons learned. The report includes a bibliography of previous reports and briefings on the topic.

  4. Hanford Supplemental Treatment: Literature and Modeling Review of SRS HLW Salt Dissolution and Fractional Crystallization

    Energy Technology Data Exchange (ETDEWEB)

    Choi, A. S.; Flach, G. P.; Martino, C. J.; Zamecnik, J. R.; Harris, M. K.; Wilmarth, W. R.; Calloway, T. B.

    2005-03-23

    In order to accelerate waste treatment and disposal of Hanford tank waste by 2028, the Department of Energy (DOE) and CH2M Hill Hanford Group (CHG), Inc. are evaluating alternative technologies which will be used in conjunction with the Waste Treatment Plant (WTP) to safely pretreat and immobilize the tank waste. Several technologies (Bulk Vitrification and Steam Reforming) are currently being evaluated for immobilizing the pretreated waste. Since the WTP does not have sufficient capacity to pretreat all the waste going to supplemental treatment by the 2028 milestone, two technologies (Selective Dissolution and Fractional Crystallization) are being considered for pretreatment of salt waste. The scope of this task was to: (1) evaluate the recent Savannah River Site (SRS) Tank 41 dissolution campaign and other literature to provide a more complete understanding of selective dissolution, (2) provide an update on the progress of salt dissolution and modeling activities at SRS, (3) investigate SRS experience and outside literature sources on industrial equipment and experimental results of previous fractional crystallization processes, and (4) evaluate recent Hanford AP104 boildown experiments and modeling results and recommend enhancements to the Environmental Simulation Program (ESP) to improve its predictive capabilities. This report provides a summary of this work and suggested recommendations.

  5. Shedding new light on lipid functions with CARS and SRS microscopy.

    Science.gov (United States)

    Yu, Yong; Ramachandran, Prasanna V; Wang, Meng C

    2014-08-01

    Modern optical microscopy has granted biomedical scientists unprecedented access to the inner workings of a cell, and revolutionized our understanding of the molecular mechanisms underlying physiological and disease states. In spite of these advances, however, visualization of certain classes of molecules (e.g. lipids) at the sub-cellular level has remained elusive. Recently developed chemical imaging modalities - Coherent Anti-Stokes Raman Scattering (CARS) microscopy and Stimulated Raman Scattering (SRS) microscopy - have helped bridge this gap. By selectively imaging the vibration of a specific chemical group, these non-invasive techniques allow high-resolution imaging of individual molecules in vivo, and circumvent the need for potentially perturbative extrinsic labels. These tools have already been applied to the study of fat metabolism, helping uncover novel regulators of lipid storage. Here we review the underlying principle of CARS and SRS microscopy, and discuss the advantages and caveats of each technique. We also review recent applications of these tools in the study of lipids as well as other biomolecules, and conclude with a brief guide for interested researchers to build and use CARS/SRS systems for their own research. This article is part of a Special Issue entitled Tools to study lipid functions.

  6. Recrystallization and Morphology of Microstructure in Al-Sc Alloys

    Institute of Scientific and Technical Information of China (English)

    Zhang Jun; Zhang Zonghua

    2007-01-01

    Minor addition of Sc to aluminum results in the rapid precipitation of homogeneously distributed Al3Sc dispersoids. The presence of Al3Sc dispersoids is more effective recrystallization inhibitors. Our work established the precipitation of homogeneously distributed Al3Sc dispersoids, which are coherent with the matrix, have the L12 structure. It was also established that the addition of Sc was effective in improving the recrystallization resistance.

  7. K2SC: K2 Systematics Correction

    Science.gov (United States)

    Aigrain, Suzanne; Parviainen, Hannu; Pope, Benjamin

    2016-05-01

    K2SC (K2 Systematics Correction) models instrumental systematics and astrophysical variability in light curves from the K2 mission. It enables the user to remove both position-dependent systematics and time-dependent variability (e.g., for transit searches) or to remove systematics while preserving variability (for variability studies). K2SC automatically computes estimates of the period, amplitude and evolution timescale of the variability for periodic variables and can be run on ASCII and FITS light curve files. Written in Python, this pipeline requires NumPy, SciPy, MPI4Py, Astropy (ascl:1304.002), and George (ascl:1511.015).

  8. Norma Audio Revo SC-/PA-150

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Norma audio是意大利一间顶级HI-Fi音响器材生产商。这款IRevo SC-2/PA-150为正是公司旗下的一款高端型号产品。其中,Revo SC-2前置放大器的放大电路以低噪音、高速和宽频作为设计重点,能反映出音频信号中的每一个细节。

  9. Postoperative Perfection: Ceiling Effects and Lack of Discrimination With Both SRS-22 and -24 Outcomes Instruments in Patients With Adolescent Idiopathic Scoliosis.

    Science.gov (United States)

    Bastrom, Tracey P; Bartley, Carrie; Marks, Michelle C; Yaszay, Burt; Newton, Peter O

    2015-12-01

    Review of a prospective database registry. To compare the Scoliosis Research Society (SRS)-22 and SRS-24 outcomes instruments in terms of scores, rate of ceiling effects, and discriminant ability in patients with pre- and postoperative adolescent idiopathic scoliosis. Despite improvements noted with the SRS-22, the SRS-24 is still occasionally used prospectively and for comparisons with previous studies reporting SRS-24 scores. Previous work has demonstrated that postoperative scores from the 2 versions are not interchangeable. A multicenter prospective registry of patients who underwent surgical correction of adolescent idiopathic scoliosis was queried for preoperative and 2-year postoperative SRS-22 and SRS-24 scores. Scores were compared between versions and ceiling effects were identified. Groups of deformity severity were created to evaluate discriminant ability. 829 patients were identified. The SRS-22 scores for pain and general function were significantly greater than SRS-24 scores (P self-image (P self-image domain was able to discriminate between large (29°+) and small (≤11°) residual curves (P < 0.05). Scores obtained by the SRS-22 and the SRS-24 are not translatable despite shared domains. Whereas both versions demonstrated preoperative discriminant ability, postoperative discrimination of residual deformity is lacking in both. Patient-reported outcomes of treatment are crucial in advancing treatment, and improvement in the ability to assess subjective outcomes is essential. 3.

  10. Genetic labelling and application of the isoproturon-mineralizing Sphingomonas sp. strain SRS2 in soil and rhizosphere

    DEFF Research Database (Denmark)

    Kristensen, K.E.; Jacobsen, C.S.; Hansen, L.H.

    2006-01-01

    AIMS: To construct a luxAB-labelled Sphingomonas sp. strain SRS2 maintaining the ability to mineralize the herbicide isoproturon and usable for monitoring the survival and distribution of strain SRS2 on plant roots in laboratory systems. METHODS AND RESULTS: We inserted the mini-Tn5-luxAB marker...... into strain SRS2 using conjugational mating. In the transconjugant mutants luciferase was produced in varying levels. The mutants showed significant differences in their ability to degrade isoproturon. One luxAB-labelled mutant maintained the ability to mineralize isoproturon and was therefore selected...... for monitoring colonization of barley roots. CONCLUSIONS: We successfully constructed a genetically labelled isoproturon-mineralizing-strain SRS2 and demonstrated its ability to survive in soil and its colonization of rhizosphere. SIGNIFICANCE AND IMPACT OF THE STUDY: The construction of a luxAB-labelled strain...

  11. PILOT SCALE TESTING OF MONOSODIUM TITANATE MIXING FOR THE SRS SMALL COLUMN ION EXCHANGE PROCESS - 11224

    Energy Technology Data Exchange (ETDEWEB)

    Poirier, M.; Restivo, M.; Williams, M.; Herman, D.; Steeper, T.

    2011-01-25

    The Small Column Ion Exchange (SCIX) process is being developed to remove cesium, strontium, and select actinides from Savannah River Site (SRS) Liquid Waste using an existing waste tank (i.e., Tank 41H) to house the process. Savannah River National Laboratory (SRNL) is conducting pilot-scale mixing tests to determine the pump requirements for suspending monosodium titanate (MST), crystalline silicotitanate (CST), and simulated sludge. The purpose of this pilot scale testing is to determine the requirements for the pumps to suspend the MST particles so that they can contact the strontium and actinides in the liquid and be removed from the tank. The pilot-scale tank is a 1/10.85 linear scaled model of SRS Tank 41H. The tank diameter, tank liquid level, pump nozzle diameter, pump elevation, and cooling coil diameter are all 1/10.85 of their dimensions in Tank 41H. The pump locations correspond to the proposed locations in Tank 41H by the SCIX program (Risers B5 and B2 for two pump configurations and Risers B5, B3, and B1 for three pump configurations). The conclusions from this work follow: (i) Neither two standard slurry pumps nor two quad volute slurry pumps will provide sufficient power to initially suspend MST in an SRS waste tank. (ii) Two Submersible Mixer Pumps (SMPs) will provide sufficient power to initially suspend MST in an SRS waste tank. However, the testing shows the required pump discharge velocity is close to the maximum discharge velocity of the pump (within 12%). (iii) Three SMPs will provide sufficient power to initially suspend MST in an SRS waste tank. The testing shows the required pump discharge velocity is 66% of the maximum discharge velocity of the pump. (iv) Three SMPs are needed to resuspend MST that has settled in a waste tank at nominal 45 C for four weeks. The testing shows the required pump discharge velocity is 77% of the maximum discharge velocity of the pump. Two SMPs are not sufficient to resuspend MST that settled under these

  12. Vadose Zone VOC Mass Transfer Testing At The SRS Miscellaneous Chemical Basin

    Energy Technology Data Exchange (ETDEWEB)

    Riha, B

    2005-10-30

    Active remedial activities have been ongoing since 1996 to address low levels of solvent contamination at the Miscellaneous Chemical Basin at SRS. Contaminant levels in the subsurface may be approaching levels where mass transfer limitations are impacting the efficiency of the remedial action. Rate limited mass transfer effects have been observed at other sites in the vadose zone at the SRS, however, detailed measurements and evaluation has not been undertaken. Anecdotal evidence suggests that the mass transfer rates are very slow from the fine grain sediments. This conclusion is based on the observation that measured soil gas concentrations tend to be low in permeable zones relative to the higher concentrations found in fine grain zones. Decreasing soil gas concentration with depth below the ''upland unit'' at several areas at SRS is also evidence of slow diffusion rates. In addition, due to the length of time since disposal ceased at the MCB, we hypothesize that mobile solvents have migrated downward, and the solvent remaining in the upper fine grain zone (''upland unit'') are trapped in fine grain material and are primarily released by gas diffusion (Riha and Rossabi 2004). Natural weathering and other chemical solutions disposed with the solvents can further enhance this effect by increasing the micro-porosity in the clays (kaolinite). This microporosity can result in increased entrapment of water and solvents by capillary forces (Powers, et. al., 2003). Also supporting this conclusion is the observation that active SVE has proven ineffective on VOC removal from the fine grain zones at the SRS. Adsorption and the very slow release phenomenon have been documented similarly in the literature especially for old solvent spills such as at the SRS (Pavlostathis and Mathavan 1992; Oostrom and Lenhard 2003). Mass transfer relationships need to be developed in order to optimize remediation activities and to determine actual

  13. SRS 2010 Vegetation Inventory GeoStatistical Mapping Results for Custom Reaction Intensity and Total Dead Fuels.

    Energy Technology Data Exchange (ETDEWEB)

    Edwards, Lloyd A. [Leading Solutions, LLC.; Paresol, Bernard [U.S. Department of Agriculture, Forest Service, Pacific Northwest Research Station, Portland, OR.

    2014-09-01

    This report of the geostatistical analysis results of the fire fuels response variables, custom reaction intensity and total dead fuels is but a part of an SRS 2010 vegetation inventory project. For detailed description of project, theory and background including sample design, methods, and results please refer to USDA Forest Service Savannah River Site internal report “SRS 2010 Vegetation Inventory GeoStatistical Mapping Report”, (Edwards & Parresol 2013).

  14. Ground motion following selection of SRS design basis earthquake and associated deterministic approach. Final report: Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    1991-03-01

    This report summarizes the results of a deterministic assessment of earthquake ground motions at the Savannah River Site (SRS). The purpose of this study is to assist the Environmental Sciences Section of the Savannah River Laboratory in reevaluating the design basis earthquake (DBE) ground motion at SRS during approaches defined in Appendix A to 10 CFR Part 100. This work is in support of the Seismic Engineering Section`s Seismic Qualification Program for reactor restart.

  15. Digitized Fit of the SRS Stokes Spectrum and Raman Gain%SRS Stokes谱线的数值拟合与Raman放大的研究

    Institute of Scientific and Technical Information of China (English)

    王智; 童治; 简水生

    2002-01-01

    本文利用R.H.Stolen的实验结果,拟合得到SRS Stokes谱线的多项式近似表达式.该表达式精度较高,有一定的理论价值.在此基础上,研究了不同光纤的Raman增益和噪声指数.结果表明增益和噪声指数差异主要由光纤的有效纤芯面积引起,因而有效纤芯面积最小的G.653光纤Raman增益和噪声指数最大.

  16. Molecular mapping of split rice spikelet mutant srs-1 and analysis of its homeotic function in rice

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    srs-1, a new floral organ identity gene in rice, was mapped using RAPD and RFLP markers. Firstly, the cross was made between "ZhaiYeQing 8" (ZYQ8, indica) and split rice spikelet (SRS, japonica) mutant. The ratio of wild-type individuals and mutant plants in F2 population is 3:1, which indicates that the mutant characteristics are controlled by single recessive gene, srs-1. Consequently, BSA method was adopted and 520 random 10-mer primers were used to screen polymorphic bands between two bulks. Six primers could amplify polymorphic bands, of which S465 generates the most stable RAPD patterns. Then, S465 that cosegregates in F2 population has been converted into an RFLP marker successfully. Furthermore, srs-1 gene was mapped on chromosome 3 using DH mapping population. The effect of srs-1 gene results in the mutant of split rice spikelet. The mutant has longer and softer palea/lemma than those of wild-type, and two small palea/lemma-like organs between palea and lemma. In addition, there is a flower with three stamens and carpel in the axil of lemma. Thus, there are nine stamens and two carpels in the spikelet of mutant. srs-1 gene may belong to homeotic gene of class A according to the mutant characteristics and ABC model.

  17. Label-free biomolecular characterization of human breast cancer tissue with stimulated Raman scattering (SRS) spectral imaging (Conference Presentation)

    Science.gov (United States)

    Lu, Fa-Ke F.; Calligaris, David; Suo, Yuanzhen; Santagata, Sandro; Golby, Alexandra J.; Xie, X. Sunney; Mallory, Melissa A.; Golshan, Mehra; Dillon, Deborah A.; Agar, Nathalie Y. R.

    2017-02-01

    Stimulated Raman scattering (SRS) microscopy has been used for rapid label-free imaging of various biomolecules and drugs in living cells and tissues (Science, doi:10.1126/science.aaa8870). Our recent work has demonstrated that lipid and protein mapping of cancer tissue renders pathology-like images, providing essential histopathological information with subcellular resolution of the entire specimen (Cancer Research, doi: 10.1158/0008-5472.CAN-16-027). We have also established the first SRS imaging Atlas of human brain tumors (Harvard Dataverse, doi: (doi:10.7910/DVN/EZW4EK). SRS imaging of tissue could provide invaluable information for cancer diagnosis and surgical guidance in two aspects: rapid surgical pathology and quantitative biomolecular characterization. In this work, we present the use of SRS microscopy for characterization of a few essential biomolecules in breast cancer. Human breast cancer tissue specimens at the tumor core, tumor margin and normal area (5 cm away from the tumor) from surgical cases will be imaged with SRS at multiple Raman shifts, including the peaks for lipid, protein, blood (absorption), collagen, microcalcification (calcium phosphates and calcium oxalate) and carotenoids. Most of these Raman shifts have relatively strong Raman cross sections, which ensures high-quality and fast imaging. This proof-of-principle study is sought to demonstrate the feasibility and potential of SRS imaging for ambient diagnosis and surgical guidance of breast cancer.

  18. Development of SRS.php, a Simple Object Access Protocol-based library for data acquisition from integrated biological databases.

    Science.gov (United States)

    Barbosa-Silva, A; Pafilis, E; Ortega, J M; Schneider, R

    2007-12-11

    Data integration has become an important task for biological database providers. The current model for data exchange among different sources simplifies the manner that distinct information is accessed by users. The evolution of data representation from HTML to XML enabled programs, instead of humans, to interact with biological databases. We present here SRS.php, a PHP library that can interact with the data integration Sequence Retrieval System (SRS). The library has been written using SOAP definitions, and permits the programmatic communication through webservices with the SRS. The interactions are possible by invoking the methods described in WSDL by exchanging XML messages. The current functions available in the library have been built to access specific data stored in any of the 90 different databases (such as UNIPROT, KEGG and GO) using the same query syntax format. The inclusion of the described functions in the source of scripts written in PHP enables them as webservice clients to the SRS server. The functions permit one to query the whole content of any SRS database, to list specific records in these databases, to get specific fields from the records, and to link any record among any pair of linked databases. The case study presented exemplifies the library usage to retrieve information regarding registries of a Plant Defense Mechanisms database. The Plant Defense Mechanisms database is currently being developed, and the proposal of SRS.php library usage is to enable the data acquisition for the further warehousing tasks related to its setup and maintenance.

  19. Measurement of the SC magnetic field

    CERN Multimedia

    CERN PhotoLab

    1973-01-01

    The 3.5-metre-arm carrying 100 Hall plates used for the measurmeent of the SC magnetic field. The arm rotates in a horizontal plane, its positioning and the data read-out are controlled by an on-line computer.

  20. Magnet measuring equipment of SC2

    CERN Multimedia

    CERN PhotoLab

    1974-01-01

    Checking the positioning of the magnet measuring equipment installed between the poles of SC2. The steel structure in front of the magnet is designed to house the rotary condenser and to shield it from the stray magnetic field of the accelerator.

  1. Magnet measuring equipment of SC2

    CERN Multimedia

    1974-01-01

    Checking the positioning of the magnet measuring equipment installed between the poles of SC2. The steel structure in front of the magnet is designed to house the rotary condenser and to shield it from the stray magnetic field of the accelerator. On the left, Marinus van Gulik. (See Photo Archive 7402005 and Annual Report 1974, p. 44.)

  2. The Synchrocyclotron (SC) in building 300

    CERN Multimedia

    Maximilien Brice

    2012-01-01

    The red magnet of CERN's first accelerator, the Synchrocyclotron (SC), has occupied a large part of Hall 300 since it was installed in the late 1950s. The remaining part of the 300-square-metre building has been used as a storage room since the accelerator was shut down in 1990. Now a public exhibition will breathe new life into the hall.

  3. Knowledge insufficient: the management of haemoglobin SC disease.

    Science.gov (United States)

    Pecker, Lydia H; Schaefer, Beverly A; Luchtman-Jones, Lori

    2017-02-01

    Although haemoglobin SC (HbSC) accounts for 30% of sickle cell disease (SCD) in the United States and United Kingdom, evidence-based guidelines for genotype specific management are lacking. The unique pathology of HbSC disease is complex, characterized by erythrocyte dehydration, intracellular sickling and increased blood viscosity. The evaluation and treatment of patients with HbSC is largely inferred from studies of SCD consisting mostly of haemoglobin SS (HbSS) patients. These studies are underpowered to allow definitive conclusions about HbSC. We review the pathophysiology of HbSC disease, including known and potential differences between HbSS and HbSC, and highlight knowledge gaps in HbSC disease management. Clinical and translational research is needed to develop targeted treatments and to validate management recommendations for efficacy, safety and impact on quality of life for people with HbSC. © 2016 John Wiley & Sons Ltd.

  4. Saturated thickness, High Plains aquifer, 2009

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This raster data set represents the saturated thickness of the High Plains aquifer of the United States, 2009, in feet. The High Plains aquifer underlies...

  5. Incidence of spinal deformity in adults and its distribution according SRS-Schwab classification

    Directory of Open Access Journals (Sweden)

    Marcus Vinicius Amaral Barreto

    2015-06-01

    Full Text Available OBJECTIVE: To evaluate the incidence of spinal deformity in adults, as well as its distribution according the curve type and the occurrence of sagittal modifiers of the SRS-Schwab classification..METHODS: Radiographs in frontal and lateral views of the entire column were performed and radiographic parameters were used to diagnose the vertebral deformity for the classification according to the SRS-Schwab system.RESULTS: We included 302 patients in the study, 236 (78.1% women and 66 (21.9% men. Fifty-six of the participants were diagnosed with ASD, 50 women and 6 men. The incidence of ASD was 18.5% in the total population, ranging from 9.1% in males and 21.2% in females (p=0.04. As to age group, the incidence was 11.9% in patients between 18 and 39 years, 12% between 40 and 59 years and 28.8% in patients with 60 years of age or older, significantly higher in the oldest group (p=0.002. When analyzing the correlation between age and progression of sagittal modifiers, there was no significant difference in the PI-LL and PT modifiers, but there was significant difference of SVA modifier (p=0.008, with a higher age in individuals "++".CONCLUSION: This study presented demographic data on ASD in a Brazilian population sample. There was a higher incidence of ASD in females and individuals aged ≥ 60 years. As for the sagittal modifiers of SRS-Schwab classification, there was a correlation between increasing age and degree of progression of SVA.

  6. Recommendations for research studies on treatment of idiopathic scoliosis: Consensus 2014 between SOSORT and SRS non-operative management committee.

    Science.gov (United States)

    Negrini, Stefano; Hresko, Timothy M; O'Brien, Joseph P; Price, Nigel

    2015-01-01

    The two main societies clinically dealing with idiopathic scoliosis are the Scoliosis Research Society (SRS), founded in 1966, and the international Society on Scoliosis Orthopedic and Rehabilitation Treatment (SOSORT), started in 2004. Inside the SRS, the Non-Operative Management Committee (SRS-NOC) has the same clinical interest of SOSORT, that is the Orthopaedic and Rehabilitation (or Non-Operative, or conservative) Management of idiopathic scoliosis patients. The aim of this paper is to present the results of a Consensus among the best experts of non-operative treatment of Idiopathic Scoliosis, as represented by SOSORT and SRS, on the recommendation for research studies on treatment of Idiopathic Scoliosis. The goal of the consensus statement is to establish a framework for research with clearly delineated inclusion criteria, methodologies, and outcome measures so that future meta- analysis or comparative studies could occur. A Delphi method was used to generate a consensus to develop a set of recommendations for clinical studies on treatment of Idiopathic Scoliosis. It included the development of a reference scheme, which was judged during two Delphi Rounds; after this first phase, it was decided to develop the recommendations and 4 other Delphi Rounds followed. The process finished with a Consensus Meeting, that was held during the SOSORT Meeting in Wiesbaden, 8-10 May 2014, moderated by the Presidents of SOSORT (JP O'Brien) and SRS (SD Glassman) and by the Chairs of the involved Committees (SOSORT Consensus Committee: S Negrini; SRS Non-Operative Committee: MT Hresko). The Boards of the SRS and SOSORT formally accepted the final recommendations. The 18 Recommendations focused: Research needs (3), Clinically significant outcomes (4), Radiographic outcomes (3), Other key outcomes (Quality of Life, adherence to treatment) (2), Standardization of methods of non-operative research (6).

  7. Precipitation hardening in ternary alloys of the Al-Sc-Cu and Al-Sc-Si systems

    Energy Technology Data Exchange (ETDEWEB)

    Kharakterova, M.L.; Eskin, D.G.; Toropova, L.S. (Russian Academy of Sciences, Moscow (Russian Federation). A.A. Baikov Inst. of Metallurgy)

    1994-07-01

    The processes of precipitation hardening in cast ternary alloys of the Al-Sc-Cu and Al-Sc-Si systems were studied in the temperature range of aging from 100 to 450 C and at exposures to 200 h. It was shown that the CuAl[sub 2] and ScAl[sub 3] phases were involved in the process of aging in ternary Al-Sc-Cu alloys, and the Si and V (AlSiSc) phases, in ternary Al-Sc-Si alloys with excess silicon in a supersaturated solid solution. The V phase was for the first time revealed as the hardening phase in aluminum alloys.

  8. Presence and absence of bats across habitat scales in the Upper Coastal Plain of South Carolina.

    Energy Technology Data Exchange (ETDEWEB)

    Ford, W.Mark; Menzel, Jennifer M.; Menzel, Michael A.: Edwards, John W.; Kilgo, John C.

    2006-10-01

    Abstract During 2001, we used active acoustical sampling (Anabat II) to survey foraging habitat relationships of bats on the Savannah River Site (SRS) in the upper Coastal Plain of South Carolina. Using an a priori information-theoretic approach, we conducted logistic regression analysis to examine presence of individual bat species relative to a suite of microhabitat, stand, and landscape-level features such as forest structural metrics, forest type, proximity to riparian zones and Carolina bay wetlands, insect abundance, and weather. There was considerable empirical support to suggest that the majority of the activity of bats across most of the 6 species occurred at smaller, stand-level habitat scales that combine measures of habitat clutter (e.g., declining forest canopy cover and basal area), proximity to riparian zones, and insect abundance. Accordingly, we hypothesized that most foraging habitat relationships were more local than landscape across this relatively large area for generalist species of bats. The southeastern myotis (Myotis austroriparius) was the partial exception, as its presence was linked to proximity of Carolina bays (best approximating model) and bottomland hardwood communities (other models with empirical support). Efforts at SRS to promote open longleaf pine (Pinus palustris) and loblolly pine (P. taeda) savanna conditions and to actively restore degraded Carolina bay wetlands will be beneficial to bats. Accordingly, our results should provide managers better insight for crafting guidelines for bat habitat conservation that could be linked to widely accepted land management and environmental restoration practices for the region.

  9. Design of a Carousel Process for Removing Cesium from SRS Waste Using Crystalline Silicotitanate Ion Exchanger

    Energy Technology Data Exchange (ETDEWEB)

    Walker, D.D.

    1999-01-15

    Designs of a three-column carousel process based on crystalline silicotitanate (CST) ion exchanger have been developed for removing radioactive 137Cs+ from Savannah River Site's (SRS) nuclear wastes. A multicomponent ion exchange equilibrium model (Zheng et al., 1997) from Texas A&M University, which is based on batch data obtained from CST powder, is used to generate cesium loading data at different cesium concentrations for various types of SRS wastes. These loading data are fit to the Langmuir equation to obtain effective single-component cesium isotherm parameters. The predictions are in reasonable agreement with batch test data obtained from CST powder, an early CST pellet batch (38B), and a later batch (IE911) using two SRS waste simulants. The ratios between experimental cesium distribution coefficients and predicted values are between 0.56 and 1.0. The variation appears to be due to inadequate equilibration time in some of the batches. Mass transfer parameters are estimated by analyzing column data of a simulated SRS waste and Melton Valley Storage Tank W29 (MVST-W29) waste. The intraparticle diffusivity estimated for the two wastes can be well correlated by means of the Stokes-Einstein equation.Simulations are performed to determine the length of the mass transfer zone for given feed compositions, Cs+ concentrations, and linear velocities. In order to ensure high column utilization during both the transient and cyclic steady state periods, the length of a single segment in the carousel process is chosen to be the mass transfer zone length after the concentration wave achieves a constant pattern. Analysis of the dimensionless groups in the differential mass balance equations reveals that the normalized mass transfer zone length is linearly proportional to the particle Peclet number. The proportionality constant is a function of the waste composition and the Cs+ concentration in the waste. The higher the effective Cs+ capacity and the higher the Cs

  10. LHCb Data Replication During SC3

    CERN Multimedia

    Smith, A

    2006-01-01

    LHCb's participation in LCG's Service Challenge 3 involves testing the bulk data transfer infrastructure developed to allow high bandwidth distribution of data across the grid in accordance with the computing model. To enable reliable bulk replication of data, LHCb's DIRAC system has been integrated with gLite's File Transfer Service middleware component to make use of dedicated network links between LHCb computing centres. DIRAC's Data Management tools previously allowed the replication, registration and deletion of files on the grid. For SC3 supplementary functionality has been added to allow bulk replication of data (using FTS) and efficient mass registration to the LFC replica catalog.Provisional performance results have shown that the system developed can meet the expected data replication rate required by the computing model in 2007. This paper details the experience and results of integration and utilisation of DIRAC with the SC3 transfer machinery.

  11. Reduced-Latency SC Polar Decoder Architectures

    CERN Document Server

    Zhang, Chuan; Parhi, Keshab K

    2011-01-01

    Polar codes have become one of the most favorable capacity achieving error correction codes (ECC) along with their simple encoding method. However, among the very few prior successive cancellation (SC) polar decoder designs, the required long code length makes the decoding latency high. In this paper, conventional decoding algorithm is transformed with look-ahead techniques. This reduces the decoding latency by 50%. With pipelining and parallel processing schemes, a parallel SC polar decoder is proposed. Sub-structure sharing approach is employed to design the merged processing element (PE). Moreover, inspired by the real FFT architecture, this paper presents a novel input generating circuit (ICG) block that can generate additional input signals for merged PEs on-the-fly. Gate-level analysis has demonstrated that the proposed design shows advantages of 50% decoding latency and twice throughput over the conventional one with similar hardware cost.

  12. Single chain Fab (scFab fragment

    Directory of Open Access Journals (Sweden)

    Brenneis Mariam

    2007-03-01

    Full Text Available Abstract Background The connection of the variable part of the heavy chain (VH and and the variable part of the light chain (VL by a peptide linker to form a consecutive polypeptide chain (single chain antibody, scFv was a breakthrough for the functional production of antibody fragments in Escherichia coli. Being double the size of fragment variable (Fv fragments and requiring assembly of two independent polypeptide chains, functional Fab fragments are usually produced with significantly lower yields in E. coli. An antibody design combining stability and assay compatibility of the fragment antigen binding (Fab with high level bacterial expression of single chain Fv fragments would be desirable. The desired antibody fragment should be both suitable for expression as soluble antibody in E. coli and antibody phage display. Results Here, we demonstrate that the introduction of a polypeptide linker between the fragment difficult (Fd and the light chain (LC, resulting in the formation of a single chain Fab fragment (scFab, can lead to improved production of functional molecules. We tested the impact of various linker designs and modifications of the constant regions on both phage display efficiency and the yield of soluble antibody fragments. A scFab variant without cysteins (scFabΔC connecting the constant part 1 of the heavy chain (CH1 and the constant part of the light chain (CL were best suited for phage display and production of soluble antibody fragments. Beside the expression system E. coli, the new antibody format was also expressed in Pichia pastoris. Monovalent and divalent fragments (DiFabodies as well as multimers were characterised. Conclusion A new antibody design offers the generation of bivalent Fab derivates for antibody phage display and production of soluble antibody fragments. This antibody format is of particular value for high throughput proteome binder generation projects, due to the avidity effect and the possible use of

  13. The SC gets ready for visitors

    CERN Multimedia

    Antonella Del Rosso

    2012-01-01

    Hall 300, which houses the Synchrocyclotron (SC), CERN’s first accelerator, is getting ready to host a brand-new exhibition. The site will be one of the stops on the new visit itineraries that will be inaugurated for the 2013 CERN Open Day.   The Synchrocyclotron through the years. Just as it did in the late 1950s, when the accelerator was first installed, the gigantic red structure of the Synchrocyclotron's magnet occupies a large part of the 300-square-metre hall. “We have completed the first phase of the project that will give the SC a new lease of life,” says Marco Silari, the project leader and a member of CERN’s Radiation Protection Group. “We have removed all the equipment that was not an integral part of the accelerator. The hall is now ready for the civil-engineering work that will precede the installation of the exhibition.” The SC was witness to a big part of the history of CERN. The accelerator produced ...

  14. Molecular mapping of split rice spikelet mutant srs-1 and analysis of its homeotic function in rice

    Institute of Scientific and Technical Information of China (English)

    白素兰; 刘永胜; 孙敬三; 朱立煌

    2000-01-01

    srs-1, a new floral organ identity gene in rice, was mapped using RAPD and RFLP markers. Firstly, the cross was made between "ZhaiYeQing 8" (ZYQ8, indica) and split rice spikelet (SRS, japonica) mutant. The ratio of wild-type individuals and mutant plants in F2 population is 3:1, which indicates that the mutant characteristics are controlled by single recessive gene, srs-1. Consequently, BSA method was adopted and 520 random 10-mer primers were used to screen polymorphic bands between two bulks. Six primers could amplify polymorphic bands, of which S465 generates the most stable RAPD patterns. Then, S465 that cosegregates in F2 population has been converted into an RFLP marker successfully. Furthermore, srs-1 gene was mapped on chromosome 3 using DH mapping population. The effect of srs-1 gene results in the mutant of split rice spikelet. The mutant has longer and softer palea/lemma than those of wild-type, and two small palea/lemma-like organs between palea and lemma. In addition, there is a flower wit

  15. Peri-SRS Administration of Immune Checkpoint Therapy for Melanoma Metastatic to the Brain: Investigating Efficacy and the Effects of Relative Treatment Timing on Lesion Response.

    Science.gov (United States)

    Yusuf, Mehran B; Amsbaugh, Mark J; Burton, Eric; Chesney, Jason; Woo, Shiao

    2017-04-01

    To investigate the efficacy of immune checkpoint therapy (ICT) administered with stereotactic radiosurgery (SRS) and determine the effects of relative treatment timing on lesion response. A prospective institutional database of all patients with intact brain metastases treated with SRS from 2008 to 2015 was reviewed for patients diagnosed with malignant melanoma. Lesion response was determined using a modified RECIST v1.1 criteria. Patients were grouped according to if they received ICT and the timing of ICT relative to SRS. Cox regression was used to identify predictors of lesion failure (LF) and distant brain failure (DBF). The Wilcoxon rank-sum test was used to compare median lesion regression after SRS between treatment groups. Fifty-one patients with 167 metastases were evaluated. Eighteen patients (59 lesions) were treated with peri-SRS ICT with anticytotoxic T-lymphocyte-associated protein 4 or antiprogrammed cell death protein 1 therapy. Peri-SRS ICT was a significant favorable predictor for reduced hazard of LF (hazard ratio, 0.131; confidence interval, 0.028-0.610). Concurrent ICT given with SRS (hazard ratio, 0.364; confidence interval, 0.161-0.825) significantly predicted freedom from DBF. When quantitative lesion response was examined, peri-SRS ICT resulted in a significantly greater median percent lesion regression than did SRS alone at 1.5 (-30.7% vs. -14.6%; P = 0.018), 4 (-42.3% vs. -18.8%; P = 0.031), and 5 months after SRS (-52.01 vs. -14.9%; P = 0.002). ICT combined with SRS was associated with greater lesion regression of melanoma brain metastases and decreased LF. When given concurrently, combined SRS and ICT may result in improved freedom from DBF. Copyright © 2017 Elsevier Inc. All rights reserved.

  16. Evaluation of Retro recon for SRS planning correction according to the error of recognize to coordinate

    Energy Technology Data Exchange (ETDEWEB)

    Moon, Hyeon Seok; Jeong, Deok Yang; Do, Gyeong Min; Lee, Yeong Cheol; KIm, Sun Myung; Kim, Young Bun [Dept. of Radiation Oncology, Korea University Guro Hospital, Seoul (Korea, Republic of)

    2016-12-15

    The purpose of this study was to evaluate the Retro recon in SRS planning using BranLAB when stereotactic location error occurs by metal artifact. By CT simulator, image were acquired from head phantom(CIRS, PTW, USA). To observe stereotactic location recognizing and beam hardening, CT image were approved by SRS planning system(BrainLAB, Feldkirchen, Germany). In addition, we compared acquisition image(1.25mm slice thickness) and Retro recon image(using for 2.5 mm, 5mm slice thickness). To evaluate these three images quality, the test were performed by AAPM phantom study. In patient, it was verified stereotactic location error. All the location recognizing error did not occur in scanned image of phantom. AAPM phantom scan images all showed the same trend. Contrast resolution and Spatial resolution are under 6.4 mm, 1.0 mm. In case of noise and uniformity, under 11, 5 of HU were measured. In patient, the stereotactic location error was not occurred at reconstructive image. For BrainLAB planning, using Retro recon were corrected stereotactic error at beam hardening. Retro recon may be the preferred modality for radiation treatment planning and approving image quality.

  17. Feasibility Study on Applying Radiophotoluminescent Glass Dosimeters for CyberKnife SRS Dose Verification.

    Science.gov (United States)

    Hsu, Shih-Ming; Hung, Chao-Hsiung; Liao, Yi-Jen; Fu, Hsiao-Mei; Tsai, Jo-Ting; Huang, Yung-Hui; Huang, David Y C

    2017-01-01

    CyberKnife is one of multiple modalities for stereotactic radiosurgery (SRS). Due to the nature of CyberKnife and the characteristics of SRS, dose evaluation of the CyberKnife procedure is critical. A radiophotoluminescent glass dosimeter was used to verify the dose accuracy for the CyberKnife procedure and validate a viable dose verification system for CyberKnife treatment. A radiophotoluminescent glass dosimeter, thermoluminescent dosimeter, and Kodak EDR2 film were used to measure the lateral dose profile and percent depth dose of CyberKnife. A Monte Carlo simulation for dose verification was performed using BEAMnrc to verify the measured results. This study also used a radiophotoluminescent glass dosimeter coupled with an anthropomorphic phantom to evaluate the accuracy of the dose given by CyberKnife. Measurements from the radiophotoluminescent glass dosimeter were compared with the results of a thermoluminescent dosimeter and EDR2 film, and the differences found were less than 5%. The radiophotoluminescent glass dosimeter has some advantages in terms of dose measurements over CyberKnife, such as repeatability, stability, and small effective size. These advantages make radiophotoluminescent glass dosimeters a potential candidate dosimeter for the CyberKnife procedure. This study concludes that radiophotoluminescent glass dosimeters are a promising and reliable dosimeter for CyberKnife dose verification with clinically acceptable accuracy within 5%.

  18. An evaluation of the ecological consequences of partial-power operation of the K Reactor, SRS

    Energy Technology Data Exchange (ETDEWEB)

    Gladden, J.B.; Mackey, H.E.; Paller, M.H.; Specht, W.L.; Wike, L.D.; Wilde, E.W.

    1991-06-01

    The K Reactor at the Savannah River Site (SRS) shut-down in spring 1988 for maintenance and safety upgrades. Since that time the receiving stream for thermal effluent, Indian Grave Branch and Pen Branch, have undergone a pattern of post-thermal recovery that is typical of other SRS streams following removal of thermal stress. Divesity of fish and aquatic macroinvertebrate communities has increased and available habitats have been colonized by numerous species of herbaceous and woody plants. K Reactor is scheduled to resume operation in 1991 and operate through 1992 without a cooling tower to cool the discharge. It is likely that the reactor will operate at approximately one-third to one-half of full power (800--1200 MW thermal) during this period and effluent temperatures will be substantially lower than earlier operation at full power. Monthly average discharge temperatures at half-power operation will range from approximately 42{degrees}C in winter to 49{degrees}C in summer. The volume of water discharged will not be affected by altered power levels and will average approximately 10--11 m{sup 3}/s. The ecological consequences of this mode of operation on the Indian Grave/Pen Branch stream system have been evaluated.

  19. Plain Polynomial Arithmetic on GPU

    Science.gov (United States)

    Anisul Haque, Sardar; Moreno Maza, Marc

    2012-10-01

    As for serial code on CPUs, parallel code on GPUs for dense polynomial arithmetic relies on a combination of asymptotically fast and plain algorithms. Those are employed for data of large and small size, respectively. Parallelizing both types of algorithms is required in order to achieve peak performances. In this paper, we show that the plain dense polynomial multiplication can be efficiently parallelized on GPUs. Remarkably, it outperforms (highly optimized) FFT-based multiplication up to degree 212 while on CPU the same threshold is usually at 26. We also report on a GPU implementation of the Euclidean Algorithm which is both work-efficient and runs in linear time for input polynomials up to degree 218 thus showing the performance of the GCD algorithm based on systolic arrays.

  20. Southern Great Plains Safety Orientation

    Energy Technology Data Exchange (ETDEWEB)

    Schatz, John

    2014-05-01

    Welcome to the Atmospheric Radiation Measurement (ARM) Climate Research Facility (ARM) Southern Great Plains (SGP) site. This U.S. Department of Energy (DOE) site is managed by Argonne National Laboratory (ANL). It is very important that all visitors comply with all DOE and ANL safety requirements, as well as those of the Occupational Safety and Health Administration (OSHA), the National Fire Protection Association, and the U.S. Environmental Protection Agency, and with other requirements as applicable.

  1. Subcloning and expression of the NcSRS2 gene fragment of Neospora caninum%新孢子虫NcSRS2基因的亚克隆和表达

    Institute of Scientific and Technical Information of China (English)

    余劲术; 刘群; 汪明

    2006-01-01

    本研究根据NcSRS2基因序列设计合成一对引物,将上、下游引物分别引入EcoRI,XhoI酶切位点,用PCR技术从pGEX-NcSRS2重组质粒扩增截去N端疏水氨基酸序列NcSRS2的基因片段(以下称dNcSRS2),插入到pGEX-6p-1质粒的多克隆位点,转化大肠杆菌BL21感受态细胞,于氨苄阳性LB培养平板上筛选阳性克隆,酶切及PCR鉴定;经IPTG诱导在E.coli中表达,用SDS-PAGE和免疫印迹分析表达产物并纯化.结果表明,新孢子虫dNcSRS2基因体外扩增产物与预期值相符,约1041bp;所构建pGEX-dNcSRS2重组质粒经双酶切与PCR鉴定,与预期结果一致;SDS-PAGE和免疫印迹显示,表达融合蛋白的分子量约为62.6 kD,表达效率为32.3%,该蛋白具有特异的免疫反应性,为新孢子虫病诊断试剂盒的研制和疫苗的研制奠定了基础.

  2. ViSC Social Competence Program.

    Science.gov (United States)

    Strohmeier, Dagmar; Hoffmann, Christine; Schiller, Eva-Maria; Stefanek, Elisabeth; Spiel, Christiane

    2012-01-01

    The ViSC Social Competence Program has been implemented in Austrian schools within the scope of a national strategy plan, Together Against Violence. The program is a primary preventive program designed for grades 5 to 8. The prevention of aggression and bullying is defined as a school development task, and the initial implementation of the program lasts one school year. The program consists of universal and specific actions that are implemented through in-school teacher training and a class project for students. The program was evaluated with a randomized intervention control group design. Data were collected from teachers and students. Results suggest that the program reduces aggression in schools.

  3. Experimental Determination and Thermodynamic Modeling of Electrical Conductivity of SRS Waste Tank Supernate

    Energy Technology Data Exchange (ETDEWEB)

    Pike, J. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Reboul, S. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2015-06-01

    SRS High Level Waste Tank Farm personnel rely on conductivity probes for detection of incipient overflow conditions in waste tanks. Minimal information is available concerning the sensitivity that must be achieved such that that liquid detection is assured. Overly sensitive electronics results in numerous nuisance alarms for these safety-related instruments. In order to determine the minimum sensitivity required of the probe, Tank Farm Engineering personnel need adequate conductivity data to improve the existing designs. Little or no measurements of liquid waste conductivity exist; however, the liquid phase of the waste consists of inorganic electrolytes for which the conductivity may be calculated. Savannah River Remediation (SRR) Tank Farm Facility Engineering requested SRNL to determine the conductivity of the supernate resident in SRS waste Tank 40 experimentally as well as computationally. In addition, SRNL was requested to develop a correlation, if possible, that would be generally applicable to liquid waste resident in SRS waste tanks. A waste sample from Tank 40 was analyzed for composition and electrical conductivity as shown in Table 4-6, Table 4-7, and Table 4-9. The conductivity for undiluted Tank 40 sample was 0.087 S/cm. The accuracy of OLI Analyzer™ was determined using available literature data. Overall, 95% of computed estimates of electrical conductivity are within ±15% of literature values for component concentrations from 0 to 15 M and temperatures from 0 to 125 °C. Though the computational results are generally in good agreement with the measured data, a small portion of literature data deviates as much as ±76%. A simplified model was created that can be used readily to estimate electrical conductivity of waste solution in computer spreadsheets. The variability of this simplified approach deviates up to 140% from measured values. Generally, this model can be applied to estimate the conductivity within a factor of two. The comparison of the

  4. SRS MOX fuel lead assemblies data report for the surplus plutonium disposition environmental impact statement

    Energy Technology Data Exchange (ETDEWEB)

    O`Connor, D.G.; Fisher, S.E.; Holdaway, R. [and others

    1998-08-01

    The purpose of this document is to support the US Department of Energy (DOE) Fissile Materials Disposition Program`s preparation of the draft surplus plutonium disposition environmental impact statement. This is one of several responses to data call requests for background information on activities associated with the operation of the lead assembly (LA) mixed-oxide (MOX) fuel fabrication facility. DOE-MD requested that the DOE Site Operations Offices nominate DOE sites that meet established minimum requirements that could produce MOX LAs. Six initial site combinations were proposed: (1) Argonne National Laboratory-West (ANL-W) with support from Idaho National Engineering and Environmental Laboratory (INEEL), (2) Hanford, (3) Los Alamos National Laboratory (LANL) with support from Pantex, (4) Lawrence Livermore National Laboratory (LLNL), (5) Oak Ridge Reservation (ORR), and (6) Savannah River Site(SRS). After further analysis by the sites and DOE-MD, five site combinations were established as possible candidates for producing MOX LAs: (1) ANL-W with support from INEEL, (2) Hanford, (3) LANL, (4) LLNL, and (5) SRS. SRS has proposed an LA MOX fuel fabrication approach that would be done entirely inside an S and S Category 1 area. An alternate approach would allow fabrication of fuel pellets and assembly of fuel rods in an S and S Category 2 or 3 facility with storage of bulk PuO{sub 2} and assembly, storage, and shipping of fuel bundles in an S and S Category 1 facility. The total Category 1 approach, which is the recommended option, would be done in the 221-H Canyon Building. A facility that was never in service will be removed from one area, and a hardened wall will be constructed in another area to accommodate execution of the LA fuel fabrication. The non-Category 1 approach would require removal of process equipment in the FB-Line metal production and packaging glove boxes, which requires work in a contamination area. The Immobilization Hot Demonstration Program

  5. Measurement of (43)Sc and (44)Sc production cross-section with an 18MeV medical PET cyclotron.

    Science.gov (United States)

    Carzaniga, Tommaso Stefano; Auger, Martin; Braccini, Saverio; Bunka, Maruta; Ereditato, Antonio; Nesteruk, Konrad Pawel; Scampoli, Paola; Türler, Andreas; van der Meulen, Nicholas

    2017-11-01

    (43)Sc and (44)Sc are positron emitter radionuclides that, in conjunction with the β(-) emitter (47)Sc, represent one of the most promising possibilities for theranostics in nuclear medicine. Their availability in suitable quantity and quality for medical applications is an open issue and their production with medical cyclotrons represents a scientific and technological challenge. For this purpose, an accurate knowledge of the production cross sections is mandatory. In this paper, we report on the cross section measurement of the reactions (43)Ca(p,n)(43)Sc, (44)Ca(p,2n) (43)Sc, (46)Ti(p,α)(43)Sc, and (44)Ca(p,n)(44)Sc at the Bern University Hospital cyclotron. A study of the production yield and purity performed by using commercially available enriched target materials is also presented. Copyright © 2017 Elsevier Ltd. All rights reserved.

  6. BOOK REVIEW: Assessing Sc1 for GCSE

    Science.gov (United States)

    Reynolds, H.

    2000-01-01

    It is well known that investigations that `fit' the National Curriculum or examination board criteria are few in number. The fair testing emphasis means that pupils all over the country are finding out what affects the rate of a chemical reaction, the rate of photosynthesis or, in the case of Physics, the resistance of a wire. This book focuses on nine of the most common Sc1 investigations and how to prepare for them, manage and assess them. The author, a GCSE examiner, has turned his expertise into a handbook for improving Sc1 performance in the classroom. He has produced a book that would be extremely useful to both newly qualified teachers and experienced teachers. The first aim of the book, however, is to explain the requirements of Sc1. This is done comprehensively with examples of what the jargon means in practice. By breaking down the elements of planning, obtaining evidence, analysing evidence and evaluating, it is easy to see the subtleties of the mark descriptors. At first glance there seems to be little difference between the type of scientific knowledge needed for planning at level 6 and level 8. However, the level 8 statement specifies `detailed' scientific knowledge and understanding, which would mean a student should use equations from physics or symbolic chemical equations to support their arguments. One of the most useful sections in the book details the marking problems that can arise with some investigations. For example, in an investigation into electromagnets it is difficult for students to provide sufficient relevant scientific theory to satisfy the requirements of planning at level 6. One of the problems with Sc1 is that certain requirements, such as graph plotting, are difficult for many students. This book provides exercises that can be given to students to improve those skills. Each of the nine investigations is covered in great detail. Each investigation begins with an introduction detailing the rationale for choosing it, whether students

  7. Behavior of mercury, lead, cesium, and uranyl ions on four SRS soils

    Energy Technology Data Exchange (ETDEWEB)

    Bibler, J.P.; Marson, D.B.

    1992-03-20

    Samples of four Savannah River Site (SRS) soils were tested for sorption behavior with Hg[sup 2+], Pb[sup 2+], UO[sub 2][sup 2+], and Cs[sup +] ions. The purpose of the study was to determine the selectivity of the different soils for these ions alone and in the presence of the competing cations, H[sup +] and Ca[sup 2+]. Distribution constants, Kd's, for the test ions in various solutions have been determined for the four soils. In general, sorption by all of the soils appeared to be more complex than a simple ion exchange or adsorption process. In particular, the presence of organic matter in soil increased the capacity of the soil due to its chelating ability. Similar soils did not react similarly toward each metal cation.

  8. Behavior of mercury, lead, cesium, and uranyl ions on four SRS soils

    Energy Technology Data Exchange (ETDEWEB)

    Bibler, J.P.; Marson, D.B.

    1992-03-20

    Samples of four Savannah River Site (SRS) soils were tested for sorption behavior with Hg{sup 2+}, Pb{sup 2+}, UO{sub 2}{sup 2+}, and Cs{sup +} ions. The purpose of the study was to determine the selectivity of the different soils for these ions alone and in the presence of the competing cations, H{sup +} and Ca{sup 2+}. Distribution constants, Kd`s, for the test ions in various solutions have been determined for the four soils. In general, sorption by all of the soils appeared to be more complex than a simple ion exchange or adsorption process. In particular, the presence of organic matter in soil increased the capacity of the soil due to its chelating ability. Similar soils did not react similarly toward each metal cation.

  9. Hydrostratigraphy of the General Separations Area, Savannah River Site (SRS), South Carolina

    Energy Technology Data Exchange (ETDEWEB)

    Aadland, R.K.; Harris, M.K.; Lewis, C.M.; Gaughan, T.F. (Westinghouse Savannah River Co., Aiken, SC (United States)); Westbrook, T.M. (Dames and Moore, Atlanta, GA (United States))

    1991-01-01

    Detailed analysis and synthesis of geophysical, core, and hydrologic data from 230 wells were used to delineate the hydrostratigraphy and aquifer characteristics of the General Separations Area at SRS. The study area is hydrologically bounded on the north and northwest by Upper Three Runs Creek (UTRC) and on the south by Fourmile Branch (FB). The Cretaceous-Tertiary sedimentary sequence underlying the study area is divided into two Aquifer Systems; in ascending order, Aquifer Systems I and 11. The study concentrated on Aquifer System U, which includes all the Tertiary sediments above the Black Mingo Group (Paleocene) to the water table. This report includes a series of lithostratigraphic cross-sections, piezometric gradient profiles, head ratio contour maps, aquifer isopach maps, and potentiometric surface maps which illustrate the aquifer characteristics of the study area.

  10. TRENDS IN ATMOPSHERIC CLIMATE PARAMETERS MEASURED AT SRS 1964-2013

    Energy Technology Data Exchange (ETDEWEB)

    Weinbeck, S. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-04-20

    Meteorological data collected at SRS since the mid-1960’s have been analyzed for trends in minimum and maximum temperature, heating and cooling degree days, precipitation and relative humidity. The trends in meteorological data collected have been relatively small compared to the interannual variability that is observed. The observed increases, while small, appear to be real (statistically significant). Overnight low temperatures (3.1°F) have increased over twice as fast as the increases in daytime highs (1.4°F). Similarly, there are statistically significant increases in the number of cooling degree days as well. There has been a similar decrease in the number of HDD and freezing days, consistent with the overall increase in overnight low temperatures.

  11. Phase transition and thermodynamic properties of SrS via first-principles calculations

    Institute of Scientific and Technical Information of China (English)

    Cheng Yan; Lu Lai-Yu; Jia Ou-He; Chen Xiang-Rong

    2008-01-01

    The phase transition of SrS from NaG1 structure (B1) to CsCl structure (B2) is investigated by means of ab initio plane-wave pseudopotential density functional theory, and the thermodynamic properties of the B1 and the B2 structures are obtained through the quasi-harmonic Debye model. It is found that the transition phase from the B1 to the B2 structures occurs at 17.9 GPa, which is in good agreement with experimental data and other calculated results.Moreover, the thermodynamic properties (including specific heat capacity, the Debye temperature, thermal expansion and Grüneisen parameter) have also been obtained successfully.

  12. SRS BUILDER 1.0: An Upper Type CASE Tool For Requirement Specification

    CERN Document Server

    Mandal, Ardhendu

    2011-01-01

    Software (SW) development is a labor intensive activity. Modern software projects generally have to deal with producing and managing large and complex software products. Developing such software has become an extremely challenging job not only because of inherent complexity, but also mainly for economic constraints unlike time, quality, maintainability concerns. Hence, developing modern software within the budget still remains as one of the main software crisis. The most significant way to reduce the software development cost is to use the Computer-Aided Software Engineering (CASE) tools over the entire Software Development Life Cycle (SDLC) process as substitute to expensive human labor cost. We think that automation of software development methods is a valuable support for the software engineers in coping with this complexity and for improving quality too. This paper demonstrates the newly developed CASE tools name "SRS Builder 1.0" for software requirement specification developed at our university laborato...

  13. Exploratory Factor Analysis of SRS-2 Teacher Ratings for Youth with ASD.

    Science.gov (United States)

    Nelson, Andrew T; Lopata, Christopher; Volker, Martin A; Thomeer, Marcus L; Toomey, Jennifer A; Dua, Elissa

    2016-09-01

    This study examined the factor structure and internal consistency of special education teaching staff ratings on the Social Responsiveness Scale-2 (SRS-2; Constantino and Gruber 2012), as well as the percentage of ratings falling above pre-established cut scores, for a sample of lower-functioning youth with autism spectrum disorder (ASD; n = 264). Results of the exploratory factor analysis yielded a four-factor correlated solution. The individual factors and total score demonstrated satisfactory internal consistency reliability for screening purposes. When applying the lowest pre-established cut score (T ≥ 60; minimum indication of clinically significant symptoms/impairments), 85 % of the sample had ratings in that range or higher (more severe). Implications for assessment and future research are provided.

  14. Groundwater flow and tritium migration from the SRS Old Burial Ground to Fourmile Branch

    Energy Technology Data Exchange (ETDEWEB)

    Flach, G.P.; Hamm, L.L.; Harris, M.K. [and others

    1996-04-01

    The objectives of this investigation are twofold. The initial goal is to devise and demonstrate a technique for directly incorporating fine-scale lithologic data into heterogeneous hydraulic conductivity fields, for improved groundwater flow and contaminant transport model accuracy. The ultimate goal is to rigorously simulate past and future tritium migration from the SRS Old Burial Ground towards Fourmile Branch, to better understand the effects of various remediation alternatives such as no action and capping. Large-scale variability in hydraulic conductivity is usually the main influence on field-scale groundwater flow patterns and dispersive transport, following the relative locations of recharge and discharge areas. Incorporating realistic hydraulic conductivity heterogeneity into flow and transport models is paramount to accurate simulations, particularly for contaminant migration. Sediment lithologic descriptions and geophysical logs typically offer finer spatial resolution, and therefore more potential information about heterogeneity, than other site characterization data.

  15. Construction of Prokaryotic Expression Plasmid of NcSRS2 Gene of Neospora caninum%犬新孢子虫NcSRS2基因原核表达质粒的构建

    Institute of Scientific and Technical Information of China (English)

    丁德; 梁晚枫; 田野; 田万年; 贾立军; 张守发

    2008-01-01

    根据已发表的犬新孢子虫NcSRS2基因序列,设计1对含有EcoRⅠ和NotⅠ酶切位点的引物.以提取犬新孢子虫虫体基因组DNA为模板,应用PCR扩增获得NcSRS2 ORF基因片段,将此基因片段克隆到pMD18-T Simple载体上,用EcoRⅠ和NotⅠ双酶切该片段,回收得到含有两个酶切位点黏端的NcSRS2 ORF基因,将此基因片段克隆至相同酶切回收后的PGEM-4T-2原核表达载体中,获得重组质粒pGEX-NcSRS2,经PCR鉴定,限制性内切酶分析和克隆片段序列测定比较,证实了重组质粒的正确性.

  16. MOBILIZATION AND CHARACTERIZATION OF COLLOIDS GENERATED FROM CEMENT LEACHATES MOVING THROUGH A SRS SANDY SEDIMENT

    Energy Technology Data Exchange (ETDEWEB)

    Li, D.; Roberts, K.; Kaplan, D.; Seaman, J.

    2011-09-20

    Naturally occurring mobile colloids are ubiquitous and are involved in many important processes in the subsurface zone. For example, colloid generation and subsequent mobilization represent a possible mechanism for the transport of contaminants including radionuclides in the subsurface environments. For colloid-facilitated transport to be significant, three criteria must be met: (1) colloids must be generated; (2) contaminants must associate with the colloids preferentially to the immobile solid phase (aquifer); and (3) colloids must be transported through the groundwater or in subsurface environments - once these colloids start moving they become 'mobile colloids'. Although some experimental investigations of particle release in natural porous media have been conducted, the detailed mechanisms of release and re-deposition of colloidal particles within natural porous media are poorly understood. Even though this vector of transport is known, the extent of its importance is not known yet. Colloid-facilitated transport of trace radionuclides has been observed in the field, thus demonstrating a possible radiological risk associated with the colloids. The objective of this study was to determine if cementitious leachate would promote the in situ mobilization of natural colloidal particles from a SRS sandy sediment. The intent was to determine whether cementitious surface or subsurface structure would create plumes that could produce conditions conducive to sediment dispersion and mobile colloid generation. Column studies were conducted and the cation chemistries of influents and effluents were analyzed by ICP-OES, while the mobilized colloids were characterized using XRD, SEM, EDX, PSD and Zeta potential. The mobilization mechanisms of colloids in a SRS sandy sediment by cement leachates were studied.

  17. Evaluation of no-MST operations in the SRS ARP for Hanford LAWPS

    Energy Technology Data Exchange (ETDEWEB)

    Herman, D. [Savannah River Site (SRS), Aiken, SC (United States)

    2016-11-14

    The Savannah River Site (SRS) Actinide Removal Process has been processing salt waste since 2008. This process includes a filtration step in the 512-S facility. Initial operations included the addition, or strike, of monosodium titanate (MST) to remove soluble actinides and strontium. The added MST and any entrained sludge solids were then separated from the supernate by cross flow filtration. During this time, the filter operations have, on many occasions, been the bottleneck process limiting the rate of salt processing. Recently, 512-S- has started operations utilizing “No-MST” where the MST actinide removal strike was not performed and the supernate was simply pre-filtered prior to Cs removal processing. Direct filtration of decanted tank supernate, as demonstrated in 512-S, is the proposed method of operation for the Hanford Low Activity Waste Pretreatment System (LAWPS) facility. Processing decanted supernate without MST solids has been demonstrated for cross flow filtration to provide a significant improvement in production with the SRS Salt Batches 8 and 9 feed chemistries. The average filtration rate for the first 512-S batch processing cycle using No-MST has increased filtrate production by over 35% of the historical average. The increase was sustained for more than double the amount of filtrate batches processed before cleaning of the filter was necessary. While there are differences in the design of the 512-S and Hanford filter systems, the 512-S system should provide a reasonable indication of LAWPS filter performance with similar feed properties. Based on the data from the 512-S facility and with favorable feed properties, the LAWPS filter, as currently sized at over twice the size of the 512-S filter (532 square feet filtration area versus 235 square feet), has the potential to provide sustained filtrate production at the upper range of the planned LAWPS production rate of 17 gpm.

  18. ACTUAL-WASTE TESTING OF ULTRAVIOLET LIGHT TO AUGMENT THE ENHANCED CHEMICAL CLEANING OF SRS SLUDGE

    Energy Technology Data Exchange (ETDEWEB)

    Martino, C.; King, W.; Ketusky, E.

    2012-07-10

    In support of Savannah River Site (SRS) tank closure efforts, the Savannah River National Laboratory (SRNL) conducted Real Waste Testing (RWT) to evaluate Enhanced Chemical Cleaning (ECC), an alternative to the baseline 8 wt% oxalic acid (OA) chemical cleaning technology for tank sludge heel removal. ECC utilizes a more dilute OA solution (2 wt%) and an oxalate destruction technology using ozonolysis with or without the application of ultraviolet (UV) light. SRNL conducted tests of the ECC process using actual SRS waste material from Tanks 5F and 12H. The previous phase of testing involved testing of all phases of the ECC process (sludge dissolution, OA decomposition, product evaporation, and deposition tank storage) but did not involve the use of UV light in OA decomposition. The new phase of testing documented in this report focused on the use of UV light to assist OA decomposition, but involved only the OA decomposition and deposition tank portions of the process. Compared with the previous testing at analogous conditions without UV light, OA decomposition with the use of UV light generally reduced time required to reach the target of <100 mg/L oxalate. This effect was the most pronounced during the initial part of the decomposition batches, when pH was <4. For the later stages of each OA decomposition batch, the increase in OA decomposition rate with use of the UV light appeared to be minimal. Testing of the deposition tank storage of the ECC product resulted in analogous soluble concentrations regardless of the use or non-use of UV light in the ECC reactor.

  19. Thirty-year solid waste generation forecast for facilities at SRS

    Energy Technology Data Exchange (ETDEWEB)

    1994-07-01

    The information supplied by this 30-year solid waste forecast has been compiled as a source document to the Waste Management Environmental Impact Statement (WMEIS). The WMEIS will help to select a sitewide strategic approach to managing present and future Savannah River Site (SRS) waste generated from ongoing operations, environmental restoration (ER) activities, transition from nuclear production to other missions, and decontamination and decommissioning (D&D) programs. The EIS will support project-level decisions on the operation of specific treatment, storage, and disposal facilities within the near term (10 years or less). In addition, the EIS will provide a baseline for analysis of future waste management activities and a basis for the evaluation of the specific waste management alternatives. This 30-year solid waste forecast will be used as the initial basis for the EIS decision-making process. The Site generates and manages many types and categories of waste. With a few exceptions, waste types are divided into two broad groups-high-level waste and solid waste. High-level waste consists primarily of liquid radioactive waste, which is addressed in a separate forecast and is not discussed further in this document. The waste types discussed in this solid waste forecast are sanitary waste, hazardous waste, low-level mixed waste, low-level radioactive waste, and transuranic waste. As activities at SRS change from primarily production to primarily decontamination and decommissioning and environmental restoration, the volume of each waste s being managed will change significantly. This report acknowledges the changes in Site Missions when developing the 30-year solid waste forecast.

  20. Construction of multiform scFv antibodies using linker peptide

    Institute of Scientific and Technical Information of China (English)

    Shihua Wang; Cengjie Zheng; Ying Liu; Huirong Zheng; Zonghua Wang

    2008-01-01

    Multiform single chain variable fragments (acFvs) including different length linker scFvs and bispecific seFv were constructed. The linker lengths of 0, 3, 5, 8, 12, and 15 amino acids between VH and VL of antideoxynivalenol (anti-DON) scFv were used to analyze the affinities of scFvs. The affinity constants of these scFvs increased when the linker was lower than 12 amino acids. The affinity constant would not change when the linker was longer than 12 amino acids. Fusion gene of anti-DON seFv and antizearalenone (anti-ZEN) scFv was also constructed through eormection by a short peptide tinker DNA to express a bispecific scFv. The affinity constants assay showed that the two scFvs of fusion bispecific scFv remained their own affinity compared to their parental scFvs. Competitive direct enzyme linked immunosorbent assay was used to detect DON and ZEN in contaminated wheat (Triticum aestivum L.) samples, and the results indicated that this bispecifie acFv was applicable in DON and ZEN detection. This work confirmed that bispecific scFv could be successfully obtained, and might also have an application in diagnosing fungal infection, and breeding transgertic plants.

  1. 牛新孢子虫NcSRS2基因腺病毒穿梭载体的构建及在293细胞中的表达%Construction of bovine Neospora caninum NcSRS2 adenovirus shuttle vector and expression of NcSRS2 gene in 293 cells

    Institute of Scientific and Technical Information of China (English)

    贾立军; 张守发; 刘明明

    2012-01-01

    应用PCR技术扩增牛新孢子虫NcSRS2基因,纯化PCR产物后与克隆载体pMD18-T Simple Vector连接,将PCR、酶切鉴定及测序分析正确的pMD-18T-NcSRS2重组质粒进行EcoRⅠ和XbaⅠ双酶切,克隆至相同酶切回收后的腺病毒穿梭载体pCR259中,再将PCR、酶切鉴定正确的pCR259-NcSRS2重组质粒转染293细胞,应用IF-AT和Western-blotting技术检测重组质粒在293细胞中的表达情况。结果显示,扩增的牛新孢子虫NcSRS2基因长度为1 227bp,与GenBank中发表的NcSRS2(AF061249)核苷酸序列同源性为99%,构建的pCR259-NcSRS2重组质粒在293细胞中得到瞬时表达,表达蛋白的相对分子质量为43 000,具有较好的反应原性。本试验为新孢子虫病腺病毒载体疫苗的构建奠定了基础。%In this research,bovine Neospora caninum NcSRS2 gene was amplified by PCR.The purified PCR products were ligated with pMD18-T simple vector.After enzyme digestion and sequence analysis,the correct pMD-18T-NcSRS2 gene was digested by EcoRⅠand XbaⅠ,and cloned into the adenovirus shuttle vector pCR259 which was digested by the same enzymes.The correct pCR259-NcSRS2 recombinant plasmid was transfected into 293 cells.The expression of recombinant plasmid in 293 cells was detected by IFAT and Western-blotting.The result shows that the length of bovine Neospora caninum NcSRS2 gene is 1 227 bp.which has 99% homology with sequence and sequence in GenBank.The pCR259-NcSRS2 recombinant plasmid could transiently express in 293 cells.The molecular weight of the expressed protein which has good reactionogenicity is 43 000.This research laid the foundation for the construction of Neospora caninum vector-adenovirus vaccine

  2. SC response characteristics of two kinds of coagulant

    Institute of Scientific and Technical Information of China (English)

    杨万东; 宋爽; 史惠祥

    2002-01-01

    Automatic coagulant dosage control with streaming current (SC) technique is introduced in this paper. Aluminum and ferric coagulants are widely used in surface water treatment. The SC response characteristics of P-AlCl3 aluminum coagulant and P-FeCl3 ferric coagulant were investigated in this work. Bench-scale water treatment results were obtained from jar tests including rapid mixing, flocculation and undisturbed sedimentation. Results showed that aluminum coagulant is more sensitive than ferric coagulant to SC response.

  3. SC response characteristics of two kinds of coagulant

    Institute of Scientific and Technical Information of China (English)

    杨万东; 宋爽; 史惠祥

    2002-01-01

    Automatic coagulant dosage control with streaming current (SC) technique is in troduced inthis paper. Aluminum and ferric coagulants are widely used in surface water treatment. The SC response characteristics of P-AiCI3 aluminum coagulant and P-FeCI3 ferric coagulant were investigated in this work. Bench-scale water treatment results were obtained from jar tests including rapid mixing,flocculation and undisturbed sedimentation. Results showed that aluminum coagulant is more sensitive than ferric coagulant to SC response.

  4. Final Scientific Report: DE-SC0002194

    Energy Technology Data Exchange (ETDEWEB)

    Seidler, Gerald [Univ. of Washington, Seattle, WA (United States)

    2017-04-07

    We provide the final scientific report for DE-SC0002194. During the term of this grant, 28 publications spanning a variety of topics were addressed under the rubric of advanced x-ray methods and their application to extreme conditions of time-resolution or x-ray intensities. Notable accomplishments include a new observation of XANES features associated with f-shell reconfiguration in lanthanides, size-dependent x-ray heating effects under XFEL illumination conditions, theoretical development of improved treatments of inelastic x-ray scattering for 'warm dense matter' conditions, and several new instrument develop efforts for atomic, molecular, and condensed phase studies in the lab and at major facility lightsources.

  5. Exit and Paradise Creek Braid Plain Kilometers, 2012

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This dataset consists of points designating braid plain kilometers, or distance along the braid plain centerline, for the 2012 active braid plain of Exit Creek and...

  6. Anomalous Halo Formation in an Arc-Melted ScNi-Sc2Ni Off-Eutectic Binary Alloy

    Directory of Open Access Journals (Sweden)

    Kai Wang

    2016-07-01

    Full Text Available Diverse non-equilibrium eutectic structures have attracted numerous experimental and theoretical studies. One special type is the formation of a halo of one phase around a primary dendrite of another phase. In our experiments, it was occasionally observed that ScNi halos grow as dendritic morphology around the primary Sc 2 Ni dendrites in an arc-melted ScNi-Sc 2 Ni off-eutectic binary alloy. The formation of this anomalous halo structure was then well reproduced by employing quantitative phase-field simulations. Based on the phase-field simulation, It was found that (i the large undercooling and growth velocity of the ScNi phase during solidification causes the formation of halos; and (ii the released latent heat induces the recalescence phenomenon, and changes the solidification sequence largely, resulting in the anomalous halo structure in the Sc-34 at % Ni alloy.

  7. IEC SC15E: Report on liaison activities of CIGRÉ-SC15

    DEFF Research Database (Denmark)

    Henriksen, Mogens

    2000-01-01

    WG’s activities under CIGRÉ SC15:WG 15.01 - Fluid impregnated systems.WG 15.02 - Dielectric Liquids.WG 15.03 - Gas Insulation.WG 15.04 - Outdoor Insulation.WG 15.05 - Capacitors.WG 15.07 - Solid Insulating Materials for Rotating Machines.WG 15/33.08 - Insulation Monitoring and Life Estimation. WG...

  8. Energy dependence of deformation parameters in the SC(p,p') SC reaction

    Energy Technology Data Exchange (ETDEWEB)

    Jones, K.W.; Glashausser, C.; de Swiniarski, R.; Nanda, S.; Carey, T.A.; Cornelius, W.; Moss, J.M.; McClelland, J.B.; Comfort, J.R.; Escudie, J.

    1986-01-01

    Values of deformation parameters have been extracted from macroscopic coupled-channels analyses of inelastic proton scattering to the first 2 , 3 , and 4 states of SC over the energy range from 200 to 700 MeV. The apparent deformations are almost unchanged over this energy interval; they agree also with nucleon scattering data at much lower energies and at 800 MeV and 1 GeV.

  9. PLAINS CO2 REDUCTION PARTNERSHIP

    Energy Technology Data Exchange (ETDEWEB)

    Edward N. Steadman; John A. Harju; Erin M. O' Leary; James A. Sorensen; Daniel J. Daly; Melanie D. Jensen; Thea E. Reikoff

    2004-10-01

    The Plains CO{sub 2} Reduction (PCOR) Partnership continues to make great progress. Task 2 (Technology Deployment) focused on developing information regarding deployment issues to support Task 5 (Modeling and Phase II Action Plans) by providing information to be used to assess CO{sub 2} sequestration opportunities in the PCOR Partnership region. Task 3 (Public Outreach) focused on developing an informational video about CO{sub 2} sequestration. Progress in Task 4 (Sources, Sinks, and Infrastructure) included the continued collection of data regarding CO{sub 2} sources and sinks and data on the performance and costs for CO{sub 2} separation, capture, treatment, and compression for pipeline transportation. Task 5 focused on screening and qualitatively assessing sequestration options. Task 5 activities also continue to be useful in structuring data collection and other activities in Tasks 2, 3, and 5.

  10. PLAINS CO2 REDUCTION PARTNERSHIP

    Energy Technology Data Exchange (ETDEWEB)

    Edward N. Steadman; John A. Harju; Erin M. O' Leary; James A. Sorensen; Daniel J. Daly; Melanie D. Jensen; Thea E. Reikoff

    2005-01-01

    The Plains CO{sub 2} Reduction (PCOR) Partnership continues to make great progress. Task 2 (Technology Deployment) focused on developing information regarding deployment issues to support Task 5 (Modeling and Phase II Action Plans) by providing information to be used to assess CO{sub 2} sequestration opportunities in the PCOR Partnership region. Task 3 (Public Outreach) focused on developing an informational video about CO{sub 2} sequestration. Progress in Task 4 (Sources, Sinks, and Infrastructure) included the continued collection of data regarding CO{sub 2} sources and sinks and data on the performance and costs for CO{sub 2} separation, capture, treatment, and compression for pipeline transportation. Task 5 focused on screening and qualitatively assessing sequestration options. Task 5 activities also continue to be useful in structuring data collection and other activities in Tasks 2, 3, and 5.

  11. PLAINS CO2 REDUCTION PARTNERSHIP

    Energy Technology Data Exchange (ETDEWEB)

    Edward N. Steadman; John A. Harju; Erin M. O' Leary; James A. Sorensen; Daniel J. Daly; Melanie D. Jensen; Thea E. Reikoff

    2005-01-01

    The Plains CO{sub 2} Reduction (PCOR) Partnership continues to make great progress. Task 2 (Technology Deployment) focused on developing information regarding deployment issues to support Task 5 (Modeling and Phase II Action Plans) by providing information to be used to assess CO{sub 2} sequestration opportunities in the PCOR Partnership region. Task 3 (Public Outreach) focused on developing an informational video about CO{sub 2} sequestration. Progress in Task 4 (Sources, Sinks, and Infrastructure) included the continued collection of data regarding CO{sub 2} sources and sinks and data on the performance and costs for CO{sub 2} separation, capture, treatment, and compression for pipeline transportation. Task 5 focused on screening and qualitatively assessing sequestration options. Task 5 activities also continue to be useful in structuring data collection and other activities in Tasks 2, 3, and 5.

  12. Reliability and validity of the adapted Greek version of scoliosis research society – 22 (SRS-22 questionnaire

    Directory of Open Access Journals (Sweden)

    Christodoulou Evangelos A

    2009-07-01

    Full Text Available Abstract Background The SRS-22 is a valid instrument for the assessment of the health related quality of life of patients with Idiopathic scoliosis. The SRS-22 questionnaire was developed in USA and has been widely used in the English speaking countries. Recently it has been translated and validated in many other languages. The purpose of this study is to evaluate the reliability and validity of the adapted Greek version of the refined Scoliosis Research Society-22 Questionnaire. Methods Following the steps of cross – cultural adaptation the adapted Greek version of the SRS-22 questionnaire and a validated Greek version of the SF-36 questionnaire were mailed to 68 patients treated surgically for Idiopathic Scoliosis. 51 out of the 68 patients returned the 1st set of questionnaires, while a second set was emailed to 30 randomly selected patients of the first time responders. 20 out of the 30 patients returned the 2nd set. The mean age at the time of operation was16,2 years and the mean age at the time of evaluation was 21,2 years. Descriptive statistics for content analysis were calculated. Reliability assessment was determined by estimating Cronbach's α and intraclass correlation coefficient (ICC respectively. Concurrent validity was evaluated by comparing SRS-22 domains with relevant domains in the SF-36 questionnaire using Pearson's Correlation Coefficient (r. Results The calculated Cronbach's α of internal consistency for three of the corresponding domains (pain 0.85; mental health 0.87; self image 0.83 were very satisfactory and for two domains (function/activity 0.72 and satisfaction 0.67 were good. The ICC of all domains of SRS-22 questionnaire was high (ICC>0.70, demonstrating very satisfactory or excellent test/retest reproducibility. Considering concurrent validity all correlations were found to be statistically significant at the 0.01 level among related domains and generally demonstrated high correlation coefficient. Conclusion

  13. Human bulbar conjunctival hemodynamics in hemoglobin SS and SC disease.

    Science.gov (United States)

    Wanek, Justin; Gaynes, Bruce; Lim, Jennifer I; Molokie, Robert; Shahidi, Mahnaz

    2013-08-01

    The known biophysical variations of hemoglobin (Hb) S and Hb C may result in hemodynamic differences between subjects with SS and SC disease. The purpose of this study was to measure and compare conjunctival hemodynamics between subjects with Hb SS and SC hemoglobinopathies. Image sequences of the conjunctival microcirculation were acquired in 9 healthy control subjects (Hb AA), 24 subjects with SC disease, and 18 subjects with SS disease, using a prototype imaging system. Diameter (D) and blood velocity (V) measurements were obtained in multiple venules of each subject. Data were categorized according to venule caliber by averaging V and D for venules with diameters less than (vessel size 1) or greater than (vessel size 2) 15 µm. V in vessel size 2 was significantly greater than V in vessel size 1 in the AA and SS groups (P ≥ 0.009), but not in the SC group (P = 0.1). V was significantly lower in the SC group as compared to the SS group (P = 0.03). In AA and SS groups, V correlated with D (P ≤ 0.005), but the correlation was not statistically significant in the SC group (P = 0.08). V was inversely correlated with hematocrit in the SS group for large vessels (P = 0.03); however, no significant correlation was found in the SC group (P ≥ 0.2). Quantitative assessment of conjunctival microvascular hemodynamics in SS and SC disease may advance understanding of sickle cell disease pathophysiology and thereby improve therapeutic interventions.

  14. 76 FR 58401 - Safety Zone; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2011-09-21

    ... Zone; Swim Around Charleston, Charleston, SC in the Federal Register (76 FR 38586). We received no... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Swim Around Charleston, Charleston, SC... temporary moving safety zone during the Swim Around Charleston, a swimming race occurring on waters of...

  15. Teleconnection between rainfall over South China and the East European Plain in July and August

    Science.gov (United States)

    Su, Qin; Lu, Riyu

    2014-10-01

    In the present reported work, we identified that there is a significant negative relationship between rainfall over South China (SC) and the East European Plain (EEP) in the months of July and August, and investigated the possible reason for this negative relationship. The correlation coefficients between SC and the EEP rainfall were calculated to be -0.42 for July and -0.35 for August, both significant at the 95 % confidence level. We report that a wave-like train of circulation anomalies and a pathway of wave-activity flux stretching from Europe to East China connect the anticyclonic anomaly over Europe and the cyclonic anomaly over central and southern China, which are responsible for less EEP rainfall and more SC rainfall. We suggest that the teleconnection between SC and EEP rainfall results from the extension of stationary Rossby waves in the mid-latitudes in the upper troposphere for both July and August. This stationary Rossby wave is contributed to by summer North Atlantic Oscillation (NAO) and its extension features are determined by the location and intensity of the climatological upper-tropospheric westerly jet. Furthermore, we found that there was an interdecadal change around the mid-1970s in the negative SC-EEP rainfall relationship for both July and August. The negative correlation was significant and strong in the period 1976-2005, but much weaker in the period 1955-1975. The extension of stationary Rossby waves from Europe to East China was responsible for the significant negative relationship during the period 1976-2005.

  16. RANGE AND DISTRIBUTION OF TECHNETIUM KD VALUES IN THE SRS SUBSURFACE ENVIRONMENT

    Energy Technology Data Exchange (ETDEWEB)

    Kaplan, D

    2008-10-28

    Performance assessments (PAs) are risk calculations used to estimate the amount of low-level radioactive waste that can be disposed at DOE sites. Distribution coefficients (K{sub d} values) are input parameters used in PA calculations to provide a measure of radionuclide sorption to sediment; the greater the K{sub d} value, the greater the sorption and the slower the estimated movement of the radionuclide through sediment. Understanding and quantifying K{sub d} value variability is important for estimating the uncertainty of PA calculations. Without this information, it is necessary to make overly conservative estimates about the possible limits of K{sub d} values, which in turn may increase disposal costs. Finally, technetium is commonly found to be amongst the radionuclides posing potential risk at waste disposal locations because it is believed to be highly mobile in its anionic form (pertechnetate, TcO{sub 4}{sup -}), it exists in relatively high concentrations in SRS waste, and it has a long half-life (213,000 years). The objectives of this laboratory study were to determine under SRS environmental conditions: (1) whether and to what extent TcO{sub 4}{sup -} sorbs to sediments, (2) the range of Tc K{sub d} values, (3) the distribution (normal or log-normal) of Tc K{sub d} values, and (4) how strongly Tc sorbs to SRS sediments through desorption experiments. Objective 3, to identify the Tc K{sub d} distribution is important because it provides a statistical description that influences stochastic modeling of estimated risk. The approach taken was to collect 26 sediments from a non-radioactive containing sediment core collected from E-Area, measure Tc K{sub d} values and then perform statistical analysis to describe the measured Tc K{sub d} values. The mean K{sub d} value was 3.4 {+-} 0.5 mL/g and ranged from -2.9 to 11.2 mL/g. The data did not have a Normal distribution (as defined by the Shapiro-Wilk's Statistic) and had a 95-percentile range of 2.4 to 4

  17. Solid Waste Information Tracking System (SWITS), Backlog Waste Modifications, Software Requirements Specification (SRS)

    Energy Technology Data Exchange (ETDEWEB)

    Clark, R.E. [USDOE Richland Operations Office, WA (United States)

    1995-05-05

    Purpose of this document is to define the system requirements necessary to improve computer support for the WHC backlog waste business process through enhancements to the backlog waste function of the SWITS system. This SRS document covers enhancements to the SWITS system to support changes to the existing Backlog Waste screens including new data elements, label changes, and new pop-up screens. The pop-ups will allow the user to flag the processes that a waste container must have performed on it, and will provide history tracking of changes to data. A new screen will also be provided allowing Acceptable Services to perform mass updates to specific data in Backlog Waste table. The SWITS Backlog Waste enhancements in this document will support the project goals in WHC-SD-WM-003 and its Revision 1 (Radioactive Solid Waste Tracking System Conceptual Definition) for the control, tracing, and inventory management of waste as the packages are generated and moved through final disposal (cradle-to-grave).

  18. Investigation of the thermal mixing in a T-junction flow with different SRS approaches

    Energy Technology Data Exchange (ETDEWEB)

    Gritskevich, M.S., E-mail: gritskevich@ymail.com [St. Petersburg State Polytechnical University, 195251 St. Petersburg (Russian Federation); Garbaruk, A.V. [St. Petersburg State Polytechnical University, 195251 St. Petersburg (Russian Federation); Frank, Th.; Menter, F.R. [Software Development Department, ANSYS, 83714 Otterfing (Germany)

    2014-11-15

    Highlights: • Global (SAS, DDES) and zonal (ELES-WMLES) models are compared for the T-junction flow. • All the models accurately predict mean, RMS, and spectral quantities. • ELES-WMLES approach yields very good results independent of the advection scheme. • SAS and the DDES models are slightly less accurate. • SAS depends on the advection scheme. - Abstract: An investigation of different turbulence Scale-Resolving Simulation (SRS) modeling approaches for the flow in a T-junction has been conducted using the Scale-Adaptive Simulation (SAS), the Delayed Detached Eddy Simulation (DDES) and the Embedded Large Eddy Simulation (ELES) methods. The results show that all models are able to accurately predict mean and RMS velocity profiles and velocity spectra, when are used in combination with a low dissipation advection scheme. However, when a slightly more dissipative scheme is used, the SAS model yields less accurate results, indicating that this flow does not produce a strong enough flow instability to allow the safe application of this model. The DDES and the ELES models show less sensitivity to the numerical setting compared to the SAS model. The main goal of the study is the accurate prediction of heat transfer on the walls in the mixing zone. In that respect, the ELES method produces the most consistent agreement with the experimental data.

  19. Thermal stability of Al-Mg-Sc-Zr alloy

    Institute of Scientific and Technical Information of China (English)

    ZHAO Wei-tao; YAN De-sheng; RONG Li-jian

    2006-01-01

    The thermal stability of Al3(Sc,Zr) precipitates in the cold worked Al-Mg-Sc-Zr alloy after elevated temperature exposure was investigated. The evaluation was conducted using room temperature tensile, Vicker's hardness, optical metallography and scanning electron microscope (SEM) with the backscatter. The results show that the Al3(Sc,Zr) precipitates and mechanical properties have no obvious change, and the grains keep elongated along the working direction as that in cold worked sample after exposure at 300 ℃ for 1 000 h. The coarsening of Al3(Sc,Zr) precipitates occurs and is no longer effective on the recrystallization resistance, and partial recrystallization is observed after 400 ℃ exposure. In particular, after 500 ℃ exposure, the hardness decreases drastically and the alloy has fully recrystallized due to the obvious coarsening of Al3(Sc,Zr) precipitates.

  20. Cyclotron production of (44)Sc: From bench to bedside.

    Science.gov (United States)

    van der Meulen, Nicholas P; Bunka, Maruta; Domnanich, Katharina A; Müller, Cristina; Haller, Stephanie; Vermeulen, Christiaan; Türler, Andreas; Schibli, Roger

    2015-09-01

    (44)Sc, a PET radionuclide, has promising decay characteristics (T1/2 = 3.97 h, Eβ(+)av = 632 keV) for nuclear imaging and is an attractive alternative to the short-lived (68)Ga (T1/2 = 68 min, Eβ(+)av = 830 keV). The aim of this study was the optimization of the (44)Sc production process at an accelerator, allowing its use for preclinical and clinical PET imaging. (44)CaCO3 targets were prepared and irradiated with protons (~11 MeV) at a beam current of 50 μA for 90 min. (44)Sc was separated from its target material using DGA extraction resin and concentrated using SCX cation exchange resin. Radiolabeling experiments at activities up to 500 MBq and stability tests were performed with DOTANOC by investigating different scavengers, including gentisic acid. Dynamic PET of an AR42J tumor-bearing mouse was performed after injection of (44)Sc-DOTANOC. The optimized chemical separation method yielded up to 2 GBq (44)Sc of high radionuclidic purity. In the presence of gentisic acid, radiolabeling of (44)Sc with DOTANOC was achieved with a radiochemical yield of ~99% at high specific activity (10 MBq/nmol) and quantities which would allow clinical application. The dynamic PET images visualized increasing uptake of (44)Sc-DOTANOC into AR42J tumors and excretion of radioactivity through the kidneys of the investigated mouse. The concept "from-bench-to-bedside" was clearly demonstrated in this extended study using cyclotron-produced (44)Sc. Sufficiently high activities of (44)Sc of excellent radionuclidic purity are obtainable for clinical application, by irradiation of enriched calcium at a cyclotron. This work demonstrates a promising basis for introducing (44)Sc to clinical routine of nuclear imaging using PET. Copyright © 2015 Elsevier Inc. All rights reserved.

  1. Construction of an Eukaryotic Expression Plasmid for NcSRS2 Gene of Neospora caninum%犬新孢子虫NcSRS2基因真核表达质粒的构建

    Institute of Scientific and Technical Information of China (English)

    赵占中; 刘群; 汪明

    2005-01-01

    根据犬新孢子虫NcSRS2基因序列,设计了1对含有Kozak序列、PstⅠ和XbaⅠ酶切位点的引物,以含有NcSRS2基因的质粒P43为模板,经PCR扩增获得NcSRS2 ORF基因片段,用PstⅠ和XbaⅠ双酶切该片段,回收得到含有以上2个酶切位点黏端的NcSR2 ORF基因,将此基因片段克隆至相同酶切回收后的pcDNA3.1(+)真核表达载体中,获得重组质粒pcNCSRS2.经PCR鉴定、限制性内切酶分析和克隆片段序列测定、比较,证实了重组质粒的正确性.

  2. Hydride vapor phase epitaxy growth of GaN, InGaN, ScN, and ScAIN

    NARCIS (Netherlands)

    Bohnen, T.

    2010-01-01

    Chemical vapor deposition (CVD); hydride vapor phase epitaxy (HVPE); gallium nitride (GaN); indium gallium nitride (InGaN); scandium nitride (ScN); scandium aluminum nitride (ScAlN); semiconductors; thin films; nanowires; III nitrides; crystal growth - We studied the HVPE growth of different III ni

  3. Effective single chain antibody (scFv) concentrations in vivo via adenoviral vector mediated expression of secretory scFv

    NARCIS (Netherlands)

    Arafat, WO; Gomez-Navarro, J; Buchsbaum, DJ; Xiang, J; Casado, E; Barker, SD; Mahasreshti, PJ; Haisma, HJ; Barnes, MN; Siegal, GP; Alvarez, RD; Hemminki, A; Nettelbeck, DM; Curiel, DT

    2002-01-01

    Single chain antibodies (scFv) represent powerful interventional agents for the achievement of targeted therapeutics. The practical utility of these agents have been limited, however, by difficulties related to production of recombinant scFv and the achievement of effective and sustained levels of s

  4. Whillans Ice Plain Stick Slip

    Science.gov (United States)

    Lipovsky, B.; Dunham, E. M.

    2015-12-01

    Concern about future sea level rise motivates the study of fast flowing ice. The Whillans Ice Plain (WIP) region of the West Antarctic Ice Sheet is notable for decelerating from previously fast motion during the instrumental record. Since most ice flux in Antarctica occurs through ice streams, understanding the conditions that cause ice stream stagnation is of basic importance in understanding the continent's contribution to future sea level rise. Although recent progress has been made in understanding the relationship between basal conditions and ice stream motion, direct observation of the temporal variation in subglacial conditions during ice stream stagnation has remained elusive. The Whillans Ice Plain flows to the sea mostly by way of stick-slip motion. We present numerical simulations of this stick-slip motion that capture the inertial dynamics, seismic waves, and the evolution of sliding with rate- and state-dependent basal friction. Large scale stick-slip behavior is tidally modulated and encompasses the entire WIP. Sliding initiates within one of several locked regions and then propagates outward with low average rupture velocity (~ 200 m/s). Sliding accelerates over a period of 200 s attain values as large as 65 m/d. From Newton's second law, this acceleration is ~ T / (rho H) for average shear stress drop T, ice thickness H, and ice density rho. This implies a 3 Pa stress drop that must be reconciled with the final stress drop of 300 Pa inferred from the total slip and fault dimensions. A possible explanation of this apparent discrepancy is that deceleration of the ice is associated with a substantial decrease in traction within rate-strengthening regions of the bed. During these large-scale sliding events, m-scale patches at the bed produce rapid (20 Hz) stick-slip motion. Each small event occurs over ~ 1/100 s, produces ~ 40 microns of slip, and gives rise to a spectacular form of seismic tremor. Variation between successive tremor episodes allows us

  5. The high-temperature modification of ScRuSi - Structure, 29Si and 45Sc solid state NMR spectroscopy

    Science.gov (United States)

    Hoffmann, Rolf-Dieter; Rodewald, Ute Ch.; Haverkamp, Sandra; Benndorf, Christopher; Eckert, Hellmut; Heying, Birgit; Pöttgen, Rainer

    2017-10-01

    A polycrystalline sample of the TiNiSi type low-temperature (LT) modification of ScRuSi was synthesized by arc-melting. Longer annealing in a sealed silica tube (6 weeks at 1270 K) followed by quenching led to the high-temperature (HT) phase. HT-ScRuSi adopts the ZrNiAl structure type: P 6 bar 2 m , a = 688.27(9), c = 336.72(5) pm, wR2 = 0.0861, 260 F2 values, 14 variables. The striking structural building units are regular, tricapped trigonal prisms Si1@Ru3Sc6 and Si2@Ru6Sc3. Both polymorphs have been characterized by 29Si and 45Sc MAS-NMR spectroscopy. The local scandium environments in the two polymorphs are easily distinguished by their electric field gradient tensor values, in agreement with theoretically calculated values.

  6. Reliability and concurrent validity of the adapted Chinese version of Scoliosis Research Society-22 (SRS-22) questionnaire.

    Science.gov (United States)

    Cheung, Kenneth M C; Senkoylu, Alpaslan; Alanay, Ahmet; Genc, Yasemin; Lau, Sarah; Luk, Keith D

    2007-05-01

    Validation study to define validity and reliability of an adapted and translated questionnaire. Assessment of the concurrent validity and reliability of a Chinese version of SRS-22 outcome instrument. No valid health-related quality of life (HRQL) outcome instrument exists for patients with spinal deformity in Chinese. The modified SRS-22 questionnaire was proven to be an appropriate outcome instrument in English, and has already been translated and validated in several other languages. The English version of the SRS-22 questionnaire was adapted to Chinese according to the International Quality of Life Assessment Project guidelines. To assess reliability, 48 subjects with adolescent idiopathic scoliosis (mean age, 16.5 years) filled the questionnaire on 2 separate occasions (Group 1). To assess concurrent validity, 50 subjects (mean age, 21 years) filled in the same questionnaire and a previously validated Chinese version of the Short Form-36 (SF36) questionnaire (Group 2). Internal consistency, reproducibility and concurrent validity were determined with Cronbach's alpha coefficient, interclass correlation coefficient and Pearson correlation coefficient, respectively. Cronbach's alpha coefficient for the 4 major domains (function/activity, pain, self-image/appearance and mental health) were high. Intraclass correlation was also excellent for all domains. For concurrent validity, excellent correlation was found in 1 domain, good in 12 domains, moderate in 3 domains, and poor in 1 domain of the 17 relevant domains. Both cultural adaptation and linguistic translation are essential in any attempt to use a HRQL questionnaire across cultures. The Chinese version of the SRS-22 outcome instrument has satisfactory internal consistency and excellent reproducibility. It is ready for use in clinical studies on idiopathic scoliosis in Chinese-speaking societies.

  7. Cyclotron production of {sup 43}Sc for PET imaging

    Energy Technology Data Exchange (ETDEWEB)

    Walczak, Rafał [Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warsaw (Poland); Krajewski, Seweryn [Synektik S.A., Research and Development Center, Warsaw (Poland); Szkliniarz, Katarzyna [Department of Nuclear Physics, University of Silesia, Katowice (Poland); Sitarz, Mateusz [Heavy Ion Laboratory, University of Warsaw, Warsaw (Poland); Abbas, Kamel [Nuclear Security Unit, Joint Research Centre, Institute for Transuranium Elements, European Commission, Ispra (Italy); Choiński, Jarosław; Jakubowski, Andrzej; Jastrzębski, Jerzy [Heavy Ion Laboratory, University of Warsaw, Warsaw (Poland); Majkowska, Agnieszka [Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warsaw (Poland); Simonelli, Federica [Nuclear Decommissioning Unit, Joint Research Centre, Ispra Site Management Directorate, European Commission, Ispra (Italy); Stolarz, Anna; Trzcińska, Agnieszka [Heavy Ion Laboratory, University of Warsaw, Warsaw (Poland); Zipper, Wiktor [Department of Nuclear Physics, University of Silesia, Katowice (Poland); Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warsaw (Poland)

    2015-12-04

    Recently, significant interest in {sup 44}Sc as a tracer for positron emission tomography (PET) imaging has been observed. Unfortunately, the co-emission by {sup 44}Sc of high-energy γ rays (E{sub γ} = 1157, 1499 keV) causes a dangerous increase of the radiation dose to the patients and clinical staff. However, it is possible to produce another radionuclide of scandium—{sup 43}Sc—having properties similar to {sup 44}Sc but is characterized by much lower energy of the concurrent gamma emissions. This work presents the production route of {sup 43}Sc by α irradiation of natural calcium, its separation and purification processes, and the labeling of [DOTA,Tyr3] octreotate (DOTATATE) bioconjugate. Natural CaCO{sub 3} and enriched [{sup 40}Ca]CaCO{sub 3} were irradiated with alpha particles for 1 h in an energy range of 14.8–30 MeV at a beam current of 0.5 or 0.25 μA. In order to find the optimum method for the separation of {sup 43}Sc from irradiated calcium targets, three processes previously developed for {sup 44}Sc were tested. Radiolabeling experiments were performed with DOTATATE radiobioconjugate, and the stability of the obtained {sup 43}Sc-DOTATATE was tested in human serum. Studies of {sup nat}CaCO{sub 3} target irradiation by alpha particles show that the optimum alpha particle energies are in the range of 24–27 MeV, giving 102 MBq/μA/h of {sup 43}Sc radioactivity which creates the opportunity to produce several GBq of {sup 43}Sc. The separation experiments performed indicate that, as with {sup 44}Sc, due to the simplicity of the operations and because of the chemical purity of the {sup 43}Sc obtained, the best separation process is when UTEVA resin is used. The DOTATATE conjugate was labeled by the obtained {sup 43}Sc with a yield >98 % at elevated temperature. Tens of GBq activities of {sup 43}Sc of high radionuclidic purity can be obtainable for clinical applications by irradiation of natural calcium with an alpha beam.

  8. Effects of cooling rate on solidification behavior of dilute Al-Sc and Al-Sc-Zr solid solution

    Institute of Scientific and Technical Information of China (English)

    金头男; 聂祚仁; 徐国富; 阮海琼; 杨军军; 付静波; 左铁镛

    2004-01-01

    Six alloys with different compositions of Al-0.1%Sc, Al-0.3%Sc, Al-0.3%Zr, Al-0.1% Sc-0. 1%Zr,Al-0.3%Sc-0.1%Zr and Al-0.3%Sc-0.3%Zr were prepared by casting in a wedge shaped copper mould. The hardness test, microstructure observation, and DSC thermal analysis were applied to fully investigate the solidification behavior of the wedge tip (whose cooling rate is 1 000 K/s) and the top surface (cooling rate 100 K/s) of each casting. The results show that the cast structures in the hypoeutectic region of Al-Sc alloys are slightly affected by cooling rates during the solidification. In the case of hypereutectic alloy of Al-0.3%Sc-0.3%Zr , the cast grains were remarkably refined under the condition of a 100 K/s cooling rate, however, under a 1 000 K/s cooling rate condition,solute atoms contribute nothing to the grain-refinement, due to the eutectic concentration becomes higher. The hardness can be improved to a greater degree by Sc single addition, compared to single Zr addition, but it can be improved even greater when Sc added together with Zr. It is sensitive to cooling rate, the higher the cooling rate, the greater the hardness. By combining the results of TEM examination and DSC analysis, it can be seen that a supersaturated Al solid solution forms during the solidification, and the solubility of Sc in Al solution can be improved by increasing the cooling rate.

  9. Tracking Neospora caninum parasites using chimera monoclonal antibodies against its surface antigen-related sequences (rNcSRS2).

    Science.gov (United States)

    Dong, Jinhua; Otsuki, Takahiro; Kato, Tatsuya; Park, Enoch Y

    2014-03-01

    Neosporosis, an infectious disease of cattle and dogs, causes an abortion in cattle, which has a major damage on the dairy industry worldwide. Tracking of Neospora caninum parasite that is responsible for neosporosis is required for the prevention of this infectious disease. We developed three chimera monoclonal antibodies consist of variable regions of murine antibody and constant regions of human antibody against N. caninum. Recombinant surface antigen-related sequence 2 (rNcSRS2) of N. caninum was expressed in silkworm larvae, and immunized in mice to obtain phage displaying antibody library. Through three rounds of selection, three antibodies, A6, E1 and H3, were isolated and bound to rNcSRS2 with nanomolar to micromolar affinity. In immunofluorescent staining assays, A6 and E1 bound to N. caninum strain Nc-Liv, demonstrating a successful tracking of the parasite. H3 clone bound to rNcSRS2 but not to a truncated protein without glycosylphosphatidylinositol (GPI) anchor domain in the carboxyl terminal. Amino acid sequences of A6 and E1 were similar, but that of H3 differed in the CDR-H1 region, which might be the reason of their difference of affinity. These antibodies are thought to be useful for prevention of cattle from neosporosis.

  10. Label-free chemical imaging of live Euglena gracilis by high-speed SRS spectral microscopy (Conference Presentation)

    Science.gov (United States)

    Wakisaka, Yoshifumi; Suzuki, Yuta; Tokunaga, Kyoya; Hirose, Misa; Domon, Ryota; Akaho, Rina; Kuroshima, Mai; Tsumura, Norimichi; Shimobaba, Tomoyoshi; Iwata, Osamu; Suzuki, Kengo; Nakashima, Ayaka; Goda, Keisuke; Ozeki, Yasuyuki

    2016-03-01

    Microbes, especially microalgae, have recently been of great interest for developing novel biofuels, drugs, and biomaterials. Imaging-based screening of live cells can provide high selectivity and is attractive for efficient bio-production from microalgae. Although conventional cellular screening techniques use cell labeling, labeling of microbes is still under development and can interfere with their cellular functions. Furthermore, since live microbes move and change their shapes rapidly, a high-speed imaging technique is required to suppress motion artifacts. Stimulated Raman scattering (SRS) microscopy allows for label-free and high-speed spectral imaging, which helps us visualize chemical components inside biological cells and tissues. Here we demonstrate high-speed SRS imaging, with temporal resolution of 0.14 seconds, of intracellular distributions of lipid, polysaccharide, and chlorophyll concentrations in rapidly moving Euglena gracilis, a unicellular phytoflagellate. Furthermore, we show that our method allows us to analyze the amount of chemical components inside each living cell. Our results indicate that SRS imaging may be applied to label-free screening of living microbes based on chemical information.

  11. Specific features of SRS-CARS monitoring of low impurity concentrations of hydrogen in dense gas mixtures

    Science.gov (United States)

    Mikheev, Gennady M.; Mogileva, Tatyana N.; Popov, Aleksey Yu.

    2006-09-01

    The possibility of measuring the hydrogen impurity concentration in dense gas mixtures by coherent anti-Stokes Raman scattering (CARS) is studied. In this technique, biharmonic laser pumping based on stimulated Raman scattering (SRS) in compressed hydrogen is used. Because of the interference between the coherent scattering components from buffer gas molecules and molecules of the impurity to be detected, the signal recorded may depend on the hydrogen concentration by a parabolic law, which has a minimum and makes the results uncertain. It is shown that this uncertainty can be removed if the frequency of the biharmonic laser pump, which is produced by the SRS oscillator, somewhat differs from the frequency of molecular oscillations of hydrogen in the test mixture. A sensitivity of 5 ppm is obtained as applied to the hydrogen-air mixture under normal pressure. The description of a set-up for the determination of the coefficient of the hydrogen diffusion in gas mixtures is given. The main assembly units are a diffusion chamber and an automated laser system for the selective hydrogen diagnostics in gas mixtures by the SRS-CARS method. The determination of the diffusion coefficient is based on the approximation of the experimental data describing the hydrogen concentration varying with time at a specified point in the diffusion chamber and the accurate solution of the diffusion equation for the selected one-dimensional geometry of the experiment.

  12. 44 CFR 10.14 - Flood plains and wetlands.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Flood plains and wetlands. 10... Flood plains and wetlands. For any action taken by FEMA in a flood plain or wetland, the provisions of... Executive Order 11988, Flood Plain Management, and Executive Order 11990, Protection of Wetlands (44...

  13. Southern Great Plains Atmospheric Radiation Measurement Site

    Data.gov (United States)

    Federal Laboratory Consortium — The Southern Great Plains Atmospheric Radiation Measurement Site (SGP-ARM) is the oldest and largest of DOE's Arm sites. It was established in 1992. It consists of...

  14. PLAINS CO2 REDUCTION PARTNERSHIP

    Energy Technology Data Exchange (ETDEWEB)

    Edward N. Steadman; John A. Harju; Erin M. O' Leary; James A. Sorensen; Daniel J. Daly; Melanie D. Jensen; Lisa S. Botnen

    2005-07-01

    The Plains CO{sub 2} Reduction (PCOR) Partnership characterization work is nearing completion, and most remaining efforts are related to finalizing work products. Task 2 (Technology Deployment) has developed a Topical Report entitled ''Deployment Issues Related to Geologic CO{sub 2} Sequestration in the PCOR Partnership Region''. Task 3 (Public Outreach) has developed an informational Public Television program entitled ''Nature in the Balance'', about CO{sub 2} sequestration. The program was completed and aired on Prairie Public Television in this quarter. Task 4 (Sources, Sinks, and Infrastructure) efforts are nearing completion, and data regarding CO{sub 2} sources and sinks and data on the performance and costs for CO{sub 2} separation, capture, treatment, and compression for pipeline transportation are being incorporated into a series of topical reports. The expansion of the Decision Support System Geographic Information System database has continued with the development of a ''save bookmark'' feature that allows users to save a map from the system easily. A feature that allows users to develop a report that summarizes CO{sub 2} sequestration parameters was also developed. Task 5 (Modeling and Phase II Action Plans) focused on screening and qualitatively assessing sequestration options and developing economic estimates for important regional CO{sub 2} sequestration strategies.

  15. PLAINS CO2 REDUCTION PARTNERSHIP

    Energy Technology Data Exchange (ETDEWEB)

    Edward N. Steadman; John A. Harju; Erin M. O' Leary; James A. Sorensen; Daniel J. Daly; Melanie D. Jensen; Thea E. Reikoff

    2005-04-01

    The Plains CO{sub 2} Reduction (PCOR) Partnership continues to make great progress. Task 2 (Technology Deployment) focused on developing information regarding deployment issues to support Task 5 (Modeling and Phase II Action Plans) and provided information to be used to assess CO{sub 2} sequestration opportunities in the PCOR Partnership region. Task 2 efforts also included preparation of a draft topical report entitled ''Deployment Issues Related to Geologic CO{sub 2} Sequestration in the PCOR Partnership Region'', which is nearing completion. Task 3 (Public Outreach) focused on developing an informational video about CO{sub 2} sequestration. The video will be completed and aired on Prairie Public Television in the next quarter. Progress in Task 4 (Sources, Sinks, and Infrastructure) included the continued collection of data regarding CO{sub 2} sources and sinks and data on the performance and costs for CO{sub 2} separation, capture, treatment, and compression for pipeline transportation. The addition of the Canadian province of Alberta to the PCOR Partnership region expanded the decision support system (DSS) geographic information system database. Task 5 screened and qualitatively assessed sequestration options. Task 5 activities also continue to be useful in structuring data collection and other activities in Tasks 2, 3, and 5.

  16. The Effects of Ingestion of Sugarcane Juice and Commercial Sports Drinks on Cycling Performance of Athletes in Comparison to Plain Water

    OpenAIRE

    Kalpana, Kommi; Lal, Priti Rishi; Kusuma, Doddipalli Lakshmi; Khanna, Gulshan Lal

    2013-01-01

    Purpose Sugarcane juice (ScJ) is a natural drink popular in most tropical Asian regions. However, research on its effect in enhancing sports performance is limited. The present investigation was to study the effect of sugarcane juice on exercise metabolism and sport performance of athletes in comparison to a commercially available sports drinks. Methods Fifteen male athletes (18-25 yrs) were asked to cycle until volitional exhaustion at 70% VO2 max on three different trials viz. plain water (...

  17. The influence of shear-velocity heterogeneity on ScS2/ScS amplitude ratios and estimates of Q in the mantle

    Science.gov (United States)

    Chaves, Carlos A. M.; Ritsema, Jeroen

    2016-08-01

    Regional waveforms of deep-focus Tonga-Fiji earthquakes indicate anomalous traveltime differences (ScS2-ScS) and amplitude ratios (ScS2/ScS) of the phases ScS and ScS2. The correlation between the ScS2-ScS delay time and the ScS2/ScS amplitude ratio suggests that shear wave apparent Q in the mantle below the Tonga-Fiji region is highest when shear wave velocities are lowest. This observation is unexpected if temperature variations were responsible for the seismic anomalies. Using spectral element method waveform simulations for four tomographic models, we demonstrate that focusing and scattering of shear waves by long-wavelength 3-D heterogeneity in the mantle may overwhelm the signal from intrinsic attenuation in long-period ScS2/ScS amplitude ratios. The tomographic models reproduce the trends in recorded ScS2-ScS difference times and ScS2/ScS amplitude ratios. Although they cannot be ruled out, variations in shear wave attenuation (i.e., the quality factor Q) are not necessary to explain the data.

  18. Wildflowers of the Savannah River Site

    Energy Technology Data Exchange (ETDEWEB)

    Seger, Tona [Savannah River Site (SRS), Aiken, SC (United States). USDA Forest Service

    2015-08-01

    This guidebook is a resource to help field personnel (nonbotanists) identify plants on the Savannah River Site (SRS) premises. Although not a complete flora guide, this publication contains information about 123 plant species found on the SRS. Plants are listed by their common names and arranged by the color of the flower. The SRS supports a diverse array of plant communities. Land use history, the establishment of the SRS, and current land management practices have shaped the flora presently found on the SRS. Located south of Aiken, SC, SRS spans 198,344 acres with land covering Aiken, Allendale, and Barnwell Counties. Situated on the Upper Coastal Plain and Sandhills physiographic provinces, the SRS has more than 50 distinct soil types. The topography is rolling to flat with elevation ranges from 50 to 400 feet above sea level.

  19. Clinical commissioning and use of the Novalis Tx linear accelerator for SRS and SBRT.

    Science.gov (United States)

    Kim, Jinkoo; Wen, Ning; Jin, Jian-Yue; Walls, Nicole; Kim, Sangroh; Li, Haisen; Ren, Lei; Huang, Yimei; Doemer, Anthony; Faber, Kathleen; Kunkel, Tina; Balawi, Ahssan; Garbarino, Kimberly; Levin, Kenneth; Patel, Samir; Ajlouni, Munther; Miller, Brett; Nurushev, Teamor; Huntzinger, Calvin; Schulz, Raymond; Chetty, Indrin J; Movsas, Benjamin; Ryu, Samuel

    2012-05-10

    ) MLC commissioning: Winston Lutz test, light/radiation field congruence, and Picket Fence tests were performed and were within criteria established by the relevant task group reports. The measured mean MLC transmission and dynamic leaf gap of 6 MV SRS beam were 1.17% and 0.36 mm, respectively. (3) Baseline characteristics of OBI and ETX: The isocenter localization errors in the left/right, posterior/anterior, and superior/inferior directions were, respectively, -0.2 ± 0.2 mm, -0.8 ± 0.2 mm, and -0.8 ± 0.4 mm for ETX, and 0.5 ± 0.7 mm, 0.6 ± 0.5 mm, and 0.0 ± 0.5 mm for OBI cone-beam computed tomography. The registration angular discrepancy was 0.1 ± 0.2°, and the maximum robotic couch error was 0.2°. (4) End-to-end tests: The measured isocenter dose differences from the planned values were 0.8% and 0.4%, measured respectively by an ion chamber and film. The gamma pass rate, measured by EBT2 film, was 95% (3% DD and 1 mm DTA). Through a systematic series of quantitative commissioning experiments and end-to-end tests and our initial clinical experience, described in this report, we demonstrate that the NTX is a robust system, with the image guidance and MLC requirements to treat a wide variety of sites - in particular for highly accurate delivery of SRS and SBRT-based treatments.

  20. EVALUATION OF THE DURABILITY OF THE STRUCTURAL CONCRETE OF REACTOR BUILDINGS AT SRS

    Energy Technology Data Exchange (ETDEWEB)

    Duncan, A.; Reigel, M.

    2011-02-28

    The Department of Energy (DOE) intends to close 100-150 facilities in the DOE complex using an in situ decommissioning (ISD) strategy that calls for grouting the below-grade interior volume of the structure and leaving the above-grade interior open or demolishing it and disposing of it in the slit trenches in E Area. These closures are expected to persist and remain stable for centuries, but there are neither facility-specific monitoring approaches nor studies on the rate of deterioration of the materials used in the original construction or on the ISD components added during closure (caps, sloped roofs, etc). This report will focus on the evaluation of the actual aging/degradation of the materials of construction used in the ISD structures at Savannah River Site (SRS) above grade, specifically P & R reactor buildings. Concrete blocks (six 2 to 5 ton blocks) removed from the outer wall of the P Reactor Building were turned over to SRNL as the first source for concrete cores. Larger cores were received as a result of grouting activities in P and R reactor facilities. The cores were sectioned and evaluated using microscopy, x-ray diffraction (XRD), ion chromatography (IC) and thermal analysis. Scanning electron microscopy shows that the aggregate and cement phases present in the concrete are consistent with the mix design and no degradation mechanisms are evident at the aggregate-cement interfaces. Samples of the cores were digested and analyzed for chloride ingress as well as sulfate attack. The concentrations of chloride and sulfate ions did not exceed the limits of the mix design and there is no indication of any degradation due to these mechanisms. Thermal analysis on samples taken along the longitudinal axis of the cores show that there is a 1 inch carbonation layer (i.e., no portlandite) present in the interior wall of the reactor building and a negligible carbonation layer in the exterior wall. A mixed layer of carbonate and portlandite extends deeper into the

  1. TU-F-201-02: Applications in SRS, SBRT, IMRT, VMAT, and KV Imaging

    Energy Technology Data Exchange (ETDEWEB)

    Chiu-Tsao, S. [Quality MediPhys LLC (United States)

    2015-06-15

    Since the introduction of radiochromic films (RCF) for radiation dosimetry, the scope of RCF dosimetry has expanded steadily to include many medical applications, such as radiation therapy and diagnostic radiology. The AAPM Task Group (TG) 55 published a report on the recommendations for RCF dosimetry in 1998. As the technology is advancing rapidly, and its routine clinical use is expanding, TG 235 has been formed to provide an update to TG-55 on radiochromic film dosimetry. RCF dosimetry applications in clinical radiotherapy have become even more widespread, expanding from primarily brachytherapy and radiosurgery applications, and gravitating towards (but not limited to) external beam therapy (photon, electron and protons), such as quality assurance for IMRT, VMAT, Tomotherapy, SRS/SRT, and SBRT. In addition, RCF applications now extend to measurements of radiation dose in particle beams and patients undergoing medical exams, especially fluoroscopically guided interventional procedures and CT. The densitometers/scanners used for RCF dosimetry have also evolved from the He-Ne laser scanner to CCD-based scanners, including roller-based scanner, light box-based digital camera, and flatbed color scanner. More recently, multichannel RCF dosimetry introduced a new paradigm for external beam dose QA for its high accuracy and efficiency. This course covers in detail the recent advancements in RCF dosimetry. Learning Objectives: Introduce the paradigm shift on multichannel film dosimetry Outline the procedures to achieve accurate dosimetry with a RCF dosimetry system Provide comprehensive guidelines on RCF dosimetry for various clinical applications One of the speakers has a research agreement from Ashland Inc., the manufacturer of Gafchromic film.

  2. ENHANCED CHEMICAL CLEANING OF SRS WASTE TANKS TO IMPROVE ACTINIDE SOLUBILITY

    Energy Technology Data Exchange (ETDEWEB)

    Rudisill, T.; Thompson, M.

    2011-09-20

    Processes for the removal of residual sludge from SRS waste tanks have historically used solutions containing up to 0.9 M oxalic acid to dissolve the remaining material following sludge removal. The selection of this process was based on a comparison of a number of studies performed to evaluate the dissolution of residual sludge. In contrast, the dissolution of the actinide mass, which represents a very small fraction of the waste, has not been extensively studied. The Pu, Np, and Am in the sludge is reported to be present as hydrated and crystalline oxides. To identify aqueous solutions which have the potential to increase the solubility of the actinides, the alkaline and mildly acidic test solutions shown below were selected as candidates for use in a series of solubility experiments. The efficiency of the solutions in solubilizing the actinides was evaluated using a simulated sludge prepared by neutralizing a HNO{sub 3} solution containing Pu, Np, and Am. The hydroxide concentration was adjusted to a 1.2 M excess and the solids were allowed to age for several weeks prior to starting the experiments. The sludge was washed with 0.01 M NaOH to prepare the solids for use. Following the addition of an equal portion of the solids to each test solution, the concentrations of Pu, Np, and Am were measured as a function of time over a 792 h (33 day) period to provide a direct comparison of the efficiency of each solution in solubilizing the actinide elements. Although the composition of the sludge was limited to the hydrated actinide oxides (and did not contain other components of demonstrated importance), the results of the study provides guidance for the selection of solutions which should be evaluated in subsequent tests with a more realistic surrogate sludge and actual tank waste.

  3. Pascal-SC a computer language for scientific computation

    CERN Document Server

    Bohlender, Gerd; von Gudenberg, Jürgen Wolff; Rheinboldt, Werner; Siewiorek, Daniel

    1987-01-01

    Perspectives in Computing, Vol. 17: Pascal-SC: A Computer Language for Scientific Computation focuses on the application of Pascal-SC, a programming language developed as an extension of standard Pascal, in scientific computation. The publication first elaborates on the introduction to Pascal-SC, a review of standard Pascal, and real floating-point arithmetic. Discussions focus on optimal scalar product, standard functions, real expressions, program structure, simple extensions, real floating-point arithmetic, vector and matrix arithmetic, and dynamic arrays. The text then examines functions a

  4. III-V compound SC for optoelectronic devices

    Directory of Open Access Journals (Sweden)

    Sudha Mokkapati

    2009-04-01

    Full Text Available III-V compound semiconductors (SC have played a crucial role in the development of optoelectronic devices for a broad range of applications. Major applications of InP or GaAs based III-V compound SC are devices for optical fiber communications, infrared and visible LEDs/LDs and high efficiency solar cells. GaN based compounds are extremely important for short wavelength light emitters used in solid state lighting systems. We review the important device applications of various III-V compound SC materials.

  5. SC-System of convergence theory and foundations

    Directory of Open Access Journals (Sweden)

    Sergio G. De los Cobos Silva

    2015-08-01

    Full Text Available In this paper a novel system of convergence (SC is presented as well as its fundamentals and computing experience. An implementation using a novel mono-objetive particle swarm optimization (PSO algorithm with three phases (PSO-3P: stabilization, generation with broad-ranging exploration and generation with in-depth exploration, is presented and tested in a diverse benchmark problems. Evidence shows that the three-phase PSO algoritm along with the SC criterion (SC-PSO-3Pcan converge to the global optimum in several difficult test functions for multiobjective optimization problems, constrained optimization problems and unconstrained optimization problems with 2 until 120,000 variables.

  6. Gadolinium scandium germanide, Gd2Sc3Ge4

    Directory of Open Access Journals (Sweden)

    Sumohan Misra

    2009-04-01

    Full Text Available Gd2Sc3Ge4 adopts the orthorhombic Pu5Rh4-type structure. The crystal structure contains six sites in the asymmetric unit: two sites are statistically occupied by rare-earth atoms with Gd:Sc ratios of 0.967 (4:0.033 (4 and 0.031 (3:0.969 (3, one site (.m. symmetry is occupied by Sc atoms, and three distinct sites (two of which with .m. symmetry are occupied by Ge atoms. The rare-earth atoms form two-dimensional slabs with Ge atoms occupying the trigonal-prismatic voids.

  7. TESTING OF ENHANCED CHEMICAL CLEANING OF SRS ACTUAL WASTE TANK 5F AND TANK 12H SLUDGES

    Energy Technology Data Exchange (ETDEWEB)

    Martino, C.; King, W.

    2011-08-22

    Forty three of the High Level Waste (HLW) tanks at the Savannah River Site (SRS) have internal structures that hinder removal of the last approximately five thousand gallons of waste sludge solely by mechanical means. Chemical cleaning can be utilized to dissolve the sludge heel with oxalic acid (OA) and pump the material to a separate waste tank in preparation for final disposition. This dissolved sludge material is pH adjusted downstream of the dissolution process, precipitating the sludge components along with sodium oxalate solids. The large quantities of sodium oxalate and other metal oxalates formed impact downstream processes by requiring additional washing during sludge batch preparation and increase the amount of material that must be processed in the tank farm evaporator systems and the Saltstone Processing Facility. Enhanced Chemical Cleaning (ECC) was identified as a potential method for greatly reducing the impact of oxalate additions to the SRS Tank Farms without adding additional components to the waste that would extend processing or increase waste form volumes. In support of Savannah River Site (SRS) tank closure efforts, the Savannah River National Laboratory (SRNL) conducted Real Waste Testing (RWT) to evaluate an alternative to the baseline 8 wt. % OA chemical cleaning technology for tank sludge heel removal. The baseline OA technology results in the addition of significant volumes of oxalate salts to the SRS tank farm and there is insufficient space to accommodate the neutralized streams resulting from the treatment of the multiple remaining waste tanks requiring closure. ECC is a promising alternative to bulk OA cleaning, which utilizes a more dilute OA (nominally 2 wt. % at a pH of around 2) and an oxalate destruction technology. The technology is being adapted by AREVA from their decontamination technology for Nuclear Power Plant secondary side scale removal. This report contains results from the SRNL small scale testing of the ECC process

  8. BLAST2SRS, a web server for flexible retrieval of related protein sequences in the SWISS-PROT and SPTrEMBL databases

    DEFF Research Database (Denmark)

    Bimpikis, Konstantinos; Budd, Aidan; Linding, Rune

    2003-01-01

    SRS (Sequence Retrieval System) is a widely used keyword search engine for querying biological databases. BLAST2 is the most widely used tool to query databases by sequence similarity search. These tools allow users to retrieve sequences by shared keyword or by shared similarity, with many public......://blast2srs.embl.de/) aims to meet this need. This server therefore combines the two ways to search sequence databases: similarity and keyword....

  9. Infectivity-associated PrP(Sc) and disease duration-associated PrP(Sc) of mouse BSE prions.

    Science.gov (United States)

    Miyazawa, Kohtaro; Okada, Hiroyuki; Masujin, Kentaro; Iwamaru, Yoshifumi; Yokoyama, Takashi

    2015-01-01

    Disease-related prion protein (PrP(Sc)), which is a structural isoform of the host-encoded cellular prion protein, is thought to be a causative agent of transmissible spongiform encephalopathies. However, the specific role of PrP(Sc) in prion pathogenesis and its relationship to infectivity remain controversial. A time-course study of prion-affected mice was conducted, which showed that the prion infectivity was not simply proportional to the amount of PrP(Sc) in the brain. Centrifugation (20,000 ×g) of the brain homogenate showed that most of the PrP(Sc) was precipitated into the pellet, and the supernatant contained only a slight amount of PrP(Sc). Interestingly, mice inoculated with the obtained supernatant showed incubation periods that were approximately 15 d longer than those of mice inoculated with the crude homogenate even though both inocula contained almost the same infectivity. Our results suggest that a small population of fine PrP(Sc) may be responsible for prion infectivity and that large, aggregated PrP(Sc) may contribute to determining prion disease duration.

  10. Precipitation in cold-rolled Al-Sc-Zr and Al-Mn-Sc-Zr alloys prepared by powder metallurgy

    KAUST Repository

    Vlach, Martin

    2013-12-01

    The effects of cold-rolling on thermal, mechanical and electrical properties, microstructure and recrystallization behaviour of the AlScZr and AlMnScZr alloys prepared by powder metallurgy were studied. The powder was produced by atomising in argon with 1% oxygen and then consolidated by hot extrusion at 350 C. The electrical resistometry and microhardness together with differential scanning calorimetry measurements were compared with microstructure development observed by transmission and scanning electron microscopy, X-ray diffraction and electron backscatter diffraction. Fine (sub)grain structure developed and fine coherent Al3Sc and/or Al3(Sc,Zr) particles precipitated during extrusion at 350 C in the alloys studied. Additional precipitation of the Al3Sc and/or Al3(Sc,Zr) particles and/or their coarsening was slightly facilitated by the previous cold rolling. The presence of Sc,Zr-containing particles has a significant antirecrystallization effect that prevents recrystallization at temperatures minimally up to 420 C. The precipitation of the Al6Mn- and/or Al 6(Mn,Fe) particles of a size ~ 1.0 μm at subgrain boundaries has also an essential antirecrystallization effect and totally suppresses recrystallization during 32 h long annealing at 550 C. The texture development of the alloys seems to be affected by high solid solution strengthening by Mn. The precipitation of the Mn-containing alloy is highly enhanced by a cold rolling. The apparent activation energy of the Al3Sc particles formation and/or coarsening and that of the Al6Mn and/or Al 6(Mn,Fe) particle precipitation in the powder and in the compacted alloys were determined. The cold deformation has no effect on the apparent activation energy values of the Al3Sc-phase and the Al 6Mn-phase precipitation. © 2013 Elsevier Inc.

  11. Application of flood index in monitoring Flood-plain ecosystems (by the example of the Middle Ob flood-plain)

    OpenAIRE

    Bolotnov, V. P.

    2007-01-01

    The concept of regional hydroecological monitoring has been developed for the flood-plain of the Middle Ob. Its object is to control the state of flood-plain ecosystem productivity for organization of scientific, regional-adopted and ecologically regulated nature management. For this purpose hydroecological zoning of flood-plain territory performed, the most representative stations of water-gauge observations for each flood-plain zone organized, the scheme of flood-plain flooding was prepared...

  12. The data acquisition system (DAS) for the improved CERN SC

    CERN Document Server

    Beger, H; Fiebig, A; Schroot, H

    1975-01-01

    A digital data acquisition system (DAS) based on a minicomputer is described which registers the failure sequences in various equipment areas of the CERN synchrocyclotron (henceforward referred to as the SC). The avalanches of failure signals which occur from time to time are tapped from the alarm/security systems, time-resolved to 10 msec and recorded on a printer in order to aid SC failure diagnosis. The mechanisms of the DAS and its relation to the SC equipment are explained in some detail. All programs were constructed at assembler language level for speed and for ease of on-line program maintenance. The alarm sequences recorded have been of considerable help during the running in of the new radiofrequency system. Now that the new SC is operational, the DAS furnishes useful data from several equipment areas to the operators and engineers.

  13. 75 FR 71734 - Outer Continental Shelf (OCS), Scientific Committee (SC)

    Science.gov (United States)

    2010-11-24

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF THE INTERIOR Bureau of Ocean Energy Management, Regulation and Enforcement Outer Continental Shelf (OCS), Scientific Committee (SC) AGENCY: Bureau of Ocean Energy Management, Regulation and Enforcement (BOEMRE),...

  14. Aging of Al-0,3 at. % Sc alloy

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Ber, L.B.; Bykov, L.S.; Toropova, L.S.; Anastas' eva, G.K. (AN SSSR, Moscow. Inst. Metallurgii)

    1984-06-01

    Method of measuring electric conductivity, hardness and yield limit was used to study the kinetics of aging of Al-0.3 at.%Sc alloy in 20-450 deg c range. It was established by X-ray methods of monocrystal investigation and diffraction electron microscopy that coherent precipitations of equilibrium ScAl/sub 3/ pha se with li/sub 2/ type structure and 0.41 nm lattice parameter represent the product of decomposition of supersaturated solid solution. Characteristic features and the kinetics of ScAl/sub 3/ phase particle growth were studied by the electron microscopic method. The activation energy of scandium and aluminium diffusion equal to 3.81 MJ/kg was determined. The analysis of deformation hardening of Al-0.3 at.%Sc alloy at different stages of aging was conducted.

  15. 表达牛源犬新孢子虫NcSRS2基因重组腺病毒的构建及免疫原性分析%Construction of a Recombinant Adenovirus Expressing NcSRS2 Protein of Bovine Neospora Caninum and Immunogenicity Analysis of the Protein

    Institute of Scientific and Technical Information of China (English)

    贾立军; 于龙政; 张守发

    2012-01-01

    为构建牛源犬新孢子虫NcSRS2基因重组腺病毒,并分析其免疫原性,PCR扩增牛源犬新孢子虫NcSRS2基因,构建克隆质粒pMD18-T-NcSRS2、重组腺病毒穿梭质粒pCR259-NcSRS2及表达质粒Transpose-AdNcSRS2,脂质体介导转染QBI-HEK293细胞,包装重组腺病毒Ad5-NcSRS2,PCR检测重组腺病毒NcSRS2基因,IFAT和Western blotting检测NcSRS2基因在QBI-HEK293细胞中的表达,测定病毒滴度后,收集病毒液免疫BALB/c小鼠,间接ELISA检测小鼠血清IgG抗体水平.结果显示,扩增的牛源犬新孢子虫NcSRS2基因大小为1 227 bp,与GenBank中发表的NcSRS2( AF061249)核苷酸序列相似性为99%;重组腺病毒Ad5-NcSRS2在293细胞中包装成功,表达蛋白的相对分子质量为43 ku,具有较好的反应原性;测得重组腺病毒Ad5-NcSRS2滴度为109TCID50·mL-1,间接ELISA检测二免后3周BALB/c小鼠血清中IgG抗体效价达1 ∶ 2 048.本研究成功构建了具有良好免疫原性的重组腺病毒Ad5-NcSRS2,为牛源犬新孢子虫NcSRS2基因重组腺病毒载体疫苗的研制奠定了基础.%In order to construct a recombinant adenovirus expressing NcSRS2 protein of bovine Neospora Caninum, NcSRS2 gene of bovine Neospora Caninum was amplified by PCR, pMD18-T-NcSRS2, pCR259-NcSRS2 and Transpose-Ad-NcSRS2 were constructed in this research. Coated with liposome, Transpose-Ad-NcSRS2 was transfected into QBI-HEK293 cells to package recombinant adenovirus Ad5-NcSRS2. Recombinant adenovirus NcSRS2 gene was detected by PCR. The expression of NcSRS2 gene in QBI-HEK293 cells was detected by IFAT and Western blotting. After the virus titer was determined, the virus fluid was collected to inoculate BALB/c mice and IgG antibody levels in the sera were measured by indirect ELISA. The size of NcSRS2 gene was 1 227 bp. The nucleotide sequence of the gene shared 99% homology with that in GenBank (AF061249). Recombinant adenovirus Ad5-NcSRS2 was successfully packaged in 293 cells. The protein

  16. Magnetic properties of the Sc-H system

    Energy Technology Data Exchange (ETDEWEB)

    Volkenshtein, N.V.; Galoshina, E.V. (AN SSSR, Sverdlovsk. Ural' skij Nauchnyj Tsentr); Kost, M.E. (AN SSSR, Moscow. Inst. Obshchej i Neorganicheskoj Khimii); Shubina, T.S. (Ural' skij Gosudarstvennyj Univ., Sverdlovsk (USSR))

    1983-05-01

    The magnetic susceptibility in the ..cap alpha..-phase region of the Sc-H system and in scandium hydrides ScH/sub 2/ is investigated. The temperature dependence of the susceptibility was measured from liquid-helium temperature to room temperature in a magnetic field of 10 kOe. The influence of hydrogenation and of band structure parameters (density of states at the Fermi level, spin-relaxation time, and Fermi energy) on the susceptibility is shown and discussed.

  17. Homogenization of alloys in the system Al-Mg-Sc

    Science.gov (United States)

    Drits, M. E.; Toropova, L. S.; Bykov, Yu. G.

    1983-07-01

    A reduction in homogenizing anneal temperature and a reduction in soaking time leads to an increase in yield point for alloys of the system Al-Mg-Sc. The optimum homogenizing schedule for alloys of this system is heating to 400°C and soaking for up to 10 h. This homogenizing schedule provides an alloy structure of fine coherent ScAl3-phase precipitates and dissolution of excess β-phase precipitates.

  18. Theoretical studies of the low-lying states of ScO, ScS, VO, and VS

    Science.gov (United States)

    Bauschlicher, Charles W., Jr.; Langhoff, Stephen R.

    1986-01-01

    Bonding in the low-lying states of ScO, ScS, VO, and VS is theoretically studied. Excellent agreement is obtained with experimental spectroscopic constants for the low-lying states of ScO and VO. The results for VS and ScS show that the bonding in the oxides and sulfides is similar, but that the smaller electronegativity in S leads to a smaller ionic component in the bonding. The computed D0 of the sulfides are about 86 percent of the corresponding oxides, and the low-lying excited states are lower in the sulfides than in the corresponding oxides. The CPF method is shown to be an accurate and cost-effective method for obtaining reliable spectroscopic constants for these systems.

  19. Effect of homogenizing heatings on the properties of Al-Sc and Al-Mg-Sc alloy systems

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Toropova, L.S.; Anastas' eva, G.K.; Nagornichnykh, G.L.

    Effect of annealing on hardness and electric conductivity of cast alloys of Al-Mg-Sc and Al-Sc systems has been studied. Magnesium content in studied alloys was changed in the range of 0-6.5%, scandium content was chosen to be constant -0.4%. It has been revealed that homogenizing heatings of Al-Sc alloys lead to a decomposition of abnormally saturated solid solution during crystallization at temperatures >250 deg C. Maximum hardness values are achieved after annealing at 300 deg C during 1h. Homogenizing of Al-Mg--- Sc alloys at 350 deg C during 24h leads to practically full solubility of a nonequilibrium ..beta..-phase (Mg/sub 2/Al/sub 3/) and also to a decomposition of a solid solution abnormally saturated with scandium. Maximum values of hardness are achieved after annealing at 35O deg C during 0.5-1h.

  20. Evolution des zones humides d'Anatolie intérieure : exemple de la plaine de Konya, Turquie

    Directory of Open Access Journals (Sweden)

    Catherine Kuzucuoglu

    2000-05-01

    Full Text Available L’évolution 1987-1993 du lac d’Akgöl (Est de la plaine de Konya est cartographiée et mesurée, par diachronie de deux scènes SPOT XS. La contraction correspond à un accroissement des prélèvements dans les nappes d’eau souterraines. D’autres secteurs font l’objet d’une cartographie géomorphologique illustrant l’évolution des paléoenvironnements lacustres et palustres au Pléistocène Supérieur.

  1. Dibutyl Phosphoric Acid Solubility in High-Acid, Uranium-Bearing Solutions at SRS

    Energy Technology Data Exchange (ETDEWEB)

    Pierce, R.A.

    1998-10-02

    The Savannah River Site has enriched uranium (EU) solution which has been stored for almost 10 years since being purified in the second uranium cycle of the H area solvent extraction process. The concentrations in solution are approximately 6 g/L U and about 0.1 M nitric acid. Residual tributylphosphate in the solutions has slowly hydrolyzed to form dibutyl phosphoric acid (HDBP) at concentrations averaging 50 mg/L. Uranium is known to form compounds with the dibutylphosphate ion (DBP) which have limited solubility. The potential to form uranium-DBP solids raises a nuclear criticality safety issue. Prior SRTC tests (WSRC-TR-98-00188) showed that U-DBP solids precipitate at concentrations potentially attainable during the storage of enriched uranium solutions. Furthermore, evaporation of the existing EUS solution without additional acidification could result in the precipitation of U-DBP solids if the DBP concentration in the resulting solution exceeds 110 mg/L at ambient temperature. The same potential exists for evaporation of unwashed 1CU solutions. As a follow-up to the earlier studies, SRTC studied the solubility limits for solutions containing acid concentrations above 0.5M HNO3. The data obtained in these tests reveals a shift to higher levels of DBP solubility above 0.5M HNO3 for both 6 g/L and 12 g/L uranium solutions. Analysis of U-DBP solids from the tests identified a mixture of different molecular structures for the solids created. The analysis distinguished UO2(DBP)2 as the dominant compound present at low acid concentrations. As the acid concentration increases, the crystalline UO2(DBP)2 shows molecular substitutions and an increase in amorphous content. Further analysis by methods not available at SRS will be needed to better identify the specific compounds present. This data indicates that acidification prior to evaporation can be used to increase the margin of safety for the storage of the EUS solutions. Subsequent experimentation evaluated options

  2. USE OF CEMENTITIOUS MATERIALS FOR SRS REACTOR FACILITY IN-SITU DECOMMISSIONING - 11620

    Energy Technology Data Exchange (ETDEWEB)

    Langton, C.; Stefanko, D.; Serrato, M.; Blankenship, J.; Griffin, W.; Waymer, J.; Matheny, D.; Singh, D.

    2010-12-07

    for filling the reactor vessels, and (2) a specialty grout mix to fill a selected portion of the P-Reactor Disassembly Basin. Details of the grout mixes designed for ISD of he SRS Reactor Disassembly Basins and below grade portions of the 105-Buildings was described elsewhere. Material property test results, placement strategies, full-scale production and delivery systems will also be described.

  3. EVALUATION OF ENHANCED VOC REMOVAL WITH SOIL FRACTURING IN THE SRS UPLAND UNIT

    Energy Technology Data Exchange (ETDEWEB)

    Riha, B

    2005-10-31

    The Environmental Restoration Technology Section (ERTS) of the Savannah River National Laboratory (SRNL) conducted pilot scale testing to evaluate the effectiveness of using hydraulic fracturing as a means to improve soil vapor extraction (SVE) system performance. Laboratory and field research has shown that significant amounts of solvents can be entrapped in low permeability zones by capillary forces and removal by SVE can be severely limited due to low flow rates, mass transfer resistance of the hydrophobic compounds by trapped interparticle water, and diffusion resistance. Introducing sand-filled fractures into these tight zones improves the performance of SVE by (1) increasing the overall permeability of the formation and thereby increasing SVE flow rates, (2) shortening diffusion pathways, and (3) increasing air permeability by improving pore water removal. The synergistic effect of the fracture well completion methods, fracture and flow geometry, and pore water removal appears to increase the rate of solvent mass removal over that of increasing flow rate alone. A field test was conducted where a conventional well in the SRS Upland Unit was tested before and after hydraulic fracturing. ERTS teamed with Clemson University through the South Carolina University and Education Foundation (SCUREF) program utilizing their expertise in fracturing and fracture modeling. The goals of the fracturing pilot testing were to evaluate the following: (1) The effect of hydraulic fractures on the performance of a conventional well. This was the most reliable way to remove the effects of spatial variations in permeability and contaminant distribution on relative well performance. It also provided data on the option of improving the performance of existing wells using hydraulic fractures. (2) The relative performance of a conventional SVE well and isolated hydraulic fractures. This was the most reliable indicator of the performance of hydraulic fractures that could be created in a

  4. Risk-Based Remediation Approach for Cs-137 Contaminated Sediment/Soils at the Savannah River Site (SRS) Lower Three Runs Tail (U) - 13348 - SRNS-RP-2012-00546

    Energy Technology Data Exchange (ETDEWEB)

    Freeman, Candice [Department of Energy- Savannah River Site, Aiken, SC (United States); Bergren, Christopher; Blas, Susan; Kupar, James [Area Completion Projects, Savannah River Nuclear Solutions, LLC (United States)

    2013-07-01

    Lower Three Runs is a large blackwater stream that runs through the eastern and southern portion of the Savannah River Site. The Lower Three Runs watershed includes two SRS facility areas: P Area (P Reactor) and R Area (R Reactor) that provided effluent discharges to Lower Three Runs. During reactor operations, effluent discharges were well above natural (pre-industrial) or present day stream discharges. The watershed contains a 2,500-acre mainstream impoundment (PAR Pond), several smaller pre-cooler ponds, and a canal system that connects the pre-cooler ponds and discharges surface water to PAR Pond. From the PAR Pond dam, Lower Three Runs flows approximately 36 kilometers braiding through bottom-land/flood-plain forests before it enters the Savannah River. About eight kilometers downstream from the PAR Pond dam, the SRS boundary narrows (termed the Lower Three Runs tail) providing a limited buffer of DOE property for the Lower Three Runs stream and associated flood-plain. Previous screening characterization efforts revealed Cs-137 contamination in the sediment/soils of the flood-plain. As a part of the American Recovery and Reinvestment Act stimulus package, a comprehensive characterization effort was executed on the sediment/soils of the Lower Three Runs tail flood-plain providing a comprehensive look at the contaminant signature of the area. As a follow-up to that characterization, a regulatory decision Core Team, comprised of members of the South Carolina Department of Health and Environmental Control, Environmental Protection Agency - Region IV, and DOE, conducted negotiations on a risk-based approach to address the level of contamination found in the tail flood-plain as an early action that provided a long-term solution to exposure scenarios. For evaluation purposes, the adolescent trespasser was selected as the most likely human receptor for the Lower Three Runs tail portion because of the natural attractiveness of the area for recreational activities (i

  5. {sup 210}Pb geochronology and chemical characterization of sediment cores from lakes of the Parana river alluvial plain

    Energy Technology Data Exchange (ETDEWEB)

    Teixeira, L.F.L.; Damatto, S.R.; Scapin, M.A. [IPEN - Instituto de Pesquisas Energeticas e Nucleares (Brazil); Remor, M.B.; Sampaio, S.C. [UNIOESTE - Universidade Estadual do Oeste do Parana (Brazil)

    2014-07-01

    The flood plain of the upper Parana River is located among the lakes formed by the Brazilian hydroelectric plants being the last part of the Parana river, in Brazil, where there is an ecosystem with interaction river-flood plain. This flood plain has considerable habitat variability, with great diversity of terrestrial and aquatic species, and the floods are the main factor that regulates the operation of this ecosystem. The seasonality of the flood pulses is mainly influenced by the El Nino phenomenon, which increases precipitation in the drainage basin of the flood plain of the upper Parana River. Because of its unique characteristics this ecosystem is the subject of intense study since 1980, mainly from the ecological point of view. Therefore, two sediment cores were collected in the ponds formed by the floods, Patos pond and Garcas pond, in order to characterize the sediment chemically and evaluate a possible historic contamination. The trace element concentrations As, Ba, Br, Ce, Co, Cr, Cs, Eu, Hf, La, Lu, Nd, Rb, Sb, Sc, Sm, Ta, Tb, Th, U, Yb and Zn (mg.kg{sup -1}) and the major elements Si, Al, Fe, Ti, K, Ca, Mg, P, V, Mn, and Na (%) were determined in the sediment cores dated by {sup 210}Pb method, using instrumental neutron activation analysis, X-ray fluorescence and gross beta counting, respectively. The results obtained for the elements Ce, Cr, Cs, La, Nd, Sc, Sm and Th are higher than the values of Upper Continental Crust for both ponds. The sedimentation rates obtained for Garca pond, 0.77 cm.y{sup -1}, and Patos pond, 0.62 cm.y{sup -1} are in agreement with studies performed in sedimentary environments similar to the present work, such as Brazilian wetland Pantanal. The enrichment factor and the geo-accumulation index were used to assess the presence of anthropogenic sources of pollution. Document available in abstract form only. (authors)

  6. Compensation of native donor doping in ScN: Carrier concentration control and p-type ScN

    Science.gov (United States)

    Saha, Bivas; Garbrecht, Magnus; Perez-Taborda, Jaime A.; Fawey, Mohammed H.; Koh, Yee Rui; Shakouri, Ali; Martin-Gonzalez, Marisol; Hultman, Lars; Sands, Timothy D.

    2017-06-01

    Scandium nitride (ScN) is an emerging indirect bandgap rocksalt semiconductor that has attracted significant attention in recent years for its potential applications in thermoelectric energy conversion devices, as a semiconducting component in epitaxial metal/semiconductor superlattices and as a substrate material for high quality GaN growth. Due to the presence of oxygen impurities and native defects such as nitrogen vacancies, sputter-deposited ScN thin-films are highly degenerate n-type semiconductors with carrier concentrations in the (1-6) × 1020 cm-3 range. In this letter, we show that magnesium nitride (MgxNy) acts as an efficient hole dopant in ScN and reduces the n-type carrier concentration, turning ScN into a p-type semiconductor at high doping levels. Employing a combination of high-resolution X-ray diffraction, transmission electron microscopy, and room temperature optical and temperature dependent electrical measurements, we demonstrate that p-type Sc1-xMgxN thin-film alloys (a) are substitutional solid solutions without MgxNy precipitation, phase segregation, or secondary phase formation within the studied compositional region, (b) exhibit a maximum hole-concentration of 2.2 × 1020 cm-3 and a hole mobility of 21 cm2/Vs, (c) do not show any defect states inside the direct gap of ScN, thus retaining their basic electronic structure, and (d) exhibit alloy scattering dominating hole conduction at high temperatures. These results demonstrate MgxNy doped p-type ScN and compare well with our previous reports on p-type ScN with manganese nitride (MnxNy) doping.

  7. Survival in nuclear waste, extreme resistance, and potential applications gleaned from the genome sequence of Kineococcus radiotolerans SRS30216.

    Directory of Open Access Journals (Sweden)

    Christopher E Bagwell

    Full Text Available Kineococcus radiotolerans SRS30216 was isolated from a high-level radioactive environment at the Savannah River Site (SRS and exhibits gamma-radiation resistance approaching that of Deinococcus radiodurans. The genome was sequenced by the U.S. Department of Energy's Joint Genome Institute which suggested the existence of three replicons, a 4.76 Mb linear chromosome, a 0.18 Mb linear plasmid, and a 12.92 Kb circular plasmid. Southern hybridization confirmed that the chromosome is linear. The K. radiotolerans genome sequence was examined to learn about the physiology of the organism with regard to ionizing radiation resistance, the potential for bioremediation of nuclear waste, and the dimorphic life cycle. K. radiotolerans may have a unique genetic toolbox for radiation protection as it lacks many of the genes known to confer radiation resistance in D. radiodurans. Additionally, genes involved in the detoxification of reactive oxygen species and the excision repair pathway are overrepresented. K. radiotolerans appears to lack degradation pathways for pervasive soil and groundwater pollutants. However, it can respire on two organic acids found in SRS high-level nuclear waste, formate and oxalate, which promote the survival of cells during prolonged periods of starvation. The dimorphic life cycle involves the production of motile zoospores. The flagellar biosynthesis genes are located on a motility island, though its regulation could not be fully discerned. These results highlight the remarkable ability of K radiotolerans to withstand environmental extremes and suggest that in situ bioremediation of organic complexants from high level radioactive waste may be feasible.

  8. Survival in nuclear waste, extreme resistance, and potential applications gleaned from the genome sequence of Kineococcus radiotolerans SRS30216.

    Science.gov (United States)

    Bagwell, Christopher E; Bhat, Swapna; Hawkins, Gary M; Smith, Bryan W; Biswas, Tapan; Hoover, Timothy R; Saunders, Elizabeth; Han, Cliff S; Tsodikov, Oleg V; Shimkets, Lawrence J

    2008-01-01

    Kineococcus radiotolerans SRS30216 was isolated from a high-level radioactive environment at the Savannah River Site (SRS) and exhibits gamma-radiation resistance approaching that of Deinococcus radiodurans. The genome was sequenced by the U.S. Department of Energy's Joint Genome Institute which suggested the existence of three replicons, a 4.76 Mb linear chromosome, a 0.18 Mb linear plasmid, and a 12.92 Kb circular plasmid. Southern hybridization confirmed that the chromosome is linear. The K. radiotolerans genome sequence was examined to learn about the physiology of the organism with regard to ionizing radiation resistance, the potential for bioremediation of nuclear waste, and the dimorphic life cycle. K. radiotolerans may have a unique genetic toolbox for radiation protection as it lacks many of the genes known to confer radiation resistance in D. radiodurans. Additionally, genes involved in the detoxification of reactive oxygen species and the excision repair pathway are overrepresented. K. radiotolerans appears to lack degradation pathways for pervasive soil and groundwater pollutants. However, it can respire on two organic acids found in SRS high-level nuclear waste, formate and oxalate, which promote the survival of cells during prolonged periods of starvation. The dimorphic life cycle involves the production of motile zoospores. The flagellar biosynthesis genes are located on a motility island, though its regulation could not be fully discerned. These results highlight the remarkable ability of K radiotolerans to withstand environmental extremes and suggest that in situ bioremediation of organic complexants from high level radioactive waste may be feasible.

  9. SU-E-T-48: A Multi-Institutional Study of Independent Dose Verification for Conventional, SRS and SBRT

    Energy Technology Data Exchange (ETDEWEB)

    Takahashi, R; Kamima, T [The Cancer Institute Hospital of JFCR, Koto-ku, Tokyo (Japan); Tachibana, H; Baba, H [National Cancer Center Hospital East, Kashiwa, Chiba (Japan); Itano, M; Yamazaki, T [Inagi Municipal Hospital, Inagi, Tokyo (Japan); Ishibashi, S; Higuchi, Y [Sasebo City General Hospital, Sasebo, Nagasaki (Japan); Shimizu, H [Kitasato University Medical Center, Kitamoto, Saitama (Japan); Yamamoto, T [Otemae Hospital, Chuou-ku, Osaka-city (Japan); Yamashita, M [Kobe City Medical Center General Hospital, Kobe, Hyogo (Japan); Sugawara, Y [The National Center for Global Health and Medicine, Shinjuku-ku, Tokyo (Japan); Sato, A [Itabashi Central General Hospital, Itabashi-ku, Tokyo (Japan); Nishiyama, S [Kuki General Hospital, Kuki, Saitama (Japan); Kawai, D [Kanagawa Cancer Center, Yokohama, Kanagawa-prefecture (Japan); Miyaoka, S [Kamitsuga General Hospital, Kanuma, Tochigi (Japan)

    2015-06-15

    Purpose: To show the results of a multi-institutional study of the independent dose verification for conventional, Stereotactic radiosurgery and body radiotherapy (SRS and SBRT) plans based on the action level of AAPM TG-114. Methods: This study was performed at 12 institutions in Japan. To eliminate the bias of independent dose verification program (Indp), all of the institutions used the same CT-based independent dose verification software (Simple MU Analysis, Triangle Products, JP) with the Clarkson-based algorithm. Eclipse (AAA, PBC), Pinnacle{sup 3} (Adaptive Convolve) and Xio (Superposition) were used as treatment planning system (TPS). The confidence limits (CL, Mean±2SD) for 18 sites (head, breast, lung, pelvis, etc.) were evaluated in comparison in dose between the TPS and the Indp. Results: A retrospective analysis of 6352 treatment fields was conducted. The CLs for conventional, SRS and SBRT were 1.0±3.7 %, 2.0±2.5 % and 6.2±4.4 %, respectively. In conventional plans, most of the sites showed within 5 % of TG-114 action level. However, there were the systematic difference (4.0±4.0 % and 2.5±5.8 % for breast and lung, respectively). In SRS plans, our results showed good agreement compared to the action level. In SBRT plans, the discrepancy between the Indp was variable depending on dose calculation algorithms of TPS. Conclusion: The impact of dose calculation algorithms for the TPS and the Indp affects the action level. It is effective to set the site-specific tolerances, especially for the site where inhomogeneous correction can affect dose distribution strongly.

  10. REVIEW OF ALTERNATIVE ENHANCED CHEMICAL CLEANING OPTIONS FOR SRS WASTE TANKS

    Energy Technology Data Exchange (ETDEWEB)

    Hay, M.; Koopman, D.

    2009-08-01

    A literature review was conducted to support the Task Technical and Quality Assurance Plan for Alternative Enhanced Chemical Cleaning (AECC) for sludge heel removal funded as part of the EM-21 Engineering and Technology program. The goal was to identify potential technologies or enhancements to the baseline oxalic acid cleaning process for chemically dissolving or mobilizing Savannah River Site (SRS) sludge heels. The issues with the potentially large volume of oxalate solids generated from the baseline process have driven an effort to find an improved or enhanced chemical cleaning technology for the tank heels. This literature review builds on a previous review conducted in 2003. A team was charged with evaluating the information in these reviews and developing recommendations of alternative technologies to pursue. The new information in this report supports the conclusion of the previous review that oxalic acid remains the chemical cleaning agent of choice for dissolving the metal oxides and hydroxides found in sludge heels in carbon steel tanks. The potential negative impact of large volumes of sodium oxalate on downstream processes indicates that the amount of oxalic acid used for chemical cleaning needs to be minimized as much as possible or the oxalic acid must be destroyed prior to pH adjustment in the receipt tank. The most straightforward way of minimizing the volume of oxalic acid needed for chemical cleaning is through more effective mechanical cleaning. Using a mineral acid to adjust the pH of the sludge prior to adding oxalic acid may also help to minimize the volume of oxalic acid used in chemical cleaning. If minimization of oxalic acid proves insufficient in reducing the volume of oxalate salts, several methods were found that could be used for oxalic acid destruction. For some waste tank heels, another acid or even caustic treatment (or pretreatment) might be more appropriate than the baseline oxalic acid cleaning process. Caustic treatment of high

  11. Plain carbon steel bipolar plates for PEMFC

    Institute of Scientific and Technical Information of China (English)

    WANG Jianli; SUN Juncai; TIAN Rujin; XU Jing

    2006-01-01

    Bipolar plates are a multifunctional component of PEMFC. Comparing with the machined graphite and stainless steels, the plain carbon steel is a very cheap commercial metal material. In this paper, the possibility of applying the plain carbon steels in the bipolar plate for PEMFC was exploited. In order to improve the corrosion resistance of the low carbon steel in the PEMFCs' environments,two surface modification processes was developed and then the electrochemical performances and interfacial contact resistance (ICR) of the surface modified plate of plain carbon steel were investigated. The results show that the surface modified steel plates have good corrosion resistance and relatively low contact resistance, and it may be a candidate material as bipolar plate of PEMFC.

  12. The Macaque Social Responsiveness Scale (mSRS: A Rapid Screening Tool for Assessing Variability in the Social Responsiveness of Rhesus Monkeys (Macaca mulatta.

    Directory of Open Access Journals (Sweden)

    Eric J Feczko

    Full Text Available Understanding the biological mechanisms underlying human neuropsychiatric disorders, such as autism spectrum disorder (ASD, has been hindered by the lack of a robust, translational animal model. Rhesus monkeys (Macaca mulatta display many of the same social behaviors that are affected in ASD, making them an excellent animal species in which to model social impairments. However, the social impairments associated with ASD may reflect extreme ends of a continuous distribution of traits. Thus, to validate the rhesus monkey as an animal model for studying social impairments that has strong translational relevance for ASD, researchers need an easily-implemented measurement tool that can quantify variation in social behavior dimensionally. The Social Responsiveness Scale (SRS is a 65-item survey that identifies both typical and atypical social behaviors in humans that covary with ASD symptom severity. A chimpanzee SRS has already been validated and the current study adapted this tool for use in the rhesus monkey (mSRS. Fifteen raters completed the mSRS for 105 rhesus monkeys living at the Yerkes National Primate Research Center. The mSRS scores showed a unimodal distribution with a positive skew that identified 6 statistical outliers. Inter-rater reliability was very strong, but only 17 of the 36 questions showed positive intra-item reliability. The results of an exploratory factor analysis identified 3 factors that explained over 60% of the variance, with 12 items significantly loading onto the primary factor. These items reflected behaviors associated with social avoidance, social anxiety or inflexibility and social confidence. These initial findings are encouraging and suggest that variability in the social responsiveness of rhesus monkeys can be quantified using the mSRS: a tool that has strong translational relevance for human disorders. With further modification, the mSRS may provide an promising new direction for research on the biological

  13. Hydrogeochemical analysis for Tasuj plain aquifer, Iran

    Indian Academy of Sciences (India)

    Ata Allah Nadiri; Asghar Asghari Moghaddam; Frank T-C Tsai; Elham Fijani

    2013-08-01

    This study investigated the hydrogeochemical processes of groundwater in the Tasuj plain, Iran. The Tasuj plain is one of the 12 marginal plains around Urmia Lake which is currently under a critical ecological condition. In the last decades, the Tasuj plain aquifer suffered from severe groundwater level declination and caused degradation of groundwater quality. To better understand hydrogeochemical processes in the Tasuj plain, this study adopted graphical methods and multivariate statistical techniques to analyze groundwater samples. A total of 504 groundwater samples was obtained from 34 different locations (qanats, wells, and springs) over 12 years (1997–2009) and analyzed for 15 water quality parameters. From the results, the Piper diagram indicated four groundwater types and the Stiff diagram showed eight different sources of groundwater samples. The Durov diagram identified five major hydrogeochemical processes in the aquifer. However, hierarchical cluster analysis (HCA) identified five water types in the groundwater samples because HCA was able to analyze more chemical and physical data than graphical methods. The HCA result was checked by discriminant analysis and found consistency in all samples that were classified into correct groups. Using factor analysis, we identified three factors that accounted for 81.6% of the total variance of the dataset. Based on the high factor loadings of the variables, factors 1 and 2 reflected the natural hydrogeochemical processes and factor 3 explained the effect of agricultural fertilizers and human activities in the Tasuj plain. Dendrograms from 2000 to 2009 were studied to understand the temporal variation of groundwater quality. Comparing the distributions of groundwater types in 2000 and 2009, we found that the mixing zone was expanded. This may be due to artificial groundwater recharge in the recharge area and the effect of inverse ion exchange in the discharge area.

  14. Drought Assessment in the Moldavian Plain

    Directory of Open Access Journals (Sweden)

    Pelin Liviu Ioan

    2016-06-01

    Full Text Available The Moldavian Plain, located in the North-Eastern part of Romania, has a temperate-continental climate with a nuance of excessivity in the precipitation regime. This paper aims to analyse droughts in the Moldavian Plain for the period 1961-2010, by using a classical method - the de Martonne Aridity Index, and two other less known indices developed in Romania and the Republic of Moldova. Among these indices, the Dry Spells Index demonstrates a increasing frequency of dry years in recent decades.

  15. Final Technical Report for Award SC0008613

    Energy Technology Data Exchange (ETDEWEB)

    Knopf, Daniel A. [Stony Brook Univ., NY (United States)

    2017-04-05

    Discovering how aerosol particles, present in the atmosphere in sizes of a few nanometers to hundred micrometers, initiate ice crystal formation represents a great challenge. Atmospheric ice nucleation is important because ice crystals alter the radiative properties of clouds and thus climate, and impact precipitation and thus the hydrological cycle. The difficulty in predicting atmospheric ice formation is attributable at least in part, to the diversity of ice nucleation pathways, the physical and chemical complexity of the ice nucleating particles (INPs), and the relatively small numbers of INPs (compared with all other aerosol particles), sometimes less than one in 100000. These factors in turn makes constraining ice nucleation parameterizations for modeling applications challenging. The majority of airborne particles are known to be organic in nature or contain organic biogenic material. The presence of organic material adds to the complexity of the particles and therefore the predictability of ice nucleation events since the organic species can display different phase states, e.g. liquid or solid, in response to temperature and humidity. The award DE-SC0008613 to PI Prof. Daniel Knopf at Stony Brook University, “Relating the Chemical and Physical Properties of Aerosols to the Water Uptake and Ice Nucleation Potential of Particles Collected During the Carbonaceous Aerosols and Radiative Effects Study (CARES)”, allowed examination of laboratory generated aerosol particles and field-collected particles for their propensity to nucleate ice under typical tropospheric conditions and relate ice nucleation to the physicochemical properties of the particles including their morphology and chemical composition. This in turn allowed for development of ice nucleation parameterizations for implementation in cloud models. The award resulted in 10 peer-reviewed publications and more than 20 seminar and conference presentations. We demonstrated that the rate of immersion

  16. Medialogy (English Information Brochure on the education M.Sc.,Medialogy, 3rd to 10th semester (B.Sc. & M.Sc) - For graduates from higher study programmes such as Multimedia Design and IT Graduates)

    DEFF Research Database (Denmark)

    Nordahl, Rolf

    2005-01-01

    An information brochure, 24 pages, in English which describes the education M.Sc., Medialogy, offered by Aalborg University in Copenhagen and Esbjerg. The brochure describes the 3rd to 10th semester (B.Sc. and M.Sc. degree) of the education. The information is primarily directed toward potential...

  17. Piezoelectric coefficients and spontaneous polarization of ScAlN.

    Science.gov (United States)

    Caro, Miguel A; Zhang, Siyuan; Riekkinen, Tommi; Ylilammi, Markku; Moram, Michelle A; Lopez-Acevedo, Olga; Molarius, Jyrki; Laurila, Tomi

    2015-06-24

    We present a computational study of spontaneous polarization and piezoelectricity in Sc(x)Al(1-x)N alloys in the compositional range from x = 0 to x = 0.5, obtained in the context of density functional theory and the Berry-phase theory of electric polarization using large periodic supercells. We report composition-dependent values of piezoelectric coefficients e(ij), piezoelectric moduli d(ij) and elastic constants C(ij). The theoretical findings are complemented with experimental measurement of e33 for a series of sputtered ScAlN films carried out with a piezoelectric resonator. The rapid increase with Sc content of the piezoelectric response reported in previous studies is confirmed for the available data. A detailed description of the full methodology required to calculate the piezoelectric properties of ScAlN, with application to other complex alloys, is presented. In particular, we find that the large amount of internal strain present in ScAlN and its intricate relation with electric polarization make configurational sampling and the use of large supercells at different compositions necessary in order to accurately derive the piezoelectric response of the material.

  18. REVIEW OF ALTERNATIVE ENHANCED CHEMICAL CLEANING OPTIONS FOR SRS WASTE TANKS

    Energy Technology Data Exchange (ETDEWEB)

    Hay, M.; Koopman, D.

    2009-08-01

    A literature review was conducted to support the Task Technical and Quality Assurance Plan for Alternative Enhanced Chemical Cleaning (AECC) for sludge heel removal funded as part of the EM-21 Engineering and Technology program. The goal was to identify potential technologies or enhancements to the baseline oxalic acid cleaning process for chemically dissolving or mobilizing Savannah River Site (SRS) sludge heels. The issues with the potentially large volume of oxalate solids generated from the baseline process have driven an effort to find an improved or enhanced chemical cleaning technology for the tank heels. This literature review builds on a previous review conducted in 2003. A team was charged with evaluating the information in these reviews and developing recommendations of alternative technologies to pursue. The new information in this report supports the conclusion of the previous review that oxalic acid remains the chemical cleaning agent of choice for dissolving the metal oxides and hydroxides found in sludge heels in carbon steel tanks. The potential negative impact of large volumes of sodium oxalate on downstream processes indicates that the amount of oxalic acid used for chemical cleaning needs to be minimized as much as possible or the oxalic acid must be destroyed prior to pH adjustment in the receipt tank. The most straightforward way of minimizing the volume of oxalic acid needed for chemical cleaning is through more effective mechanical cleaning. Using a mineral acid to adjust the pH of the sludge prior to adding oxalic acid may also help to minimize the volume of oxalic acid used in chemical cleaning. If minimization of oxalic acid proves insufficient in reducing the volume of oxalate salts, several methods were found that could be used for oxalic acid destruction. For some waste tank heels, another acid or even caustic treatment (or pretreatment) might be more appropriate than the baseline oxalic acid cleaning process. Caustic treatment of high

  19. Water-level change, High Plains aquifer, 1980 to 1995

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This raster data set represents water-level change in the High Plains aquifer of the United States from 1980 to 1995, in feet. The High Plains aquifer underlies...

  20. Water-level change, High Plains aquifer, 1995 to 2000

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This raster data set represents water-level change in the High Plains aquifer of the United States from 1995 to 2000, in feet. The High Plains aquifer underlies...

  1. Water-level change, High Plains aquifer, 2005 to 2009

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This raster data set represents water-level change in the High Plains aquifer of the United States from 2005 to 2009, in feet. The High Plains aquifer underlies...

  2. Water-level change, High Plains aquifer, 2000 to 2005

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This raster data set represents water-level change in the High Plains aquifer of the United States from 2000 to 2005, in feet. The High Plains aquifer underlies...

  3. Diagnostic performances of the S.R.S. (scintigraphy of somatostatin receptors) and of the PET-F.D.G. in the extension situation of the well differentiated endocrine carcinomas at high Ki67; Performances diagnostiques de la SRS et de la TEP-FDG dans le bilan d'extension des carcinomes endocrines bien differencies a Ki67 eleve ({>=} 10%)

    Energy Technology Data Exchange (ETDEWEB)

    Abgrala, R.; Leboulleux, S.; Deandreis, D.; Lumbroso, J.; Schlumberger, M.; Baudin, E. [Medecine nucleaire, institut Gustave-Roussy, Villejuif, (France); Auperin, A. [Biostatistiques, Institut Gustave-Roussy, Villejuif, (France); Dromain, C. [radiologie, institut Gustave-Roussy, Villejuif, (France); Guigay, J. [pneumologie, institut Gustave-Roussy, Villejuif, (France); Ducreux, M. [hepato-gastroenterologie, Institut Gustave-Roussy, Villejuif, (France)

    2009-05-15

    The results suggest that among 90% of patients with well differentiated endocrine carcinomas at high Ki, the PET-F.D.G. is more noticeable or equivalent to the scintigraphy of somatostatin receptors (S.R.S.). (N.C.)

  4. Alternative Chemical Cleaning Methods for High Level Waste Tanks: Actual Waste Testing with SRS Tank 5F Sludge

    Energy Technology Data Exchange (ETDEWEB)

    King, William D. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Hay, Michael S. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-08-30

    Solubility testing with actual High Level Waste tank sludge has been conducted in order to evaluate several alternative chemical cleaning technologies for the dissolution of sludge residuals remaining in the tanks after the exhaustion of mechanical cleaning and sludge sluicing efforts. Tests were conducted with archived Savannah River Site (SRS) radioactive sludge solids that had been retrieved from Tank 5F in order to determine the effectiveness of an optimized, dilute oxalic/nitric acid cleaning reagent toward dissolving the bulk non-radioactive waste components. Solubility tests were performed by direct sludge contact with the oxalic/nitric acid reagent and with sludge that had been pretreated and acidified with dilute nitric acid. For comparison purposes, separate samples were also contacted with pure, concentrated oxalic acid following current baseline tank chemical cleaning methods. One goal of testing with the optimized reagent was to compare the total amounts of oxalic acid and water required for sludge dissolution using the baseline and optimized cleaning methods. A second objective was to compare the two methods with regard to the dissolution of actinide species known to be drivers for SRS tank closure Performance Assessments (PA). Additionally, solubility tests were conducted with Tank 5 sludge using acidic and caustic permanganate-based methods focused on the “targeted” dissolution of actinide species.

  5. SU-E-T-38: A Head to Head Comparison of Two Commercial Phantoms Used for SRS QA

    Energy Technology Data Exchange (ETDEWEB)

    Sarkar, V; Huang, L; Huang, Y; Szegedi, M; Rassiah-Szegedi, P; Zhao, H; Salter, B [University of Utah Huntsman Cancer Institute, Salt Lake City, UT (United States)

    2015-06-15

    Purpose: To compare and contrast two commercial SRS QA phantoms. Methods: Both phantoms were evaluated in terms of their ease of setup as well as the time required to switch inserts for different tests. They were both used to evaluate the coincidence of the radiation and laser isocenters of a linear accelerator. End-to-end dosimetric tests were also performed using both ion chambers and films along two planes through the center of the phantoms. Since one phantom allows for multiple ion chamber orientations, a test was also performed to determine the effect of having the chamber oriented along the radiation beam axis’. Results: Changing inserts took 2 minutes on average for one phantom compared to 5 minutes for the other. The laser/radiation isocenter coincidence as determined from each phantom showed a maximum difference of 0.2mm. Ion chamber results were within 0.5% of the expected values when the chamber was perpendicular to the beams but measured a 3% underdose when the chamber was along the beam direction. Gamma (2%,2mm) pass rates of corresponding films were within 1% between phantoms. Conclusion: The results of the corresponding tests run on both phantoms were comparable, showing that the phantoms were equivalent for the subset of SRS QA tests run here. However, the under dose observed when the chamber was parallel to the beam direction suggests that this configuration should be avoided.

  6. Optimization of Saltcake Removal Flowsheet at SRS through Incorporation of Testing and In-Tank Waste Experience

    Energy Technology Data Exchange (ETDEWEB)

    Hansen, Adam G. [Savannah River Remediation, LLC., Aiken, SC (United States); Tihey, John R. [Savannah River Remediation, LLC., Aiken, SC (United States)

    2015-01-15

    Saltcake removal at SRS may be performed for several reasons: to provide space for evaporator operation (i.e., to precipitate more salt in the drop tank), to provide feed for salt processing (i.e. immobilize the waste), or to remove the salt for tank closure. Many different salt dissolution techniques have been employed in the 40 years that SRS has been performing salt removal, from a basic “Add, Sit, Remove” method (water is added on top of the saltcake and time is allowed for diffusion), to performing interstitial liquid removal, or using mixing devices to promote contact with the liquid. Lessons learned from previous saltcake removal campaigns, in addition to testing and modeling, have led to opportunities for improvements to the overall saltcake removal process. This includes better understanding of salt properties and behavior during dissolution; the primary concerns for salt dissolution are the release of radiolytic hydrogen and criticality prevention (post-dissolution). Recent developments in salt dissolution include the reuse of dilute supernate and a semi-continuous dissolution (SCD) process, where low volume mixing eductors are used to deliver water near the surface of the saltcake at the same rate as the salt solution is removed and transferred to a receipt tank.

  7. Heavy metal removal and recovery using microorganisms. Volume 1, State-of-the-art and potential applications at the SRS

    Energy Technology Data Exchange (ETDEWEB)

    Wilde, E.W. [Westinghouse Savannah River Co., Aiken, SC (United States); Benemann, J.R. [Benemann (J.R.), Pinole, CA (United States)

    1991-02-01

    Microorganisms -- bacteria, fungi, and microalgae -- can accumulate relatively large amounts of toxic heavy metals and radionuclides from the environment. These organisms often exhibit specificity for particular metals. The metal content of microbial biomass can be a substantial fraction of total dry weight with concentration factors (metal in dry biomass to metal in solution) exceeding one million in some cases. Both living and inert (dead) microbial biomass can be used to reduce heavy metal concentrations in contaminated waters to very low levels -- parts per billion and even lower. In many respects (e.g. specificity, residual metal concentrations, accumulation factors, and economics) microbial bioremoval processes can be superior to conventional processes, such as ion exchange and caustic (lime or hydroxide) precipitation for heavy metals removal from waste and contaminated waters. Thus, bioremoval could be developed to contribute to the clean-up of wastes at the Savannah River Site (SRS) and other DOE facilities. However, the potential advantages of bioremoval processes must still be developed into practical operating systems. A detailed review of the literature suggests that appropriate bioremoval processes could be developed for the SRS. There is great variability from one biomass source to another in bioremoval capabilities. Bioremoval is affected by pH, other ions, temperature, and many other factors. The biological (living vs. dead) and physical (immobilized vs. dispersed) characteristics of the biomass also greatly affect metal binding. Even subtle differences in the microbial biomass, such as the conditions under which it was cultivated, can have major effects on heavy metal binding.

  8. Experience with OpenMP for MADX-SC

    Energy Technology Data Exchange (ETDEWEB)

    D' Imperio, Nicholas [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Montag, Christophe [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Yu, Kwangmin [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Kapin, Valery [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); McIntosh, Eric [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Renshall, Harry [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Schmidt, Frank [European Organization for Nuclear Research (CERN), Geneva (Switzerland)

    2014-07-01

    MADX-SC allows the treatment of frozen space charge using beam-beam elements in a thin lattice, i.e. one can take advantage of the standard set-up of MAD-X lattices without the need for specialized codes for the space-charge (SC) evaluation. The idea is to simulate over many turns without the problem of noise as in the PIC SC codes. For the examples under study, like the PS and RHIC, it would be desirable to simulate up to 1 million turns or more. To this end one had to make an effort to optimize the scalar speed and, most importantly, get a speed-up of approximately a factor of 5 using OpenMP.

  9. Estudo medico da hemoglobinopatia SC em negroides paulistas

    OpenAIRE

    Raquel Ribeiro Gomes

    1988-01-01

    Resumo: A hemoglobinopatia SC é a segunda síndrome falcêmica mais importante no Brasil, devido à sua significativa prevalência entre negróides e também pelas manifestações clínicas apresentadas Apesar disso, ela tem sido pouco estudada em nosso país, não existindo na literatura nacional nenhum trabalho específico sobre essa doença. No presente trabalho, procurou-se investigar o significado médico da doença SC no Estado de são Paulo, analisando-se dois tipos de casuísticas de pacientes SC. Em ...

  10. Experience with OpenMP 1 for MADX-SC

    CERN Document Server

    D’Imperio, N; Yu, K; Kapin, V; McIntosh, E; Renshall, H; Schmidt, F

    2014-01-01

    MADX-SC [1–3] allows the treatment of frozen space charge using beam-beam elements in a thin lattice, i.e. one can take advantage of the standard set-up of MAD-X [4] lattices without the need for specialized codes for the space-charge (SC) evaluation. The idea is to simulate over many turns without the problem of noise as in the PIC 1 SC codes. For the examples under study, like the PS and RHIC, it would be desirable to simulate up to 1 million turns or more. To this end one had to make an effort to optimize the scalar speed and, most importantly, get a speed-up of approximately a factor of 5 using OpenMP [5].

  11. Transport of one SC coil through the village of Meyrin

    CERN Multimedia

    1956-01-01

    In 1952, before CERN was officially founded, two accelerator projects were launched: one for an innovative accelerator to operate at an energy level unequalled at the time, the other for a more standard machine, a Synchro-Cyclotron (SC) to operate at 600 MeV. Design work on the SC was started in 1952 and carried out by teams scattered throughout Europe. Once construction began in 1954, CERN had to arrange road transport for the first of what has since been a long series of spectacular component deliveries, such as those of the machine's two magnetic coils each weighing 60 tonnes and measuring 7.2 metres in diameter. Above, one of them is seen passing through the village of Meyrin. The SC was commissioned in 1957 and was operational for 34 years!

  12. Synthesis and structure of perovskite ScMnO3.

    Science.gov (United States)

    Chen, Haiyan; Yu, Tian; Gao, Peng; Bai, Jianming; Tao, Jing; Tyson, Trevor A; Wang, Liping; Lalancette, Roger

    2013-08-19

    The rare-earth manganites RMnO3 (R = rare earth) are a class of important multiferroics with stable hexagonal structures for small R ion radius (Sc, Lu, Yb, ...). Metastable perovskite phases of these systems possess intriguing electronically driven electrical polarization, but the synthesis of the perovskite phase for the end member ScMnO3 system has proven to be elusive. We report the structure of a new monoclinic P2(1)/n perovskite phase of ScMnO3 synthesized from the hexagonal phase under high-pressure and high-temperature conditions. This extends the small ion region for so-called E-phase electronically driven ferroelectric manganese perovsites.

  13. The {\\sc Majorana Demonstrator} Neutrinoless Double-Beta Decay Experiment

    CERN Document Server

    Abgrall, N; Avignone, F T; Barabash, A S; Bertrand, F E; Boswell, M; Brudanin, V; Busch, M; Caldwell, A S; Chan, Y-D; Christofferson, C D; Combs, D C; Detwiler, J A; Doe, P J; Efremenko, Yu; Egorov, V; Ejiri, H; Elliott, S R; Esterline, J; Fast, J E; Finnerty, P; Fraenkle, F M; Galindo-Uribarri, A; Giovanetti, G K; Goett, J; Green, M P; Gruszko, J; Guiseppe, V E; Gusey, K; Hallin, A L; Hazama, R; Hegai, A; Henning, R; Hoppe, E W; Howard, S; Howe, M A; Keeter, K J; Kidd, M F; Knecht, A; Kochetov, O; Konovalov, S I; Kouzes, R T; LaFerriere, B D; Leon, J; Leviner, L E; Loach, J C; MacMullin, S; Martin, R D; Mertens, S; Mizouni, L; Nomachi, M; Orrell, J L; O'Shaughnessy, C; Overman, N R; Phillips, D G; Poon, A W P; Pushkin, K; Radford, D C; Rielage, K; Robertson, R G H; Ronquest, M C; Schubert, A G; Shanks, B; Shima, T; Shirchenko, M; Snavely, K J; Snyder, N; Steele, D; Strain, J; Suriano, A M; Thompson, J; Timkin, V; Tornow, W; Varner, R L; Vasilyev, S; Vetter, K; Vorren, K; White, B R; Wilkerson, J F; Xu, W; Yakushev, E; Young, A R; Yu, C-H; Yumatov, V

    2013-01-01

    The {\\sc Majorana Demonstrator will search for the neutrinoless double-beta decay of the isotope Ge-76 with a mixed array of enriched and natural germanium detectors. The observation of this rare decay would indicate the neutrino is its own antiparticle, demonstrate that lepton number is not conserved, and provide information on the absolute mass scale of the neutrino. The {\\sc Demonstrator} is being assembled at the 4850-foot level of the Sanford Underground Research Facility in Lead, South Dakota. The array will be situated in a low-background environment and surrounded by passive and active shielding. Here we describe the science goals of the {\\sc Demonstrator} and the details of its design.

  14. Necrotizing fasciitis : plain radiographic and CT findings

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Chang Dae; Park, Jeong Hee; Jeon, Hae Jeong; Lim, Jong Nam; Heo, Tae Haeng; Park, Dong Rib [Konkuk Univ. College of Medicine, Seoul (Korea, Republic of)

    1996-11-01

    To evaluate the plain radiographic and CT findings of the necrotizing fasciitis. We retrospectively reviewed the radiologic findings of 4 cases with necrotizing fasciitis. Three cases were proven pathologically. We evaluated pattern and extent of the gas shadows in plain films. CT findings were analysed, with emphasis on : (a) gas pattern, (b) extent, (c) location and involved site, (d) associated focal abscess, and (e) swelling of the adjacent muscles. On plain radiographs, four cases showed streaky or mottled gas densities in the pelvis, three cases in the perineum, one case in the abdomen, and two cases in the thigh. On CT images, gas pattern was mottled and streaky appearance with swelling of the adjacent muscles. Gas shadows located in the extraperitoneal space in four cases, fascial layer in four cases, and subcutaneous layer in four cases. There were gas shadows in pelvic wall, perineum, abdominal wall, buttock, thigh, and scrotum. Focal low density lesion suggestive of focal abscess was not visualized. Plain radiography is useful for early diagnosis of the necrotizing fasciitis and CT is very useful for detection of precise location and extent of the disease. CT is also useful for differentiation of necrotizing fasciitis from focal abscess and cellulitis.

  15. Porosity Prediction of Plain Weft Knitted Fabrics

    Directory of Open Access Journals (Sweden)

    Muhammad Owais Raza Siddiqui

    2014-12-01

    Full Text Available Wearing comfort of clothing is dependent on air permeability, moisture absorbency and wicking properties of fabric, which are related to the porosity of fabric. In this work, a plug-in is developed using Python script and incorporated in Abaqus/CAE for the prediction of porosity of plain weft knitted fabrics. The Plug-in is able to automatically generate 3D solid and multifilament weft knitted fabric models and accurately determine the porosity of fabrics in two steps. In this work, plain weft knitted fabrics made of monofilament, multifilament and spun yarn made of staple fibers were used to evaluate the effectiveness of the developed plug-in. In the case of staple fiber yarn, intra yarn porosity was considered in the calculation of porosity. The first step is to develop a 3D geometrical model of plain weft knitted fabric and the second step is to calculate the porosity of the fabric by using the geometrical parameter of 3D weft knitted fabric model generated in step one. The predicted porosity of plain weft knitted fabric is extracted in the second step and is displayed in the message area. The predicted results obtained from the plug-in have been compared with the experimental results obtained from previously developed models; they agreed well.

  16. The geologic story of the Great Plains

    Science.gov (United States)

    Trimble, Donald E.

    1980-01-01

    The Great Plains! The words alone create a sense of space and a feeling of destiny a challenge. But what exactly is this special part of Western America that contains so much of our history? How did it come to be? Why is it different?

  17. Pedogeographic regionalization of the Pomurje plain

    Directory of Open Access Journals (Sweden)

    Franc Lovrenčak

    1991-12-01

    Full Text Available The paper deals with the pedogeographic regionalization of the Pomurje plain (Northeast Slovenia. With regard to differences in parent material, landforms, and hydrographic characteristics, the soil cover is ranked into two pedogeographic regions. Each of them is furthermore divided into several subregions grouped together according to related soil groups.

  18. Great plains regional climate assessment technical report

    Science.gov (United States)

    The Great Plains region (GP) plays important role in providing food and energy to the economy of the United States. Multiple climatic and non-climatic stressors put multiple sectors, livelihoods and communities at risk, including agriculture, water, ecosystems and rural and tribal communities. The G...

  19. 49 CFR 230.102 - Tender plain bearing journal boxes.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Tender plain bearing journal boxes. 230.102... Locomotives and Tenders Running Gear § 230.102 Tender plain bearing journal boxes. Plain bearing journal boxes... expected to damage the bearing; or have a detrimental effect on the lubrication of the journal and...

  20. Thermoelectric performance of functionalized Sc2C MXenes

    KAUST Repository

    Kumar, S.

    2016-07-05

    Functionalization of the MXene Sc2C, which has the rare property to realize semiconducting states for various functionalizations including O, F, and OH, is studied with respect to the electronic and thermal behavior. The lowest lattice thermal conductivity is obtained for OH functionalization and an additional 30% decrease can be achieved by confining the phonon mean free path to 100 nm. Despite a relatively low Seebeck coefficient, Sc2C(OH)2 is a candidate for intermediate-temperature thermoelectric applications due to compensation by a high electrical conductivity and very low lattice thermal conductivity.

  1. Determination of Sc by Ion-exchanger Colorimetry

    Institute of Scientific and Technical Information of China (English)

    1999-01-01

    Ion-exchanger colorimetry for scandium in the form of ternary color system "Sc(Ⅲ)-CPA-pc-Ac" was developed. The influences of types and grain sizes of resin, adsorption modes and the acidity on the determination were studied systematically, and the optimum operating conditions and the allowable amounts of foreign ions were determined. In comparison with the ordinary solution colorimetry, both of the sensitivity and the selectivity of this ion-exchanger colorimetry are improved obviously. The preliminary uses of this method to the determination of Sc(Ⅲ) in two synthetic samples were satisfied.

  2. Product policy of SC Electrecord S.A.

    Directory of Open Access Journals (Sweden)

    Ph. D. Candidate Cristina Andreescu (Manolache

    2009-12-01

    Full Text Available The global brand has the advantage of the scale economy, facilitates the company image and prestige and sometimes benefits even from its origin country effect. Its use is quite difficult (the semantic variations can impede the use of the same brand. The international brands act as a restriction against standardisation (the product should not be differentiated as there are internationally accepted and recognized brands. This paper makes an overview description of the general market environment, but also of the arket environment of SC ELECTRECORD S.A.; it underlines the product characteristics as well as the commercial diagnosis within SC ELECTRECORD S.A.

  3. Bayesian narrowband interference mitigation in SC-FDMA

    KAUST Repository

    Ali, Anum

    2015-08-12

    This paper presents a novel narrowband interference (NBI) mitigation scheme for SC-FDMA systems. The proposed scheme exploits the frequency domain sparsity of the unknown NBI signal and adopts a low complexity Bayesian sparse recovery procedure. In practice, however, the sparsity of the NBI is destroyed by a grid mismatch between NBI sources and SC-FDMA system. Towards this end, an accurate grid mismatch model is presented and a sparsifying transform is utilized to restore the sparsity of the unknown signal. Numerical results are presented that depict the suitability of the proposed scheme for NBI mitigation.

  4. Radiation protection Group (SC/RP) desperately seeking...

    CERN Multimedia

    A. Hervé, Y. Donjoux / SC

    2006-01-01

    We are trying to trace two transit permits (passavants), which constitute the customs clearance documentation for two 'AD6'portable radiation detectors. The two permits (No. 1308 and No. 1309) were sent in the same internal mail envelope towards the middle of March 2006 but never reached their final destination. After weeks of searching in vain, we are now appealing for your help. If you have these two permits in your possession, please get in touch with us. Many thanks in advance. A.HERVE - SC/RP- ( 163168 / 70927) Y.DONJOUX - SC/RP - (160105 / 73171)

  5. Optical Mixing Controlled Stimulated Scattering instabilities: Suppression of SRS by the Controlled Introduction of Ion Acoustic and Electron Plasma Wave Turbulence

    CERN Document Server

    Afeyan, Bedros; Won, K; Montgomery, D S; Hammer, J; Kirkwood, R K; Schmitt, A J

    2012-01-01

    In a series of experiments on the Omega laser facility at LLE, we have demonstrated the suppression of SRS in prescribed spectral windows due to the presence of externally controlled levels of ion acoustic waves (IAW, by crossing two blue beams at the Mach -1 surface) and electron plasma waves (EPW, by crossing a blue and a green beam around a tenth critical density plasma) generated via optical mixing. We have further observed SRS backscattering of a green beam when crossed with a blue pump beam, in whose absence, that (green beam) backscattering signature was five times smaller. This is direct evidence for green beam amplification when crossed with the blue. Additional proof comes from transmitted green beam measurements. A combination of these techniques may allow the suppression of unacceptable levels of SRS near the light entrance hole of large-scale hohlraums on the NIF or LMJ.

  6. A pictoral review on somatostatin receptor scintigraphy in neuroendocrine tumors: The role of multimodality imaging with SRS and GLUT receptor imaging with FDG PET-CT

    Directory of Open Access Journals (Sweden)

    Sneha Shah

    2012-01-01

    Full Text Available Somatostatin receptor scintigraphy is considered as a comprehensive imaging modality for many neuroendocrine tumors. Multiple radiotracers using combinations of gamma or positron emitting radionuclides and tracers are now available. Newer radiopharmaceuticals using 99m Tc labeled with TOC, TATE, NOC are good alternatives to the 68 - Gallium radiotracers where the PET facility is not available. The pictoral depicts the role of SRS using 99m TC - HYNIC -TOC radiotracers in staging and treatment planning of NETs. Characterization of the tumor biology using combined SRS and FDG PET/CT is also demonstrated with a proposed categorization method. The emerging role of SRS in tailored targeted radionuclide therapy is outlined in brief.

  7. Tetrahedron dynamics in the icosahedral quasicrystals i-ZnMgSc and i-ZnAgSc and the cubic 1/1-approximant Zn6Sc.

    Science.gov (United States)

    Euchner, H; Yamada, T; Rols, S; Ishimasa, T; Kaneko, Y; Ollivier, J; Schober, H; Mihalkovic, M; de Boissieu, M

    2013-03-20

    A comparison of periodic approximants and their quasicrystalline counterparts offers the opportunity to better understand the structure, physical properties and stabilizing mechanisms of these complex phases. We present a combined experimental and molecular dynamics study of the lattice dynamics of the icosahedral quasicrystals i-ZnMgSc and i-ZnAgSc and compare it to recently published results obtained for the cubic 1/1-approximant Zn(6)Sc. Both phases, quasicrystal and approximant, are built up from large atomic clusters which contain a tetrahedral shell at the cluster centre and are packed either quasiperiodically or on a bcc lattice. Using quasielastic neutron scattering and atomic scale simulations, we show that in the quasicrystal the tetrahedra display a dynamics similar to that observed in the 1/1-approximant: the tetrahedra behave as a 'single molecule' and reorient dynamically on a timescale of the order of a few ps. The tetrahedra reorientation is accompanied by a large distortion of the surrounding cluster shells which provide a unique dynamical flexibility to the quasicrystal. However, whereas in the 1/1-approximant the tetrahedron reorientation is observed down to T(c) = 160 K, where a phase transition takes place, in the quasicrystal the tetrahedron dynamics is gradually freezing from 550 to 300 K, similarly to a glassy system.

  8. Analysis Results for Sub-Samples of SRS Tanks 30, 32, and 39 to Support Evaluations of the I-129 Inventory

    Energy Technology Data Exchange (ETDEWEB)

    King, W. D. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2017-01-11

    In order to appropriately model and predict the chemical integrity and performance of cementitious materials used for waste immobilization at the Savannah River Site (SRS), it is critical to understand the I-129 solubility and distribution within the tank farm. Iodine in radioactive waste and in environmental media is typically highly mobile and long lived. Iodine is ubiquitous in SRS tank waste and waste forms. The iodine is assumed to be soluble and present at low levels in Performance Assessments (PAs) for SRS Tank Farms, and is one of the dose drivers in the PAs for both the SRS Salt Disposal Facility (SDF) and the H-Area Tank Farm (HTF). Analysis of tank waste samples is critical to understanding the Tank Farm iodine inventory and reducing disposal uncertainty. Higher than expected iodine levels have recently been observed in residual solids isolated from some SRS tanks prior to closure, indicating uncertainty regarding the chemical species involved. If the iodine inventory uncertainty is larger than anticipated, future work may be necessary to reduce the uncertainty. This memorandum satisfies a portion of the work scope identified in Task Plan SRNL-RP-2016-00651. A separate memorandum issued previously, reported historical unpublished I-129 data, a significant portion of which was below detectable analytical limits. This memorandum includes iodine and general chemical analysis results for six archived SRNL samples which were previously reported to have I-129 concentrations below detectable limits. Lower sample dilution factors were used for the current analyses in order to obtain concentrations above detection. The samples analyzed included surface and depth samples from SRS tanks 30, 32, and 39.

  9. Geomorphological development of Eastern Mongolian plain, Mongolia

    Science.gov (United States)

    khukhuudei, Ulambadrakh; otgonbayar, Orolzodmaa

    2016-04-01

    Several summaries and investigations of the geomorphological description and feature for Eastern Mongolian plain (EMP), the one of the largest geomorphological district, fully covering east side of Mongolia (Murzayev, 1949; Vlodavets, 1950, 1955; Marinov, Khasin, 1954; Marinov, 1966; Nikolayeva, 1971; Selivanov, 1972; Chichagov, 1974, 1976; Grigorov, 1975; Korjuyev, 1982; Syirnev, 1982, 1984) had been publishing continuously. But literature for geomorphology of EMP have been not appeared during over the past 20 years. However, we re-combine the geomorphological development of EMP, according to the results of many publications for surrounding regions of Russia and China and unpublished maps. Main morphology of EMP has the plain, containing with aeolian, fluvial and lacustrine landforms. Plain morphology defined that denudation plains to North Kherlen, South Kherlen, Baruun Urt, Uulbayan, Delgerekh and other which developed on the Paleozoic rocks, layered plain to Choibalsan, Tamsag, Ongon, Gert, Sumiin nuur and Torey- on the Late Cretaceous and Neogene sediments and accumulation plain with alluvial and lacustrine origin such as Menen, Buir nuur, Tamsagbulag, Khalzan and other. These plains of EMP related with tectonics and structure of region and inherited the development of the Mesozoic, particularly Late Mesozoic structure. Large basins of EMP are Tamsag, Choibalsan and Torey and other small basins - from 7-10 km to 25-30 km width and rather a several 10 km extend, cutting a basement. The origin of plain morphology for EMP is interpreted as two main stages of the geomorphological development model, based on geology. In first stage or Late Jurassic (?) - Lower Cretaceous period, there was developed rift basin, then, in second stage or since Late Cretaceous period, plain morphology originated from the intermountain basin that dominated by exogenic process and kept in current EMP area. Data relevant to the development history of EMP are following. 1. Rift volcanism

  10. Change of ancient hydrology net in Northeast China Plain

    Institute of Scientific and Technical Information of China (English)

    Hui QU; Yu CHU; Fenglong ZHANG; Fuli QI; Xiangkui YANG

    2006-01-01

    Comparing with lithofacies palaeogeography of several great plains, the authors analyzed four great plains in Quaternary diastrophism, the sedimentary facies, sedimentary environment and their evolution from the independent embryonic and river system of ancient Heilongjiang finally to the Halar highland, Songnen Plain, Sanjiang Plain, the Xingkai Lake Plain and various river systems, collected the unification outside the system of Heilongjiang River to release into the sea, south ancient Xialiao River finally piracy Dongliao River, Xialiao River had released into the sea the ancient water law vicissitude and the evolved rule.

  11. TAILORING INORGANIC SORBENTS FOR SRS STRONTIUM AND ACTINIDE SEPARATIONS: MODIFIED MONOSODIUM TITANATE PHASE III FINAL REPORT

    Energy Technology Data Exchange (ETDEWEB)

    Taylor-Pashow, K.; Hobbs, D.

    2010-09-01

    a total dose of 3.95 x 10{sup 6} R, indicated little to no affect on the performance of the material to remove Sr and actinides. Previous testing established that mMST releases oxygen gas during the synthesis, and continues to off-gas during storage post synthesis. The post-synthesis gas release rate was measured under several conditions, including varying the pH of the wash water and at elevated temperature (49 C, typical of bounding summertime storage without air conditioning). Results indicated that a high pH (basic) wash reduced the initial gas release rate, but after 2 days the release rates from all different pH washed samples were not statistically different. The gas release rate at 49 C, a temperature at which the material may be exposed to during shipping and storage, was consistently about 2.5 times higher than the rate at room temperature. All gas release results indicated that vented containers would be necessary for shipping and storage of large quantities of material. Suspension of sorbate-loaded solids into diluted solutions representing intermediate and final stages of washing for 24-hours revealed no evidence of desorption of Sr, Pu or Np from the mMST solids. Based on the results of the Phase III testing as well as that from earlier studies (Phases I and II), SRNL researchers recommend adopting the use of the mMST material for the removal of strontium and actinides from the SRS HLW supernatant liquids in the Actinide Removal Process and Salt Waste Processing Facility. Given the decrease in Sr and Pu removal performance for the mMST having an age of 4 years and 8 months, we recommend that mMST be used within 30 months of production. Furthermore we recommend that DOE provide funding to conduct pilot-scale testing of the mixing and settling characteristics of the mMST and impact, if any, on the generation of hydrogen during processing in the Defense Waste Processing Facility (DWPF).

  12. Genome Sequence of Herpes Simplex Virus 1 Strain SC16

    Science.gov (United States)

    Rastrojo, Alberto; López-Muñoz, Alberto Domingo

    2017-01-01

    ABSTRACT Herpes simplex virus 1 (HSV-1), also known as Human herpesvirus 1, is a highly prevalent human neurotropic pathogen that causes a variety of diseases, including lethal encephalitis. Here, we report the genome sequence of the HSV-1 strain SC16. PMID:28126930

  13. Calibration of the DLP-SC-3300-02 probe

    DEFF Research Database (Denmark)

    Pivnenko, Sergey; Breinbjerg, Olav

    This report douments the calibration measurement of the DLP-SC-3300-02 dual-linearly polarized near-field probe. The measurement comprises radiation pattern, diretivity, gain, spetra of spherial wave coefients, polarization charateristis, and complex channel balance at 41 frequencies, as well...

  14. Programmable SC biquad using one single capacitor bank

    OpenAIRE

    Torralba Silgado, Antonio Jesús; Pérez Vega-Leal, Alfredo; García Franquelo, Leopoldo

    2001-01-01

    This paper presents a new technique for programming SC circuits using a single time-multiplexed capacitor bank, achieving a significant reduction in capacitance area. Simulation results of a programmable biquad low pass filter show the validity of the proposed method.

  15. Toelating Herbasan SC welkom voor dahlia, A. coronaria en narcis

    NARCIS (Netherlands)

    Leeuwen, van P.J.; Koster, A.T.J.; Trompert, J.P.T.

    2005-01-01

    Onlangs is Herbasan SC voor de onkruidbestrijding in onder meer dahlia, narcis en Anemone coronaria toegelaten. PPO ging na hoe het middel het beste is in te zetten. In dit artikel zijn de resultaten van het onderzoek vermeld en een advies voor toepassing

  16. 78 FR 20369 - South Carolina Disaster #SC-00021

    Science.gov (United States)

    2013-04-04

    ... ADMINISTRATION South Carolina Disaster SC-00021 AGENCY: U.S. Small Business Administration. ACTION: Notice. SUMMARY: This is a notice of an Administrative declaration of a disaster for the State of South Carolina dated 03/29/2013. Incident: Windsor Green Condo Complex Fire. Incident Period: 03/16/2013....

  17. 77 FR 14700 - Safety Zones; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2012-03-13

    ... notice regarding our public dockets in the January 17, 2008, issue of the Federal Register (73 FR 3316... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zones; Swim Around Charleston, Charleston, SC... establish temporary moving safety zones during the Swim Around Charleston, a swimming race occurring on...

  18. 76 FR 38586 - Safety Zone; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2011-07-01

    ... Federal Register (73 FR 3316). Public Meeting We do not now plan to hold a public meeting. But you may... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Swim Around Charleston, Charleston, SC... establish a temporary moving safety zone during the Swim Around Charleston, a swimming race occurring...

  19. 78 FR 54583 - Safety Zone; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2013-09-05

    ..., telephone 202-366-9826. SUPPLEMENTARY INFORMATION: Table of Acronyms DHS Department of Homeland Security FR... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Swim Around Charleston, Charleston, SC... temporary moving safety zone during the Swim Around Charleston, a swimming race occurring on waters of...

  20. 77 FR 51471 - Safety Zone; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2012-08-24

    ... rulemaking (NPRM) entitled Safety Zone; Swim Around Charleston, Charleston, SC in the Federal Register (77 FR...: Table of Acronyms DHS Department of Homeland Security FR Federal Register NPRM Notice of Proposed... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Swim Around Charleston, Charleston,...

  1. South Carolina's SC LENDS: Optimizing Libraries, Transforming Lending

    Science.gov (United States)

    Hamby, Rogan; McBride, Ray; Lundberg, Maria

    2011-01-01

    Since SC LENDS started operating in June 2009, more public libraries have come on board. All of this on the back end connects to a Mozilla-based staff client that has distributions for Mac OS X and Microsoft Windows, using SSL encryption to keep communications secure and private between remote libraries and the servers hosted at a high-end…

  2. Envíos Confianza, S.C.

    OpenAIRE

    Banco Interamericano de Desarrollo (BID); S.C. Envíos Confianza

    2009-01-01

    Presentación acerca de Envíos Confianza, S.C., en el cual da a conocer su historia, misión, visión, valores, efecto de las remesas en comunidades e impacto de la crisis financiera. Además, señala la proyección para el 2009-2011.

  3. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    The catalogue contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short candidate projects as well as regular 3rd semester...... projects at the M.Sc. programme in Civil and Structural Engineering....

  4. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    The following pages contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short master projects as well as regular 3rd...... semester projects at the M.Sc. programme in Civil and Structural Engineering....

  5. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    This catalogue contains a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short candidate projects as well as regular 3rd...... semester projects at the M.Sc. programme in Civil and Structural Engineering....

  6. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    Clausen, Johan

    The report contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short candidate projects as well as regular 3rd semester...... projects at the M.Sc. programme in Civil and Structural Engineering....

  7. 44gSc from metal calcium targets for PET

    DEFF Research Database (Denmark)

    Severin, Gregory; Gagnon, K.; Engle, J. W.

    2012-01-01

    A low-cost and efficient method for producing pre-clinical scale quantities of 44gSc is presented. Production involves proton irradiation of natural unenriched calcium metal followed by rapid separation of radioscandium from the target using hydroxmate functionalized resin.© 2012 American Institu...

  8. Sensitivity and variability of Presage dosimeter formulations in sheet form with application to SBRT and SRS QA

    Energy Technology Data Exchange (ETDEWEB)

    Dumas, Michael, E-mail: mdumas1127@gmail.com [Department of Radiation Oncology, Wayne State University School of Medicine and Karmanos Cancer Institute Detroit, Detroit, Michigan 48201 and Department of Radiation Oncology, Henry Ford Hospital, Detroit, Michigan 48202 (United States); Rakowski, Joseph T. [Department of Radiation Oncology, Wayne State University School of Medicine and Karmanos Cancer Institute Detroit, Detroit, Michigan 48201 (United States)

    2015-12-15

    Purpose: To measure sensitivity and stability of the Presage dosimeter in sheet form for various chemical concentrations over a range of clinical photon energies and examine its use for stereotactic body radiation therapy (SBRT) and stereotactic radiosurgery (SRS) QA. Methods: Presage polymer dosimeters were formulated to investigate and optimize their sensitivity and stability. The dosimeter is composed of clear polyurethane base, leucomalachite green (LMG) reporting dye, and bromoform radical initiator in 0.9–1.0 mm thick sheets. The chemicals are mixed together for 2 min, cast in an aluminum mold, and left to cure at 60 psi for a minimum of two days. Dosimeter response was characterized at energies Co-60, 6 MV, 10 MV flattening-filter free, 15 MV, 50 kVp (mean 19.2 keV), and Ir-192. The dosimeters were scanned by a Microtek Scanmaker i800 at 300 dpi, 2{sup 16} bit depth per color channel. Red component images were analyzed with ImageJ and RIT. SBRT QA was done with gamma analysis tolerances of 2% and 2 mm DTA. Results: The sensitivity of the Presage dosimeter increased with increasing concentration of bromoform. Addition of tin catalyst decreased curing time and had negligible effect on sensitivity. LMG concentration should be at least as high as the bromoform, with ideal concentration being 2% wt. Gamma Knife SRS QA measurements of relative output and profile widths were within 2% of manufacturer’s values validated at commissioning, except the 4 mm collimator relative output which was within 3%. The gamma pass rate of Presage with SBRT was 73.7%, compared to 93.1% for EBT2 Gafchromic film. Conclusions: The Presage dosimeter in sheet form was capable of detecting radiation over all tested photon energies and chemical concentrations. The best sensitivity and photostability of the dosimeter were achieved with 2.5% wt. LMG and 8.2% wt. bromoform. Scanner used should not emit any UV radiation as it will expose the dosimeter, as with the Epson 10000 XL scanner

  9. SU-D-BRA-02: Motion Assessment During Open Face Mask SRS Using CBCT and Surface Monitoring

    Energy Technology Data Exchange (ETDEWEB)

    Williams, BB; Fox, CJ; Hartford, AC; Gladstone, DJ [Dartmouth-Hitchcock Medical Center, Lebanon, NH (Lebanon)

    2016-06-15

    Purpose: To assess the robustness of immobilization using open-face mask technology for linac-based stereotactic radiosurgery (SRS) with multiple non-coplanar arcs via repeated CBCT acquisition, with comparison to contemporaneous optical surface tracking data. Methods: 25 patients were treated in open faced masks with cranial SRS using 3–4 non-coplanar arcs. Repeated CBCT imaging was performed to verify the maintenance of proper patient positioning during treatment. Initial patient positioning was performed based on prescribed shifts and optical surface tracking. Positioning refinements employed rigid 3D-matching of the planning CT and CBCT images and were implemented via automated 6DOF couch control. CBCT imaging was repeated following the treatment of all non-transverse beams with associated couch kicks. Detected patient translations and rotations were recorded and automatically corrected. Optical surface tracking was applied throughout the treatments to monitor motion, and this contemporaneous patient positioning data was recorded to compare against CBCT data and 6DOF couch adjustments. Results: Initial patient positions were refined on average by translations of 3±1mm and rotations of ±0.9-degrees. Optical surface tracking corroborated couch corrections to within 1±1mm and ±0.4-degrees. Following treatment of the transverse and subsequent superior-oblique beam, average translations of 0.6±0.4mm and rotations of ±0.4-degrees were reported via CBCT, with optical surface tracking in agreement to within 1.1±0.6mm and ±0.6-degrees. Following treatment of the third beam, CBCT indicated additional translations of 0.4±0.2mm and rotations of ±0.3-degrees. Cumulative couch corrections resulted in 0.7 ± 0.4mm average magnitude translations and rotations of ±0.4-degrees. Conclusion: Based on CBCT measurements of patients during SRS, the open face mask maintained patient positioning to within 1.5mm and 1-degree with >95% confidence. Patient positioning

  10. Effect of Sc on Precipitation Hardening of AlSi6Mg Alloy

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    The effect of Sc on precipitation hardening of AlSi6Mg was studied. Zr was previously reported that it increased the effectiveness of Sc in wrought aluminum in many areas so Zr was also used together with Sc in this study.Different levels of Sc and Zr additions were added to AlSi6Mg before casting in the permanent mold. The samples were precipitation hardened at different aging temperatures and for various aging time before testing for tensile strength and hardness. It was found that Sc addition into Al6SiMg can change its response to age hardening. Additions of Sc and Sc with Zr increased both yield strength and hardness for both aging temperatures. In addition, Sc was found to modify eutectic Si to obtain fibrous morphology. This effect of Sc on eutectic silicon modification has never been reported before.

  11. Role of cell death in the propagation of PrP(Sc) in immune cells.

    Science.gov (United States)

    Takahashi, Kenichi; Inoshima, Yasuo; Ishiguro, Naotaka

    2015-03-01

    A number of studies have suggested that macrophages, dendritic cells, and follicular dendritic cells play an important role in the propagation of PrP(Sc). Both accumulation and proteolysis of PrP(Sc) have been demonstrated in peripheral macrophages. Macrophages may act as reservoirs for PrP(Sc) particles if the cells die during transient PrP(Sc) propagation. However, whether cell death plays a role in PrP(Sc) propagation in macrophages remains unclear. In this study, we investigated the possibility of propagation and transmission of PrP(Sc) between dead immune cells and living neural cells. We found that under specific conditions, transient PrP(Sc) propagation occurs in dead cells, indicating that interaction between PrP(C) and PrP(Sc) on plasma membrane lipid rafts might be important for PrP(Sc) propagation. Co-culturing of killed donor PrP(Sc)-infected macrophages with recipient N2a-3 neuroblastoma cells accelerated PrP(Sc) transmission. Our results suggest that cell death may play an important role in PrP(Sc) propagation, whereas transient PrP(Sc) propagation in macrophages has little effect on PrP(Sc) transmission.

  12. Update on the NSF PAARE Program at SC State

    Science.gov (United States)

    Walter, Donald K.; Ajello, Marco; Brittain, Sean D.; Cash, Jennifer; Hartmann, Dieter; Ho, Shirley; Howell, Steve B.; King, Jeremy R.; Leising, Mark D.; Smith, Daniel M.

    2017-01-01

    We report on results from our NSF PAARE program during Year 2 of the project. Our partnership under this PAARE award includes South Carolina State University (a Historically Black College/University), Clemson University (a Ph.D. granting institution) as well as individual investigators at NASA Ames and Carnegie Mellon University. Our recent work on variable and peculiar stars, work with the Kepler Observatory and our educational products in cosmology for non-STEM majors will be presented. We have successfully piloted sharing our teaching resources by offering an upper-level astrophysics course taught at Clemson via video conferencing , allowing a graduating senior from SC State to take a course not available through his home institution. Additionally, we are working on a memorandum of agreement between the two institutions that will allow for the seamless transfer of an undergraduate from SC State to Clemson’s graduate program in physics and astronomy. Our curriculum work includes new web-based cosmology activities and laboratory experiments. SC State undergraduates are reporting at this conference on their work with the light curves of semiregular variables using Kepler data. Additionally, we are heavily involved in the Citizen CATE Experiment. A PAARE scholarship student from SC State and the PAARE PI traveled to Indonesia for the March 2016 solar eclipse. Their results are also being presented elsewhere at this conference (see Myles McKay’s poster). Support for this work includes our NSF PAARE award AST-1358913 as well as resources and support provided by Clemson University and the National Optical Astronomy Observatory. Additional support has been provided by the South Carolina Space Grant Consortium and from NASA to SC State under awards NNX11AB82G and NNX13AC24G. CATE work has been supported by NASA SMD award NNX16AB92A to the National Solar Observatory. Additional details can be found at: http://physics.scsu.edu

  13. MODELING OF ION-EXCHANGE FOR CESIUM REMOVAL FROM DISSOLVED SALTCAKE IN SRS TANKS 1-3, 37 AND 41

    Energy Technology Data Exchange (ETDEWEB)

    Smith, F

    2007-08-15

    This report presents an evaluation of the expected performance of engineered Crystalline Silicotitanate (CST) and spherical Resorcinol-Formaldehyde (RF) ion exchange resin for the removal of cesium from dissolved saltcake in SRS Tanks 1-3, 37 and 41. The application presented in this report reflects the expected behavior of engineered CST IE-911 and spherical RF resin manufactured at the intermediate-scale (approximately 100 gallon batch size; batch 5E-370/641). It is generally believed that scale-up to production-scale in RF resin manufacturing will result in similarly behaving resin batches whose chemical selectivity is unaffected while total capacity per gram of resin may vary. As such, the predictions provided within this report should provide reasonable estimates of production-scale column performance. Two versions of the RF cesium isotherm were used. The older version provides a conservative estimate of the resin capacity while the newer version more accurately fits the most recent experimental data.

  14. DFT calculations of electronic and optical properties of SrS with LDA, GGA and mGGA functionals

    Science.gov (United States)

    Sharma, Shatendra; Sharma, Jyotsna; Sharma, Yogita

    2016-05-01

    The theoretical investigations of electronic and optical properties of SrS are made using the first principle DFT calculations. The calculations are performed for the local-density approximation (LDA), generalized gradient approximation (GGA) and for an alternative form of GGA i.e. metaGGA for both rock salt type (B1, Fm3m) and cesium chloride (B2, Pm3m) structures. The band structure, density of states and optical spectra are calculated under various available functional. The calculations with LDA and GGA functional underestimate the values of band gaps with all functional, however the values with mGGA show reasonably good agreement with experimental and those calculated by using other methods.

  15. Effect of solution treatment on the aging processes of Al-Sc alloys

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Toropova, L.S. (AN SSSR, Moscow. Inst. Metallurgii); Dutkiewicz, J.; Salawa, J. (Polish Academy of Sciences, Cracow. Inst. for Metal Research)

    1984-10-01

    The kinetics of aging process of two Al-Sc alloys containing 0.2 and 0.5 wt% Sc, respectively was investigated using electrical resistivity and hardness measurements. Transmission electron micrographs of quenched samples show Sc-rich precipitates, especially Al/sub 3/Sc precipitates. The addition of Sc to Al causes the strongest hardening effect during aging in relation to other alloying additions. Cast Al-Sc alloys and water quenched ones from solid solubility range show very similiar age-hardening curves.

  16. Assessment of ammonium, nitrate, phosphate, and heavy metal pollution in groundwater from Amik Plain, southern Turkey.

    Science.gov (United States)

    Ağca, Necat; Karanlık, Sema; Ödemiş, Berkant

    2014-09-01

    Amik Plain is one of the most important agricultural areas of Turkey. Because the groundwater resources have been used not only for irrigation but also for drinking purpose, groundwater resources play a vital role in this area. However, there exist no or a very limited number of studies on groundwater quality and its physicochemical and heavy metal composition for Amik Plain. This study aimed to assess groundwater of Amik Plain in terms of human health and suitability for irrigation based on physicochemical variables, heavy metals, and their spatial distribution. A total of 92 groundwater samples were collected from wells and were analyzed for temperature (T), salt content (SC), dissolved oxygen (DO), ammonium (NH4(+)), nitrate (NO3(-)), and phosphorus (P) and such heavy metals as cadmium (Cd), cobalt (Co), chromium (Cr), copper (Cu), iron (Fe), manganese (Mn), nickel (Ni), lead (Pb), and zinc (Zn). The temperature, SC, DO, NH4(+), and NO3(-) parameters were measured in situ immediately with YSI Professional plus instrument (Pro Plus). Water depth was taken from owner of the wells. Heavy metal analyses were carried out in triplicate using inductively coupled atomic emission spectrometer (ICP-AES). The ICP-AES was calibrated for all the metals by running different concentrations of standard solutions. Descriptive statistical analyses were calculated to characterize distribution of physicochemical properties and heavy metal contents of groundwater. Correlation analysis was used to assess the possible relationships among heavy metals and physicochemical properties of the groundwater. Spatial variability in groundwater parameters were determined by geostatistical methods. Result shows that the highest and lowest coefficient of variation occurred for NO3(-) and T, respectively. Mean water table depth was 92.1 m, and only 12 of all the samples exceeded the desirable limit of 50 mg/L for NO3(-) content. The metal concentrations showed a dominance in the order of Fe >

  17. Generation and immunity testing of a recombinant adenovirus expressing NcSRS2-NcGRA7 fusion protein of bovine Neospora caninum.

    Science.gov (United States)

    Jia, Li-Jun; Zhang, Shou-Fa; Qian, Nian-Chao; Xuan, Xue-Nan; Yu, Long-Zheng; Zhang, Xue-Mei; Liu, Ming-Ming

    2013-04-01

    Neospora caninum is the etiologic agent of bovine neosporosis, which affects the reproductive performance of cattle worldwide. The transmembrane protein, NcSRS2, and dense-granule protein, NcGRA7, were identified as protective antigens based on their ability to induce significant protective immune responses in murine neosporosis models. In the current study, NcSRS2 and NcGRA7 genes were spliced by overlap-extension PCR in a recombinant adenovirus termed Ad5-NcSRS2-NcGRA 7, expressing the NcSRS2-NcGRA7 gene, and the efficacy was evaluated in mice. The results showed that the titer of the recombinant adenovirus was 10(9)TCID50/ml. Three weeks post-boost immunization (w.p.b.i.), the IgG antibody titer in sera was as high as 1:4,096. IFN-γ and IL-4 levels were significantly different from the control group (P<0.01). This research established a solid foundation for the development of a recombinant adenovirus vaccine against bovine N. caninum.

  18. A case of Silver–Russell syndrome (SRS): multiple pituitary hormone deficiency, lack of H19 hypomethylation and favourable growth hormone (GH) treatment response

    Indian Academy of Sciences (India)

    Zoran S. Gucev; Velibor Tasic; Aleksandra Jancevska; Ilija Kirovski

    2009-08-01

    Hypomethylation of the imprinting control region 1 (ICR1) at the IGF2/H19 locus on 11p15 is linked to Silver–Russell syndrome (SRS) and/or hemihypertrophy. This SRS patient was born in term with weight of 3500 g (50 percentile) and length 48 cm (>1 SD below the mean). He was first noticed at the age of 10 years for short stature (114.5 cm, $-3.85$ SD), relatively normal head circumference, a classic facial phenotype, hemihypertrophy (2.5 cm thinner left arm and leg in comparison to the right, asymmetric face), moderate clinodactyly and striking thinness (BMI of 15.3). At the age of 30, the body asymmetry ameliorated (1 cm thinner left arm and leg than the right), and BMI normalized (20.5 cm). Methylation analysis was performed by bisulphate treatment of DNA samples, radiolabelled PCR amplification, and digestion of the PCR products using restriction enzymes. The patient had normomethylation, and in addition hypopituitarism, with low levels of growth hormone (GH) (provocative testing before the start and after termination of GH treatment), thyroxin, TSH, FSH, LH and testosterone. The GH was given for six years, growth response was satisfactory and he reached an adult height of 166 cm. This is a first report of hypopituitarism in a patient with SRS without H19 hypomethylation. It seems that the lack of hypomethylation in this hypopituitary SRS patient is responsible, at least partly, for the favourable final adult height under GH treatment.

  19. Test Review: Constantino, J. N., & Gruber, C. P. (2012). "Social Responsiveness Scale-Second Edition" ("SRS-2"). Torrance, CA: Western Psychological Services

    Science.gov (United States)

    Bruni, Teryn P.

    2014-01-01

    This article reviews the Social Responsiveness Scale-Second Edition (SRS-2), a 65-item rating scale measuring deficits in social behavior associated with Autism Spectrum Disorder (ASD), as outlined by the "Diagnostic and Statistical Manual of Mental Disorders" (4th ed., text rev.; "DSM-IV-TR"; American Psychiatric Association,…

  20. Pro-recombination role of Srs2 protein requires SUMO (small ubiquitin-like modifier) but is independent of PCNA (proliferating cell nuclear antigen) interaction

    DEFF Research Database (Denmark)

    Kolesar, Peter; Altmannova, Veronika; Pinela da Silva, Sonia Cristina;

    2016-01-01

    -interacting motif (SIM) of Srs2 is important for the interaction with several recombination factors. Lack of SIM, but not proliferating cell nuclear antigen (PCNA)-interacting motif (PIM), leads to increased cell death under circumstances requiring homologous recombination for DNA repair. Simultaneous mutation...

  1. Scoliosis Research Society (SRS) Criteria and Society of Scoliosis Orthopaedic and Rehabilitation Treatment (SOSORT) 2008 Guidelines in Non-Operative Treatment of Idiopathic Scoliosis.

    Science.gov (United States)

    Korbel, Krzysztof; Kozinoga, Mateusz; Stoliński, Łukasz; Kotwicki, Tomasz

    2014-07-28

    According to the Scoliosis Research Society (SRS), idiopathic scoliosis (IS) is a curvature of more than 10° Cobb angle, affecting 2-3% of pediatric population. Idiopathic scoliosis accounts for 80% of all scoliosis cases. Non-operative principles in the therapy of idiopathic scoliosis, including Scoliosis Research Society (SRS) criteria and guidelines proposed by the experts of the Society on Scoliosis Orthopedic and Rehabilitation Treatment (SOSORTS) were presented. The possibility to carry out quality of life assessments in a conservative procedure was also demonstrated. Based on the natural history of idiopathic scoliosis, SRS criteria, SOSORT 2008 experts' opinion and the knowledge of the possibilities of psychological assessment of conservative IS treatment, rules were proposed regarding nonsurgical IS therapy procedures, with special consideration being paid to the proper treatment start time (age, Risser test, biological maturity, Cobb angle), possibility of curvature progression, the importance of physiotherapy and psychological assessment. The knowledge of SRS criteria and SOSORT guidelines regarding the conservative treatment of IS are essential for proper treatment (the right time to start treatment), and supports establishment of interdisciplinary treatment teams, consisting of a physician, a physiotherapist, an orthopedic technician and a psychologist.

  2. Two anionically derivatized scandium oxoselenates(IV): ScF[SeO3] and Sc2O2[SeO3

    Science.gov (United States)

    Greiner, Stefan; Chou, Sheng-Chun; Schleid, Thomas

    2017-02-01

    Scandium fluoride oxoselenate(IV) ScF[SeO3] and scandium oxide oxoselenate(IV) Sc2O2[SeO3] could be synthesized through solid-state reactions. ScF[SeO3] was obtained phase-pure, by reacting mixtures of Sc2O3, ScF3 and SeO2 (molar ratio: 1:1:3) together with CsBr as fluxing agent in corundum crucibles embedded into evacuated glassy silica ampoules after firing at 700 °C for seven days. Sc2O2[SeO3] first emerged as by-product during the attempts to synthesize ScCl[SeO3] following aforementioned synthesis route and could later be reproduced from appropriate Sc2O3/SeO3 mixtures. ScF[SeO3] crystallizes monoclinically in space group P21/m with a=406.43(2), b =661.09(4), c=632.35(4) pm, β=93.298(3)° and Z=2. Sc2O2[SeO3] also crystallizes in the monoclinic system, but in space group P21/n with a=786.02(6), b=527.98(4), c=1086.11(8) pm, β=108.672(3)° for Z=4. The crystal structures of both compounds are strongly influenced by the stereochemically active lone pairs of the ψ1-tetrahedral [SeO3]2- anions. They also show partial structures, where the derivatizing F- or O2- anions play an important role. For ScF[SeO3] chains of the composition 2+ ∞ 1[FSc2/2] form from connected [FSc2]5+ dumbbells, while [OSc3]7+ pyramids and [OSc4]10+ tetrahedra units are condensed to layers according to 2+ ∞ 2[O2Sc2 ] in Sc2O2[SeO3].

  3. Groundwater recharge and chemical evolution in the southern High Plains of Texas, USA

    Science.gov (United States)

    Fryar, Alan; Mullican, William; Macko, Stephen

    2001-11-01

    és dans les sols des hautes terres par évapotranspiration, avec le ruissellement et l'infiltration dans les playas et les fossés (modifiée localement par l'écoulement en retour des eaux usées et des laisses d'irrigation). Des réactions probables intervenant au cours de la recharge sont l'oxydation de la matière organique, la dissolution et le dégazage du CO2, la dissolution du CaCO3, l'altération des silicates et l'échange de cations. Les données concernant Si et 14C laissent penser qu'il existe une drainance descendante à partir d'aquifères perchés vers l'aquifère des Hautes Plaines. Des modèles vraisemblables de bilan de matière pour l'aquifère des Hautes Plaines prennent en compte des scénarios d'écoulement avec drainance mais sans réactions, des écoulements avec réactions mais sans drainance et des écoulements sans réactions ni drainance. Les mécanismes de recharge et d'évolution chimique déterminés dans cette étude sont en accord avec ceux mis en évidence dans d'autres aquifères du centre sud et du sud-ouest des états-Unis. Resumen. El acuífero libre de High Plains (Ogallala) es el mayor de los Estados Unidos y supone la fuente principal de abastecimiento en la región semiárida del sur de High Plains (Texas) y de Nuevo México. Los análisis de agua y suelos realizados al nordeste de Amarillo (Texas), junto con los datos de otros estudios regionales, indican que los procesos que tienen lugar durante la recarga del acuífero controlan la composición de las aguas subterráneas en la mitad septentrional de los High Plains del Sur. Los datos isotópicos y hidroquímicos son coherentes con una secuencia de episodios de precipitación, concentración de solutos en la parte superior del suelo por evapotranspiración, escorrentía, e infiltración a través de 'playas' y zanjas (modificadas localmente por los flujos de retorno de aguas residuales y de excedentes de riego).

  4. A Phase 3 Trial of Whole Brain Radiation Therapy and Stereotactic Radiosurgery Alone Versus WBRT and SRS With Temozolomide or Erlotinib for Non-Small Cell Lung Cancer and 1 to 3 Brain Metastases: Radiation Therapy Oncology Group 0320

    Energy Technology Data Exchange (ETDEWEB)

    Sperduto, Paul W., E-mail: psperduto@mropa.com [Metro MN CCOP, Minneapolis, Minnesota (United States); Wang, Meihua [RTOG Statistical Center, Philadelphia, Pennsylvania (United States); Robins, H. Ian [University of Wisconsin Medical School Cancer Center, Madison, Wisconsin (United States); Schell, Michael C. [Wilmot Cancer Center, University of Rochester, Rochester, New York (United States); Werner-Wasik, Maria [Thomas Jefferson University, Philadelphia, Pennsylvania (United States); Komaki, Ritsuko [University of Texas MD Anderson Cancer Center, Houston, Texas (United States); Souhami, Luis [McGill University, Montreal, Quebec (Canada); Buyyounouski, Mark K. [Fox Chase Cancer Center, Philadelphia, Pennsylvania (United States); Khuntia, Deepak [University of Wisconsin Hospital, Madison, Wisconsin (United States); Demas, William [Akron City Hospital, Akron, Ohio (United States); Shah, Sunjay A. [Christiana Care Health Services, Inc, CCOP, Newark, Delaware (United States); Nedzi, Lucien A. [University of Texas Southwestern Medical School, Dallas, Texas (United States); Perry, Gad [The Ottawa Hospital Cancer Centre, Ottawa, Ontario (Canada); Suh, John H. [Cleveland Clinic Foundation, Cleveland, Ohio (United States); Mehta, Minesh P. [Northwestern Memorial Hospital, Chicago, Illinois (United States)

    2013-04-01

    Background: A phase 3 Radiation Therapy Oncology Group (RTOG) study subset analysis demonstrated improved overall survival (OS) with the addition of stereotactic radiosurgery (SRS) to whole brain radiation therapy (WBRT) in non-small cell lung cancer (NSCLC) patients with 1 to 3 brain metastases. Because temozolomide (TMZ) and erlotinib (ETN) cross the blood-brain barrier and have documented activity in NSCLC, a phase 3 study was designed to test whether these drugs would improve the OS associated with WBRT + SRS. Methods and Materials: NSCLC patients with 1 to 3 brain metastases were randomized to receive WBRT (2.5 Gy × 15 to 37.5 Gy) and SRS alone, versus WBRT + SRS + TMZ (75 mg/m{sup 2}/day × 21 days) or ETN (150 mg/day). ETN (150 mg/day) or TMZ (150-200 mg/m{sup 2}/day × 5 days/month) could be continued for as long as 6 months after WBRT + SRS. The primary endpoint was OS. Results: After 126 patients were enrolled, the study closed because of accrual limitations. The median survival times (MST) for WBRT + SRS, WBRT + SRS + TMZ, and WBRT + SRS + ETN were qualitatively different (13.4, 6.3, and 6.1 months, respectively), although the differences were not statistically significant. Time to central nervous system progression and performance status at 6 months were better in the WBRT + SRS arm. Grade 3 to 5 toxicity was 11%, 41%, and 49% in arms 1, 2, and 3, respectively (P<.001). Conclusion: The addition of TMZ or ETN to WBRT + SRS in NSCLC patients with 1 to 3 brain metastases did not improve survival and possibly had a deleterious effect. Because the analysis is underpowered, these data suggest but do not prove that increased toxicity was the cause of inferior survival in the drug arms.

  5. Structural, elastic and thermodynamic properties of Ti2SC

    Indian Academy of Sciences (India)

    Hongzhi Fu; Wenfang Liu; Tao Gao

    2011-12-01

    The structural parameters, elastic constants and thermodynamic properties of Ti2SC were investigated under pressure and temperature by using first-principles plane-wave pseudopotential density functional theory within the generalized gradient approximation. The obtained results are in agreement with the available experimental data. The bulk moduli along the - and -axes, $B_{a}$ and $B_{c}$, almost linearly increase with pressure, and the former is always smaller than the latter. The ratio of $B_{c}/B_{a}$ has a trend of gradual increase as the pressure increases. It is found that the elastic constants, anisotropy and Debye temperature of Ti2SC increase with pressure, while axial compressibility along the - and -axes decreases with pressure. The thermal properties including the equation of state, the Grüneisen parameter , the anisotropies $\\Delta_{p}, \\Delta_{S1}$ and $\\Delta_{S2}$, and the heat capacity are estimated at various pressures and temperatures.

  6. Dynamical stability and evolution of the discs of Sc galaxies

    CERN Document Server

    Fuchs, B

    1997-01-01

    We examine the local stability of galactic discs against axisymmetric density perturbations with special attention to the different dynamics of the stellar and gaseous components. In particular the discs of the Milky Way and of NGC 6946 are studied. The Milky Way is shown to be stable, whereas the inner parts of NGC 6946, a typical Sc galaxy from the Kennicutt (1989) sample, are dynamically unstable. The ensuing dynamical evolution of the composite disc is studied by numerical simulations. The evolution is so fierce that the stellar disc heats up dynamically on a short time scale to such a degree, which seems to contradict the morphological appearance of the galaxy. The star formation rate required to cool the disc dynamically is estimated. Even if the star formation rate in NGC 6946 is at present high enough to meet this requirement, it is argued that the discs of Sc galaxies cannot sustain such a high star formation rate for longer periods.

  7. A Study on the Fluorescence System of Sc-BPMPHD-CTMAB and Its Analytical Application

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    @@ Introduction The fluorescence of Sc3+ itself in solution is not observed. After complexed with an organic ligand with a chromophore, Sc3+ makes the ligand, which has no or has weak fluorescence, emit strong fluorescence.

  8. Status of Simulation Tools for the ILD ScECAL

    OpenAIRE

    Kotera, Katsushige; anduze, marc; Boudry, Vincent; Brient, Jean-Claude; Jeans, Daniel; Kawagoe, Kiyotomo; Miyamoto, Akiya; de Freitas, Paulo Mora; Musat, Gabriel; Ono, Hiroaki; Takeshita, Tohru; Uozumi, Satoru

    2010-01-01

    The scintillator-strip electromagnetic calorimeter (ScECAL) is one of the calorimeter technic for the ILC. To achieve the fine granularity from the strip-segmented layers the strips in odd layers are orthogonal with respect to those in the even layers. In order to extract the best performance from such detector concept, a special reconstruction method and simulation tools are being developed in ILD collaboration. This manuscript repots the status of developing of those tools.

  9. Metastable Al-Sc phase diagram in aluminium rich region

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Toropova, L.S.; Bykov, Yu.G.; Gushchina, F.L.; Elagin, V.I.; Filatov, Yu.A.

    1982-12-01

    An aluminium rich part of binary metastable phase diagram Al-Sc for 100 deg/s alloy cooling rate under crystallization is studied. Eutectic horizontal in the metastable diagram is 4 deg lower as compared to the equilibrium one, scandium concentration in the eutectic point makes up approximately 0.8%, the maximum solubility is 0.6%. Maximum cast grain refining in aluminium under crystallization at the rate of 100 deg/s is attained at 0.6% scandium content.

  10. QUALITY MANAGEMENT OF BAKERY PRODUCTS: A CASE STUDY IN SC

    Directory of Open Access Journals (Sweden)

    Nicoleta- Luminiţa STRÂMBEANU RISTEA

    2013-01-01

    Full Text Available The paper aimed to present the benefits of implementing HACCP (Hazard Analysis and Critical Control Points to company S.C. "DOBRE AND SONS" S.R.L. Constanta, Romania. The data have been provided by the above mentioned manufacturer. The objectives of S.C. "DOBRE AND SONS" S.R.L. are protecting the health of the consumers of the products and their satisfaction regarding the consumption of products that are nutritional, tasty, fresh, free from microbiological, chemical and physical hazard, as well as possessing stable properties during the validity for consumption. In this respect, there has been implemented and maintained an integrated management system of food quality and safety according to SR EN ISO 9001:2008, SR EN ISO 22000:2005 and according to IFS standard, version 5/2007, which consists of determining the potential biological, chemical and physical hazards that might affect the safety of bread and bakery products, or the health of the consumer. HACCP team is analyzing hazard using one of the recommended techniques: brainstorming or the cause - effect diagram. In conclusion, the company S.C. "DOBRE AND SONS" S.R.L. Constanta, Romania provides awareness and employee involvement at all levels in achieving the appointed objectives.

  11. Charleston Harbor, SC, Regional Sediment Management Study; Beneficial Use of Dredged Material through Nearshore Placement

    Science.gov (United States)

    2017-05-01

    ER D C/ CH L TR -1 7- 7 Regional Sediment Management (RSM) Program Charleston Harbor, SC, Regional Sediment Management Study...acwc.sdp.sirsi.net/client/default. Regional Sediment Management (RSM) Program ERDC/CHL TR-17-7 May 2017 Charleston Harbor, SC, Regional Sediment...454632, “Charleston Harbor, SC; Regional Sediment Management Study” ERDC/CHL TR-17-7 ii Abstract The 2015 Charleston Harbor, SC, final

  12. A study of Al-Sc-Zr alloys in the aluminum-rich region

    Energy Technology Data Exchange (ETDEWEB)

    Toropova, L.S.; Kamardinkin, A.N.; Kindzhibalo, V.V.; Tyvanchuk, A.T. (AN SSSR, Institut Metallurgii, Moscow (USSR))

    1990-12-01

    Alloys in the ternary system Al-Sc-Zr along a section of approximately 1.0 pct Sc and 0.8 pct Zr were investigated by X-ray diffraction and electron probe analyses. It is found that phases Al3Sc and Al3Zr are in equilibrium with the alpha solid solution of aluminum. The contents of zirconium and scandium in the phase Al3Sc are determined as a function of their concentrations in the alloy.

  13. Effect of ScAl/sub 3/ phase dispersity on hardening of A1-6. 3% Mg-0. 21% Sc alloy

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Bykov, Y.G.; Toropova, L.S.

    1985-09-01

    This paper reports on attempts to evaluate the quantitatively separate influence exerted on the hardening of an aluminum alloy containing 6.3% Mg and 0.21% Sc by both particles of the ScAl/sub 3/ phase exhibiting a different degree of dispersity and also the substructure which is formed in the alloy after hot deformation. The binary aluminum alloy containing 6.3% of Mg after hot deformation has a fully recrystallized structure, while the aluminum alloy containing 6.5% of Mg and Sc is recrystallized. It is concluded that: the magnitude of substructure hardening of the A1-6.3% Mg-0.21% Sc alloy is similar, irrespective of the dispersity of coherent ScAl/sub 3/ particles; and, hardening of the alloy, which is governed by coherent ScAl/sub 3/-phase segregations less than 20 mm in diameter, significantly exceeds the effect of substructure hardening.

  14. Crystal fields of dilute Tb, Dy, or Er in Sc obtained by magnetization measurements

    DEFF Research Database (Denmark)

    Høg, J.; Touborg, P.

    1976-01-01

    Crystal-field parameters for dilute Sc-Tb, Sc-Dy, and Sc-Er alloys have been obtained by fitting theoretical expressions to the experimentally measured paramagnetic susceptibility. The initial susceptibility was measured and corrected for the effects of ordering at the lowest temperatures in the ...

  15. Preparation and characterization of Sc doped MgB2 wires

    DEFF Research Database (Denmark)

    Grivel, Jean-Claude; Burdusel, M.

    2016-01-01

    The in-situ technique was used to manufacture scandium (Sc) doped MgB2 wires in a composite Cu–Nb sheath. After reaction at 700 °C, at most 1 at.% Mg was replaced by Sc in the MgB2 phase, without significant influence on its superconducting transition temperature. For higher Sc concentrations...

  16. File list: InP.PSC.10.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 35242 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.PSC.10.AllAg.EpiSC.bed ... ...InP.PSC.10.AllAg.EpiSC mm9 Input control Pluripotent stem cell EpiSC SRX590285,SRX5

  17. File list: InP.PSC.50.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 90285 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.PSC.50.AllAg.EpiSC.bed ... ...InP.PSC.50.AllAg.EpiSC mm9 Input control Pluripotent stem cell EpiSC SRX535242,SRX5

  18. File list: InP.PSC.20.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 90285 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.PSC.20.AllAg.EpiSC.bed ... ...InP.PSC.20.AllAg.EpiSC mm9 Input control Pluripotent stem cell EpiSC SRX535242,SRX5

  19. File list: His.PSC.10.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 0286,SRX535238 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.10.AllAg.EpiSC.bed ... ...His.PSC.10.AllAg.EpiSC mm9 Histone Pluripotent stem cell EpiSC SRX590288,SRX535240,

  20. File list: Unc.PSC.05.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 074908,SRX1074905 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.05.AllAg.EpiSC.bed ... ...Unc.PSC.05.AllAg.EpiSC mm9 Unclassified Pluripotent stem cell EpiSC SRX1074917,SRX1

  1. File list: His.PSC.50.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 909,SRX1074906 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.50.AllAg.EpiSC.bed ... ...His.PSC.50.AllAg.EpiSC mm9 Histone Pluripotent stem cell EpiSC SRX535239,SRX535240,

  2. File list: InP.PSC.05.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 35242 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.PSC.05.AllAg.EpiSC.bed ... ...InP.PSC.05.AllAg.EpiSC mm9 Input control Pluripotent stem cell EpiSC SRX590285,SRX5

  3. File list: Unc.PSC.50.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 074905,SRX1074908 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.50.AllAg.EpiSC.bed ... ...Unc.PSC.50.AllAg.EpiSC mm9 Unclassified Pluripotent stem cell EpiSC SRX1074917,SRX1

  4. File list: His.PSC.05.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 4916,SRX590286 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.05.AllAg.EpiSC.bed ... ...His.PSC.05.AllAg.EpiSC mm9 Histone Pluripotent stem cell EpiSC SRX590288,SRX535240,

  5. File list: Unc.PSC.20.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 074908,SRX1074905 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.20.AllAg.EpiSC.bed ... ...Unc.PSC.20.AllAg.EpiSC mm9 Unclassified Pluripotent stem cell EpiSC SRX1074917,SRX1

  6. File list: His.PSC.20.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 4906,SRX535241 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.20.AllAg.EpiSC.bed ... ...His.PSC.20.AllAg.EpiSC mm9 Histone Pluripotent stem cell EpiSC SRX535239,SRX661083,

  7. 牛源犬新孢子虫NcSRS2-NcGRA7融合基因的克隆与生物信息学分析%Cloning and bioinformatics analysis of NcSRS2-NcGRA7 fusion gene of bovine Neospora caninum

    Institute of Scientific and Technical Information of China (English)

    贾立军; 张守发; 谷振甲

    2013-01-01

    为了解牛源犬新孢子虫NcSRS2-NcGRA7融合基因的生物学特性,本试验提取牛源犬新孢子虫基因组DNA,应用PCR技术扩增犬新孢子虫表面蛋白基因NcSRS2和致密颗粒蛋白基因NcGRA7,SOE-PCR技术拼接NcSRS2和NcGRA7基因,构建NcSRS2-NcGRA7融合基因重组克隆质粒,并进行PCR鉴定、双酶切鉴定及生物信息学分析.结果,NcSRS2基因扩增片段大小为1 061 bp,NcGRA7基因扩增片段大小为364 bp,NcSRS2-NcGRA7融合基因扩增片段大小为1 482 bp;获得重组克隆质粒pMD18-NcSRS2-NcGRA7经PCR鉴定、双酶切鉴定正确;测序分析表明,与Gen-Bank中已发表的美国株犬新孢子虫(AF061249、AF176649)核苷酸序列同源性为99%;经DNAman等软件分析,预测NcSRS2-NcGRA7融合蛋白抗原指数较高,融合蛋白二级结构以α-螺旋和β-折叠为主,三级结构中2种蛋白独立折叠,并借助Linker互相连接,功能互不影响.本试验为牛源犬新孢子虫NcSRS2-NcGRA7融合蛋白的免疫学研究奠定了基础.%In order to understand the biological characteristic of NcSRS2-NcGRA7 fusion gene of bovine Neospora Caninum,genomic DNA of N.caninum was extracted.The surface protein gene NcSRS2 and granule protein gene NcGRA7 were amplified by PCR,respectively.Nc-SRS2-NcGRA7 fusion gene was synthesized by SOE-PCR.The NcSRS2-NcGRA7 cloning vector was constructed and identified by PCR amplification,double digestion and bioinformatic analysis.The results showed that the sizes of NcSRS2,NcGRA7 and NcSRS2-NcGRA7 were 1061 bp,364 bp and 1482 bp,respectively.The cloning vector was demonstrated to be correct by PCR and double digestion.Sequencing analysis showed that the nucleotide sequences of NcSRS2 and NcGRA7 shared 99% homology with those published in GenBank (AF061249,AF176649).Prediction analysis by DNAman software indicated that the antigen index of NcSRS2-NcGRA7 was high.The main secondary structure of the fusion protein was mainly composed of α-helix and

  8. Suitable scale of Weigan River plain oasis

    Institute of Scientific and Technical Information of China (English)

    HU ShunJun; SONG YuDong; TIAN ChangYan; LI YueTan; LI XiuCang; CHEN XiaoBing

    2007-01-01

    Desert coexists with oasis in long time, and the existence and development of oasis system demand better oasis vegetation ecological system. Oasis scale of arid zone plain encircling water should be determined in case of desertification caused by land over-reclamation under the circumstance of water resources shortage. Steady oasis with virtuous circle must have appropriate land use structure for agriculture, forestry and graziery. The study on the suitable scale and developmental space of oasis will provide theoretical and applicable foundation for effective construction of oases. By analyzing the hydrothermal, water and soil balance, an optimal mathematical model has been established. Based on hydrometeorology data collected for years in Weigan River plain, and by the principle of water balance,a calculation has been made of the water resources for evapotranspiration and the optimal acreage of oasis and cultivated land, which shows that the water resources for evapotranspiration in the Weigan River plain oasis is 22.32×108 m3 and the optimal oasis acreage under the condition of conventional irrigation mode is 3716.06 km2, in which the suitable cultivated land acreage is 1564.79 km2. Under the condition of water-saving irrigation, the suitable oasis acreage is 5515.49 km2, in which the suitable cultivated land acreage is 2322.31 km2. The oasis area had reached 4123 km2, and the cultivated land acreage had reached 1507 km2 after the Agriculture Irrigation Drainage Water Project of World Bank Loan in Weigan River basin was finished in 1997. The oasis and cultivated land acreage will be more suitable, and the oasis scale can be enlarged moderately by means of water saving irrigation.

  9. Ages of plains volcanism on Mars

    Science.gov (United States)

    Hauber, Ernst; Jagert, Felix; Broz, Petr

    2010-05-01

    Plain-style volcanism [1] is widespread in the Tharsis and Elysium volcanic provinces on Mars, [2,3]. Detailed images and topographic data reveal the morphology and topography of clusters of low shields and associated lava flows. The landforms of plains volcanism on Mars have all well-known terrestrial analogues in basaltic volcanic regions, such as Hawaii, Iceland, and in particular the Snake River Plains [4]. The very gentle flank slopes (Ga - 2.9 Ga). Our results indicate that Late Amazonian volcanism is more widespread in Tharsis than previously recognized. Based on our results it appears possible that Mars is volcanologically not dead yet. Ongoing work investigates the volumes of erupted products and implications for the outgassing history and atmospheric evolution of Mars. [1] Greeley R. (1982) JGR 87, 2705-2712. [2] Plescia J. (1981) Icarus, 45, 586-601. [3] Hodges C.A. and Moore H.J. (1994) Atlas of volcanic features on Mars: USGS Prof. Paper 1534, 194 p. [4] Hauber E. et al. (2009) J. Volcanol. Geotherm. Res. 185, 69-95. [5] Wilson L. et al. (2009) J. Volcanol. Geotherm. Res. 185, 28-46. [6] Vaucher, J. et al. (2009) Icarus 204, 418-442. [7] Baratoux D. et al. (2009) J. Volcanol. Geotherm. Res. 185, 47-68. [8] Bleacher J.E. et al. (2009) J. Volcanol. Geotherm. Res. 185, 96-102. [9] Ivanov B.A. (2001) Space Sci. Rev. 96, 87-104. [10] Hartmann W.H. and Neukum G. (2001) Space Sci. Rev. 96, 165-194 [11] Kneissl T. et al. (2010) LPS XVI, submitted. [12] Michael, G.G. and Neukum G. (2010) Earth Planet. Sci. Lett., in press. . [13] Malin M.C. et al. (2007) JGR 112, E05S04, doi: 10.1029/2006JE002808.

  10. Overview of 2009 IEC/TC SC 77C Plenary Meeting%2009 IEC/TC SC 77C年会

    Institute of Scientific and Technical Information of China (English)

    孟萃

    2009-01-01

    介绍了在法国召开的2009 IEC/TC SC 77C分技术委员会工作组会议讨论的IEC 61000-4-35、IEC 6100-5-9、IEC 6100-5-8三个标准项目实施情况、标准维护需求及新的技术工作.

  11. Medicine Wheels of the Great Plains

    Science.gov (United States)

    Vogt, David

    Medicine Wheels are unexplained aboriginal boulder configurations found primarily on hilltops and river valley vistas across the northwest Great Plains of North America. Their varied, complex designs have inspired diverse hypotheses concerning their meaning and purpose, including astronomical ones. While initial "observatory" speculations were unfounded, and quests to "decode" these structures remain unfulfilled and possibly misguided, the Medicine Wheels nevertheless represent a uniquely worthwhile case study in archaeoastronomical theory and method. In addition, emerging technologies for data acquisition and analysis pertinent to Medicine Wheels offer prospectively important new sight lines for the future of archaeoastronomy.

  12. Molecular and functional characterization of peptidoglycan-recognition protein SC2 (PGRP-SC2) from Nile tilapia (Oreochromis niloticus) involved in the immune response to Streptococcus agalactiae.

    Science.gov (United States)

    Gan, Zhen; Chen, Shannan; Hou, Jing; Huo, Huijun; Zhang, Xiaolin; Ruan, Baiye; Laghari, Zubair Ahmed; Li, Li; Lu, Yishan; Nie, Pin

    2016-07-01

    PGRP-SC2, the member of PGRP family, plays an important role in regulation of innate immune response. In this paper, a PGRP-SC2 gene of Nile tilapia, Oreochromis niloticus (designated as On-PGRP-SC2) was cloned and its expression pattern under the infection of Streptococcus agalactiae was investigated. Sequence analysis showed main structural features required for amidase activity were detected in the deduced amino acid sequence of On-PGRP-SC2. In healthy tilapia, the On-PGRP-SC2 transcripts could be detected in all the examined tissues, with the most abundant expression in the muscle. When infected with S. agalactiae, there was a clear time-dependent expression pattern of On-PGRP-SC2 in the spleen, head kidney and brain. The assays for the amidase activity suggested that recombinant On-PGRP-SC2 protein had a Zn(2+)-dependent PGN-degrading activity. Moreover, our works showed that recombinant On-PGRP-SC2 protein could significantly reduce bacterial load in target organs attacked by S. agalactiae. These findings indicated that On-PGRP-SC2 may play important roles in the immune response to S. agalactiae in Nile tilapia.

  13. Acid-base chemistry in the formation of Mackay-type icosahedral clusters: μ3-acidity analysis of Sc-rich phases of the Sc-Ir system.

    Science.gov (United States)

    Guo, Yiming; Stacey, Timothy E; Fredrickson, Daniel C

    2014-05-19

    The crystal structures of intermetallic phases offer a wealth of geometrical features (helices, multishelled clusters, and host-guest motifs) whose formation has yet to be explained or predicted by chemical theory. A recently developed extension of the acid-base concept to metallic systems, the μ3-acidity model, provides an avenue for developing this understanding for intermetallics formed from transition metals. In this Article, we illustrate how this approach can be used to understand one of the most striking geometrical entities to emerge in intermetallic chemistry, the Mackay cluster of icosahedral quasicrystals. We present μ3-acidity analyses, based on DFT-calibrated Hückel calculations, for a series of Sc-Ir intermetallics: ScIr (CsCl-type), Sc2Ir (Ti2Ni-type), Sc11Ir4, and the Mackay cluster containing phases Sc57Ir13 and Sc44Ir7. We begin by illustrating that a μ3-acidity model correctly predicts that each of these phases is stable relative to disproportionation into their neighboring compounds when a common set of Hückel parameters and d-orbital occupancies is used. Next, we explain these results by developing a relationship between the distance distribution of homoatomic contacts within an atom's coordination sphere and the μ3-neutralization it experiences. For a given average homoatomic distance, the role of heteroatomic contacts is higher when the distribution of homoatomic contacts is narrower. This effect is key to the strength of the acid-base neutralization of the Sc-rich phases, where the Sc atoms find a scarcity of Ir atoms from which to obtain neutralization. Under these circumstances, Sc-Ir contacts should be maximized, whereas the number and distance variations of the Sc-Sc contacts should be minimized. These expectations are borne out by the observed crystal structures. In particular, the Mackay clusters of Sc57Ir13 and Sc44Ir7, in which a central Ir atom is icosahedrally coordinated by a pentagonal dodecahedral array of face-sharing Sc

  14. Effect of ScAl/sub 3/ phase dispersity on hardening of Al-6. 3 pct Mg-0. 21 pct Sc alloy

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Bykov, IU.G.; Toropova, L.S.

    1985-09-01

    The relative contributions of disperse coherent ScAl/sub 3/ segregations and of the substructure to the hardening of an aluminum alloy containing 6.3 pct Mg and 0.21 pct Sc are evaluated quantitatively. It is shown that the extent of substructure hardening is independent of the dispersity of coherent ScAl/sub 3/ particles and, consequently, of the homogenizing treatment. The contribution of coherent ScAl/sub 3/ segregations less than 20 nm in diameter to the hardening of the alloy significantly exceeds that of substructure hardening. 9 references.

  15. Al-Mg-Sc-Zr合金的再结晶%Recrystallization of Al-Mg-Sc-Zr Alloys

    Institute of Scientific and Technical Information of China (English)

    张永红; 尹志民; 张杰; 潘青林; 彭志辉

    2002-01-01

    研究了添加微量Sc,Zr的Al-Mg合金的再结晶行为,结果表明:Al-Mg-Sc-Zr合金的再结晶起始温度为400℃,细小、弥散、与基体共格的析出相对位错和亚晶的钉扎作用是合金再结晶温度大幅度提高的主要原因,再结晶形核机制为亚晶聚合机制.%The recrystalization behavior of Al-Mg alloys with Sc and Zr additives was studied.It is found that the recrystallization of the alloy began at 400℃.The main reason of the great increase of recrystallization temperature is attributed to that the dislocations and subgrain boundaries.The recrystallizing nucleation mechanism was the subgrain boundary merging mechanism in the alloy are pinned by ultrafine dispersed coherent precipitates.

  16. Fourier Transform Microwave Spectroscopy of Sc13C2 and Sc12C13C: Establishing AN Accurate Structure of ScC2 (tilde{X}2A1)

    Science.gov (United States)

    Burton, Mark; Halfen, DeWayne T.; Min, Jie; Ziurys, Lucy M.

    2016-06-01

    Pure rotational spectra of Sc13C2 and Sc12C13C (tilde{X}2A1) have been obtained using Fourier Transform Microwave methods. These molecules were created from scandium vapor in combination with 13CH4 and/or 12CH4, diluted in argon, using a Discharge Assisted Laser Ablation Source (DALAS). Transitions in the frequency range of 14-30 GHz were observed for both species including hyperfine splitting due to the nuclear spin of Sc (I = 7/2) and 13C (I = 1/2). Rotational, spin-rotational, and hyperfine constants have been determined for Sc13C2 and Sc12C13C, as well as a refined structure for ScC2. In agreement with theoretical calculations and previous Sc12C2 results, these data confirm a cyclic (or T-shaped) structure for this molecule. Scandium carbides have been shown to form endohedral-doped fullerenes, which have unique electrical and magnetic properties due to electron transfer between the metal and the carbon-cage. Spectroscopy of ScC2 provides data on model systems for comparison with theory.

  17. Trends in Attendance at Scoliosis Research Society Annual Meetings (SRS AM) and International Meeting on Advanced Spine Techniques (IMAST): Location, Location, Location.

    Science.gov (United States)

    Chen, Foster; Cho, Woojin; Kim, Han Jo; Levine, David B

    2017-07-01

    Descriptive, respective. Although overall membership in Scoliosis Research Society (SRS) has grown over the years, we were curious to see the effects of changing event venue location and timing on conference attendance. Every year, the SRS hosts two major meetings: the Annual Meeting (SRS AM) in the autumn, and the International Meeting on Advanced Spine Techniques (IMAST) in the summer. Sites have alternated from within and outside North America. Often, these meetings have also overlapped with several holidays in certain countries. This was an observational study of attendance from past SRS AM and IMAST meetings. Fourteen years of AM and 8 years of IMAST data were made available from the SRS. Participation based on delegate type and countries were tallied. Details from the 10 most represented nations and host nations per year were also tallied, and their national holidays were reviewed for overlaps with the AM. Membership in AM and IMAST increased from 820 in 2003 to 1,323 in 2016. Attendance at the AM has increased, whereas attendance at IMAST has declined, even after adjusting for membership size. Trends in participation were highly influenced by location. Participation by attendees from the host continent, and especially the host country, is generally high. The negative impact of distant meetings is profoundly seen with North Americans, whereas the positive impact of a nearby meeting was mostly clearly demonstrated by South Americans. Although SRS AM overlapped with holidays in China, Japan, or Korea nearly 50% of the time, this did not influence participation by delegates from these countries. Participation in the AM is highly influenced by location. Although North Americans represented the largest constituency, their presence was not needed to drive total attendance and was not sufficient to turn around the downturn in IMAST attendance. Choice of location can encourage the participation of delegates from the host and neighboring nations; through strategic

  18. Improving Web Page Readability by Plain Language

    CERN Document Server

    Hussain, Walayat; Ali, Arif

    2011-01-01

    In today's world anybody who wants to access any information the first choice is to use the web because it is the only source to provide easy and instant access to information. However web readers face many hurdles from web which includes load of web pages, text size, finding related information, spelling and grammar etc. However understanding of web pages written in English language creates great problems for non native readers who have basic knowledge of English. In this paper, we propose a plain language for a local language (Urdu) using English alphabets for web pages in Pakistan. For this purpose we developed two websites, one with a normal English fonts and other in a local language text scheme using English alphabets. We also conducted a questionnaire from 40 different users with a different level of English language fluency in Pakistan to gain the evidence of the practicality of our approach. The result shows that the proposed plain language text scheme using English alphabets improved the reading com...

  19. Plain Language Summary: Adult Sinusitis (Sinus Infection).

    Science.gov (United States)

    Caspersen, Leslie A; Walter, Lindsey M; Walsh, Sandra A; Rosenfeld, Richard M; Piccirillo, Jay F

    2015-08-01

    This plain language summary serves as an overview in explaining sinusitis (pronounced sign-you-side-tis). The purpose of this plain language summary is to provide patients with standard language explaining their condition in an easy-to-read format. This summary applies to those 18 years of age or older with sinusitis. The summary is featured as an FAQ (frequently asked question) format. The summary addresses how to manage and treat sinusitis symptoms. Adult sinusitis is often called a sinus infection. A healthcare provider may refer to a sinus infection as rhinosinusitis (pronounced rhi-no-sign-you-side-tis). This includes the nose as well as the sinuses in the name. A sinus infection is the swelling of the sinuses and nasal cavity.The summary is based on the published 2015 "Clinical Practice Guideline: Adult Sinusitis." The evidence-based guideline includes research to support more effective diagnosis and treatment of adult sinus infections. The guideline was developed as a quality improvement opportunity for managing sinus infections by creating clear recommendations to use in medical practice. © American Academy of Otolaryngology—Head and Neck Surgery Foundation 2015.

  20. Improving Web Page Readability by Plain Language

    Directory of Open Access Journals (Sweden)

    Walayat Hussain

    2011-05-01

    Full Text Available In todays world anybody who wants to access any information the first choice is to use the web because it is the only source to provide easy and instant access to information. However web readers face many hurdles from web which includes load of web pages, text size, finding related information, spelling and grammar etc. However understanding of web pages written in English language creates great problems for non native readers who have basic knowledge of English. In this paper, we propose a plain language for a local language (Urdu using English alphabets for web pages in Pakistan. For this purpose we developed two websites, one with a normal English fonts and other in a local language text scheme using English alphabets. We also conducted a questionnaire from 40 different users with a different level of English language fluency in Pakistan to gain the evidence of the practicality of our approach. The result shows that the proposed plain language text scheme using English alphabets improved the reading comprehension for non native English speakers in Pakistan.

  1. Creep of plain weave polymer matrix composites

    Science.gov (United States)

    Gupta, Abhishek

    Polymer matrix composites are increasingly used in various industrial sectors to reduce structural weight and improve performance. Woven (also known as textile) composites are one class of polymer matrix composites with increasing market share mostly due to their lightweight, their flexibility to form into desired shape, their mechanical properties and toughness. Due to the viscoelasticity of the polymer matrix, time-dependent degradation in modulus (creep) and strength (creep rupture) are two of the major mechanical properties required by engineers to design a structure reliably when using these materials. Unfortunately, creep and creep rupture of woven composites have received little attention by the research community and thus, there is a dire need to generate additional knowledge and prediction models, given the increasing market share of woven composites in load bearing structural applications. Currently, available creep models are limited in scope and have not been validated for any loading orientation and time period beyond the experimental time window. In this thesis, an analytical creep model, namely the Modified Equivalent Laminate Model (MELM), was developed to predict tensile creep of plain weave composites for any orientation of the load with respect to the orientation of the fill and warp fibers, using creep of unidirectional composites. The ability of the model to predict creep for any orientation of the load is a "first" in this area. The model was validated using an extensive experimental involving the tensile creep of plain weave composites under varying loading orientation and service conditions. Plain weave epoxy (F263)/ carbon fiber (T300) composite, currently used in aerospace applications, was procured as fabrics from Hexcel Corporation. Creep tests were conducted under two loading conditions: on-axis loading (0°) and off-axis loading (45°). Constant load creep, in the temperature range of 80-240°C and stress range of 1-70% UTS of the

  2. Evaluation of Setup Uncertainties for Single-Fraction SRS by Comparing the Two Different Mask-Creation Methods

    CERN Document Server

    Baek, Jong Geun; Oh, Young Kee; Lee, Hyun Jeong; Kim, Eng Chan

    2015-01-01

    The purpose of this study was to evaluate the setup uncertainties for single-fraction stereotactic radiosurgery (SF-SRS) based on the clinical data with the two different mask-creation methods using pretreatment CBCT imaging guidance. Dedicated frameless fixation BrainLAB masks for 23 patients were created as a routine mask (R-mask) making method, as explained in the BrainLAB user manual. The alternative masks (A-mask) which were created by modifying the cover range of the R-mask for the patient head were used for 23 patients. The systematic errors including the each mask and stereotactic target localizer were analyzed and the errors were calculated as the mean and standard deviation (SD) from the LR, SI, AP, and yaw setup corrections. In addition, the frequency of three-dimensional (3D) vector length were also analyzed. The values of the mean setup corrections for the R-mask in all directions were small; < 0.7 mm and < 0.1 degree, whereas the magnitudes of the SDs were relatively large compared to the ...

  3. SRS Tank 38H and 43H Supernate Foaming Studies and Tank 38H Reel Tape Solids Characterization

    Energy Technology Data Exchange (ETDEWEB)

    King, W. D. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Restivo, M. L. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Martino, C. J. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2014-12-04

    Radioactive waste samples retrieved from Savannah River Site (SRS) Tanks 38H and 43H (concentrate receipt and feed tanks, respectively, for the 2H Evaporator system) were evaluated with regard to their tendency to form foams during air sparging. This work was conducted due to recent processing issues and outages in the evaporator that were believed to have resulted from sample foaming. The samples evaluated for foam formation included supernate collected in April of 2014 (near the time of the evaporator outage) as well as historical samples available within the SRNL shielded cells facility. The April samples included one Tank 43H surface sample (HTF-43-14-42), one Tank 43H sub-surface sample (HTF-43-14-43), and one Tank 38H (HTF-38-14-41) surface sample. In addition, two Tank 43H samples (HTF-43-14-8 and HTF-43-14-9) and one Tank 38H sample (HTF-38-14-6) were also evaluated along with a blended sample of various historical Tank 38H and 43H samples. Characterization results for the April samples are also provided. The composition of the samples was similar to historical evaporator system samples received at SRNL.

  4. Environmental restoration: Integrating hydraulic control of groundwater, innovative contaminant removal technologies and wetlands restoration--A case study at SRS

    Energy Technology Data Exchange (ETDEWEB)

    Lewis, C.M.; Serkiz, S.M.; Adams, J.; Welty, M. (Westinghouse Savannah River Co., Aiken, SC (United States))

    1992-01-01

    The groundwater remediation program at the F and H Seepage Basins, Savannah River Sits (SRS) is a case study of the integration of various environmental restoration technologies at a single waste site. Hydraulic control measures are being designed to mitigate the discharge of groundwater plumes to surface water. One of the primary constituents of the plumes is tritium. An extraction and reinjection scenario is being designed to keep the tritium in circulation in the shallow groundwater, until it can naturally decay. This will be accomplished by extracting groundwater downgradient of the waste sites, treatment, and reinjection of the tritiated water into the water table upgradient of the basins. Innovative in-situ technologies, including electrolytic migration, are being field tested at the site to augment the pump-treat-reinject system. The in-situ technologies target removal of contaminants which are relatively immobile, yet represent long term risks to human health and the environment. Wetland restoration is an integral part of the F and H remediation program. Both in-situ treatment of the groundwater discharging the wetlands to adjust the pH, and replacement of water loss due to the groundwater extraction program ar being considered. Toxicity studies indicate that drought and the effects of low pH groundwater discharge have been factors in observed tree mortality in wetlands near the waste sites.

  5. LOCAL COLLISION SIMULATION OF AN SC WALL USING ENERGY ABSORBING STEEL

    Directory of Open Access Journals (Sweden)

    CHUL-HUN CHUNG

    2013-08-01

    Full Text Available This study evaluates the local damage of a turbine in an auxiliary building of a nuclear power plant due to an external impact by using the LS-DYNA finite element program. The wall of the auxiliary building is SC structure and the material of the SC wall plate is high manganese steel, which has superior ductility and energy absorbance compared to the ordinary steel used for other SC wall plates. The effects of the material of the wall, collision speed, and angle on the magnitude of the local damage were evaluated by local collision analysis. The analysis revealed that the SC wall made of manganese steel had significantly less damage than the SC wall made of ordinary steel. In conclusion, an SC wall made of manganese steel can have higher effective resistance than an SC wall made of ordinary steel against the local collision of an airplane engine or against a turbine impact.

  6. Performance Analysis of OFDM 60GHz System and SC-FDE 60GHz System

    Directory of Open Access Journals (Sweden)

    Han Xueyan

    2016-01-01

    Full Text Available In this paper, the performance of 60GHz wireless communication system with SC and OFDM is studied, the models of OFDM 60GHz system and SC 60GHz frequency domain equalization (SC-FDE system are established, and the bit error rate (BER performance of OFDM 60GHz system and SC-FDE 60GHz system in 802.15.3c channels is compared. The simulation results show that SC-FDE 60GHz system has a slight advantage over OFDM system in line-of-sight (LOS channels, while OFDM 60GHz system has a slight advantage over SC-FDE system in non-line-of-sight (NLOS channels. For 60GHz system, OFDM 60GHz system has a slight advantage over SC-FDE system in overcoming multipath fading, but the performance of both is close whether in the LOS or NLOS case.

  7. Circles of the World: Traditional Art of the Plains Indians.

    Science.gov (United States)

    Conn, Richard

    1985-01-01

    The art of the Plains Indians is discussed, and an art exhibition of their work to be held at the California Academy of Sciences in San Francisco from January 12 to April 29, 1985, is described. The exhibit shows and explains how Plains art served aspects of the Indians' traditional life. (RM)

  8. 18 CFR 801.8 - Flood plain management and protection.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Flood plain management... COMMISSION GENERAL POLICIES § 801.8 Flood plain management and protection. (a) Periodic inundation of lands along waterways has not discouraged development of flood hazards areas. Major floods cause loss of...

  9. 7 CFR 650.25 - Flood-plain management.

    Science.gov (United States)

    2010-01-01

    ... valuable for maintaining agricultural and forest products for food and fiber, fish and wildlife habitat... flood plain. Department of Housing and Urban Development (HUD) flood insurance maps, other available... if the intended action is in the base flood plain by using HUD flood insurance maps, and other...

  10. 49 CFR 215.113 - Defective plain bearing wedge.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Freight Car Components Suspension System § 215.113 Defective plain bearing wedge. A railroad may not place or continue in service a car, if a plain bearing wedge on that car is— (a) Missing; (b) Cracked; (c) Broken; or (d) Not...

  11. 49 CFR 215.107 - Defective plain bearing box: General.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Freight Car Components Suspension System § 215.107 Defective plain bearing box: General. A railroad may not place or continue in service a car, if the car has— (a) A plain bearing box that does not contain visible free oil; (b) A...

  12. comparison between sonographic and plain radiography in the ...

    African Journals Online (AJOL)

    hi-tech

    2003-10-10

    Oct 10, 2003 ... Senior Lecturer, Department of Radiology, Makerere University, ... Plain radiography made a diagnosis in 85.5% of patients and did ... abdominal pain, abdominal distension, vomiting and ... major draw back with the use of ultrasound is that it is .... Plain abdominal film demonstrates non-specific gaseous.

  13. PLAINS GERBILS (GERBILLISCUS ROBUSTA) AS FOOD OF THE ...

    African Journals Online (AJOL)

    Mgina

    Its major food in the 1970's was found to be Gerbilliscus robusta ... Senzota – Plains Gerbils as Food of the Barn Owl in the Serengeti Plains … 102 reflected as ..... Magazine. March 04. And http://www.growingproduce.com/article/. 181150 ...

  14. 27 CFR 9.207 - Outer Coastal Plain.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Outer Coastal Plain. 9.207... Outer Coastal Plain. (a) Name. The name of the viticultural area described in this section is “Outer Coastal Plain”. For purposes of part 4 of this chapter, “Outer Coastal Plain” is a term of...

  15. Post-elution processing of {sup 44}Ti/{sup 44}Sc generator-derived {sup 44}Sc for clinical application

    Energy Technology Data Exchange (ETDEWEB)

    Pruszynski, M. [Institute of Nuclear Chemistry and Technology, 03-195 Warszawa (Poland); Loktionova, N.S. [Institute of Nuclear Chemistry, Johannes Gutenberg-University of Mainz, D-55128 Mainz (Germany); Filosofov, D.V. [Joint Institute of Nuclear Research, DLNP, 141980 Dubna (Russian Federation); Roesch, F., E-mail: frank.roesch@uni-mainz.d [Institute of Nuclear Chemistry, Johannes Gutenberg-University of Mainz, D-55128 Mainz (Germany)

    2010-09-15

    The {sup 44}Ti/{sup 44}Sc (T{sub 1/2}{sup 44}Ti=60 a) generator provides cyclotron-independent access to positron-emitting {sup 44}Sc (T{sub 1/2}=3.97 d) for PET imaging. This work aims to post-elution processing of initial {sup 44}Sc generator eluates in order to reduce its volume, HCl concentration and remove the oxalate anions. The on-line adsorption of {sup 44}Sc on cationic resin AG 50W-X8 (200-400 mesh, H{sup +}-form) is achieved with >98% efficacy. Subsequently, the purified {sup 44}Sc is desorbed by using 3 ml of 0.25 M ammonium acetate (pH=4.0). The post-processing takes 10 min. The overall yield of the post-processing reached 90%, which is referred to the {sup 44}Sc obtained from the {sup 44}Ti/{sup 44}Sc generator. In addition to the chemical purification, the content of {sup 44}Ti breakthrough was further reduced by one order of magnitude. The 185 MBq generator finally provides 150 MBq of {sup 44}Sc containing <10 Bq of {sup 44}Ti ready for labeling.

  16. Heterogeneity of abnormal prion protein (PrP(Sc)) in murine scrapie prions determined by PrP(Sc)-specific monoclonal antibodies.

    Science.gov (United States)

    Ushiki-Kaku, Yuko; Shimizu, Yoshihisa; Tabeta, Naoko; Iwamaru, Yoshifumi; Ogawa-Goto, Kiyoko; Hattori, Shunji; Yokoyama, Takashi

    2014-03-01

    In prion diseases, abnormal prion protein (PrP(Sc)) is considered as the main component of the infectious agent. Delineation of PrP(Sc) conformation is expected to be a critical factor in understanding properties of prions. However, practical methods to differentiate between conformers of PrP(Sc) are inadequate. Here, we used two PrP(Sc)-specific monoclonal antibodies (mAbs), 3B7 and 3H6, and found that mAb 3H6 detected a limited portion of PrP(Sc) in five mice-adapted prion strains. The quantity of mAb 3H6-precipitated PrP(Sc) was significantly lesser in 22L compared to other strains. This result provides a direct evidence of the conformational heterogeneity of PrP(Sc) within the prion strains. Conformation-specific probes, like these mAbs, have the potential to be powerful tools for investigating conformational variations in PrP(Sc).

  17. THE SC7/SC14 GENE FAMILY OF SCHIZOPHYLLUM-COMMUNE CODES FOR EXTRACELLULAR PROTEINS SPECIFICALLY EXPRESSED DURING FRUIT-BODY FORMATION

    NARCIS (Netherlands)

    SCHUREN, FHJ; ASGEIRSDOTTIR, SA; KOTHE, EM; SCHEER, JMJ; WESSELS, JGH

    The Sc7 and Sc14 genes are specifically expressed in the dikaryon of the basidiomycete fungus Schizophyllum commune during fruiting. These genes are closely linked (within 6 kb) and highly similar in gene structure and nucleotide sequence (70% identical nucleotides in their coding regions). The

  18. The Effect of SRS on Signal Power in Single-mode Silica Fiber in DWDM Optical Communication System with Equally Spaced Channels

    Institute of Scientific and Technical Information of China (English)

    GONG Jiamin; FANG Qiang; LIU Juan; WANG Yongchang

    2000-01-01

    Assuming that the Raman gain profile of silica fiber is a triangular function, we derive analytic solutions of N-channel steady-state forward SRS coupling wave equation with equal (but arbitrary) channel spacing. Considering the SRS cross coupling among N-channels, the analytic solutions are applicable to arbitrary signal light power. The results point out that the sequence mi=pi(z)/pi(0) [pi(z) and pi(0) is the power of signal light of i-th channel at transmission length z and 0, respectively. i=1,2,...N] maintains a geometric progression with the common ratio q in the transmission process. The common ratio q varies as a exponential function of the effective transmission length, the sum of input light power and the channel spacing, respectively.

  19. Technical standard: Management of radioactive waste at the SRS storage/disposal facilities, 643-7G, 643-29G, 709-2G

    Energy Technology Data Exchange (ETDEWEB)

    Cook, J.R.

    1990-06-01

    This Standard applies to the storage or disposal of Low-Level Radioactive Waste and Transuranic Waste at the Savannah River Site (SRS) Radioactive Waste Storage/Disposal Facility 643-7G, and to the storage of Mixed Waste at facilities 643-29G and 709-2G. This Standard applies only to current operations. The objective for prescribing the requirements in this Standard is to provide for storage and disposal of radioactive waste at SRS in a manner that will ensure the safety and health of employees and of the public, and that will protect the environment. The Technical Standards and Operational Safety Requirements are the formal instruments for setting boundaries for administrative control of all processes.

  20. Heteroduplex DNA position defines the roles of the Sgs1, Srs2, and Mph1 helicases in promoting distinct recombination outcomes.

    Science.gov (United States)

    Mitchel, Katrina; Lehner, Kevin; Jinks-Robertson, Sue

    2013-01-01

    The contributions of the Sgs1, Mph1, and Srs2 DNA helicases during mitotic double-strand break (DSB) repair in yeast were investigated using a gap-repair assay. A diverged chromosomal substrate was used as a repair template for the gapped plasmid, allowing mismatch-containing heteroduplex DNA (hDNA) formed during recombination to be monitored. Overall DSB repair efficiencies and the proportions of crossovers (COs) versus noncrossovers (NCOs) were determined in wild-type and helicase-defective strains, allowing the efficiency of CO and NCO production in each background to be calculated. In addition, the products of individual NCO events were sequenced to determine the location of hDNA. Because hDNA position is expected to differ depending on whether a NCO is produced by synthesis-dependent-strand-annealing (SDSA) or through a Holliday junction (HJ)-containing intermediate, its position allows the underlying molecular mechanism to be inferred. Results demonstrate that each helicase reduces the proportion of CO recombinants, but that each does so in a fundamentally different way. Mph1 does not affect the overall efficiency of gap repair, and its loss alters the CO-NCO by promoting SDSA at the expense of HJ-containing intermediates. By contrast, Sgs1 and Srs2 are each required for efficient gap repair, strongly promoting NCO formation and having little effect on CO efficiency. hDNA analyses suggest that all three helicases promote SDSA, and that Sgs1 and Srs2 additionally dismantle HJ-containing intermediates. The hDNA data are consistent with the proposed role of Sgs1 in the dissolution of double HJs, and we propose that Srs2 dismantles nicked HJs.

  1. Heteroduplex DNA position defines the roles of the Sgs1, Srs2, and Mph1 helicases in promoting distinct recombination outcomes.

    Directory of Open Access Journals (Sweden)

    Katrina Mitchel

    Full Text Available The contributions of the Sgs1, Mph1, and Srs2 DNA helicases during mitotic double-strand break (DSB repair in yeast were investigated using a gap-repair assay. A diverged chromosomal substrate was used as a repair template for the gapped plasmid, allowing mismatch-containing heteroduplex DNA (hDNA formed during recombination to be monitored. Overall DSB repair efficiencies and the proportions of crossovers (COs versus noncrossovers (NCOs were determined in wild-type and helicase-defective strains, allowing the efficiency of CO and NCO production in each background to be calculated. In addition, the products of individual NCO events were sequenced to determine the location of hDNA. Because hDNA position is expected to differ depending on whether a NCO is produced by synthesis-dependent-strand-annealing (SDSA or through a Holliday junction (HJ-containing intermediate, its position allows the underlying molecular mechanism to be inferred. Results demonstrate that each helicase reduces the proportion of CO recombinants, but that each does so in a fundamentally different way. Mph1 does not affect the overall efficiency of gap repair, and its loss alters the CO-NCO by promoting SDSA at the expense of HJ-containing intermediates. By contrast, Sgs1 and Srs2 are each required for efficient gap repair, strongly promoting NCO formation and having little effect on CO efficiency. hDNA analyses suggest that all three helicases promote SDSA, and that Sgs1 and Srs2 additionally dismantle HJ-containing intermediates. The hDNA data are consistent with the proposed role of Sgs1 in the dissolution of double HJs, and we propose that Srs2 dismantles nicked HJs.

  2. Postoperative perceived health status in adolescent following idiopathic scoliosis surgical treatment: results using the adapted French version of Scoliosis Research Society Outcomes questionnaire (SRS-22).

    Science.gov (United States)

    Chaib, Y; Bachy, M; Zakine, S; Mary, P; Khouri, N; Vialle, R

    2013-06-01

    Assessing functional outcome from patient-based outcomes questionnaires are essential to the evaluation of adolescent idiopathic scoliosis surgical treatment At the minimum follow-up of 2 years, 45 operated on adolescent idiopathic scoliosis patients were mailed the French version of the Scoliosis Research Society Outcome Instrument (SRS-22) questionnaires containing items on pain, activities of daily living, and satisfaction. Mean values of the SRS-22 domains were 3,66 for the Pain domain, 3,85 for the Self-perceived image domain, 4,32 for the Function domain, 3,52 for the Mental health domain and 4,12 for the Global satisfaction with management domain. Mean value of the global SRS-22 score was 3,88. We showed no differences in functional SRS-22 health status in patients according to the type of curve (Lenke classification). We showed statistically significant correlations between the gain of Cobb angle and Patients self-image and function domain scores. There was a statistically significant correlation between preoperative Cobb angle and patient satisfaction with management. Even if Function and Self-image scores in our patients are close to control group values, indicating good short to mid-term outcome of surgical treatment, scores for pain and mental health status were significantly lower in patients than controls. Long-term follow-up studies conducted by multiple surgeons over successive generations are mandatory to assess clinical significance of these differences. Level IV. Retrospective study. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  3. Structural transformations in Sc/Si multilayers irradiated by EUVlasers

    Energy Technology Data Exchange (ETDEWEB)

    Voronov, D.L.; Zubarev, E.N.; Pershyn, Y.P.; Sevryukova, V.A.; Kondratenko, V.V.; Vinogradov, A.V.; Artioukov, I.A.; Uspenskiy, Y.A.; Grisham, M.; Vaschenko, G.; Menoni, C.S.; Rocca, J.J.

    2007-08-21

    Multilayer mirrors for the extreme ultraviolet (EUV) are keyelements for numerous applications of coherent EUV sources such as newtabletop lasers and free-electron lasers. However the field ofapplications is limited by the radiation and thermal stability of themultilayers. Taking into account the growing power of EUV sources thestability of the optics becomes crucial. To overcome this problem it isnecessary to study the degradation of multilayers and try to increasetheir temporal and thermal stability. In this paper we report the resultsof detailed study of structural changes in Sc/Simultilayers when exposedto intense EUV laser pulses. Various types of surface damage such asmelting, boiling, shockwave creation and ablation were observed asirradiation fluencies increase. Cross-sectional TEM study revealed thatthe layer structure was completely destroyed in the upper part ofmultilayer, but still survived below. The layers adjacent tothe substrateremained intact even through the multilayer surface melted down, thoughthe structure of the layers beneath the molten zone was noticeablychanged. The layer structure in this thermally affected zone is similarto that of isothermally annealed samples. All stages of scandium silicideformation such as interdiffusion, solid-state amorphization, silicidecrystallization, etc., are present in the thermally affected zone. Itindicates a thermal nature of the damage mechanism. The tungstendiffusion barriers were applied to the scandium/silicon interfaces. Itwas shown that the barriers inhibited interdiffusion and increased thethermal stability of Sc/Si mirrors.

  4. V-ATPase, ScNhxlp and Yeast Vacuole Fusion

    Institute of Scientific and Technical Information of China (English)

    Quan-Sheng Qiu

    2012-01-01

    Membrane fusion is the last step in trafficking pathways during which membrane vesicles fuse with target organelles to deliver cargos.It is a central cellular reaction that plays important roles in signal transduction,protein sorting and subcellular compartmentation.Recent progress in understanding the roles of ion transporters in vacuole fusion in yeast is summanzed in this article.It is becoming increasingly evident that the vacuolar proton pump V-ATPase and vacuolar Na+/H+ antiporter ScNhxlp are key components of the vacuole fusion machinery in yeast.Yeast ScNhxlp regulates vacuole fusion by controlling the luminal pH.V-ATPases serve a dual role in vacuolar integrity in which they regulate both vacuole fusion and fission reactions in yeast.Fission defects are epistatic to fusion defects.Vacuole fission depends on the proton translocation activity of the V-ATPase; by contrast,the fusion reaction does not need the transport activity but requires the physical presence of the proton pump.Vo,the membrane-integral sector of the V-ATPase,forms trans-complexes between the opposing vacuoles in the terminal phase of vacuole fusion where the Vo trans-complexes build a continuous proteolipid channel at the fusion site to mediate the bilayer fusion.

  5. The first SC-SAGD pilot in the Grosmont

    Energy Technology Data Exchange (ETDEWEB)

    Solanki, S.C.; Barrett, K.; Riva, D.; Becker, L.; Brindle, G. [Laricina Energy Ltd. (Canada)

    2011-07-01

    In north-eastern Alberta, the Grosmont Formation is an Upper Devonian carbonate succession containing a vast amount of bitumen. In an attempt to exploit this resource, Laricina Energy Ltd. and OSUM Oil Sands Corp. built the first ever solvent-cyclic steam-assisted gravity drainage (SC-SAGD) pilot. In this process, solvent and/or steam are continuously injected at reservoir pressure to heat the reservoir and thus reduce bitumen viscosity. The aim of this paper is to present the pilot project and its initial results. The reservoir's geology, the recovery process, the drilling and completion challenges as well as the design and the operational plan are discussed in this paper. Steam injection started in December 2010 and indications show that the wells are progressing as planned. Results showed an uptime greater than 90% so far and this is expected to further improve in the future. The first SC-SAGD pilot is discussed and early phases showed excellent results from the project.

  6. The SRS2 suppressor of rad6 mutations of Saccharomyces cerevisiae acts by channeling DNA lesions into the RAD52 DNA repair pathway

    Energy Technology Data Exchange (ETDEWEB)

    Schiestl, R.H.; Prakash, S.; Prakash, L. (Univ. of Rochester School of Medicine, NY (USA))

    1990-04-01

    rad6 mutants of Saccharomyces cerevisiae are defective in the repair of damaged DNA, DNA damage induced mutagenesis, and sporulation. In order to identify genes that can substitute for RAD6 function, the authors have isolated genomic suppressors of the UV sensitivity of rad6 deletion (rad6{Delta}) mutations and show that they also suppress the {gamma}-ray sensitivity but not the UV mutagenesis or sporulation defects of rad6. The suppressors show semidominance for suppression of UV sensitivity and dominance for suppression of {gamma}-ray sensitivity. The six suppressor mutations they isolated are all alleles of the same locus and are also allelic to a previously described suppressor of the rad6-1 nonsense mutation, SRS2. They show that suppression of rad6{Delta} is dependent on the RAD52 recombinational repair pathway since suppression is not observed in the rad6{Delta} SRS2 strain containing an additional mutation in either the RAD51, RAD52, RAD54, RAD55 or RAD57 genes. Possible mechanisms by which SRS2 may channel unrepaired DNA lesions into the RAD52 DNA repair pathway are discussed.

  7. Myxomatosis on the Western Plains of Victoria.

    Science.gov (United States)

    Tighe, F G; Edmonds, J W; Nolan, I F; Shepherd, R C; Gocs, A

    1977-10-01

    Myxomatosis on the Western Plains is an enzootic disease in contrast with the epizootic pattern which is general in eastern Australia. The most unusual aspects are the presence of significant numbers of diseased rabbits throughout the winter and the continuously low percentage of rabbits with antibodies to myxoma virus. Climatic and topographic conditions are unsuited to the production of the high densities of mosquitoes necessary for widespread epizootics. Under these conditions the effects of less efficient methods of myxomatosis transmission are apparent. The unusual epidemiology of myxomatosis has resulted in selection for virulence of the virus similar to that which has occurred under summer epizootic conditions. All field strains are now in the mid range of virulence.

  8. Viking 2 Image of Mars Utopian Plain

    Science.gov (United States)

    1976-01-01

    The boulder-strewn field of red rocks reaches to the horizon nearly two miles from Viking 2 on Mars' Utopian Plain. Scientists believe the colors of the Martian surface and sky in this photo represent their true colors. Fine particles of red dust have settled on spacecraft surfaces. The salmon color of the sky is caused by dust particles suspended in the atmosphere. Color calibration charts for the cameras are mounted at three locations on the spacecraft. Note the blue starfield and red stripes of the flag. The circular structure at top is the high-gain antenna, pointed toward Earth. Viking 2 landed September 3, 1976, some 4600 miles from its twin, Viking 1, which touched down on July 20.

  9. Myxomatosis on the Western Plains of Victoria.

    Science.gov (United States)

    Tighe, F. G.; Edmonds, J. W.; Nolan, I. F.; Shepherd, R. C.; Gocs, A.

    1977-01-01

    Myxomatosis on the Western Plains is an enzootic disease in contrast with the epizootic pattern which is general in eastern Australia. The most unusual aspects are the presence of significant numbers of diseased rabbits throughout the winter and the continuously low percentage of rabbits with antibodies to myxoma virus. Climatic and topographic conditions are unsuited to the production of the high densities of mosquitoes necessary for widespread epizootics. Under these conditions the effects of less efficient methods of myxomatosis transmission are apparent. The unusual epidemiology of myxomatosis has resulted in selection for virulence of the virus similar to that which has occurred under summer epizootic conditions. All field strains are now in the mid range of virulence. PMID:20473

  10. A first-principles study of hydrogen interaction and saturation on ScAl{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Samolia, Madhu [Department of Chemistry, Indian Institute of Technology Ropar, Rupnagar 140001 (India); Dhilip Kumar, T.J., E-mail: dhilip@iitrpr.ac.in [Department of Chemistry, Indian Institute of Technology Ropar, Rupnagar 140001 (India)

    2013-03-05

    Graphical abstract: Electrostatic potential superimposed on electron density of H{sub 2}, Al{sub 4} and ScAI{sub 3}. Highlights: ► A first principles calculation on hydrogen interaction and saturation on stable ScAl{sub 3} cluster is performed. ► Sc atom has higher negative charge electron density over Al atom in ScAl{sub 3} from natural bond orbital charge analysis. ► H{sub 2} undergoes dissociative chemisorption on the Sc atop site resulting in Sc–H–AI bridge bond. ► H{sub 2} saturation on Sc site results initially in chemisorption and then physisorption with the maximum loading of 6 molecules resulting in stable ScAl{sub 3}H{sub 12} structure. -- Abstract: Complex metal hydrides are promising hydrogen storage material for mobile applications. The presence of scandium catalysts in complex metal hydrides is found to improve significantly the kinetics of H{sub 2} adsorption and desorption. The exact role of these additives is not completely understood. NMR studies suggests the presence of distorted ScAl{sub 3} phase which is attributed to the enhancement of reversible uptake and release rates of H{sub 2}. In this study, we have investigated the hydrogen interaction and saturation on stable ScAl{sub 3} cluster at various sites using the density functional theory by employing unrestricted B3LYP/6-311++G(d,p) and the GGA-PW91/DNP methods. From natural bond orbital charge analysis and electrostatic potential superimposed on electron density plots, ScAl{sub 3} is found to be more polarized and Sc atom in ScAl{sub 3} cluster has higher negative charge and electron density over Al atoms. H{sub 2} undergoes dissociative chemisorption on the Sc atop site in ScAl{sub 3} resulting in Sc–H–Al bridge structure. The hydrogen saturation is studied by sequential H{sub 2} adsorption on ScAl{sub 3} cluster. In the Sc site, the first H{sub 2} molecule undergoes dissociative chemisorption and further addition results in H{sub 2} physisorption with the maximum loading

  11. Cloning and prokaryotic expression of the NcSRS2 gene from Xinjiang Nc-1 strain of Neospora caninum%犬新孢子虫新疆Nc-1株NcSRS2基因的克隆及原核表达

    Institute of Scientific and Technical Information of China (English)

    杨帆; 陈亮; 王莲芳; 巴音查汗

    2010-01-01

    根据GenBank中犬新孢子虫NcSRS2基因序列设计了1对引物,从新孢子虫病阳性牛血液中提取总DNA,经PCR扩增NcSRS2基因,将其插入原核表达质粒pGEX-4T-2中,重组质粒pGEX-4T-NcSRS2经测序确定后,转入表达菌株BL21,优化其表达条件,并探讨了GST-NcSRS2蛋白的生物活性.结果显示,在37℃条件下,经终浓度为0.5 mmol/L的IPTG诱导表达4 h后,获得融合蛋白.Western-blot分析表明该融合蛋白可与相应抗体发生特异性结合,rELISA检测与弓形虫和布鲁氏菌阳性血清无交叉反应.

  12. Monuments culturels historiques dans la Plaine Roumaine

    Directory of Open Access Journals (Sweden)

    FLORINA GRECU

    2013-10-01

    Full Text Available Ce travail met en évidence le rôle de la position gé ographique dans le développement des objectifs culturels d’importance touristique et sci entifique locale, régionale ou nationale (les géosites culturels. Dans le développement des géos ites culturels de la Plaine Roumaine plusieurs étapes s’individualisent, avec des caractéristiques spécifiques: a l’étape prédaco-romaine avec les géosites néolithiques ; b l’étape daco-romaine , période dans laquelle des villes sont apparues le long des rivières allochtones (Argedava et du D anube (Turnu Magurele et Zimnicea ; c l’étape médiévale , à laquelle sont particulières les villes avec une spécificité architecturelle (Calafat, Braila et Galati et la capitale, Bucarest, fondée en 1459 ; d l’étape moderne des monuments d’une architecture nouvelle ; e l’étape contemporaine / socialiste (1948-1989 ; f l’étape actuelle (après 1989, caractérisée par un mélange d’architectures avec un impact sur l’évolution du phénomène touristique. La Plaine Roum aine, du à ses caractéristiques physico- géographiques et historiques, réunit une palette la rge de géosites culturels qui pourraient se transformer en vrais objectifs touristiques.

  13. Directed evolution of human scFvs in DT40 cells.

    Science.gov (United States)

    Lim, Alfred W Y; Williams, Gareth T; Rada, Cristina; Sale, Julian E

    2016-02-01

    Cells that constitutively diversify their immunoglobulin genes can be used for selection of novel antibodies and for refining existing affinities and specificities. Here, we report an adaptation of the chicken DT40 system wherein its capacity for somatic hypermutation is harnessed to evolve human antibodies expressed as single-chain variable fragments (scFvs). Expression of membrane-anchored scFvs from within the rearranged Igλ locus created self-diversifying scFv libraries from which we could both select scFvs of a desired specificity and evolve both the specificity and affinity of existing scFvs by iterative expansion and selection. From these scFvs, we were able to create fully human IgG antibodies with nanomolar affinities. We further enhanced the functionality of the system by creating a pool of DT40 scFv lines with high levels of mutation driven by the overexpression of a hyperactive variant of activation-induced deaminase. From this library, we successfully isolated scFvs that bound the spliceosome factor CWC15 and the cytokine human IFNγ. Our results demonstrate the flexibility and utility of DT40 for rapid generation of scFv repertoires and efficient selection, evolution and affinity maturation of scFv specificities.

  14. Comparison of indirect ELISA based on recombinant protein NcSRS2 and IFAT for detection of Neospora caninum antibodies in sheep Comparação entre ELISA baseado no antígeno recombinante NcSRS2 e RIFI para detecção de anticorpos de Neospora caninum em ovinos

    Directory of Open Access Journals (Sweden)

    Renato Andreotti

    2009-06-01

    Full Text Available Neospora caninum, an Apicomplexan parasite that can causes abortion, is responsible for considerable economic and reproductive losses in livestock. The purpose of the present study was to determine whether recombinant NcSRS2 is a suitable indirect ELISA antigen for determining specific immune response to N. caninum in sheep. A total of 441 serum samples were subjected to IFAT and rNcSRS2 based-ELISA, with both tests performing similarly. The sensitivity and specificity of indirect ELISA were 98.6 and 98.3%, respectively. The kappa index shows 0.98 concordance between the two tests, which is considered excellent. Seroprevalences of 30.8 and 32.0% were detected by IFAT and indirect ELISA, respectively, showing these tests did not differ significantly on this measure (p > 0.05. Serological analysis showed that HisG tag was detected by Western Blotting recognizing rNcSRS2 protein. The potential value of rNcSRS2-based ELISA as a highly specific and sensitive tool for serological diagnosis is also supported by the strong agreement found between IFAT and ELISA. The results support the potential use of recombinant protein NcSRS2 as an antigen in indirect ELISA in sheep.Neospora caninum é um parasito Apicomplexa que pode causar abortos e é reconhecido como agente importante responsável por perdas econômicas e reprodutivas. Este estudo avaliou a proteína recombinante NcSRS2 como antígeno para ELISA indireto na determinação de resposta imune para N. caninum em ovinos. 441 amostras de soro foram analisadas por IFAT e ELISA indireto com rNcSRS2 e ambos os testes revelaram comportamento similar. A sensibilidade e especificidade de ELISA indireto foram 98,6 e 98,3%, respectivamente. O índice kappa mostrou uma concordância entre os dois testes com valor de 0,98, que é considerado excelente. Prevalências de 30,8 e 32,0% detectadas por IFAT e ELISA indireto, respectivamente, mostraram que os testes não diferiram significativamente nesse aspecto (P

  15. Correlation between heterogeneity index (HI) and gradient index (GI) for high dose stereotactic radiotherapy/radiosurgery (SRT/SRS)

    Science.gov (United States)

    Tas, B.; Durmus, I. F.; Okumus, A.; Uzel, O. E.

    2017-02-01

    To evaluate between Heterogeneity Index (HI) and Gradient Index (GI) correlation for high dose Stereotactic radiotherapy (SRT) / Stereotactic radiosurgery (SRS) using Versa HD® lineer accelerator. Nine patients with single metastasis were used in this study. Patient's treatment planning were performed using Monaco5.1® Treatment planning system (TPS) with non-coplanar 6MV Flattening filter free (FFF) beams by partial Volumetric modulated arc therapy (VMAT) tecnique for each patient. We determined three different size of metastasis catagory which are less than 1cc, between 1cc and 5cc and larger than 5cc volume. Also, three different HI were calculated for each patients. These are 1.10, 1.20 and 1.30. Mean GI was determined 8.57±2.2 for 1.10 HI, 7.23±1.7 for 1.20 HI and 6.0±1.1 for 1.30 HI for less than 1cc metastasis. Then GI was determined 4.77±0.4 for 1.10 HI, 4.37±0.3 for 1.20 HI and 3.97±0.3 for 1.30 HI for between 1cc and 5cc metastasis. Finally, GI was determined 4.00±0.5 for 1.10 HI,3.63±0.5 for 1.20 HI and 3.27±0.4 for 1.30 HI for larger than 5cc metastasis. These results show that GI depends on significantly size and HI of metastasis especially for less than 1cc.

  16. Construction of a eukaryotic expression vector and its expression of NcSAG1-NcSRS2 fusion gene of Neospora caninum%新孢子虫SAG1-SRS2融合基因真核表达质粒的构建及表达

    Institute of Scientific and Technical Information of China (English)

    卢计委; 刘群; 汪明

    2007-01-01

    根据犬新孢子虫NcSAG1-NcSRS2融合基因序列,设计了1对含有Kozak序列、终止密码子、BamH Ⅰ和XhoⅠ酶切位点的引物,以含有NcSAG1-NcSRS2融合基因的质粒pGEX-tNcP43-P36为模板,经PCR 扩增获得NcSAG1-NcSRS2融合基因片段,用BamH Ⅰ和XhoⅠ双酶切该片段,回收得到含有以上2 个酶切位点黏端的NcSAG1-NcSRS2融合基因,将此基因片段克隆至相同酶切回收后的pcDNA3.1 (+) 真核表达载体中,获得重组质粒pcNCSAG1-SRS2.经PCR 鉴定、限制性内切酶酶切分析和克隆片段序列测定、比较,证实了重组质粒的正确性.将构建好的真核表达质粒转染到COS-7细胞中进行瞬时表达,经免疫荧光检测,证实了该载体能在细胞内进行蛋白表达.

  17. Effect of Severe Plastic Deformation on Structure and Properties of Al-Sc-Ta and Al-Sc-Ti Alloys.

    Science.gov (United States)

    Berezina, Alla; Monastyrska, Tetiana; Davydenko, Olexandr; Molebny, Oleh; Polishchuk, Sergey

    2017-12-01

    The comparative analysis of the effect of monotonous and non-monotonous severe plastic deformations (SPD) on the structure and properties of aluminum alloys has been carried out. Conventional hydrostatic extrusion (HE) with a constant deformation direction and equal-channel angular hydroextrusion (ECAH) with an abrupt change in the deformation direction were chosen for the cases of monotonous and non-monotonous SPD, respectively. Model cast hypoeutectic Al-0.3%Sc alloys and hypereutectic Al-0.6%Sc alloys with Ta and Ti additives were chosen for studying. It was demonstrated that SPD of the alloys resulted in the segregation of the material into active and inactive zones which formed a banded structure. The active zones were shown to be bands of localized plastic deformation. The distance between zones was found to be independent of the accumulated strain degree and was in the range of 0.6-1 μm. Dynamic recrystallization in the active zones was observed using TEM. The dynamic recrystallization was accompanied by the formation of disclinations, deformation bands, low-angle, and high-angle boundaries, i.e., rotational deformation modes developed. The dynamic recrystallization was more intense during the non-monotonous deformation as compared with the monotonous one, which was confirmed by the reduction of texture degree in the materials after ECAH.

  18. Tobacco plain packaging: Evidence based policy or public health advocacy?

    Science.gov (United States)

    McKeganey, Neil; Russell, Christopher

    2015-06-01

    In December 2012, Australia became the first country to require all tobacco products be sold solely in standardised or 'plain' packaging, bereft of the manufacturers' trademarked branding and colours, although retaining large graphic and text health warnings. Following the publication of Sir Cyril Chantler's review of the evidence on the effects of plain tobacco packaging, the Ministers of the United Kingdom Parliament voted in March 2015 to implement similar legislation. Support for plain packaging derives from the belief that tobacco products sold in plain packs have reduced appeal and so are more likely to deter young people and non-smokers from starting tobacco use, and more likely to motivate smokers to quit and stay quit. This article considers why support for the plain packaging policy has grown among tobacco control researchers, public health advocates and government ministers, and reviews Australian survey data that speak to the possible introductory effect of plain packaging on smoking prevalence within Australia. The article concludes by emphasising the need for more detailed research to be undertaken before judging the capacity of the plain packaging policy to deliver the multitude of positive effects that have been claimed by its most ardent supporters. Copyright © 2015 Elsevier B.V. All rights reserved.

  19. SC1327-312 & SC1329-313 two galaxy groups in-between a major merging event observed with Beppo-SAX

    CERN Document Server

    Bardelli, S; Ettori, S; Molendi, S; Zucca, E; Colafrancesco, Sergio

    2001-01-01

    We present the results of two Beppo-SAX observations of the poor clusters SC1327-312 and SC1329-313. These objects are located in a huge structure, formed by three ACO clusters, which is probably the remnant of one of the largest and best studied major mergings known. Given the fact that these poor clusters are in between two interacting ACO clusters, the aim of this work is to study the physics of the intracluster medium and to look for the possible presence of shocks. We derived the gas distribution profiles, the global (i.e. within 0.3 Mpc) temperatures and abundances and the temperature profiles and maps for SC1327-312 and SC1329-313. Also the presence of soft excess in LECS and hard excess in PDS have been checked. We do not find evidence of regions where the gas is shocked or significantly heated. The image of SC1327-312 seems rather symmetric, while the gas profile of SC1329-313 shows disturbed, comet-like shaped isophotes, with the tail pointing toward A3562 and a compression toward SC1327-312. The pr...

  20. Perceptions of branded and plain cigarette packaging among Mexican youth.

    Science.gov (United States)

    Mutti, Seema; Hammond, David; Reid, Jessica L; White, Christine M; Thrasher, James F

    2016-01-29

    Plain cigarette packaging, which seeks to remove all brand imagery and standardize the shape and size of cigarette packs, represents a novel policy measure to reduce the appeal of cigarettes. Plain packaging has been studied primarily in high-income countries like Australia and the UK. It is unknown whether the effects of plain packaging may differ in low-and-middle income countries with a shorter history of tobacco regulation, such as Mexico. An experimental study was conducted in Mexico City to examine perceptions of branded and plain cigarette packaging among smoking and non-smoking Mexican adolescents (n = 359). Respondents were randomly assigned to a branded or plain pack condition and rated 12 cigarette packages for appeal, taste, harm to health and smoker-image traits. As a behavioral measure of appeal, respondents were offered (although not given) four cigarette packs (either branded or plain) and asked to select one to keep. The findings indicated that branded packs were perceived to be more appealing (β = 3.40, p < 0.001) and to contain better tasting cigarettes (β = 3.53, p < 0.001), but were not perceived as less harmful than plain packs. Participants rated people who smoke the branded packs as having relatively more positive smoker-image traits overall (β = 2.10, p < 0.001), with particularly strong differences found among non-smokers for the traits 'glamorous', 'stylish', 'popular' and 'sophisticated' (p < 0.001). No statistically significant difference was found for the proportion of youth that accepted when offered branded compared with plain packs. These results suggest that plain packaging may reduce brand appeal among Mexican youth, consistent with findings in high-income countries.

  1. Preparation and characterization of Sc doped MgB2 wires

    Science.gov (United States)

    Grivel, J.-C.; Burdusel, M.

    2016-09-01

    The in-situ technique was used to manufacture scandium (Sc) doped MgB2 wires in a composite Cu-Nb sheath. After reaction at 700 °C, at most 1 at.% Mg was replaced by Sc in the MgB2 phase, without significant influence on its superconducting transition temperature. For higher Sc concentrations in the nominal composition, the formation of Sc-rich impurity phases was evidenced by SEM/EDS observations. The critical current density and accommodation field of the wires are weakly dependant on the Sc content. It is believed that these effects are related more to modifications of the thermal behaviour of the precursor powders revealed by DTA measurements than to actual doping. The best performance was obtained in a wire with Mg:Sc = 0.995_0.005 atomic ratio.

  2. In vitro neutralization of prions with PrP(Sc)-specific antibodies.

    Science.gov (United States)

    Taschuk, Ryan; Van der Merwe, Jacques; Marciniuk, Kristen; Potter, Andrew; Cashman, Neil; Griebel, Philip; Napper, Scott

    2015-01-01

    Prion diseases reflect the misfolding of a self-protein (PrP(C)) into an infectious, pathological isomer (PrP(Sc)). By targeting epitopes uniquely exposed by misfolding, our group developed PrP(Sc)-specific vaccines to 3 disease specific epitopes (DSEs). Here, antibodies induced by individual DSE vaccines are evaluated for their capacity to neutralize prions in vitro. For both purified antibodies and immunoreactive sera, the PrP(Sc)-specific antibodies were equally effective in neutralizing prions. Further, there was no significant increase in neutralizing activity when multiple DSEs were targeted within an assay. At a low antibody concentration, the PrP(Sc)-specific antibodies matched the neutralization achieved by an antibody that may act via both PrP(C) and PrP(Sc). At higher doses, however, this pan-specific antibody was more effective, potentially due to a combined deactivation of PrP(Sc) and depletion of PrP(C).

  3. Sulfated dextrans enhance in vitro amplification of bovine spongiform encephalopathy PrP(Sc and enable ultrasensitive detection of bovine PrP(Sc.

    Directory of Open Access Journals (Sweden)

    Yuichi Murayama

    Full Text Available BACKGROUND: Prions, infectious agents associated with prion diseases such as Creutzfeldt-Jakob disease in humans, bovine spongiform encephalopathy (BSE in cattle, and scrapie in sheep and goats, are primarily comprised of PrP(Sc, a protease-resistant misfolded isoform of the cellular prion protein PrP(C. Protein misfolding cyclic amplification (PMCA is a highly sensitive technique used to detect minute amounts of scrapie PrP(Sc. However, the current PMCA technique has been unsuccessful in achieving good amplification in cattle. The detailed distribution of PrP(Sc in BSE-affected cattle therefore remains unknown. METHODOLOGY/PRINCIPAL FINDINGS: We report here that PrP(Sc derived from BSE-affected cattle can be amplified ultra-efficiently by PMCA in the presence of sulfated dextran compounds. This method is capable of amplifying very small amounts of PrP(Sc from the saliva, palatine tonsils, lymph nodes, ileocecal region, and muscular tissues of BSE-affected cattle. Individual differences in the distribution of PrP(Sc in spleen and cerebrospinal fluid samples were observed in terminal-stage animals. However, the presence of PrP(Sc in blood was not substantiated in the BSE-affected cattle examined. CONCLUSIONS/SIGNIFICANCE: The distribution of PrP(Sc is not restricted to the nervous system and can spread to peripheral tissues in the terminal disease stage. The finding that PrP(Sc could be amplified in the saliva of an asymptomatic animal suggests a potential usefulness of this technique for BSE diagnosis. This highly sensitive method also has other practical applications, including safety evaluation or safety assurance of products and byproducts manufactured from bovine source materials.

  4. Sustainable Authorship in Plain Text using Pandoc and Markdown

    Directory of Open Access Journals (Sweden)

    Dennis Tenen

    2014-03-01

    Full Text Available In this tutorial, you will first learn the basics of Markdown—an easy to read and write markup syntax for plain text—as well as Pandoc, a command line tool that converts plain text into a number of beautifully formatted file types: PDF, .docx, HTML, LaTeX, slide decks, and more.1 With Pandoc as your digital typesetting tool, you can use Markdown syntax to add figures, a bibliography, formatting, and easily change citation styles from Chicago to MLA (for instance, all using plain text.

  5. Temperature Variation of Jiamusi Region in Sanjiang Plain

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    [Objective] The study aimed at analysing the change characteristics of temperature in Jiamusi region of Sanjiang Plain.[Method] Based on temperature data of Jiamusi region in Sanjiang Plain from 1961 to 2010,including Jiamusi,Huanan,Fujin and Fuyuan station,we studied the change trends,abrupt climate change and abnormal years of temperature in Jiamusi region.[Result] Annual average temperature of Jiamusi region in Sanjiang Plain showed increasing trend,with the increase of 0.249-0.412 ℃/10 a.The order of an...

  6. Toward low-cost affinity reagents: lyophilized yeast-scFv probes specific for pathogen antigens.

    Directory of Open Access Journals (Sweden)

    Sean A Gray

    Full Text Available The generation of affinity reagents, usually monoclonal antibodies, remains a critical bottleneck in biomedical research and diagnostic test development. Recombinant antibody-like proteins such as scFv have yet to replace traditional monoclonal antibodies in antigen detection applications, in large part because of poor performance of scFv in solution. To address this limitation, we have developed assays that use whole yeast cells expressing scFv on their surfaces (yeast-scFv in place of soluble purified scFv or traditional monoclonal antibodies. In this study, a nonimmune library of human scFv displayed on the surfaces of yeast cells was screened for clones that bind to recombinant cyst proteins of Entamoeba histolytica, an enteric pathogen of humans. Selected yeast-scFv clones were stabilized by lyophilization and used in detection assay formats in which the yeast-scFv served as solid support-bound monoclonal antibodies. Specific binding of antigen to the yeast-scFv was detected by staining with rabbit polyclonal antibodies. In flow cytometry-based assays, lyophilized yeast-scFv reagents retained full binding activity and specificity for their cognate antigens after 4 weeks of storage at room temperature in the absence of desiccants or stabilizers. Because flow cytometry is not available to all potential assay users, an immunofluorescence assay was also developed that detects antigen with similar sensitivity and specificity. Antigen-specific whole-cell yeast-scFv reagents can be selected from nonimmune libraries in 2-3 weeks, produced in vast quantities, and packaged in lyophilized form for extended shelf life. Lyophilized yeast-scFv show promise as low cost, renewable alternatives to monoclonal antibodies for diagnosis and research.

  7. File list: ALL.PSC.50.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.50.AllAg.EpiSC mm9 All antigens Pluripotent stem cell EpiSC SRX535239,SRX53...RX590290,SRX590286,SRX661084,SRX1074905,SRX1074908,SRX535237,SRX535241,SRX661085,SRX1074909,SRX1074906 http://dbarchive.biosc...iencedbc.jp/kyushu-u/mm9/assembled/ALL.PSC.50.AllAg.EpiSC.bed ...

  8. File list: ALL.PSC.10.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.10.AllAg.EpiSC mm9 All antigens Pluripotent stem cell EpiSC SRX590288,SRX53...RX590290,SRX1074917,SRX1074916,SRX590285,SRX590286,SRX535242,SRX1074908,SRX1074905,SRX535238,SRX535237 http://dbarchive.biosc...iencedbc.jp/kyushu-u/mm9/assembled/ALL.PSC.10.AllAg.EpiSC.bed ...

  9. File list: ALL.PSC.05.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.05.AllAg.EpiSC mm9 All antigens Pluripotent stem cell EpiSC SRX590288,SRX53...RX590290,SRX590289,SRX590285,SRX1074916,SRX1074917,SRX590286,SRX535242,SRX1074908,SRX1074905,SRX535237 http://dbarchive.biosc...iencedbc.jp/kyushu-u/mm9/assembled/ALL.PSC.05.AllAg.EpiSC.bed ...

  10. File list: ALL.PSC.20.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.20.AllAg.EpiSC mm9 All antigens Pluripotent stem cell EpiSC SRX535239,SRX66...RX590289,SRX590285,SRX590290,SRX590286,SRX1074909,SRX1074908,SRX1074905,SRX1074906,SRX535237,SRX535241 http://dbarchive.biosc...iencedbc.jp/kyushu-u/mm9/assembled/ALL.PSC.20.AllAg.EpiSC.bed ...

  11. DC-SC Photoinjector with Low Emittance at Peking University

    CERN Document Server

    Xiang Rong; Hao, J; Huang, Senlin; Lu Xiang Yang; Quan, Shengwen; Zhang, Baocheng; Zhao, Kui

    2005-01-01

    High average power Free Electron Lasers require the high quality electron beams with the low emittance and the sub-picosecond bunches. The design of DC-SC photoinjector, directly combining a DC photoinjector with an SRF cavity, can produce high average current beam with moderate bunch charge and high duty factor. Because of the DC gun, the emittance increases quickly at the beginning, so a carefully design is needed to control that. In this paper, the simulation of an upgraded design has been done to lower the normalized emittance below 1.5mm·mrad. The photoinjector consists of a DC gap and a 2+1/2-cell SRF cavity, and it is designed to produce 4.2 MeV electron beams at 100pC bunch charge and 81.25MHz repetition rate (8 mA average current).

  12. Domain structure and phase transition in Sc-doped zirconia

    Science.gov (United States)

    Brunauer, G.; Boysen, H.; Frey, F.; Ehrenberg, H.

    2002-01-01

    The temperature dependence of the domain structure associated with the ferroelastic phase transition (Fm↔R bar 3 m) in ZrO2 doped with 11% Sc2O3 has been determined from a peak shape analysis of high-resolution synchrotron x-ray powder diffraction data. In the temperature region of coexisting phases the observed characteristic anisotropic broadening and asymmetry of the lines is modelled by three different phases: a main rhombohedral phase, a distorted rhombohedral phase with a smaller c/a ratio, and a cubic phase. The latter two are assigned to the internal structure of the domain walls between two adjacent twin domains. The size and amount of the cubic phase show an initially slow increase with temperature followed by a very steep increase and a slow one after that. The size of the (main) rhombohedral domains remains nearly constant, while (micro-) strain in the distorted regions gradually decreases.

  13. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    Clausen, Johan Christian

    The following pages contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short master projects as well as regular 3rd...... semester projects at the M.Sc. programme in Civil and Structural Engineering. Each project description provides a brief overview of the purpose as well as the main activities. Further, a weighting between theoretical analysis, experimental work and computer modelling has been proposed. Usually...... page. Furthermore, other ideas for projects may be discussed with a potential supervisor. Many private engineering companies have a homepage on which they state that they would like to collaborate with students on a master project....

  14. Final Report for DOE Grant Number DE-SC0001481

    Energy Technology Data Exchange (ETDEWEB)

    Liang, Edison [Rice University

    2013-12-02

    This report covers research activities, major results and publications supported by DE-SC-000-1481. This project was funded by the DOE OFES-NNSA HEDLP program. It was a joint research program between Rice University and the University of Texas at Austin. The physics of relativistic plasmas was investigated in the context of ultra-intense laser irradiation of high-Z solid targets. Laser experiments using the Texas Petawatt Laser were performed in the summers of 2011, 2012 and 2013. Numerical simulations of laser-plasma interactions were performed using Monte Carlo and Particle-in-Cell codes to design and support these experiments. Astrophysical applications of these results were also investigated.

  15. Mean pion multiplicities in Ar+Sc collisions

    CERN Document Server

    Naskręt, Michał

    2016-01-01

    Preliminary results for mean negatively charged pion multiplicities $\\langle \\pi^- \\rangle$ using the $h^-$ method are presented for central Ar+Sc collisions at 13, 19, 30, 40, 75 and 150\\textit{A} GeV/c beam momentum. The data were recorded by the NA61/SHINE detector at the CERN SPS. Starting with rapidity distributions ${dn}/{dy}$ the procedure of obtaining total multiplicities is presented. The mean number of wounded nucleons $\\langle W\\rangle$ extracted from the Glissando MC model is used to calculate the ratio $\\langle \\pi^- \\rangle/\\langle W\\rangle.$ The results are compared to those from other experiments and their dependence on colliding systems and collision energy is discussed.

  16. Ferromagnetism carried by highly delocalized hybrid states in Sc-doped ZnO thin films

    KAUST Repository

    Benali Kanoun, Mohammed

    2012-05-29

    We present first-principles results for Sc-doped ZnOthin films. Neighboring Sc atoms in the surface and/or subsurface layers are found to be coupled ferromagnetically, where only two of the possible configurations induce spin polarization. In the first configuration, the polarization is carried by the Sc d states as expected for transition metaldoping. However, there is a second configuration which is energetically favorable. It is governed by polarized hybrid states of the Zns, O p, and Sc d orbitals. Such highly delocalized states can be an important ingredient for understanding the magnetism of dopedZnOthin films.

  17. Atomic bonding and mechanical properties of Al-Mg-Zr-Sc alloy

    Institute of Scientific and Technical Information of China (English)

    高英俊; 班冬梅; 韩永剑; 钟夏平; 刘慧

    2004-01-01

    The valence electron structures of Al-Mg alloy with minor Sc and Zr were calculated according to the empirical electron theory(EET) in solid. The results show that because of the strong interaction of Al atom with Zr and Sc atom in melting during solidification, the Al3 Sc and Al3 (Sc1-xZrx) particles which act as heterogeneous nuclear are firstly crystallized in alloy to make grains refine. In progress of solidification, the Al-Sc, Al-Zr-Sc segregation regions are formed in solid solution matrix of Al-Mg alloy owing to the strong interaction of Al atom with Zr, Scatoms in bulk of alloy, so in the following homogenization treatment, the finer dispersed Al3 Sc and Al3 (Sc1-x Zrx) second-particles which are coherence with the matrix are precipitated in the segregation region. These finer second particles with the strong Al-Zr, Al-Sc covalent bonds can strengthen the covalent bonds in matrix of the alloy, and also enhance the hardness and strength of Al-Mg alloy. Those finer second-particles precipitated in interface of sub-grains can also strengthen the covalence bonds there, and effectively hinder the interface of sub-grains from migrating and restrain the sub-grains from growing, and cause better thermal stability of Al-Mg alloy.

  18. Model of Dees and Rotco for the 600 MeV SC

    CERN Multimedia

    CERN PhotoLab

    1978-01-01

    The accelerating frequency of the 600 MeV Synchro-Cyclotron (SC) was modulated by the varying capacity of a rotating condenser ("Rotco", the most delicate component of the SC). A 1/5-scale model, dating from the design-period of the SC, was used to study improvements to the SC RF-system, and also the acceleration of ions, first Helium and, at the time of this picture, Carbon. In the middle of the picture is the case containing the Dees. To the left, at the wide end of the cone, a rotco. Reinhold Hohbach is busy with measurements. See also 7805235 (Annual Report 1978, p.110).

  19. Nuclear Level Density and Gamma-Ray Strength Function of 43Sc

    CERN Document Server

    Bürger, A; Hilaire, S; Guttormsen, M; Harissopulos, S; Kmiecik, M; Konstantinopoulos, T; Krticka, M; Lagoyannis, A; Lönnroth, T; Mazurek, K; Norrby, M; Nyhus, H T; Perdikakis, G; Siem, S; Spyrou, A; Syed, N U H; 10.1103/PhysRevC.85.064328

    2012-01-01

    The nuclear level density and the gamma-ray strength function have been determined for 43Sc in the energy range up to 2 MeV below the neutron separation energy using the Oslo method with the 46Ti(p,alpha)43Sc reaction. A comparison to 45Sc shows that the level density of 43Sc is smaller by an approximately constant factor of two. This behaviour is well reproduced in a microscopical/combinatorial model calculation. The gamma-ray strength function is showing an increase at low gamma-ray energies, a feature which has been observed in several nuclei but which still awaits theoretical explanation.

  20. Great Plains Wind Energy Transmission Development Project

    Energy Technology Data Exchange (ETDEWEB)

    Brad G. Stevens, P.E.; Troy K. Simonsen; Kerryanne M. Leroux

    2012-06-09

    In fiscal year 2005, the Energy & Environmental Research Center (EERC) received funding from the U.S. Department of Energy (DOE) to undertake a broad array of tasks to either directly or indirectly address the barriers that faced much of the Great Plains states and their efforts to produce and transmit wind energy at the time. This program, entitled Great Plains Wind Energy Transmission Development Project, was focused on the central goal of stimulating wind energy development through expansion of new transmission capacity or development of new wind energy capacity through alternative market development. The original task structure was as follows: Task 1 - Regional Renewable Credit Tracking System (later rescoped to Small Wind Turbine Training Center); Task 2 - Multistate Transmission Collaborative; Task 3 - Wind Energy Forecasting System; and Task 4 - Analysis of the Long-Term Role of Hydrogen in the Region. As carried out, Task 1 involved the creation of the Small Wind Turbine Training Center (SWTTC). The SWTTC, located Grand Forks, North Dakota, consists of a single wind turbine, the Endurance S-250, on a 105-foot tilt-up guyed tower. The S-250 is connected to the electrical grid on the 'load side' of the electric meter, and the power produced by the wind turbine is consumed locally on the property. Establishment of the SWTTC will allow EERC personnel to provide educational opportunities to a wide range of participants, including grade school through college-level students and the general public. In addition, the facility will allow the EERC to provide technical training workshops related to the installation, operation, and maintenance of small wind turbines. In addition, under Task 1, the EERC hosted two small wind turbine workshops on May 18, 2010, and March 8, 2011, at the EERC in Grand Forks, North Dakota. Task 2 involved the EERC cosponsoring and aiding in the planning of three transmission workshops in the midwest and western regions. Under Task

  1. Reliability and validity of chinese version of scoliosis research society-22(SRS-22)patient questionnaire%脊柱侧凸研究会-22问卷(SRS-22)中文版的信度及效度分析

    Institute of Scientific and Technical Information of China (English)

    邱勇; 刘臻; 孙强; 陈文俊; 陈海鸥; 曹兴兵; 邵翔; 孙明辉

    2008-01-01

    Objecfive To evaluate the validity and reliability of Chinese version of SRS-22 patient questionnaire.Methods The English version of the SRS-22 questionnaire was adapted to Chinese according to the International Quality of Lifc Assessment Project guidelines.and the final version was decided by the surgical experts of spine.126 subjects(35 males and 91 females,mean age,14.5 years)with adolescent idiopathic scoliosis filled the questionnaire.The curve magnitude was 33°(15°to 58°).A subgroup of 35 patients completed the questionnaire again l week later.Internal consistency.reproducibility were determined with Cronbach'S acoefficient and interclass correlation coefficient.respectively.The SRS-22 scores by treatments was also assessed.Results Coefficients for individual domains were as follows:function/activity (0.49),pain(0.73),self-image(0.67),mental health(0.78),and satisfaction(0.48).The test-retest correlation coefficients for individual domains were as follows:function(0.80),pain(0.68),self-image(0.82),mental health (0.81),and satisfaction (0.78).The ceiling effects were found high in all domains.Patients in the surgery group had the highest satisfaction score and the lowest function/activity score.Conclusion Because of the differences between cultures and values,the Chinese version of SRS-22 patient questionnaire may need improvements and the large-scale follow-up.%目的 用中文版SRS-22问卷评估巾国青少年特发性脊柱侧凸患者的牛活质量,考察SRS-22问卷中文版的信度及效度.方法 根据国际生活质量评估计划的规定,将SRS-22问卷英文版译成中文,并由脊柱外科专家讨论后确定最终版本.共有126例青少年特发性脊梓侧凸患者完成了SRS-22问卷中文版测试,男35例,女91例;年龄10~20岁,平均14.5岁;Cobb角15°~58°,平均为33°.为了完成对该问卷重测信度的评估,35例患者1周后进行了第2次问卷调查.SRS-22问卷中义版各领域的内部一致性通过Cronbach

  2. The Great Plains IDEA Gerontology Program: An Online, Interinstitutional Graduate Degree

    Science.gov (United States)

    Sanders, Gregory F.

    2011-01-01

    The Great-Plains IDEA Gerontology Program is a graduate program developed and implemented by the Great Plains Interactive Distance Education Alliance (Great Plains IDEA). The Great Plains IDEA (Alliance) originated as a consortium of Colleges of Human Sciences ranging across the central United States. This Alliance's accomplishments have included…

  3. The Great Plains IDEA Gerontology Program: An Online, Interinstitutional Graduate Degree

    Science.gov (United States)

    Sanders, Gregory F.

    2011-01-01

    The Great-Plains IDEA Gerontology Program is a graduate program developed and implemented by the Great Plains Interactive Distance Education Alliance (Great Plains IDEA). The Great Plains IDEA (Alliance) originated as a consortium of Colleges of Human Sciences ranging across the central United States. This Alliance's accomplishments have included…

  4. Level III Ecoregions of the Mississippi Alluvial Plain

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions for the Mississippi Alluvial Plain were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in...

  5. Level IV Ecoregions of the Mississippi Alluvial Plain

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions for the Mississippi Alluvial Plain were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in...

  6. Snake River Plain Basin-fill aquifer system

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This data set represents the extent of the Snake River Plain aquifer system, which includes both the basaltic and basin-fill aquifers. This dataset does not...

  7. Particulate Loads Caused by Wind Erosion in the Great Plains

    Science.gov (United States)

    Hagen, Lawrence J.; Woodruff, Neil P.

    1975-01-01

    In this paper the annual flux of suspended particulates caused by wind erosion in the Great Plains is estimated. This study demonstrated that climate causes wide variations in air pollution from wind erosion. (BT)

  8. Physiography for the Mid-Atlantic Coastal Plain

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Physiography for the Mid-Atlantic Coastal Plain was constructed by standardizing and extrapolating previous physiographic interpretations for areas within and...

  9. Subcropping Geology for the Mid-Atlantic Coastal Plain

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Subcropping geology for the Mid-Atlantic Coastal Plain was compiled and interpreted from available published sources. Formation contacts were interpolated across...

  10. Whooping crane stopover site use intensity within the Great Plains

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Whooping cranes (Grus americana) of the Aransas- Wood Buffalo population migrate twice each year through the Great Plains in North America. Recovery activities for...

  11. Southern Great Plains rapid ecoregional assessment : Pre-assessment report

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The purpose of the Pre-Assessment Report for the Southern Great Plains Rapid Ecoregional Assessment (REA) is to document the selection process for and final list of...

  12. 49 CFR 215.111 - Defective plain bearing.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Freight Car Components Suspension System § 215.111 Defective plain bearing. A railroad may not place or continue in service a car, if the car...

  13. Aerial Images of Alaska's Arctic Coastal Plain; 1974-1979

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This dataset is comprised of 10 aerial images of three different study areas on Alaska's Arctic Coastal Plain flown by NASA in 1974, 1977, 1979 and obtained from the...

  14. Vegetation - Carrizo Plain ER, 2005 - 2008 [ds561

    Data.gov (United States)

    California Department of Resources — The Vegetation Map of the Carrizo Plain Ecological Reserve, San Luis Obispo County, California was created by the California Department of Fish and Game (DFG)...

  15. Base of aquifer contours for the Northern High Plains aquifer

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Several pre-existing datasets that characterize portions of the Northern High Plains aquifer base were merged together in order to define the entire base of the...

  16. Analysis of High Plains Resource Risk and Economic Impacts

    Energy Technology Data Exchange (ETDEWEB)

    Tidwell, Vincent C. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Vargas, Vanessa N [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Jones, Shannon M [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Dealy, Bern Caudill [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Shaneyfelt, Calvin [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Smith, Braeton James [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Moreland, Barbara Denise [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2016-04-01

    The importance of the High Plains Aquifer is broadly recognized as is its vulnerability to continued overuse. T his study e xplore s how continued depletions of the High Plains Aquifer might impact both critical infrastructure and the economy at the local, r egional , and national scale. This analysis is conducted at the county level over a broad geographic region within the states of Kansas and Nebraska. In total , 140 counties that overlie the High Plains Aquifer in these two states are analyzed. The analysis utilizes future climate projections to estimate crop production. Current water use and management practices are projected into the future to explore their related impact on the High Plains Aquifer , barring any changes in water management practices, regulat ion, or policy. Finally, the impact of declining water levels and even exhaustion of groundwater resources are projected for specific sectors of the economy as well as particular elements of the region's critical infrastructure.

  17. 2003 Pearl River County, Mississippi Lidar: Flood Plain Management Project

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This lidar data was collected primarily for flood plain mapping within Pearl River County, MS. The data were processed into separate Bare Earth and First Surface...

  18. Baculovirus display of single chain antibody (scFv using a novel signal peptide

    Directory of Open Access Journals (Sweden)

    Gonzalez Gaëlle

    2010-11-01

    Full Text Available Abstract Background Cells permissive to virus can become refractory to viral replication upon intracellular expression of single chain fragment variable (scFv antibodies directed towards viral structural or regulatory proteins, or virus-coded enzymes. For example, an intrabody derived from MH-SVM33, a monoclonal antibody against a conserved C-terminal epitope of the HIV-1 matrix protein (MAp17, was found to exert an inhibitory effect on HIV-1 replication. Results Two versions of MH-SVM33-derived scFv were constructed in recombinant baculoviruses (BVs and expressed in BV-infected Sf9 cells, N-myristoylation-competent scFvG2/p17 and N-myristoylation-incompetent scFvE2/p17 protein, both carrying a C-terminal HA tag. ScFvG2/p17 expression resulted in an insoluble, membrane-associated protein, whereas scFvE2/p17 was recovered in both soluble and membrane-incorporated forms. When coexpressed with the HIV-1 Pr55Gag precursor, scFvG2/p17 and scFvE2/p17 did not show any detectable negative effect on virus-like particle (VLP assembly and egress, and both failed to be encapsidated in VLP. However, soluble scFvE2/p17 isolated from Sf9 cell lysates was capable of binding to its specific antigen, in the form of a synthetic p17 peptide or as Gag polyprotein-embedded epitope. Significant amounts of scFvE2/p17 were released in the extracellular medium of BV-infected cells in high-molecular weight, pelletable form. This particulate form corresponded to BV particles displaying scFvE2/p17 molecules, inserted into the BV envelope via the scFv N-terminal region. The BV-displayed scFvE2/p17 molecules were found to be immunologically functional, as they reacted with the C-terminal epitope of MAp17. Fusion of the N-terminal 18 amino acid residues from the scFvE2/p17 sequence (N18E2 to another scFv recognizing CD147 (scFv-M6-1B9 conferred the property of BV-display to the resulting chimeric scFv-N18E2/M6. Conclusion Expression of scFvE2/p17 in insect cells using a BV

  19. SU-D-BRB-04: Plan Quality Comparison of Intracranial Stereotactic Radiosurgery (SRS) for Gamma Knife and VMAT Treatments

    Energy Technology Data Exchange (ETDEWEB)

    Keeling, V; Algan, O; Ahmad, S; Hossain, S [University of Oklahoma Health Sciences Center, Oklahoma City, OK (United States)

    2015-06-15

    Purpose: To compare treatment plan quality of intracranial stereotactic radiosurgery (SRS) for VMAT (RapidArc) and Gamma Knife (GK) systems. Methods: Ten patients with 24 tumors (seven with 1–2 and three with 4–6 lesions), previously treated with GK 4C (prescription doses ranging from 14–23 Gy) were re-planned for RapidArc. Identical contour sets were kept on MRI images for both plans with tissues assigned a CT number of zero. RapidArc plans were performed using 6 MV flattening-filter-free (FFF) beams with dose rate of 1400 MU/minute using two to eight arcs with the following combinations: 2 full coplanar arcs and the rest non-coplanar half arcs. Beam selection was based on target depth. Areas that penetrated more than 10 cm of tissue were avoided by creating smaller arcs or using avoidance sectors in optimization. Plans were optimized with jaw tracking and a high weighting to the normal-brain-tissue and Normal-Tissue-Objective without compromising PTV coverage. Plans were calculated on a 1 mm grid size using AAA algorithm and then normalized so that 99% of each target volume received the prescription dose. Plan quality was assessed by target coverage using Paddick Conformity Index (PCI), sparing of normal-brain-tissue through analysis of V4, V8, and V12 Gy, and integral dose. Results: In all cases critical structure dose criteria were met. RapidArc had a higher PCI than GK plans for 23 out of 24 lesions. The average PCI was 0.76±0.21 for RapidArc and 0.46±0.20 for GK plans (p≤0.001), respectively. Integral dose and normal-brain-tissue doses for all criteria were lower for RapidArc in nearly all patients. The average ratio of GK to RapidArc plans was 1.28±0.27 (p=0.018), 1.31±0.25 (p=0.017), 1.81±0.43 (p=0.005), and 1.50±0.61 (p=0.006) for V4, V8, and V12 Gy, and integral dose, respectively. Conclusion: VMAT was capable of producing higher quality treatment plans than GK when using optimal beam geometries and proper optimization techniques.

  20. Some tactile comfort properties of plain knitted fabrics

    OpenAIRE

    Stanković, Snežana; Bizjak, Matejka

    2011-01-01

    The sensory perception of textile materials is related to mechanical stimuli due to pressure and friction forces, so the softness and surface properties are considered to be the key parameters of fabric hand. The aim of this study was to investigate the influence of the fibre type, yarn structure and spinning technique on softness and surface properties of plain knitted fabrics. Plain knitted fabrics (jersey) were produced from the two- assembled hemp, viscose and cotton yarns so as to obtain...

  1. Production of single chain Fab (scFab fragments in Bacillus megaterium

    Directory of Open Access Journals (Sweden)

    Dübel Stefan

    2007-11-01

    Full Text Available Abstract Background The demand on antigen binding reagents in research, diagnostics and therapy raises questions for novel antibody formats as well as appropriate production systems. Recently, the novel single chain Fab (scFab antibody format combining properties of single chain Fv (scFv and Fab fragments was produced in the Gram-negative bacterium Escherichia coli. In this study we evaluated the Gram-positive bacterium Bacillus megaterium for the recombinant production of scFab and scFvs in comparison to E. coli. Results The lysozyme specific D1.3 scFab was produced in B. megaterium and E. coli. The total yield of the scFab after purification obtained from the periplasmic fraction and culture supernatant of E. coli was slightly higher than that obtained from culture supernatant of B. megaterium. However, the yield of functional scFab determined by analyzing the antigen binding activity was equally in both production systems. Furthermore, a scFv fragment with specificity for the human C reactive protein was produced in B. megaterium. The total yield of the anti-CRP scFv produced in B. megaterium was slightly lower compared to E. coli, whereas the specific activity of the purified scFvs produced in B. megaterium was higher compared to E. coli. Conclusion B. megaterium allows the secretory production of antibody fragments including the novel scFab antibody format. The yield and quality of functional antibody fragment is comparable to the periplasmic production in E. coli.

  2. Expression and bioactivity identification of soluble MG7 scFv

    Institute of Scientific and Technical Information of China (English)

    Zhao-Cai Yu; Jie Ding; Bo-Rong Pan; Dai-Ming Fan; Xue-Yong Zhang

    2002-01-01

    AIM: To examine the molecular mass and identify thebioactivity of MG7 scFv for its application as a targetingmediator in gene therapy of gastric cancer.METHODS: Two strongly positive recombinant phage clonesscreened from MG7 recombinant phage antibody library wereseparately transfected into E. coli TG1. Plasmid wasisolated from the transfected E. coli TG1 and digested byEcoR Ⅰ and Hind Ⅲ to examine the length of exogenousscFv gene. Then, the positive recombinant phage cloneswere individually transfected into E. coli HB2151. Thetransfectant was cultured and induced by IPTG. Perplasmicextracts was prepared from the induced transfectant byosmotic shock. ELISA was used to examine the antigen-binding affinity of the soluble MG7 scFv. Immunodottingassay was adopted to evaluate the yield of soluble MG7 scFvproduced by transfected E. coli HB2151. Western blot wasused to examine the molecular mass of MG7 scFv. Finally,the nucleotide sequence of MG7 scFv was examined by DNAsequencing.RESULTS: Two positive recombinant phage clones werefound to contain the exogenous scFv gene. ELISA showedthat MG7 scFv had strong antigen-binding affinity.Immuodotting assay showed that transfected E. coli HB2151could successfully produce the soluble MG7 scFv with highyield via induction by IPTG. The molecular mass of MG7scFv was 30 kDa by western blot. DNA sequencingdemonstrated that the VH and VL genes of MG7 scFv were363bp and 321 bp, respectively.CONCLUSION: We have successfully developed the solubleMG7 scFv which possessed strong antigen-binding affinity.

  3. Facet tropism: comparison of plain film and computed tomography examinations.

    Science.gov (United States)

    Cox, J M; Aspegren, D D; Trier, K K

    1991-01-01

    This study compares the findings of plain film X-ray and computed CT examination in the diagnosis of facet orientation and the presence of tropism. Twenty consecutive patients having lumbar disc disease with sciatica were studied utilizing plain X-ray as well as CT scanning. A chiropractic radiologist read the films to determine if facet facings were sagittally, semi-sagittally or coronally oriented on both CT and plain X-ray study. CT was accepted as the most accurate method to determine the true facet orientation, and plain X-ray interpretation of facet orientation was compared to the CT reading. There was a statistically significant relationship in diagnosing tropism between plain film X-ray and CT readings, with a predictive accuracy that ranged from 58-84% across the three segmental levels. However, the exact concordance of plain film X-ray and CT readings for right and left facet facings was very low. This raises the question of how the profession defines diagnostic accuracy.

  4. Plain packaging of cigarettes: do we have sufficient evidence?

    Science.gov (United States)

    Smith, Collin N; Kraemer, John D; Johnson, Andrea C; Mays, Darren

    2015-01-01

    Tobacco industry marketing is a primary factor influencing cigarette smoking behavior and the cigarette pack has become an important marketing vehicle for tobacco companies. Standardized “plain” cigarette packaging is advocated as a public health policy to prevent and reduce morbidity and mortality caused by smoking by reducing youth smoking initiation and promoting cessation among smokers. Plain packaging was implemented in Australia in December 2012, and several other countries are considering doing so, but each faces foreseeable legal resistance from opponents to such measures. Tobacco companies have challenged these public health policies, citing international trade agreements and intellectual property laws. Decision-making in these court cases will hinge in part on whether the evidence indicates the public health benefits of plain packaging outweigh any potential harm to tobacco manufacturers’ interests. We reviewed the available evidence in support of plain packaging, finding evidence from observational, experimental, and population-based studies. Results indicate that plain packaging can reduce positive perceptions of smoking and dissuade tobacco use. Governments deciding to implement plain cigarette packaging measures can rely on this evidence to help make a strong case that plain packaging plays an important role in the context of comprehensive smoking prevention efforts. PMID:25897269

  5. NiO-ScSZ and Ni 0.9Mg 0.1O-ScSZ-based anodes under internal dry reforming of simulated biogas mixtures

    Science.gov (United States)

    Shiratori, Y.; Sasaki, K.

    Solid oxide fuel cells (SOFCs) with NiO-ScSZ and Ni 0.9Mg 0.1O-ScSZ-based anodes were operated by directly feeding a fuel mixture of CH 4, CO 2 and N 2 (CH 4 to CO 2 ratio of 3:2). Stable operation under constant current load (200 mA cm -2) was achieved with a NiO-ScSZ type anode during 200 h operating hours at 900 °C. Less stable operation occurred with a Ni 0.9Mg 0.1O-ScSZ type anode. In the case of SOFC with Ni 0.9Mg 0.1O-ScSZ as the anode, the methane reforming activity was higher than that with NiO-ScSZ. This was explained by change in the microstructure promoting reforming reactions. However, the addition of MgO resulted in degradation of electrochemical performance due to increase in ohmic resistance of the anode material during operation.

  6. EngenuitySC Commercialization and Entrepreneurial Training Project

    Energy Technology Data Exchange (ETDEWEB)

    Hughes, Meghan; Hutton, Katherine R

    2012-12-31

    A team led by EngenuitySC has performed education and outreach on development of advanced energy markets that will enable wider use of clean energy technologies. This report details the efforts that have made significant advances to improve the market place through education, outreach, and increased communications between industry members. The project resulted in two self-funded industry clusters known as the Fuel Cell Collaborative and NuHub. This project has focused on building and strengthening the leading clean energy clusters in South Carolina: nuclear energy and fuel cell technologies. For the nuclear industry, a new cluster was developed that is now known as NuHub. This cluster has already engaged over 25 nuclear industry leaders or suppliers, four public sector partners, six community economic development foundations, and nearly ten academic partners in a 175 mile radius between Augusta, Georgia and Charlotte, North Carolina. Our outreach has touched over 2,000 stakeholders through the website alone, not including the public audiences and members of the business community reached through news stories and releases that were distributed to over 620 print and online publications. NuHub has established a formal leadership structure, developed subcommittees to focus on industry issues, instituted educational programs for the workforce, and created an industry funding structure that will sustain the industry cluster and mission. NuHub has participated in a wide-variety of community building and outreach activities since its formation under this grant. In the two years since its creation in 2010, we have initiated efforts focused in four main areas that correlate with the four NuHub subcommittees including: innovation, workforce development, industry engagement, and marketing and communications. NuHub successfully raised over $160,000 in both public and private funding, which has supported work to grow the cluster and engage partners including NuScale, Fluor, and

  7. Final Technical Report – DOE Grant DE-SC0005904

    Energy Technology Data Exchange (ETDEWEB)

    Dear, Jody [Connecticut State Univ. System, Hartford, CT (United States)

    2013-10-23

    DOE grant DE-SC0005904 was allocated to fund the faculty development, curriculum development and travel to support the four institutions of the Connecticut State University System’s (CSUS) Initiative for Nanotechnology-related Equipment, Faculty Development and Curriculum Development. DOE grant DE-SC0005072 was also awarded for this program. In 2010, CSUS had identified the establishment of nanotechnology programs and infrastructure as a priority. At that time, the system set the goal of establishing an academic initiative in nanotechnology for the CSUS, beginning with the development of a series of courses at the graduate level. Implementation was planned via a collaborative effort including faculty from all four of the CSUS campuses. The CSUS Nanotechnology Working Group [CSUS NWG] was established to accomplish this goal. A faculty member from the Physics Department at Southern Connecticut State University [SCSU] was assigned the task of organizing and coordinating the work of the CSUS NWG. Representatives from each of the four CSUS campuses were appointed to join the CSUS NWG with the following initial representation: SCSU [Physics and Biology], Western Connecticut State University (WCSU) [Chemistry], Eastern Connecticut State University (ECSU) [Chemistry] and Central Connecticut State University (CCSU) [Chemistry. As a further outcome it was determined that this collaborative effort would lead to the establishment of a formal nanotechnology center, serving as the nucleus of CSUS student and faculty learning and research. This CSUS Nanotechnology Center [CSUS-NC] was to be located at Southern Connecticut State University (SCSU). The goal of this grant was to provide funding for curriculum and faculty development necessary to facilitate the development and implementation of a collaborative Graduate Certificate in Nanotechnology for the Connecticut State University System. This outcome has been successfully achieved. The courses and structure of the Graduate

  8. Structural and electronic studies of metal carbide clusterfullerene Sc2C2@Cs-C72

    Science.gov (United States)

    Feng, Yongqiang; Wang, Taishan; Wu, Jingyi; Feng, Lai; Xiang, Junfeng; Ma, Yihan; Zhang, Zhuxia; Jiang, Li; Shu, Chunying; Wang, Chunru

    2013-07-01

    We present a metal carbide clusterfullerene Sc2C2@Cs(10528)-C72, whose structure has been baffling for many years. A motional endohedral Sc2C2 cluster, special molecule geometry and electronic structure were found in Sc2C2@Cs(10528)-C72. The paramagnetic Sc2C2@Cs-C72 anion radical was successfully prepared by a chemical reduction method and hyperfine couplings in the ESR spectrum were observed.We present a metal carbide clusterfullerene Sc2C2@Cs(10528)-C72, whose structure has been baffling for many years. A motional endohedral Sc2C2 cluster, special molecule geometry and electronic structure were found in Sc2C2@Cs(10528)-C72. The paramagnetic Sc2C2@Cs-C72 anion radical was successfully prepared by a chemical reduction method and hyperfine couplings in the ESR spectrum were observed. Electronic supplementary information (ESI) available: Experimental details, HPLC chromatogram, and DFT calculations. CCDC 917712. For ESI and crystallographic data in CIF or other electronic format see DOI: 10.1039/c3nr01739g

  9. Implementation of LTE SC-FDMA on the USRP2 Software Defined Radio Platform

    DEFF Research Database (Denmark)

    Jørgensen, Peter Bjørn; Hansen, Thomas Lundgaard; Sørensen, Troels Bundgaard;

    2011-01-01

    In this paper we discuss the implementation of a Single Carrier Frequency Division Multiple Access (SC-FDMA) transceiver running over the Universal Software Radio Peripheral 2 (USRP2). SC-FDMA is the air interface which has been selected for the uplink in the latest Long Term Evolution (LTE...

  10. Superconductivity at 3.1 K in the orthorhombic ternary silicide ScRuSi

    Science.gov (United States)

    Ruan, Bin-Bin; Wang, Xiao-Chuan; Yu, Jia; Pan, Bo-Jin; Mu, Qing-Ge; Liu, Tong; Chen, Gen-Fu; Ren, Zhi-An

    2017-02-01

    We report the synthesis, crystal structure, superconductivity and physical property characterizations of the ternary equiatomic compound ScRuSi. Polycrystalline samples of ScRuSi were prepared by an arc-melting method. The as-prepared samples were identified as the orthorhombic Co2P-type o-ScRuSi by powder x-ray diffraction analysis. Electrical resistivity measurements show o-ScRuSi to be a metal which superconducts below a T c of 3.1 K; the upper critical field μ 0 H c2(0) is estimated to be 0.87 T. The magnetization and specific heat measurements confirm the bulk type-II superconductivity in o-ScRuSi, with a specific heat jump within the BCS weak coupling limit. o-ScRuSi is the first Co2P-type superconductor to contain scandium. After annealing at 1273 K for a week, o-ScRuSi transforms into hexagonal Fe2P-type h-ScRuSi, which is a Pauli-paramagnetic metal with no superconductivity observed above 1.8 K.

  11. Characterization of early transient accumulation of PrP(Sc) in immune cells.

    Science.gov (United States)

    Elhelaly, Abdelazim Elsayed; Inoshima, Yasuo; Ishiguro, Naotaka

    2013-09-27

    PrP(Sc) is known to elicit no specific immune response and the immune cells are suspected to support its accumulation. In the present study, we investigated the response of some immune cell types to PrP(Sc) to characterize an observed early transient accumulation of PrP(Sc). After cells were treated with PrP(Sc)-brain homogenate, PrP(Sc) was transiently accumulated for the first 8-12h post-exposure then completely cleared by the 5th day of the experiment. The accumulated PrP(Sc) was not a de novo product of the cell PrP(C). Further investigation of this phenomenon revealed some potential factors influencing it. These factors included cholesterol homeostasis, temperature, the degradation power of the cell and the availability of sufficient PrP(C). Our in vitro results suggest that immune cells, especially macrophages are potential risk factors for the accumulation and intercellular spread of PrP(Sc) if the complete clearance of PrP(Sc) were not fulfilled.

  12. 33 CFR 110.72c - Lake Murray, S.C.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lake Murray, S.C. 110.72c Section 110.72c Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.72c Lake Murray, S.C. (a) The area beginning at the 125...

  13. Hydrogenation reactions using scCO2 as a solvent in microchannel reactors.

    Science.gov (United States)

    Kobayashi, Juta; Mori, Yuichiro; Kobayashi, Shū

    2005-05-28

    We have developed an effective microfluidic system for hydrogenation reactions in scCO(2); the reactions proceeded very rapidly (within 1 second), by making the best use of scCO(2) and utilizing the large specific interfacial area of the microchannel reactor, and high reaction productivity was attained in each channel.

  14. High-efficient physical adsorption and detection of formaldehyde using Sc- and Ti-decorated graphdiyne

    Science.gov (United States)

    Chen, Xi; Gao, Pengfei; Guo, Lei; Wen, Yanni; Fang, Dangqi; Gong, Baihua; Zhang, Yang; Zhang, Shengli

    2017-03-01

    In sensitive analysis, the ultimate limit is to achieve reliable detection on trace amount of molecules. In this work, Sc- and Ti-decorated graphdiyne were proposed as promising materials for high-efficient molecular detection. Using density functional theory calculations, we investigated the electronic response of single Sc- and Ti-atom-decorated graphdiyne to HCHO (as a typical air pollutant). Thermodynamic analysis predicted that Sc or Ti adatom could be stabilized on the corner sites of single-layer graphdiyne sheet, with migration barriers high enough to prevent Sc or Ti adatom aggregation. The adsorption of HCHO on Sc- or Ti-decorated graphdiyne was found stronger than on pristine graphene or graphdiyne, which provides a prerequisite for molecular sensing. The electronegativity of HCHO leads to strong electronic attraction from Sc or Ti adatom to HCHO, resulting in a remarkable decrease of carrier density in graphdiyne. On Ti-decorated graphdiyne, the electronic attraction of HCHO appears to be stronger than on Sc-decorated graphdiyne and changes the system from metal to n-doped semiconductor. Quantum transport calculations show a decrease of current caused by the adsorbed HCHO. The results systematically exhibit the electronic response of Sc- or Ti-decorated graphdiyne to HCHO and suggest them as promising materials for molecule detection.

  15. Curriculum (Study Programme) for the M.Sc., Medialogy, at Aalborg University in Copenhagen

    DEFF Research Database (Denmark)

    Serafin, Stefania; Nordahl, Rolf; Lavatino, Salvatore

    2004-01-01

    Defining and describing the education, M.Sc., Medialogy. The curriculum (Study Programme) describes semesters, themes, projectunits, courses and contents of the eduation. offered at Aalborg University in Copenhagen.......Defining and describing the education, M.Sc., Medialogy. The curriculum (Study Programme) describes semesters, themes, projectunits, courses and contents of the eduation. offered at Aalborg University in Copenhagen....

  16. PRODUCTION, ISOLATION AND SPECTROSCOPIC STUDIES OF THE ENDOHEDRAL FULLERENE Sc2@C80 (Ⅰ-Ⅲ)

    Institute of Scientific and Technical Information of China (English)

    Chunru Wang; Lihua Gan; Chunli Bai; Hisanori Shinohara

    2004-01-01

    The isolation of multiple-isomers of Sc2@C80 (Ⅰ, Ⅱ, Ⅲ) endohedral metallofullerenes is reported for the first time. The new C80-based Sc-metallofullerenes are characterized by UV-Vis-NIR absorption spectroscopy and detailed chromatographic retention time data. A close relationship between the isomer structure and the corresponding HPLC retention time of the metallofullerenes is presented.

  17. Establishment and characterization of Roberts syndrome and SC phocomelia model medaka (Oryzias latipes).

    Science.gov (United States)

    Morita, Akihiro; Nakahira, Kumiko; Hasegawa, Taeko; Uchida, Kaoru; Taniguchi, Yoshihito; Takeda, Shunichi; Toyoda, Atsushi; Sakaki, Yoshiyuki; Shimada, Atsuko; Takeda, Hiroyuki; Yanagihara, Itaru

    2012-06-01

    Roberts syndrome and SC phocomelia (RBS/SC) are genetic autosomal recessive syndromes caused by establishment of cohesion 1 homolog 2 ( ESCO 2) mutation. RBS/SC appear to have a variety of clinical features, even with the same mutation of the ESCO2 gene. Here, we established and genetically characterized a medaka model of RBS/SC by reverse genetics. The RBS/SC model was screened from a mutant medaka library produced by the Targeting Induced Local Lesions in Genomes method. The medaka mutant carrying the homozygous mutation at R80S in the conserved region of ESCO2 exhibited clinical variety (i.e. developmental arrest with craniofacial and chromosomal abnormalities and embryonic lethality) as characterized in RBS/SC. Moreover, widespread apoptosis and downregulation of some gene expression, including notch1a, were detected in the R80S mutant. The R80S mutant is the animal model for RBS/SC and a valuable resource that provides the opportunity to extend knowledge of ESCO2. Downregulation of some gene expression in the R80S mutant is an important clue explaining non-correlation between genotype and phenotype in RBS/SC.

  18. SC-535, a Novel Oral Multikinase Inhibitor, Showed Potent Antitumor Activity in Human Melanoma Models

    Directory of Open Access Journals (Sweden)

    Xin Chen

    2013-07-01

    Full Text Available Background: Melanoma is considered as one of the most aggressive and deadliest cancers and current targeted therapies of melanoma often suffer limited efficacy or drug resistance. Discovery of novel multikinase inhibitors as anti-melanoma drug candidates is still needed. Methods: In this investigation, we assessed the in vitro and in vivo anti-melanoma activities of SC-535, which is a novel small molecule multikinase inhibitor discovered by us recently. We analyzed inhibitory effects of SC-535 on various melanoma cell lines and human umbilical vascular endothelial cells (HUVEC in vitro. Tumor xenografts in athymic mice were used to examine the in vivo activity of SC-535. Results: SC-535 could efficiently inhibit vascular endothelial growth factor receptor (VEGFR 1/2/3, B-RAF, and C-RAF kinases. It showed significant antiangiogenic potencies both in vitro and in vivo and considerable anti-proliferative ability against several melanoma cell lines. Oral administration of SC-535 resulted in dose-dependent suppression of tumor growth in WM2664 and C32 xenograft mouse models. Studies of mechanisms of action indicated that SC-535 suppressed the tumor angiogenesis and induced G2/M phase cell cycle arrest in human melanoma cells. SC-535 possesses favorable pharmacokinetic properties. Conclusion: All of these results support SC-535 as a potential candidate for clinical studies in patients with melanoma.

  19. 33 CFR 165.708 - Safety/Security Zone; Charleston Harbor and Cooper River, Charleston, SC.

    Science.gov (United States)

    2010-07-01

    ... Harbor and Cooper River, Charleston, SC. 165.708 Section 165.708 Navigation and Navigable Waters COAST... Guard District § 165.708 Safety/Security Zone; Charleston Harbor and Cooper River, Charleston, SC. (a... Cooper River. All coordinates referenced use datum: NAD 1983. (2) All waters within 100 yards of...

  20. SU-E-T-433: Calibration Accuracy in Mailed High-Resolution 3D Dosimetry Service for SRS/SBRT QA

    Energy Technology Data Exchange (ETDEWEB)

    Maryanski, M [MGS Research Inc, Madison, CT (United States); Keane, J; Zimberg, S [Advanced Radiation Centers of New York, Islandia, NY (United States)

    2014-06-01

    Purpose: SRS/SBRT combines hypofractionation with excellent dose distributions. However, extremely steep gradients across the target along with dose escalation, if not administered accurately, may lead to serious complications, recurrences, or even fatalities. Existing commercial QA products either lack adequate spatial resolution or the 3D aspect. By contrast, the new CrystalBall™ mailed high-resolution 3D dosimetry service removes the above limitations while reducing the overall workload on medical physics staff. The exposed dosimeters, which change optical density in proportion to local dose, are sent back to the manufacturer (MGS Research Inc., Madison, CT) for sub-millimeter-resolution laser-CT scanning and QA data analysis. QA report is returned electronically within 24 hours. The purpose of this study was to evaluate the dose calibration accuracy in this system. Methods: Two spherical CrystalBall™ polymer gel dosimeters from the same batch, 166 mm diameter, with embedded 3D image registration markers, were mounted in a special phantom designed for reproducible positioning. For full end to end testing, the optical guidance array was mounted onto the phantom and a CT was taken. Two separate Rapid Arc SRS plans were designed. Varian Medical Systems optical guidance system was used to position the phantom and the SRS treatment plans were delivered to the two spheres on Varian's Trilogy Accelerator. Exposed dosimeters were mailed back to the manufacturer for laser CT scanning and analysis. Results: For each plan, 3D gamma passing rate was 100% for 2%/2mm distance-to-agreement criteria above 50% isodose level. The two calibration curves, generated using volumetric dose and optical density data, showed excellent mutual agreement (max difference 2.2%, median difference 0.75%). Conclusion: The clinical utility of new CrystalBall™ mailed QA service for SRS/SBRT and high accuracy of dose calibration have been validated. The workflow associated with the use

  1. Phase II Nuclide Partition Laboratory Study Influence of Cellulose Degradation Products on the Transport of Nuclides from SRS Shallow Land Burial Facilities

    Energy Technology Data Exchange (ETDEWEB)

    Serkiz, S.M.

    1999-10-04

    Degradation products of cellulosic materials (e.g., paper and wood products) can significantly influence the subsurface transport of metals and radionuclides. Codisposal of radionuclides with cellulosic materials in the E-Area slit trenches at the Savannah River Site (SRS) is, therefore, expected to influence nuclide fate and transport in the subsurface. Due to the complexities of these systems and the scarcity of site-specific data, the effects of cellulose waste loading and its subsequent influence on nuclide transport are not well established.

  2. PLAINS CO2 REDUCTION (PCOR) PARTNERSHIP

    Energy Technology Data Exchange (ETDEWEB)

    Edward N. Steadman; Daniel J. Daly; Lynette L. de Silva; John A. Harju; Melanie D. Jensen; Erin M. O' Leary; Wesley D. Peck; Steven A. Smith; James A. Sorensen

    2006-01-01

    During the period of October 1, 2003, through September 30, 2005, the Plains CO2 Reduction (PCOR) Partnership, identified geologic and terrestrial candidates for near-term practical and environmentally sound carbon dioxide (CO2) sequestration demonstrations in the heartland of North America. The PCOR Partnership region covered nine states and three Canadian provinces. The validation test candidates were further vetted to ensure that they represented projects with (1) commercial potential and (2) a mix that would support future projects both dependent and independent of CO2 monetization. This report uses the findings contained in the PCOR Partnership's two dozen topical reports and half-dozen fact sheets as well as the capabilities of its geographic information system-based Decision Support System to provide a concise picture of the sequestration potential for both terrestrial and geologic sequestration in the PCOR Partnership region based on assessments of sources, sinks, regulations, deployment issues, transportation, and capture and separation. The report also includes concise action plans for deployment and public education and outreach as well as a brief overview of the structure, development, and capabilities of the PCOR Partnership. The PCOR Partnership is one of seven regional partnerships under Phase I of the U.S. Department of Energy National Energy Technology Laboratory's Regional Carbon Sequestration Partnership program. The PCOR Partnership, comprising 49 public and private sector members, is led by the Energy & Environmental Research Center at the University of North Dakota. The international PCOR Partnership region includes the Canadian provinces of Alberta, Saskatchewan, and Manitoba and the states of Montana (part), Wyoming (part), North Dakota, South Dakota, Nebraska, Missouri, Iowa, Minnesota, and Wisconsin.

  3. 4SC-202 activates ASK1-dependent mitochondrial apoptosis pathway to inhibit hepatocellular carcinoma cells

    Energy Technology Data Exchange (ETDEWEB)

    Fu, Meili, E-mail: fumeilidrlinyi@tom.com [Department of Infectious Disease, Linyi People' s Hospital, Linyi 276000 (China); Wan, Fuqiang [Department of Head and Neck Surgery, Linyi Tumor Hospital, Linyi 276000 (China); Li, Zhengling [Department of Nursing, Tengzhou Central People' s Hospital, Tengzhou 277500 (China); Zhang, Fenghua [Department of Operating Room, Linyi People' s Hospital, Linyi 276000 (China)

    2016-03-04

    The aim of the present study is to investigate the potential anti-hepatocellular carcinoma (HCC) cell activity by 4SC-202, a novel class I HDAC inhibitor (HDACi). The associated signaling mechanisms were also analyzed. We showed that 4SC-202 treatment induced potent cytotoxic and proliferation–inhibitory activities against established HCC cell lines (HepG2, HepB3, SMMC-7721) and patient-derived primary HCC cells. Further, adding 4SC-202 in HCC cells activated mitochondrial apoptosis pathway, which was evidenced by mitochondrial permeability transition pore (mPTP) opening, cytochrome C cytosol release and caspase-3/-9 activation. Inhibition of this apoptosis pathway, by caspase-3/-9 inhibitors, mPTP blockers, or by shRNA-mediated knockdown of cyclophilin-D (Cyp-D, a key component of mPTP), significantly attenuated 4SC-202-induced HCC cell death and apoptosis. Reversely, over-expression of Cyp-D enhanced 4SC-202's sensitivity in HCC cells. Further studies showed that 4SC-202 induced apoptosis signal-regulating kinase 1 (ASK1) activation, causing it translocation to mitochondria and physical association with Cyp-D. This mitochondrial ASK1-Cyp-D complexation appeared required for mediating 4SC-202-induced apoptosis activation. ASK1 stable knockdown by targeted-shRNAs largely inhibited 4SC-202-induced mPTP opening, cytochrome C release, and following HCC cell apoptotic death. Together, we suggest that 4SC-202 activates ASK1-dependent mitochondrial apoptosis pathway to potently inhibit human HCC cells. - Highlights: • 4SC-202 exerts potent anti-proliferative and cytotoxic activity against established/primary HCC cells. • SC-202-induced anti-HCC cell activity relies on caspase-dependent apoptosis activation. • 4SC-202 activates Cyp-D-dependent mitochondrial apoptosis pathway in HCC cells. • 4SC-202 activates ASK1 in HCC cells, causing it translocation to mitochondria. • Mitochondrial ASK1-Cyp-D complexation mediates 4SC-202's activity in HCC cells.

  4. Effect of Sc addition on microstructure and mechanical properties of 1460 alloy

    Directory of Open Access Journals (Sweden)

    Juan Ma

    2014-02-01

    Full Text Available The effect of minor addition of Sc on microstructure, age hardening behavior, tensile properties and fracture morphology of 1460 alloy have been studied. It is found that Sc content increase from 0.11 wt% to 0.22 wt% is favorable for grain refinement in as-cast alloy but results in a coarsening of Cu-rich particles. The alloy with 0.11 wt% Sc exhibits enhanced mechanical properties and age hardening effect. Transmission electron microscopy (TEM investigations on the alloy with 0.11 wt% Sc have suggested that a large amount of Al3(Sc, Zr particles precipitated at the earlier aging may inhibit recrystallization effectively.

  5. Homogenization and Recrystallization of Al-6Mg Alloys with and without Sc and Zr

    Institute of Scientific and Technical Information of China (English)

    姜锋; 尹志民; 黄伯云; 贺跃辉; 陈苏里

    2004-01-01

    Plates of Al-6Mg alloys with and without scandium were prepared by semi-continuous cast, homogenization, hot-rolled, cold-rolled and annealing. Based on studying of effects of temperature and time on hardness and conductivity during homogenization, it was found that homogenization of ingot with Sc and Zr can result in dispersion strengthening. Recrystallization temperature of alloys was studied by hardness method and optical metallographic method. Staring recrystallization temperature of Al-6Mg alloys with Sc and Zr is 375 ℃, increasing by 150 ℃ than Al-6Mg alloys without Sc and Zr. Mechanical properties (σb, σ0.2, δ) of hot-rolled alloy with Sc and Zr are 400 MPa, 280 MPa and 18%; cold-rolled and anneal alloy with Sc and Zr are 420 MPa, 310 MPa and 12% respectively.

  6. Scandium-44: benefits of a long-lived PET radionuclide available from the (44)Ti/(44)Sc generator system.

    Science.gov (United States)

    Roesch, F

    2012-07-01

    (44)Ti/(44)Sc radionuclide generators are of interest for molecular imaging. The 3.97 hours half-life of (44)Sc and its high positron branching of 94.27% may stimulate the application of (44)Sc-labeled PET radiopharmaceuticals. This review describes the current status of (44)Ti production, (44)Ti/(44)Sc radionuclide generator development, post-processing of generator eluates towards medical application, identification of ligands adequate to Sc(III) co-ordination chemistry, proof-of-principle labeling of (44)Sc-DOTA-octreotides, investigation of in vitro and in vivo parameters, and initial applications for molecular imaging - both in small animals and humans.

  7. INTERVIU CU DOAMNA SIMONA CAROBENE, ADMINISTRATORUL SC PROIECT MOZAIC SRL

    Directory of Open Access Journals (Sweden)

    Gheorghe Pascaru

    2013-12-01

    Full Text Available Fabrica de mozaic, înregistrată la Oficiul Registrului Comerţului în aprilie 2012 a luat fiinţă în cadrul unui proiect cu finanţare europeană nerambursabilă și are în prezent statutul de unitate protejată autorizată. În cadrul acesteia sunt angajați 10 tineri post instituţionalizați, pentru care integrarea în viaţa socială şi profesională este dificilă. Întreprinderea socială SC Proiect Mozaic SRL este rezultatul întâlnirii dintre sectorul social, non-profit şi sectorul business, deoarece are la bază un parteneriat cu un important grup de firme din domeniul construcţiilor şi amenajărilor interioare din București. În paralel cu activitatea de producţie a mozaicului, ocazional, Proiect Mozaic oferă către clienți și servicii de ambalare și asamblare produse.

  8. Preliminary Tests Of The Decris-sc Ion Source

    CERN Document Server

    Efremov, A; Bechterev, V; Bogomolov, S L; Bondarenko, P G; Datskov, V I; Dmitriev, S; Drobin, V; Lebedev, A; Leporis, M; Malinowski, H; Nikiforov, A; Paschenko, S V; Seleznev, V; Shishov, Yu A; Smirnov, Yu; Tsvineva, G; Yakovlev, B; Yazvitsky, N Yu

    2004-01-01

    A new "liquid He-free" superconducting Electron Cyclotron Resonance Ion Source DECRIS-SC, to be used as injector for the IC-100 small cyclotron, has been designed by FLNR and LHE JINR. The main feature is that a compact refrigerator of Gifford-McMahon type is used to cool the solenoid coils. For the reason of very small cooling power at 4.2 K (about 1 W) our efforts were to optimize the magnetic structure and minimize an external heating of the coils. The maximum magnetic field strength is 3 T and 2 T in injection and extraction region respectively. For the radial plasma confinement a hexapole made of NdFeB permanent magnet is used. The source will be capable of ECR plasma heating using different frequencies (14 GHz or 18 GHz). To be able to deliver usable intensities of solids, the design is also allow axial access for evaporation oven and metal samples using the plasma sputtering technique. Very preliminary results of the source test are presented.

  9. Spectrophotometric Distances to Galactic H\\,{\\sc{ii}} Regions

    CERN Document Server

    Moisés, A P; Figuerêdo, E; Blum, R D; Conti, P S; Barbosa, C L

    2010-01-01

    We present a near infrared study of the stellar content of 35 H\\,{\\sc{ii}} regions in the Galactic plane. In this work, we have used the near infrared domain $J-$, $H-$ and $K_{s}-$ band color images to visually inspect the sample. Also, color-color and color-magnitude diagrams were used to indicate ionizing star candidates, as well as, the presence of young stellar objects such as classical TTauri Stars (CTTS) and massive young stellar objects (MYSOs). We have obtained {\\it Spitzer} IRAC images for each region to help further characterize them. {\\it Spitzer} and near infrared morphology to place each cluster in an evolutionary phase of development. {\\it Spitzer} photometry was also used to classify the MYSOs. Comparison of the main sequence in color-magnitude diagrams to each observed cluster was used to infer whether or not the cluster kinematic distance is consistent with brightnesses of the stellar sources. We find qualitative agreement for a dozen of the regions, but about half the regions have near infr...

  10. Transition energy and oscillator strength of Sc18+ion

    Institute of Scientific and Technical Information of China (English)

    Wang Zhi-Wen; Yang Di; Hu Mu-Hong; Han Qiu-Ju; Li Jin-Ying

    2005-01-01

    The transition energies and the dipole oscillator strengths for the 1s22s-1s2np (2 ≤ n ≤ 9) and 1s22p-1s2nd (3≤n ≤ 9) of lithium-like Sc18+ ion are calculated by using the full core plus correlation method. The fine structure splittings of 1s2np and 1s2nd (n ≤ 9) states are determined from the expectation values of spin-orbit and spin-otherorbit interaction operators. The quantum defects of these series, as function of principal quantum number n, are obtained. The agreement between the f-values obtained from three alternative formulae is excellent. Comparisons of our results with experimental data available in the literature are carried out. Combining the single-channel quantum defect theory with the discrete oscillator strengths obtained in this work, this paper obtains the behaviour of discrete oscillator strengths and oscillator strength densities corresponding to the bound-free transitions adjacent to ionization threshold.

  11. Final Technical Report for DE-SC0012297

    Energy Technology Data Exchange (ETDEWEB)

    Dell' Antonio, Ian [Brown Univ., Providence, RI (United States)

    2017-08-01

    This is the final report on the work performed in award DE-SC0012297, Cosmic Frontier work in support of the LSST Dark Energy Science Collaboration's work to develop algorithms, simulations, and statistical tests to ensure optimal extraction of the dark energy properties from galaxy clusters observed with LSST. This work focused on effects that could produce a systematic error on the measurement of cluster masses (that will be used to probe the effects of dark energy on the growth of structure). These effects stem from the deviations from pure ellipticity of the gravitational lensing signal and from the blending of light of neighboring galaxies. Both these effects are expected to be more significant for LSST than for the stage III experiments such as the Dark Energy Survey. We calculate the magnitude of the mass error (or bias) for the first time and demonstrate that it can be treated as a multiplicative correction and calibrated out, allowing mass measurements of clusters from gravitational lensing to meet the requirements of LSST's dark energy investigation.

  12. Domain structure and phase transition in Sc-doped zirconia

    Energy Technology Data Exchange (ETDEWEB)

    Brunauer, G.; Boysen, H.; Frey, F. [Institute for Crystallography und Applied Mineralogy, LMU Muenchen, Munich (Germany); Ehrenberg, H. [Institute for Materials Science, TU Darmstadt, Darmstadt (Germany)

    2002-01-21

    The temperature dependence of the domain structure associated with the ferroelastic phase transition (Fm{sup 3-bar}m{r_reversible}R{sup 3-bar}m) in ZrO{sub 2} doped with 11% Sc{sub 2}O{sub 3} has been determined from a peak shape analysis of high-resolution synchrotron x-ray powder diffraction data. In the temperature region of coexisting phases the observed characteristic anisotropic broadening and asymmetry of the lines is modelled by three different phases: a main rhombohedral phase, a distorted rhombohedral phase with a smaller c/a ratio, and a cubic phase. The latter two are assigned to the internal structure of the domain walls between two adjacent twin domains. The size and amount of the cubic phase show an initially slow increase with temperature followed by a very steep increase and a slow one after that. The size of the (main) rhombohedral domains remains nearly constant, while (micro-) strain in the distorted regions gradually decreases. (author)

  13. Plain packaging of cigarettes: do we have sufficient evidence?

    Directory of Open Access Journals (Sweden)

    Smith CN

    2015-04-01

    Full Text Available Collin N Smith,1 John D Kraemer,2 Andrea C Johnson,1 Darren Mays1 1Department of Oncology, Georgetown University Medical Center, Lombardi Comprehensive Cancer Center, Washington, DC, USA; 2Department of Health Systems Administration, School of Nursing and Health Studies, Georgetown University, Washington, DC, USA Abstract: Tobacco industry marketing is a primary factor influencing cigarette smoking behavior and the cigarette pack has become an important marketing vehicle for tobacco companies. Standardized “plain” cigarette packaging is advocated as a public health policy to prevent and reduce morbidity and mortality caused by smoking by reducing youth smoking initiation and promoting cessation among smokers. Plain packaging was implemented in Australia in December 2012, and several other countries are considering doing so, but each faces foreseeable legal resistance from opponents to such measures. Tobacco companies have challenged these public health policies, citing international trade agreements and intellectual property laws. Decision-making in these court cases will hinge in part on whether the evidence indicates the public health benefits of plain packaging outweigh any potential harm to tobacco manufacturers’ interests. We reviewed the available evidence in support of plain packaging, finding evidence from observational, experimental, and population-based studies. Results indicate that plain packaging can reduce positive perceptions of smoking and dissuade tobacco use. Governments deciding to implement plain cigarette packaging measures can rely on this evidence to help make a strong case that plain packaging plays an important role in the context of comprehensive smoking prevention efforts. Keywords: cigarette smoking, tobacco, plain packaging, regulation, policy

  14. Downregulation of the Musca domestica peptidoglycan recognition protein SC (PGRP-SC) leads to overexpression of antimicrobial peptides and tardy pupation.

    Science.gov (United States)

    Gao, Yifu; Tang, Ting; Gu, Jihai; Sun, Lingling; Gao, Xiaobin; Ma, Xianyong; Wang, Xiaochun; Liu, Fengsong; Wang, Jianhui

    2015-10-01

    PGRP (peptidoglycan recognition protein) is a conserved protein family that recognizes the peptidoglycan in bacterial cell wall and causes the activation of various innate immune responses. Previous studies have reported that PGRP-SCs in Drosophila dampen the activation of Immune Deficiency (Imd) pathway to microbial infection, and participate in the lifespan extension of the insects. To facilitate understanding the function of PGRP-SCs from an evolutionary angle, we identified and functionally characterized the PGRP-SC gene in the housefly Musca domestica, a species that has adapted to a septic environment much harsher than the natural habitat of Drosophila. The gene designated as MdPGRP-SC was found most abundantly expressed in the 3rd instar larvae, and is expressed at this developmental stage predominantly in the gut. MdPGRP-SC was virtually unchanged in whole larvae after a septic injury at the second larval instar, while two antimicrobial peptides (AMPs), diptericin and attacin, were upregulated in the first 24h but not later. Through dsRNA microinjection, MdPGRP-SC was knocked down by RNA interference (RNAi), and caused the significant increased expression of diptericin and attacin. The pupation of MdPGRP-SC-depleted larvae was severely suppressed compared to controls. Opposite to the expression trend of MdPGRP-SC, a spontaneous active expression of diptericin and attacin was found in pre-pupae but not in third instar larvae. Taken together, our study reveals that downregulation of MdPGRP-SC leads to the overexpression of the AMPs, and is involved in the larvae-to-pupa transition of housefly.

  15. Geographic information system planning for geotechnical and earthquake engineering applications at the Savannah River Site, SC

    Energy Technology Data Exchange (ETDEWEB)

    Lee, R.

    1993-02-01

    The Savannah River Technology Center (SRTC) of the Savannah River Site is in the planning stages of compiling a geological, geophysical, and seismological data base on an industry standard Geographic Information System (GIS). The system will serve as a tool for management and integration of already collected site data,planning for additional investigations, and for special studies such as seismic hazard and risk analyses for the Savannah River Site (SRS).

  16. Geographic information system planning for geotechnical and earthquake engineering applications at the Savannah River Site, SC

    Energy Technology Data Exchange (ETDEWEB)

    Lee, R.

    1993-01-01

    The Savannah River Technology Center (SRTC) of the Savannah River Site is in the planning stages of compiling a geological, geophysical, and seismological data base on an industry standard Geographic Information System (GIS). The system will serve as a tool for management and integration of already collected site data,planning for additional investigations, and for special studies such as seismic hazard and risk analyses for the Savannah River Site (SRS).

  17. Impact of Irrigated Agroecosystems on Groundwater Resources in the US High Plains and North China Plain

    Science.gov (United States)

    Scanlon, B. R.; Longuevergne, L.; Cao, G.; Shen, Y.; Gates, J. B.; Reedy, R. W.; Zheng, C.

    2010-12-01

    Overabstraction of groundwater for irrigation in semiarid regions is depleting the worlds’ largest aquifers at much greater rates than these aquifers are being replenished by recharge. This study evaluates groundwater sustainability in the US High Plains (US HP) and North China Plain (NCP) where intensive irrigation has resulted in large water table declines. A variety of approaches were used to evaluate impacts of irrigation on groundwater resources, including GRACE satellite data, unsaturated zone profiling, and groundwater quantity and quality data. Cultivation (40% of area) and irrigation (12%) are less intensive in the US HP than in the NCP (80% cultivated, 50% irrigated). Irrigation is estimated to consume ~97% of groundwater resources in the US HP and ~70% in the NCP. Although only ~10% of groundwater resources has been consumed in the US HP (330 km3 out of 3,900 km3), the problem lies in the uneven spatial distribution. Groundwater depletion is greatest in the Central High Plains (CHP) where water table declines of up to 1.5 m/yr have been recorded in individual wells and regional declines of up to 30 m have been found over a 7,000 km2 area since irrigation began in the 1950s to 1960s. This depletion indicates an irrigation deficit of ~75 mm/yr over 60 yr (specific yield 15%). Recharge rates in the CHP are extremely low (median ~10 mm/yr) with reductions in groundwater storage exceeding recharge by ~10 times. High correlations between GRACE and measured water storage changes (R = 0.7 - 0.8) show that the satellite can accurately track regional changes in water storage. Groundwater in the NCP has declined from a depth of ~1 m in the 1960s to 20 to 40 m in the Piedmont region since expansion of irrigation beginning in the 1970s. Groundwater level declines in individual hydrographs range from 0.5 to 1.0 m/yr, indicating irrigation deficits ranging from 100 to 200 mm/yr (specific yield 20%). Lower groundwater storage changes from GRACE satellites relative to

  18. Avance normativo del SC 8 de AENOR “Conservación, restauración y rehabilitación de edificios” = Standardisation Advance of AENOR SC 8 “Conservation, Restoration and Rehabilitation of Buildings”

    OpenAIRE

    Recopar, Editor

    2014-01-01

    Avance normativo del SC 8 de AENOR “Conservación, restauración y rehabilitación de edificios” = Standardisation Advance of AENOR SC 8 “Conservation, Restoration and Rehabilitation of Buildings”

  19. Radiolabeling of DOTATOC with the long-lived positron emitter {sup 44}Sc

    Energy Technology Data Exchange (ETDEWEB)

    Pruszynski, Marek; Majkowska-Pilip, Agnieszka [Centre of Radiochemistry and Nuclear Chemistry, Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warszawa (Poland); Loktionova, Natalia S.; Eppard, Elisabeth [Institute of Nuclear Chemistry, Johannes Gutenberg-University of Mainz, Fritz-Strassmann-Weg 2, D-55128 Mainz (Germany); Roesch, Frank, E-mail: frank.roesch@uni-mainz.de [Institute of Nuclear Chemistry, Johannes Gutenberg-University of Mainz, Fritz-Strassmann-Weg 2, D-55128 Mainz (Germany)

    2012-06-15

    The positron-emitting radionuclide {sup 44}Sc with a half-life of 3.97 h and a {beta}{sup +} branching of 94.3% is of potential interest for clinical PET. As so far it is available from a {sup 44}Ti/{sup 44}Sc generator in Mainz, where long-lived {sup 44}Ti decays to no-carrier-added (nca) {sup 44}Sc. The {sup 44}Sc is a trivalent metal cation and should be suitable for complexation with many well established bifunctional chelators conjugated to peptides or other molecular targeting vectors. Thus, the aim of this work was to investigate the potential of {sup 44}Sc for labeling of DOTA-conjugated peptides. DOTA-D-Phe{sup 1}-Tyr{sup 3}-octreotide (DOTATOC) was used as a model molecule to study and optimize labeling procedure. Reaction parameters such as buffer conditions, concentration of peptide, pH range, reaction temperature and time were optimized. Addition of 21 nmol of DOTATOC to {sup 44}Sc in ammonium acetate buffer pH 4.0 provided labeling yields >98% within 25 min of heating in an oil-bath at 95 Degree-Sign C. This time can be reduced to 3 min only by applying microwave supported heating. {sup 44}Sc-DOTATOC was found to be stable in 0.9% NaCl, PBS pH 7.4, fetal calf and human serums, and also in the presence of competing metal cations (Fe{sup 3+}, Ca{sup 2+}, Cu{sup 2+}, Mg{sup 2+}), as well as other ligand competitors, like EDTA and DTPA, even after almost 25 h incubation at 37 Degree-Sign C. Present study shows that nca {sup 44}Sc forms stable complexes with the macrocyclic ligand DOTA and that {sup 44}Sc-DOTATOC and analog targeting vectors may be synthesized for further preclinical and clinical investigations. - Highlights: Black-Right-Pointing-Pointer Labeling of somatostatin analouges with positron emitter {sup 44}Sc was tested. Black-Right-Pointing-Pointer DOTATOC was labeled with {sup 44}Sc isotope. Black-Right-Pointing-Pointer Optimal conditions for {sup 44}Sc-DOTATOC synthesis were found. Black-Right-Pointing-Pointer Stability of {sup 44}Sc

  20. 超导ECR离子源DECRIS-SC2%Project of the Superconducting ECR Ion Source DECRIS-SC2

    Institute of Scientific and Technical Information of China (English)

    V.V.Bekhterev; V.V.Seleznev; A.Shishov; G.P.Tsvineva; N.YU.Yazvitsky; B.I.Yakovlev; S.L.Bogomolov; V.I.Datskov; V.M.Drobin; S.N.Dmitriev; A.A.Efremov; V.N.Loginov; A.N.Lebedev; H.Malinowski

    2007-01-01

    A new compact version of the"liquid He-free"superconducting Electron Cyclotron Resonance Ion Source,to be used as an injector for the U-400M cyclotron,is presently under construction at the FLNR in collaboration with LHE(JINR).The axial magnetic field of the source is created by the superconducting magnet,and the NdFeB hexapole is used for the radial plasma confinement.The microwave frequency of 14GHz will be used for ECR plasma heating.The DECRIS-SC2 superconducting magnet is designed for the induction of a magnetic field on the axis of the source of up to 1.4T (extraction side) and 1.9T (injection side) at nominal current of 75A.Cooling of the coils is carried out by GM cryocooler with cooling power of 1W at the temperature 4.5K.The basic design features of the superconducting magnet and of the ion source are presented.The main parts of the source are in production.The first beam test of the source is expected in the beginning of 2007.

  1. A {sup 44}Ti/{sup 44}Sc radionuclide generator for potential application of {sup 44}Sc-based PET-radiopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Filosofov, D.V. [Joint Institute of Nuclear Research, Dubna (Russian Federation). DLNP; Loktionova, N.S.; Roesch, F. [University of Mainz (Germany). Institute of Nuclear Chemistry

    2010-07-01

    {sup 44}Ti/{sup 44}Sc radionuclide generators are of interest for molecular imaging. The 3.97 h half-life of {sup 44}Sc and its high positron branching of 94% may stimulate the application of {sup 44}Sc labelled PET radiopharmaceuticals. However, both {sup 44}Ti production and {sup 44}Ti/{sup 44}Sc generator design represent challenges for basic radiochemistry. About 5 mCi (185 MBq) of {sup 44}Ti were obtained via the Sc(p, 2n) nuclear reaction. {sup 44}Ti was separated from 1.5 g of massive scandium targets in multi-step procedures, including exchange chromatography on cation exchange resin (AG 50W-X8, 200-400 mesh, H{sup +}-form). In order to design a robust {sup 44}Ti/{sup 44}Sc generator concept, distribution coefficients of Ti(IV) and Sc(III) on both AG 1-X8 (200-400 mesh, Cl{sup -}-form) and AG 50W-X8 (200-400 mesh, H{sup +}-form) resins eluted with HCl and HCl/H{sub 2}C{sub 2}O{sub 4} solution of various concentrations were investigated systematically. Optimal conditions for efficient separations of both radionuclides have been determined for AG 1-X8 resin and mixtures of 0.07 M HCl and 0.005 M H{sub 2}C{sub 2}O{sub 4}. A 5 mCi generator was prepared on an AG 1-X8 column (H=150 mm, D=3 mm, V{sub 0}=0.55 mL). The system achieved elution of 180 MBq {sup 44}Sc in 20 mL of eluate solution. The breakthrough of {sup 44}Ti is 90 Bq. This corresponds to an excellent separation factor of 2 x 10{sup 6}. In the context of long-term stability of {sup 44}Ti/{sup 44}Sc generators, a ''reverse'' type of washing steps after each elution using 0.07 M HCl/0.005 M H{sub 2}C{sub 2}O{sub 4} mixtures appeared to be essential. (orig.)

  2. Chinese tallow: Invading the southeastern Coastal Plain

    Science.gov (United States)

    ,

    2000-01-01

    Chinese tallow is an ornamental tree with colorful autumn foliage that can survive full sunlight and shade, flooding, drought, and in some cases fire. To horticulturists this kind of tree sounds like a dream, but to ecologists, land managers, and land owners this kind of tree can be a nightmare, especially when it invades an area and takes over native vegetation. Chinese tallow (Triadica sebifera), a nonnative tree from China, is currently transforming the southeastern Coastal Plain.Over the last 30 years, Chinese tallow has become a common tree in old fields and bottomland swamps of coastal Louisiana. Several studies at the U.S. Geological Survey’s National Wetlands Research Center (NWRC), Lafayette, Louisiana, are aimed at understanding the factors that contribute to Chinese tallow growth, spread, and management.When tallow invades, it eventually monopolizes an area, creating a forest without native animal or plant species. This tree exhibits classic traits of most nonnative invaders: it is attractive so people want to distribute it, it has incredible resiliency, it grows quickly and in a variety of soils, and it is resistant to pests.In the coastal prairie of Louisiana and Texas, Chinese tallow can grow up to 30 feet and shade out native sun-loving prairie species. The disappearing of prairie species is troublesome because less than 1% of original coastal prairie remains, and in Louisiana, less than 500 of the original 2.2 million acres still exist.Tallow reproduces and grows quickly and can cause large-scale ecosystem modification (fig. 1). For example, when it completely replaces native vegetation, it has a negative effect on birds by degrading the habitat. Besides shading out grasses that cattle like to eat, it can also be potentially harmful to humans and animals because of its berries (fig. 2) and plant sap that contain toxins. There is some concern its leaves may shed toxins that change the soil chemistry and make it difficult for other plants to grow.

  3. Quaternary evolution of the Southern Apennines coastal plains: a review

    Science.gov (United States)

    Santangelo, Nicoletta; Romano, Paola; Ascione, Alessandra; Russo Ermolli, Elda

    2017-02-01

    The Quaternary evolution of the main coastal basins located along the southwestern margin of the Southern Apennines has been reconstructed by integrating the huge amount of existing stratigraphical and geomorphological data. The information produced in the last twenty years has shed new light on the recent (late Middle Pleistocene to Present) history of the Campanian and Sele plains or basins. During the early Quaternary, the analysed coastal basins originated as half-grabens in response to opening processes active since the late Tortonian in the southern Tyrrhenian back-arc basin. In some of these basins (e.g. the Campanian Plain), volcanism has also played an important role. In the inner sectors of the coastal basins, the complex interplay between block faulting, sedimentary inputs and glacioeustatic fluctuations gave rise to relative sea-level change and related coastline migrations, leading to the formation of the present-day coastal plains. In the Sele Plain basin, the construction of the present-day landscape mainly resulted from the substantial ceasing of subsidence in the final part of the Middle Pleistocene. Conversely, a strong contribution to the recent evolution of the Campanian Plain has been provided by abundant volcaniclastic aggradation, able to hinder the effect of the vertical motions that occurred in the last 100 ka.

  4. Flood hydrology and methylmercury availability in coastal plain rivers.

    Science.gov (United States)

    Bradley, Paul M; Journey, Celeste A; Chapelle, Francis H; Lowery, Mark A; Conrads, Paul A

    2010-12-15

    Mercury (Hg) burdens in top-predator fish differ substantially between adjacent South Carolina Coastal Plain river basins with similar wetlands coverage. In the Congaree River, floodwaters frequently originate in the Blue Ridge and Piedmont regions, where wetlands coverage and surface water dissolved methylmercury (MeHg) concentrations are low. Piedmont-driven flood events can lead to downward hydraulic gradients in the Coastal Plain riparian wetland margins, inhibiting MeHg transport from wetland sediments, and decreasing MeHg availability in the Congaree River habitat. In the adjacent Edisto River basin, floodwaters originate only within Coastal Plain sediments, maintaining upward hydraulic gradients even during flood events, promoting MeHg transport to the water column, and enhancing MeHg availability in the Edisto River habitat. These results indicate that flood hydrodynamics contribute to the variability in Hg vulnerability between Coastal Plain rivers and that comprehensive regional assessment of the relationship between flood hydrodynamics and Hg risk in Coastal Plain streams is warranted.

  5. Plains Elevated Convection at Night (PECAN) Experiment Science Plan

    Energy Technology Data Exchange (ETDEWEB)

    Turner, D [National Oceanic and Atmospheric Administration; Parsons, D [NCAR; Geerts, B [Department of Atmospheric Science, University of Wyoming

    2015-03-01

    The Plains Elevated Convection at Night (PECAN) experiment is a large field campaign that is being supported by the National Science Foundation (NSF) with contributions from the National Oceanic and Atmospheric Administration (NOAA), the National Atmospheric and Space Administration (NASA), and the U.S. Department of Energy (DOE). The overarching goal of the PECAN experiment is to improve the understanding and simulation of the processes that initiate and maintain convection and convective precipitation at night over the central portion of the Great Plains region of the United States (Parsons et al. 2013). These goals are important because (1) a large fraction of the yearly precipitation in the Great Plains comes from nocturnal convection, (2) nocturnal convection in the Great Plains is most often decoupled from the ground and, thus, is forced by other phenomena aloft (e.g., propagating bores, frontal boundaries, low-level jets [LLJ], etc.), (3) there is a relative lack of understanding how these disturbances initiate and maintain nocturnal convection, and (4) this lack of understanding greatly hampers the ability of numerical weather and climate models to simulate nocturnal convection well. This leads to significant uncertainties in predicting the onset, location, frequency, and intensity of convective cloud systems and associated weather hazards over the Great Plains.

  6. Flood hydrology and methylmercury availability in Coastal Plain rivers

    Science.gov (United States)

    Bradley, Paul M.; Journey, Celeste A.; Chapelle, Francis H.; Lowery, Mark A.; Conrads, Paul A.

    2010-01-01

    Mercury (Hg) burdens in top-predator fish differ substantially between adjacent South Carolina Coastal Plain river basins with similar wetlands coverage. In the Congaree River, floodwaters frequently originate in the Blue Ridge and Piedmont regions, where wetlands coverage and surface water dissolved methylmercury (MeHg) concentrations are low. Piedmont-driven flood events can lead to downward hydraulic gradients in the Coastal Plain riparian wetland margins, inhibiting MeHg transport from wetland sediments, and decreasing MeHg availability in the Congaree River habitat. In the adjacent Edisto River basin, floodwaters originate only within Coastal Plain sediments, maintaining upward hydraulic gradients even during flood events, promoting MeHg transport to the water column, and enhancing MeHg availability in the Edisto River habitat. These results indicate that flood hydrodynamics contribute to the variability in Hg vulnerability between Coastal Plain rivers and that comprehensive regional assessment of the relationship between flood hydrodynamics and Hg risk in Coastal Plain streams is warranted.

  7. Quaternary evolution of the Southern Apennines coastal plains: a review

    Directory of Open Access Journals (Sweden)

    Santangelo Nicoletta

    2017-02-01

    Full Text Available The Quaternary evolution of the main coastal basins located along the southwestern margin of the Southern Apennines has been reconstructed by integrating the huge amount of existing stratigraphical and geomorphological data. The information produced in the last twenty years has shed new light on the recent (late Middle Pleistocene to Present history of the Campanian and Sele plains or basins. During the early Quaternary, the analysed coastal basins originated as half-grabens in response to opening processes active since the late Tortonian in the southern Tyrrhenian back-arc basin. In some of these basins (e.g. the Campanian Plain, volcanism has also played an important role. In the inner sectors of the coastal basins, the complex interplay between block faulting, sedimentary inputs and glacioeustatic fluctuations gave rise to relative sea-level change and related coastline migrations, leading to the formation of the present-day coastal plains. In the Sele Plain basin, the construction of the present-day landscape mainly resulted from the substantial ceasing of subsidence in the final part of the Middle Pleistocene. Conversely, a strong contribution to the recent evolution of the Campanian Plain has been provided by abundant volcaniclastic aggradation, able to hinder the effect of the vertical motions that occurred in the last 100 ka.

  8. Stratification and Storage of Soil Organic Carbon and Nitrogen as Affected by Tillage Practices in the North China Plain.

    Science.gov (United States)

    Zhao, Xin; Xue, Jian-Fu; Zhang, Xiang-Qian; Kong, Fan-Lei; Chen, Fu; Lal, Rattan; Zhang, Hai-Lin

    2015-01-01

    Tillage practices can redistribute the soil profiles, and thus affects soil organic carbon (SOC), and its storage. The stratification ratio (SR) can be an indicator of soil quality. This study was conducted to determine tillage effects on the profile distribution of certain soil properties in winter wheat (Triticum aestivum L.) and summer maize (Zea mays L.) systems in the North China Plain (NCP). Three tillage treatments, including no till (NT), rotary tillage (RT), and plow tillage (PT), were established in 2001 in Luancheng County, Hebei Province. The concentration, storage, and SR of SOC and soil total nitrogen (TN) were assessed in both the wheat and maize seasons. Compared with RT and PT, the mean SRs for all depth ratios of SOC under NT increased by 7.85% and 30.61% during the maize season, and by 14.67% and 30.91% during the wheat season, respectively. The SR of TN for 0-5:30-50 cm increased by 140%, 161%, and 161% in the maize season, and 266%, 154%, and 122% in the wheat season compared to the SR for 0-5:5-10 cm under NT, RT and PT, respectively. The data indicated that SOC and TN were both concentrated in the surface-soil layers (0-10 cm) under NT but were distributed relatively evenly through the soil profile under PT. Meanwhile, the storage of SOC and TN was higher under NT for the surface soil (0-10 cm) but was higher under PT for the deeper soil (30-50 cm). Furthermore, the storage of SOC and TN was significantly related to SR of SOC and TN along the whole soil profile (P<0.0001). Therefore, SR could be used to explain and indicate the changes in the storage of SOC and TN. Further, NT stratifies SOC and TN, enhances the topsoil SOC storage, and helps to improve SOC sequestration and soil quality.

  9. Stratification and Storage of Soil Organic Carbon and Nitrogen as Affected by Tillage Practices in the North China Plain

    Science.gov (United States)

    Zhang, Xiang-Qian; Kong, Fan-Lei; Chen, Fu; Lal, Rattan; Zhang, Hai-Lin

    2015-01-01

    Tillage practices can redistribute the soil profiles, and thus affects soil organic carbon (SOC), and its storage. The stratification ratio (SR) can be an indicator of soil quality. This study was conducted to determine tillage effects on the profile distribution of certain soil properties in winter wheat (Triticum aestivum L.) and summer maize (Zea mays L.) systems in the North China Plain (NCP). Three tillage treatments, including no till (NT), rotary tillage (RT), and plow tillage (PT), were established in 2001 in Luancheng County, Hebei Province. The concentration, storage, and SR of SOC and soil total nitrogen (TN) were assessed in both the wheat and maize seasons. Compared with RT and PT, the mean SRs for all depth ratios of SOC under NT increased by 7.85% and 30.61% during the maize season, and by 14.67% and 30.91% during the wheat season, respectively. The SR of TN for 0–5:30–50 cm increased by 140%, 161%, and 161% in the maize season, and 266%, 154%, and 122% in the wheat season compared to the SR for 0–5:5–10 cm under NT, RT and PT, respectively. The data indicated that SOC and TN were both concentrated in the surface-soil layers (0–10 cm) under NT but were distributed relatively evenly through the soil profile under PT. Meanwhile, the storage of SOC and TN was higher under NT for the surface soil (0–10 cm) but was higher under PT for the deeper soil (30–50 cm). Furthermore, the storage of SOC and TN was significantly related to SR of SOC and TN along the whole soil profile (Psoil quality. PMID:26075391

  10. Stratification and Storage of Soil Organic Carbon and Nitrogen as Affected by Tillage Practices in the North China Plain.

    Directory of Open Access Journals (Sweden)

    Xin Zhao

    Full Text Available Tillage practices can redistribute the soil profiles, and thus affects soil organic carbon (SOC, and its storage. The stratification ratio (SR can be an indicator of soil quality. This study was conducted to determine tillage effects on the profile distribution of certain soil properties in winter wheat (Triticum aestivum L. and summer maize (Zea mays L. systems in the North China Plain (NCP. Three tillage treatments, including no till (NT, rotary tillage (RT, and plow tillage (PT, were established in 2001 in Luancheng County, Hebei Province. The concentration, storage, and SR of SOC and soil total nitrogen (TN were assessed in both the wheat and maize seasons. Compared with RT and PT, the mean SRs for all depth ratios of SOC under NT increased by 7.85% and 30.61% during the maize season, and by 14.67% and 30.91% during the wheat season, respectively. The SR of TN for 0-5:30-50 cm increased by 140%, 161%, and 161% in the maize season, and 266%, 154%, and 122% in the wheat season compared to the SR for 0-5:5-10 cm under NT, RT and PT, respectively. The data indicated that SOC and TN were both concentrated in the surface-soil layers (0-10 cm under NT but were distributed relatively evenly through the soil profile under PT. Meanwhile, the storage of SOC and TN was higher under NT for the surface soil (0-10 cm but was higher under PT for the deeper soil (30-50 cm. Furthermore, the storage of SOC and TN was significantly related to SR of SOC and TN along the whole soil profile (P<0.0001. Therefore, SR could be used to explain and indicate the changes in the storage of SOC and TN. Further, NT stratifies SOC and TN, enhances the topsoil SOC storage, and helps to improve SOC sequestration and soil quality.

  11. Authenticated, private, and secured smart cards (APS-SC)

    Science.gov (United States)

    Szu, Harold; Mehmood, Amir

    2006-04-01

    From historical perspective, the recent advancements in better antenna designs, low power circuitry integrations and inexpensive fabrication materials have made possible a miniature counter-measure against Radar, a clutter behaving like a fake target return called Digital Reflection Frequency Modulation (DRFM). Such a military counter-measure have found its way in the commerce as a near field communication known as Radio Frequency Identification (RFID), a passive or active item tag T attached to every readable-writable Smart Card (SC): Passports ID, medical patient ID, biometric ID, driver licenses, book ID, library ID, etc. These avalanche phenomena may be due to the 3 rd Gen phones seeking much more versatile & inexpensive interfaces, than the line-of-sight bar-code optical scan. Despite of the popularity of RFID, the lacking of Authenticity, Privacy and Security (APS) protection restricted somewhat the wide spread commercial, financial, medical, legal, and militarily applications. Conventional APS approach can obfuscate a private passkey K of SC with the tag number T or the reader number R, or both, i.e. only T*K or R*K or both will appear on them, where * denotes an invertible operation, e.g. EXOR, but not limited to it. Then, only the authentic owner, knowing all, can inverse the operation, e.g. EXOR*EXOR= I to find K. However, such an encryption could be easily compromised by a hacker seeking exhaustively by comparison based on those frequently used words. Nevertheless, knowing biological wetware lesson for power of pairs sensors and Radar hardware counter-measure history, we can counter the counter-measure DRFM, instead using one RFID tag per SD, we follow the Nature adopting two ears/tags, e.g. each one holding portions of the ID or simply two different ID's readable only by different modes of the interrogating reader, followed by brain central processor in terms of nonlinear invertible shufflers mixing two ID bits. We prefer to adopt such a hardware

  12. Synthesis and Isolation of the Titanium-Scandium Endohedral Fullerenes-Sc2 TiC@Ih -C80 , Sc2 TiC@D5h -C80 and Sc2 TiC2 @Ih -C80 : Metal Size Tuning of the Ti(IV) /Ti(III) Redox Potentials.

    Science.gov (United States)

    Junghans, Katrin; Ghiassi, Kamran B; Samoylova, Nataliya A; Deng, Qingming; Rosenkranz, Marco; Olmstead, Marilyn M; Balch, Alan L; Popov, Alexey A

    2016-09-05

    The formation of endohedral metallofullerenes (EMFs) in an electric arc is reported for the mixed-metal Sc-Ti system utilizing methane as a reactive gas. Comparison of these results with those from the Sc/CH4 and Ti/CH4 systems as well as syntheses without methane revealed a strong mutual influence of all key components on the product distribution. Whereas a methane atmosphere alone suppresses the formation of empty cage fullerenes, the Ti/CH4 system forms mainly empty cage fullerenes. In contrast, the main fullerene products in the Sc/CH4 system are Sc4 C2 @C80 (the most abundant EMF from this synthesis), Sc3 C2 @C80 , isomers of Sc2 C2 @C82 , and the family Sc2 C2 n (2 n=74, 76, 82, 86, 90, etc.), as well as Sc3 CH@C80 . The Sc-Ti/CH4 system produces the mixed-metal Sc2 TiC@C2 n (2 n=68, 78, 80) and Sc2 TiC2 @C2 n (2 n=80) clusterfullerene families. The molecular structures of the new, transition-metal-containing endohedral fullerenes, Sc2 TiC@Ih -C80 , Sc2 TiC@D5h -C80 , and Sc2 TiC2 @Ih -C80 , were characterized by NMR spectroscopy. The structure of Sc2 TiC@Ih -C80 was also determined by single-crystal X-ray diffraction, which demonstrated the presence of a short Ti=C double bond. Both Sc2 TiC- and Sc2 TiC2 -containing clusterfullerenes have Ti-localized LUMOs. Encapsulation of the redox-active Ti ion inside the fullerene cage enables analysis of the cluster-cage strain in the endohedral fullerenes through electrochemical measurements.

  13. Climate change projections for the Texas High Plains and Rolling Plains

    Science.gov (United States)

    Modala, Naga Raghuveer; Ale, Srinivasulu; Goldberg, Daniel W.; Olivares, Miriam; Munster, Clyde L.; Rajan, Nithya; Feagin, Rusty A.

    2017-07-01

    Potential changes in future climate in the Texas Plains region were investigated in the context of agriculture by analyzing three climate model projections under the A2 climate scenario (medium-high emission scenario). Spatially downscaled historic (1971-2000) and future (2041-2070) climate datasets (rainfall and temperature) were downloaded from the North American Regional Climate Change Assessment Program (NARCCAP). Climate variables predicted by three regional climate models (RCMs) namely the Regional Climate Model Version3-Geophysical Fluid Dynamics Laboratory (RCM3-GFDL), Regional Climate Model Version3-Third Generation Coupled Global Climate Model (RCM3-CGCM3), and Canadian Regional Climate Model-Community Climate System Model (CRCM-CCSM) were evaluated in this study. Gaussian and Gamma distribution mapping techniques were employed to remove the bias in temperature and rainfall data, respectively. Both the minimum and maximum temperatures across the study region in the future showed an upward trend, with the temperatures increasing in the range of 1.9 to 2.9 °C and 2.0 to 3.2 °C, respectively. All three climate models predicted a decline in rainfall within a range of 30 to 127 mm in majority of counties across the study region. In addition, they predicted an increase in the intensity of extreme rainfall events in the future. The frost-free season as predicted by the three models showed an increase by 2.6-3.4 weeks across the region, and the number of frost days declined by 17.9 to 30 %. Overall, these projections indicate considerable changes to the climate in the Texas Plains region in the future, and these changes could potentially impact agriculture in this region.

  14. Compuestos perazufrados de platino(II) con ditioéteres y tiolatos fluorados. Estructuras cristalinas de [Pt(SC6F5)2 (p-C6H4FSCH2CH2-p-SC6H4F)], [Pt(p-SC6HF4)...

    OpenAIRE

    Jorge Bautista; Agusti Bertran; Sylvain Bernès; Ubaldo Duran; Hugo Torrens

    2003-01-01

    En este articulo se describen la síntesis y caracterización de los compuestos cis-[PtCl2(RfSCH2CH2SRf)], Rf = C6F5, p-SC6HF4, o-SC6H4F, m-SC6H4F, p-SC6H4F, m-SC6H4(CF3), y las reacciones de estos compuestos con (SC6F5)– y (p-SC6HF4)– que generan cis- [Pt(SC6F5)2(RfSCH2CH2SRf)] y cis-[Pt(p-SC6HF4) 2(RfSCH2CH2 SRf)], Rf = o-SC6H4F, m-SC6H4F, p-SC6H4F, m-SC6H4(CF3). Para estos compuestos, los datos de RMN de 19F obtenidos a diferentes temperaturas, muestran la presencia e interconversion de isóm...

  15. One-neutron knockout from {sup 51-55}Sc

    Energy Technology Data Exchange (ETDEWEB)

    Schwertel, S.; Maierbeck, P.; Gernhaeuser, R.; Bildstein, V.; Boehmer, M.; Eppinger, K.; Faestermann, T.; Friese, J.; Fabbietti, L.; Maier, L.; Winkler, S. [Technische Universitaet Muenchen, Physik Department E12, Garching (Germany); Kruecken, R. [Technische Universitaet Muenchen, Physik Department E12, Garching (Germany); TRIUMF, Vancouver (Canada); University of British Columbia, Department of Physics and Astronomy, Vancouver (Canada); Kroell, T. [Technische Universitaet Muenchen, Physik Department E12, Garching (Germany); Technische Universitaet Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); Alvarez-Pol, H.; Benjamim, E.A.; Benlliure, J.; Caamano, M.; Cortina-Gil, D.; Gascon, M.; Kurtukian, T.; Perez, D.; Rodriguez-Tajes, C. [Universidade de Santiago de Compostela, Departamento de Fisica de Particulas, Santiago de Compostela (Spain); Aksouh, F.; Aumann, T.; Behr, K.; Boretzky, K.; Bruenle, A.; Chatillon, A.; Chulkov, L.V.; Geissel, H.; Gerl, J.; Gorska, M.; Kojouharov, I.; Klimkiewicz, A.; Kurz, N.; Nociforo, C.; Schaffner, H.; Simon, H.; Stanoiu, M.; Suemmerer, K.; Weick, H. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Borge, M.J.G.; Pascual-Izarra, C.; Perea, A.; Tengblad, O. [CSIC, Instituto de Estructura de la Materia, Madrid (Spain); Buerger, A. [University of Oslo, SAFE/OCL, Oslo (Norway); CEA, Gif-sur-Yvette (France); Casarejos, E.; Brown, B.A. [University of Vigo, Vigo (Spain); Enders, J.; Schrieder, G. [Technische Universitaet Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); Hansen, P.G. [Michigan State University, NSCL, East Lansing, Michigan (United States); Jonson, B.; Nyman, G. [Chalmers Tekniska Hoegskola och Goeteborgs Universitet, Experimentell Fysik, Goeteborg (Sweden); Kanungo, R. [TRIUMF, Vancouver (Canada); GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Saint Mary' s University, Halifax (Canada); Kiselev, O. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Johannes Gutenberg Universitaet, Mainz (Germany); Paul Scherrer Institut, Villigen (Switzerland); Larsson, K. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Chalmers Tekniska Hoegskola och Goeteborgs Universitet, Experimentell Fysik, Goeteborg (Sweden); Le Bleis, T. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); IN2P3-CNRS/Universite Louis Pasteur, Institut Pluridisciplinaire Hubert Curien, Strasbourg Cedex 2 (France); Mahata, K. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Paul Scherrer Institut, Villigen (Switzerland); Nilsson, T. [Technische Universitaet Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); Chalmers Tekniska Hoegskola och Goeteborgs Universitet, Experimentell Fysik, Goeteborg (Sweden); Prochazka, A. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Comenius University, Faculty of Mathematics and Physics, Bratislava (Slovakia); Rossi, D. [Johannes Gutenberg Universitaet, Mainz (Germany); Sitar, B. [Comenius University, Faculty of Mathematics and Physics, Bratislava (Slovakia); Otsuka, T. [University of Tokyo, Hongo, Bunkyo-ku, Department of Physics, Tokyo (Japan); Tostevin, J.A. [University of Surrey, Department of Physics, Faculty of Engineering and Physical Sciences, Guildford (United Kingdom); Rae, W.D.M. [Garsington, Oxfordshire (United Kingdom)

    2012-12-15

    Results are presented from a one-neutron knockout experiment at relativistic energies of {approx} 420 A MeV on {sup 51-55}Sc using the GSI Fragment Separator as a two-stage magnetic spectrometer and the MINIBALL array for gamma-ray detection. Inclusive longitudinal momentum distributions and cross-sections were measured enabling the determination of the contributions corresponding to knockout from the {nu}p{sub 1/2}, {nu}p{sub 3/2}, (L = 1) and {nu}f{sub 7/2}, {nu}f{sub 5/2} (L = 3) neutron orbitals. The observed L = 1 and L = 3 contributions are compared with theoretical cross-sections using eikonal knockout theory and spectroscopic factors from shell model calculations using the GXPF1A interaction. The measured inclusive knockout cross-sections generally follow the trends expected theoretically and given by the spectroscopic strength predicted from the shell model calculations. However, the deduced L = 1 cross-sections are generally 30-40% higher while the L = 3 contributions are about a factor of two smaller than predicted. This points to a promotion of neutrons from the {nu}f{sub 7/2} to the {nu}p{sub 3/2} orbital indicating a weakening of the N = 28 shell gap in these nuclei. While this is not predicted for the phenomenological GXPF1A interaction such a weakening is predicted by recent calculations using realistic low-momentum interactions V{sub low} {sub k} obtained by evolving a chiral N3LO nucleon-nucleon potential. (orig.)

  16. Validity evaluation of Sc x Al1-x N material constants based on SAW characteristics

    Science.gov (United States)

    Tang, Gongbin; Han, Tao; Zhang, Qiaozhen; Yamazaki, Kenta; Omori, Tatsuya; Hashimoto, Ken-ya

    2016-11-01

    This paper is aimed at examining the validity of material constants reported for use in surface acoustic wave (SAW) device simulations. First, based on the full set of material constants calculated by first principle, bulk acoustic wave velocities are calculated for Sc x Al1-x N and compared with published experimental results. Then, the effects of the Sc x Al1-x N material constants with different Sc content on acoustic characteristics are calculated and the influence of shear vibrations on SAW characteristics are recognized. Then, a series of SAW devices are fabricated on Sc x Al1-x N film/Si substrate structure with various Cu and ScAlN thicknesses h Cu and h ScAlN, respectively, and measured variations of phase velocity V and effective electromechanical coupling factor K\\text{e}2 with these parameters are compared with the calculation. The fairly well-agreed results indicate a reliable set of Sc x Al1-x N material constants for SAW device simulations.

  17. Production, purification, and characterization of scFv TNF ligand fusion proteins.

    Science.gov (United States)

    Fick, Andrea; Wyzgol, Agnes; Wajant, Harald

    2012-01-01

    Single-chain variable fragments (scFvs) specific for tumor-associated cell surface antigens are the most broadly used reagents to direct therapeutic or diagnostic effector molecules, such as toxins, radioisotopes, and CD3-stimulating scFvs, to tumors. One novel class of effector molecules that can be targeted to tumors by scFvs are ligands of the tumor necrosis factor (TNF) family. Typically, these molecules have apoptosis inducing and/or immune stimulating properties and are therefore highly attractive for cancer treatment. N-terminal fusion of scFvs does not interfere with the receptor binding capabilities of TNF ligands and thus allows the straightforward generation of scFv TNF ligand fusion proteins. We report here a protocol for the purification of eukaryotically produced scFv TNF ligand fusion proteins based on affinity chromatography on anti-Flag agarose and further describe assays for the determination of the targeting index of this type of scFv-targeted proteins.

  18. Differential dynamics of splicing factor SC35 during the cell cycle

    Indian Academy of Sciences (India)

    Kaushlendra Tripathi; Veena K Parnaik

    2008-09-01

    Pre-mRNA splicing factors are enriched in nuclear domains termed interchromatin granule clusters or nuclear speckles. During mitosis, nuclear speckles are disassembled by metaphase and reassembled in telophase in structures termed mitotic interchromatin granules (MIGs). We analysed the dynamics of the splicing factor SC35 in interphase and mitotic cells. In HeLa cells expressing green fluorescent protein (GFP)-SC35, this was localized in speckles during interphase and dispersed in metaphase. In telophase, GFP-SC35 was highly enriched within telophase nuclei and also detected in MIGs. Fluorescence recovery after photobleaching (FRAP) experiments revealed that the mobility of GFP-SC35 was distinct in different mitotic compartments. Interestingly, the mobility of GFP-SC35 was 3-fold higher in the cytoplasm of metaphase cells compared with interphase speckles, the nucleoplasm or MIGs. Treatment of cells with inhibitors of cyclin-dependent kinases (cdks) caused changes in the organization of nuclear compartments such as nuclear speckles and nucleoli, with corresponding changes in the mobility of GFP-SC35 and GFP-fibrillarin. Our results suggest that the dynamics of SC35 are significantly influenced by the organization of the compartment in which it is localized during the cell cycle.

  19. Growth and Holographic Storage Properties of Sc, Fe Co-Doped Lithium Niobate Crystals

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The holographic storage properties of Fe (0.03% (mass fraction) Fe2O3):LiNbO3 doped with Sc at different levels (0, 1%, 2%, 3%) were investigated.The Sc threshold concentration in Fe:LiNbO3 was implied to be about 3%(mole fraction) because O-H vibration absorption peak of Sc (3%):Fe:LiNbO3 was at 3508 cm-1, compared with 3484 cm-1 of crystals with lower Sc doping level.Sc(3%):Fe:LiNbO3 exhibited higher optical damage resistance ability.The threshold intensity (wavelength 488 nm) of Sc (3%):Fe:LiNbO3 was 2.2×102 W·cm-2, two orders of magnitude higher than that of Fe:LiNbO3.Holographic storage properties of the crystals were determined in an extraordinary polarized laser of wavelength 632.8 nm by a two-wave coupling method.It was found that in terms of holographic storage properties, the optimal doping concentration of Sc was 2%(mole fraction) among this crystal series.

  20. CERN Technical Training 2004: New Short Courses (SC) on Microsoft Outlook

    CERN Multimedia

    Monique Duval

    2004-01-01

    The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 31.8.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 31.8.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 7.9.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and she...