Mapping of polyketide biosynthesis pathways in Aspergillus nidulans using a genome wide PKS gene deletion library

DEFF Research Database (Denmark)

Larsen, Thomas Ostenfeld; Rank, Christian; Klejnstrup, Marie Louise

In order to map new links between PKS genes and their products in Aspergillus nidulans we have systematically deleted all thirty-two individual genes predicted to encode polyketide synthases in this model organism. This number greatly exceeds the number of currently known PKs calling for new appr...

Characterisation of pks15/1 in clinical isolates of Mycobacterium tuberculosis from Mexico

Directory of Open Access Journals (Sweden)

Roberto Zenteno-Cuevas

2013-09-01

Full Text Available Tuberculosis (TB is an infectocontagious respiratory disease caused by members of the Mycobacterium tuberculosis complex. A 7 base pair (bp deletion in the locus polyketide synthase (pks15/1 is described as polymorphic among members of the M. tuberculosis complex, enabling the identification of Euro-American, Indo-Oceanic and Asian lineages. The aim of this study was to characterise this locus in TB isolates from Mexico. One hundred twenty clinical isolates were recovered from the states of Veracruz and Estado de Mexico. We determined the nucleotide sequence of a ± 400 bp fragment of the locus pks15/1, while genotypic characterisation was performed by spoligotyping. One hundred and fifty isolates contained the 7 bp deletion, while five had the wild type locus. Lineages X (22%, LAM (18% and T (17% were the most frequent; only three (2% of the isolates were identified as Beijing and two (1% EAI-Manila. The wild type pks15/1 locus was observed in all Asian lineage isolates tested. Our results confirm the utility of locus pks15/1 as a molecular marker for identifying Asian lineages of the M. tuberculosis complex. This marker could be of great value in the epidemiological surveillance of TB, especially in countries like Mexico, where the prevalence of such lineages is unknown.

Rapid interstellar scintillation of quasar PKS 1257-326

NARCIS (Netherlands)

Bignall, Hayley E.; Jauncey, David L.; Lovell, James E. J.; Tzioumis, Anastasios K.; Macquart, Jean-Pierre; Kedziora-Chudczer, Lucyna; Engvold, O

2005-01-01

PKS 1257-326 is one of three quasars known to show unusually large and rapid, intra-hour intensity variations, as a result of scintillation in the turbulent Galactic interstellar medium. We have measured time delays in the variability pattern arrival times at the VLA and the ATCA, as well as an

A test of unification towards the radio source PKS1413+135

International Nuclear Information System (INIS)

Ferreira, M.C.; Julião, M.D.; Martins, C.J.A.P.; Monteiro, A.M.R.V.L.

2013-01-01

We point out that existing astrophysical measurements of combinations of the fine-structure constant α, the proton-to-electron mass ratio μ and the proton gyromagnetic ratio g p towards the radio source PKS1413+135 can be used to individually constrain each of these fundamental couplings. While the accuracy of the available measurements is not yet sufficient to test the spatial dipole scenario, our analysis serves as a proof of concept as new observational facilities will soon allow significantly more robust tests. Moreover, these measurements can also be used to obtain constraints on certain classes of unification scenarios, and we compare the constraints obtained for PKS1413+135 with those previously obtained from local atomic clock measurements

A test of unification towards the radio source PKS1413+135

Energy Technology Data Exchange (ETDEWEB)

Ferreira, M.C., E-mail: up200802537@fc.up.pt [Centro de Astrofísica, Universidade do Porto, Rua das Estrelas, 4150-762 Porto (Portugal); Faculdade de Ciências, Universidade do Porto, Rua do Campo Alegre, 4150-007 Porto (Portugal); Julião, M.D., E-mail: meinf12013@fe.up.pt [Centro de Astrofísica, Universidade do Porto, Rua das Estrelas, 4150-762 Porto (Portugal); Faculdade de Engenharia, Universidade do Porto, Rua Dr Roberto Frias, 4200-465 Porto (Portugal); Martins, C.J.A.P., E-mail: Carlos.Martins@astro.up.pt [Centro de Astrofísica, Universidade do Porto, Rua das Estrelas, 4150-762 Porto (Portugal); Monteiro, A.M.R.V.L., E-mail: mmonteiro@fc.up.pt [Centro de Astrofísica, Universidade do Porto, Rua das Estrelas, 4150-762 Porto (Portugal); Faculdade de Ciências, Universidade do Porto, Rua do Campo Alegre, 4150-007 Porto (Portugal); Department of Applied Physics, Delft University of Technology, P.O. Box 5046, 2600 GA Delft (Netherlands)

2013-07-09

We point out that existing astrophysical measurements of combinations of the fine-structure constant α, the proton-to-electron mass ratio μ and the proton gyromagnetic ratio g{sub p} towards the radio source PKS1413+135 can be used to individually constrain each of these fundamental couplings. While the accuracy of the available measurements is not yet sufficient to test the spatial dipole scenario, our analysis serves as a proof of concept as new observational facilities will soon allow significantly more robust tests. Moreover, these measurements can also be used to obtain constraints on certain classes of unification scenarios, and we compare the constraints obtained for PKS1413+135 with those previously obtained from local atomic clock measurements.

Both a PKS and a PPTase are involved in melanin biosynthesis and regulation of Aureobasidium melanogenum XJ5-1 isolated from the Taklimakan desert.

Science.gov (United States)

Jiang, Hong; Liu, Guang-Lei; Chi, Zhe; Wang, Jian-Ming; Zhang, Ly-Ly; Chi, Zhen-Ming

2017-02-20

A PKS1 gene responsible for the melanin biosynthesis and a NPG1 gene in Aureobasidium melanogenum XJ5-1 were cloned and characterized. An ORF of the PKS1 gene encoding a protein with 2165 amino acids contained 6495bp while an ORF of the NPG1 gene encoding a protein with 340 amino acids had 1076bp. After analysis of their promoters, it was found that expression of both the PKS1 gene and the NPG1 gene was repressed by nitrogen sources and glucose, respectively. The PKS deduced from the cloned gene consisted of one ketosynthase, one acyl transferase, two acyl carrier proteins, one thioesterase and one cyclase while the PPTase belonged to the family Sfp-type. After disruption of the PKS1 gene and the NPG1 gene, expression of the PKS1 gene and the NPG1 gene and the melanin biosynthesis in the disruptants K5 and DP107 disappeared and expression of the PKS1 gene in the disruptant DP107 was also negatively influenced. However, after the NPG1 gene was complemented in the disruptant DP107, the melanin biosynthesis in the complementary strain BP17 was restored and expression of the PKS1 gene and the NPG1 gene was greatly enhanced, suggesting that the PKS was indeed activated and regulated by the PPTase and expression of the PKS1 gene and the NPG1 gene had a coordinate regulation. Copyright © 2016 Elsevier B.V. All rights reserved.

POLA REKRUTMEN CALONLEGISLATIF DAPIL 1 PROVINSI ACEH YANG DILAKUKAN OLEH PARTAI KEADILAN SEJAHTERA (PKS DAN PARTAI NASIONAL DEMOKRAT (NASDEM

Directory of Open Access Journals (Sweden)

Ruslan Ruslan

2016-12-01

Full Text Available Political recruitment is the process of filling positions in political institutions, including political parties. While the Political Party is a vehicle to bring a particular party political interests in the throne of power in order to achieve what is expected. The purpose of this research is to see how the pattern of recruiting candidates for legislative constituency 1 Aceh province conducted by PKS and NasDem Party, criteria to be used in recruiting candidates for legislative constituency 1 Aceh province conducted by PKS and NasDem Party and what the opportunities and challenges in recruiting candidates one electoral district conducted by PKS and NasDem Party. The method used is descriptive method with qualitative approach. The data collection was done by interview and documentation. The result showed that the pattern of recruiting candidates for the electoral district legilatif 1 Aceh province conducted by the PKS and NasDem show that much different. In connection with this, it is an opportunity and a challenge PKS namely the legislative elections of 2014 more challenges than opportunities obtained by the PKS because of money politics so were experienced by the Party NasDem money politics becomes the greatest challenge in the legislative election first times followed by the Party NasDem   DOI : http://dx.doi.org/10.17977/um019v1i22016p111

Far UV observations of PKS2155-304

International Nuclear Information System (INIS)

Maraschi, L.; Tanzi, E.G.; Treves, A.; Tarenghi, M.

1980-01-01

Several spectra of the BL Lac object PKS2155 - 304 are reported in the 1,150 - 3,200 A band taken with the IUE when the object was in a bright phase. The UV flux connects smoothly with the optical and IR observations of the source in its brightest state and its extrapolation matches the soft X-ray flux, implying a change in spectral slope around 10 15 Hz. (UK)

Islamisme dan Politisasi Agama Model PKS dalam Pilpres 2009

Directory of Open Access Journals (Sweden)

Akh. Muzakki

2014-01-01

Full Text Available In the past decade or so, Islamism as a political concept and perhaps as an ideology has gained strong momentum in Indonesia. The fall of Soeharto after more than three decades in power has helped this ideology to emerge and exert itself particularly in the form of religion oriented political party. This paper is interested in exploring the expression and actualization of Islamism by scrutinizing the political behavior of Justice and Welfare Party (Partai Keadilan Sejahtera / PKS during the 2009 presidential election. We are particularly interested in looking at the use of religious symbols and rites by the party for clear political purposes. We argue that Islamism has been manipulated by PKS during that election as a vehicle to gain power. Hence, the main problem that this paper deals with is actually the idea of the politization of religion by a political party claiming to have represented Islam and its noble teaching.

Is the GeV-TeV emission of PKS 0447-439 from the proton synchrotron radiation?

Science.gov (United States)

Gao, Quan-Gui; Lu, Fang-Wu; Ma, Ju; Ren, Ji-Yang; Li, Huai-Zhen

2018-06-01

We study the multi-wavelength emission features of PKS 0447-439 in the frame of the one-zone homogeneous lepto-hadronic model. In this model, we assumed that the steady power-laws with exponential cut-offs distributions of protons and electrons are injected into the source. The non-linear time-dependent kinematic equations, describing the evolution of protons, electrons and photons, are defined; these equations self-consistently involve synchrotron radiation of protons, photon-photon interaction, synchrotron radiation of electron/positron pairs, inverse Compton scattering and synchrotron self-absorption. The model is applied to reproduce the multi-wavelength spectrum of PKS 0447-439. Our results indicate that the spectral energy distribution (SED) of PKS 0447-439 can be reproduced well by the model. In particular, the GeV-TeV emission is produced by the synchrotron radiation of relativistic protons. The physically plausible solutions require the magnetic strength 10 G≲ B ≲ 100 G. We found that the observed spectrum of PKS 0447-439 can be reproduced well by the model whether z = 0.16 or z = 0.2, and the acceptable upper limit of redshift is z=0.343.

PROFIL PEMBELAJARAN SAINS BERBASIS KELASS SEBAGAI UPAYA MENGEMBANGKAN KPS DAN MENINGKATKAN PKS SISWA (STUDI KASUS DI SMPN 1 KOTA JAMBI

Directory of Open Access Journals (Sweden)

Sukarno Sukarno

2014-10-01

Full Text Available Kegiatan Belajar Mengajar (KBM sains di tingkat SMP bertujuan untuk mengembangkan Keterampilan Proses Sains (KPS dan menanamkan Penguasaan Konsep Sains (PKS. Oleh karena itu, KBM sains harus memberikan peluang untuk mengembangkan KPS dan PKS secara bersama-sama dan tidak terpisahkan. KBM sains berbasis Kegiatan Eksplorasi Lingkungan Alam di Sekitar Sekolah (KELASS dianggap mampu memberikan ruang yang luas untuk mengembangkan KPS siswa dan PKS. Oleh karena itu, penelitian kualitatif ini dilakukan dengan tujuan untuk mengetahui apa saja faktor pendukung dan faktor penghambat pelaksanaan KBM sains berbasis KELASS dan implikasinya terhadap KPS dan PKS siswa. Data hasil wawancara, observasi dan tes menunjukkan bahwa faktor pendukung KBM sains berbasis KELASS adalah sarana dan prasarana (indoor dan outdoor yang memadai. Sedangkan kendala utama bagi para guru sains adalah tidak adanya bahan ajar sains yang berorientasi pada eksplorasi lingkungan alam sekitar sekolah untuk mengembangkan mahasiswa KPS dan PKS. Oleh karena itu, perlu dikembangkan bahan ajar sains yang dapat mempermudah guru sains dalam melakukan KBM sains berbasis KELASS.   Kata kunci:    eksplorasi lingkungan alam di sekitar sekolah, keterampilan proses sains, penguasaan konsep sains

Optical features associated with the quasar PKS 2135-14

International Nuclear Information System (INIS)

Hawkins, M.R.S.

1978-01-01

The field surrounding the quasar PKS 2135-14 has been investigated from B and R photographs taken with the 3.8-m Anglo-Australian telescope. Isophotal plots of the plates, produced with the COSMOS measuring machine, have revealed a number of faint optical features apparently associated with the radio source. (author)

Crystallization and preliminary X-ray analysis of the bacillaene synthase trans-acting acyltransferase PksC

International Nuclear Information System (INIS)

Cuskin, Fiona; Solovyova, Alexandra S.; Lewis, Richard J.; Race, Paul R.

2011-01-01

The expression, purification and crystallization of the trans-acting acyltransferase PksC from the bacillaene hybrid polyketide synthase/nonribosomal peptide synthetase is described. The crystals belonged to the orthorhombic space group P2 1 2 1 2 1 and diffracted to 1.44 Å resolution. The antibiotic bacillaene is biosynthesized in Bacillus subtilis by a hybrid type 1 modular polyketide synthase/nonribosomal peptide synthetase of the trans-acyltransferase (trans-AT) class. Within this system, the essential acyl-group loading activity is provided by the action of three free-standing trans-acting acyltransferases. Here, the recombinant expression, purification and crystallization of the bacillaene synthase trans-acting acyltransferase PksC are reported. A diffraction data set has been collected from a single PksC crystal to 1.44 Å resolution and the crystal was found to belong to the orthorhombic space group P2 1 2 1 2 1

Arabidopsis protein kinase PKS5 inhibits the plasma membrane H+ -ATPase by preventing interaction with 14-3-3 protein

DEFF Research Database (Denmark)

Fuglsang, Anja Thoe; Guo, Yan; Cuin, Tracey A.

2007-01-01

Regulation of the trans-plasma membrane pH gradient is an important part of plant responses to several hormonal and environmental cues, including auxin, blue light, and fungal elicitors. However, little is known about the signaling components that mediate this regulation. Here, we report...... that an Arabidopsis thaliana Ser/Thr protein kinase, PKS5, is a negative regulator of the plasma membrane proton pump (PM Hþ-ATPase). Loss-of-function pks5 mutant plants are more tolerant of high external pH due to extrusion of protons to the extracellular space. PKS5 phosphorylates the PM Hþ-ATPase AHA2 at a novel...

Dinamika Islam Politik Pasca Orde baru: Kajian Psikoanalisi Lacanian atas Hubungan KAMMI dan PKS

Directory of Open Access Journals (Sweden)

Ahmad Rizky Mardhatillah Umar

2014-07-01

Full Text Available This article aims at analyzing the relations between student movement andpolitical party in post-reform era of Indonesia. KAMMI, a prominent Islamiststudent movement in Indonesia, often associated with PKS (Prosperous JusticeParty in terms of identity and political practices. It has created ‘independencedilemma’ for KAMMI because since its first Congress in 1998, this studentorganization has declared ‘independent from all political forces’. This article,using Lacanian psychoanalytical tradition, exposes the forms of KAMMI’ssubjectivity and PKS interpellation that enable this political party to dominateKAMMI’s articulatory practices. The interpellation process is supported withthe projection of fantacy, emotion, and mirror in the development of KAMMIsince 1998 until present. It leads to PKS creating the KAMMI identity andthus made KAMMI’s articulatory practices identical with this party. However,there were several attempts to dislocate the hegemony through several internalreform movements. These attempts, although made contribution to internaldynamics within KAMMI, were unable to create alternative discourse dueto several limits of those movements. The case of KAMMI can be a model toexplain how other student movements develop and relate to political parties inIndonesian post-reform.

Designing and Implementing an Assay for the Detection of Rare and Divergent NRPS and PKS Clones in European, Antarctic and Cuban Soils.

Directory of Open Access Journals (Sweden)

Gregory C A Amos

Full Text Available The ever increasing microbial resistome means there is an urgent need for new antibiotics. Metagenomics is an underexploited tool in the field of drug discovery. In this study we aimed to produce a new updated assay for the discovery of biosynthetic gene clusters encoding bioactive secondary metabolites. PCR assays targeting the polyketide synthases (PKS and non-ribosomal peptide synthetases (NRPS were developed. A range of European soils were tested for their biosynthetic potential using clone libraries developed from metagenomic DNA. Results revealed a surprising number of NRPS and PKS clones with similarity to rare Actinomycetes. Many of the clones tested were phylogenetically divergent suggesting they were fragments from novel NRPS and PKS gene clusters. Soils did not appear to cluster by location but did represent NRPS and PKS clones of diverse taxonomic origin. Fosmid libraries were constructed from Cuban and Antarctic soil samples; 17 fosmids were positive for NRPS domains suggesting a hit rate of less than 1 in 10 genomes. NRPS hits had low similarities to both rare Actinobacteria and Proteobacteria; they also clustered with known antibiotic producers suggesting they may encode for pathways producing novel bioactive compounds. In conclusion we designed an assay capable of detecting divergent NRPS and PKS gene clusters from the rare biosphere; when tested on soil samples results suggest the majority of NRPS and PKS pathways and hence bioactive metabolites are yet to be discovered.

PERAN BUDAYA ORGANISASI DALAM MEWUJUDKAN VISI MISI PARTAI KEADILAN SEJAHTERA (PKS

Directory of Open Access Journals (Sweden)

Much. Yulianto

2016-11-01

The results showed: (1 organizational culture play a role in shaping the identity and character of party members; (2 The organizational culture also plays a role in encouraging loyalty and solidity of party members; (3 the organizational culture at PKS played role in strengthening the confidence of individual members.

Redshift of the BL Lacertae object PKS 2005-489

Energy Technology Data Exchange (ETDEWEB)

Falomo, R.; Maraschi, L.; Treves, A.; Tanzi, E.G.

1987-07-01

In a high-resolution spectrum of PKS 2005-489 taken on Aug. 16, 1986 two weak emission lines (EW = about 1 A) were detected at 7031 and 7051 A. Identification with H-alpha and the 6583-A forbidden line of N II is proposed at a redshift z = 0.071. The observations correspond to a relatively faint state of the source with B = about 14.7. 12 references.

Redshift of the BL Lacertae object PKS 2005-489

International Nuclear Information System (INIS)

Falomo, R.; Maraschi, L.; Treves, A.; Tanzi, E.G.; Milano Universita, Milan, Italy; CNR, Istituto di Fisica Cosmica, Milan, Italy)

1987-01-01

In a high-resolution spectrum of PKS 2005-489 taken on Aug. 16, 1986 two weak emission lines (EW = about 1 A) were detected at 7031 and 7051 A. Identification with H-alpha and the 6583-A forbidden line of N II is proposed at a redshift z = 0.071. The observations correspond to a relatively faint state of the source with B = about 14.7. 12 references

Search for a pentaquark decaying to pKS0

Science.gov (United States)

FOCUS Collaboration; Link, J. M.; Yager, P. M.; Anjos, J. C.; Bediaga, I.; Castromonte, C.; Machado, A. A.; Magnin, J.; Massafferri, A.; de Miranda, J. M.; Pepe, I. M.; Polycarpo, E.; Dos Reis, A. C.; Carrillo, S.; Casimiro, E.; Cuautle, E.; Sánchez-Hernández, A.; Uribe, C.; Vázquez, F.; Agostino, L.; Cinquini, L.; Cumalat, J. P.; Frisullo, V.; O'Reilly, B.; Segoni, I.; Stenson, K.; Butler, J. N.; Cheung, H. W. K.; Chiodini, G.; Gaines, I.; Garbincius, P. H.; Garren, L. A.; Gottschalk, E.; Kasper, P. H.; Kreymer, A. E.; Kutschke, R.; Wang, M.; Benussi, L.; Bertani, M.; Bianco, S.; Fabbri, F. L.; Pacetti, S.; Zallo, A.; Reyes, M.; Cawlfield, C.; Kim, D. Y.; Rahimi, A.; Wiss, J.; Gardner, R.; Kryemadhi, A.; Chung, Y. S.; Kang, J. S.; Ko, B. R.; Kwak, J. W.; Lee, K. B.; Cho, K.; Park, H.; Alimonti, G.; Barberis, S.; Boschini, M.; Cerutti, A.; D'Angelo, P.; Dicorato, M.; Dini, P.; Edera, L.; Erba, S.; Inzani, P.; Leveraro, F.; Malvezzi, S.; Menasce, D.; Mezzadri, M.; Moroni, L.; Pedrini, D.; Pontoglio, C.; Prelz, F.; Rovere, M.; Sala, S.; Davenport, T. F.; Arena, V.; Boca, G.; Bonomi, G.; Gianini, G.; Liguori, G.; Lopes Pegna, D.; Merlo, M. M.; Pantea, D.; Ratti, S. P.; Riccardi, C.; Vitulo, P.; Göbel, C.; Olatora, J.; Hernandez, H.; Lopez, A. M.; Mendez, H.; Paris, A.; Quinones, J.; Ramirez, J. E.; Zhang, Y.; Wilson, J. R.; Handler, T.; Mitchell, R.; Engh, D.; Givens, K. M.; Hosack, M.; Johns, W. E.; Luiggi, E.; Nehring, M.; Sheldon, P. D.; Vaandering, E. W.; Webster, M.; Sheaff, M.

2006-08-01

We present a search for a pentaquark decaying strongly to pKS0 in γN collisions at a center-of-mass energy up to 25 GeV. Finding no evidence for such a state in the mass range of 1470 MeV/c to 2200 MeV/c, we set limits on the yield and on the cross section times branching ratio relative to Σ1385 and K892.

Phylogeny and expression analyses reveal important roles for plant PKS III family during the conquest of land by plants and angiosperm diversification

Directory of Open Access Journals (Sweden)

Lulu Xie

2016-08-01

Full Text Available AbstractPolyketide synthases (PKSs utilize the products of primary metabolism to synthesize a wide array of secondary metabolites in both prokaryotic and eukaryotic organisms. PKSs can be grouped into three distinct classes, type I, II, and III, based on enzyme structure, substrate specificity, and catalytic mechanisms. The type III PKS enzymes function as homodimers, and are the only class of PKS that do not require acyl carrier protein. Plant type III PKS enzymes, also known as chalcone synthase (CHS-like enzymes, are of particular interest due to their functional diversity. In this study, we mined type III PKS gene sequences from the genomes of six aquatic algae and twenty-five land plants (one bryophyte, one lycophyte, two basal angiosperms, sixteen core eudicots, and five monocots. PKS III sequences were found relatively conserved in all embryophytes, but not exist in algae. We also examined gene expression patterns by analyzing available transcriptome data, and identified potential cis regulatory elements in upstream sequences. Phylogenetic trees of dicots angiosperms showed that plant type III PKS proteins fall into three clades. Clade A contains CHS/STS-type enzymes coding genes with diverse transcriptional expression patterns and enzymatic functions, while clade B is further divided into subclades b1 and b2, which consist of anther-specific CHS-like enzymes. Differentiation regions, such as amino acids 196-207 between clades A and B, and predicted positive selected sites within α-helixes in late appeared branches of clade A, account for the major diversification in substrate choice and catalytic reaction. The integrity and location of conserved cis-elements containing MYB and bHLH binding sites can affect transcription levels. Potential binding sites for transcription factors such as WRKY, SPL or AP2/EREBP may contribute to tissue- or taxon-specific differences in gene expression. Our data shows that gene duplications and functional

Identification of PaPKS1, a polyketide synthase involved in melanin formation and its use as a genetic tool in Podospora anserina.

Science.gov (United States)

Coppin, Evelyne; Silar, Philippe

2007-08-01

In the filamentous fungus Podospora anserina, many pigmentation mutations map to the median region of the complex locus '14', called segment '29'. The data presented in this paper show that segment 29 corresponds to a gene encoding a polyketide synthase, designated PaPKS1, and identifies two mutations that completely or partially abolish the activity of the PaPKS1 polypeptide. We present evidence that the P. anserina green pigment is a (DHN)-melanin. Using the powerful genetic system of PaPKS1 cloning, we demonstrate that in P. anserina trans-duplicated sequences are subject to the RIP process as previously demonstrated for the cis-duplicated regions.

FERMI/LARGE AREA TELESCOPE DISCOVERY OF GAMMA-RAY EMISSION FROM THE FLAT-SPECTRUM RADIO QUASAR PKS 1454-354

International Nuclear Information System (INIS)

Abdo, A. A.; Ackermann, M.; Bechtol, K.; Berenji, B.; Blandford, R. D.; Bloom, E. D.; Borgland, A. W.; Atwood, W. B.; Axelsson, M.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Baughman, B. M.; Bogaert, G.; Bonamente, E.; Brigida, M.

2009-01-01

We report the discovery by the Large Area Telescope (LAT) onboard the Fermi Gamma-Ray Space Telescope of high-energy γ-ray (GeV) emission from the flat-spectrum radio quasar PKS 1454-354 (z = 1.424). On 2008 September 4, the source rose to a peak flux of (3.5 ± 0.7) x 10 -6 ph cm -2 s -1 (E > 100 MeV) on a timescale of hours and then slowly dropped over the following 2 days. No significant spectral changes occurred during the flare. Fermi/LAT observations also showed that PKS 1454-354 is the most probable counterpart of the unidentified EGRET source 3EG J1500-3509. Multiwavelength measurements performed during the following days (7 September with Swift; 6-7 September with the ground-based optical telescope Automated Telescope for Optical Monitoring; 13 September with the Australia Telescope Compact Array) resulted in radio, optical, UV, and X-ray fluxes greater than archival data, confirming the activity of PKS 1454-354.

Crystallization and preliminary X-ray diffraction studies of polyketide synthase-1 (PKS-1) from Cannabis sativa

International Nuclear Information System (INIS)

Taguchi, Chiho; Taura, Futoshi; Tamada, Taro; Shoyama, Yoshinari; Shoyama, Yukihiro; Tanaka, Hiroyuki; Kuroki, Ryota; Morimoto, Satoshi

2008-01-01

Polyketide synthase-1 from C. sativa has been crystallized. The crystal diffracted to 1.55 Å resolution with sufficient quality for further structure determination. Polyketide synthase-1 (PKS-1) is a novel type III polyketide synthase that catalyzes the biosynthesis of hexanoyl triacetic acid lactone in Cannabis sativa (Mexican strain). PKS-1 was overproduced in Escherichia coli, purified and finally crystallized in two different space groups. The crystal obtained in 0.1 M HEPES buffer pH 7.5 containing 0.2 M calcium acetate and 20%(w/v) polyethylene glycol 3350 diffracted to 1.65 Å resolution and belonged to space group P1, with unit-cell parameters a = 54.3, b = 59.3, c = 62.6 Å, α = 69, β = 81, γ = 80°. Another crystal obtained in 0.1 M HEPES buffer pH 7.5 containing 0.2 M sodium chloride and 20%(w/v) polyethylene glycol 3350 diffracted to 1.55 Å resolution and belonged to space group P2 1 2 1 2 1 , with unit-cell parameters a = 54.3, b = 110, c = 130 Å. These data will enable us to determine the crystal structure of PKS-1

Crystallization and preliminary X-ray diffraction studies of polyketide synthase-1 (PKS-1) from Cannabis sativa

Energy Technology Data Exchange (ETDEWEB)

Taguchi, Chiho [Faculty of Pharmaceutical Sciences, Kyushu University (Japan); Quantum Beam Science Directorate, Japan Atomic Energy Agency (Japan); Taura, Futoshi [Faculty of Pharmaceutical Sciences, Kyushu University (Japan); Tamada, Taro; Shoyama, Yoshinari [Quantum Beam Science Directorate, Japan Atomic Energy Agency (Japan); Shoyama, Yukihiro; Tanaka, Hiroyuki [Faculty of Pharmaceutical Sciences, Kyushu University (Japan); Kuroki, Ryota [Quantum Beam Science Directorate, Japan Atomic Energy Agency (Japan); Morimoto, Satoshi [Faculty of Pharmaceutical Sciences, Kyushu University (Japan)

2008-03-01

Polyketide synthase-1 from C. sativa has been crystallized. The crystal diffracted to 1.55 Å resolution with sufficient quality for further structure determination. Polyketide synthase-1 (PKS-1) is a novel type III polyketide synthase that catalyzes the biosynthesis of hexanoyl triacetic acid lactone in Cannabis sativa (Mexican strain). PKS-1 was overproduced in Escherichia coli, purified and finally crystallized in two different space groups. The crystal obtained in 0.1 M HEPES buffer pH 7.5 containing 0.2 M calcium acetate and 20%(w/v) polyethylene glycol 3350 diffracted to 1.65 Å resolution and belonged to space group P1, with unit-cell parameters a = 54.3, b = 59.3, c = 62.6 Å, α = 69, β = 81, γ = 80°. Another crystal obtained in 0.1 M HEPES buffer pH 7.5 containing 0.2 M sodium chloride and 20%(w/v) polyethylene glycol 3350 diffracted to 1.55 Å resolution and belonged to space group P2{sub 1}2{sub 1}2{sub 1}, with unit-cell parameters a = 54.3, b = 110, c = 130 Å. These data will enable us to determine the crystal structure of PKS-1.

Some physical and mechanical properties of palm kernel shell (PKS ...

African Journals Online (AJOL)

In this study, some of the mechanical and physical properties of palm kernel shells (PKS) were evaluated. These are moisture content, 7.8325 ± 0.6672%; true density, 1.254 ± 5.292 x 10-3 g/cm3; bulk density, 1.1248g/cm3; mean rupture force along width, and thickness were 3174.52 ± 270.70N and 2806.94 ± 498.45N for ...

[123I]epidepride binding to cerebellar dopamine D2/D3 receptors is displaceable: implications for the use of cerebellum as a reference region

DEFF Research Database (Denmark)

Pinborg, Lars H; Videbaek, Charlotte; Ziebell, Morten

2007-01-01

The low density of cerebellar dopamine D(2)/D(3) receptors provides the basis for using the cerebellum as a representation of free- and non-specifically bound radioligand in positron emission tomography (PET) and single photon emission computed tomography (SPECT) studies. With the development...... of ultra high-affinity dopamine D(2)/D(3) ligands like [(123)I]epidepride, [(18)F]fallypride, and [(11)C]FLB-457, quantification of extrastriatal low density receptor populations including the cerebellum is possible with important implications for calculation of binding parameters. [(123)I...... [(123)I]epidepride binding to dopamine D(2)/D(3) receptors in the cerebellum. Using the cerebellum as a representation of free and non-specifically bound radioligand and neglecting the specifically bound component may lead to results that erroneously imply that antipsychotic drugs bind to extrastriatal...

ALMA observations of AGN fuelling. The case of PKS B1718-649

Science.gov (United States)

Maccagni, F. M.; Morganti, R.; Oosterloo, T. A.; Oonk, J. B. R.; Emonts, B. H. C.

2018-06-01

We present ALMA observations of the 12CO (2-1) line of the newly born (tradio 102 years) active galactic nucleus (AGN), PKS B1718-649. These observations reveal that the carbon monoxide in the innermost 15 kpc of the galaxy is distributed in a complex warped disk. In the outer parts of this disk, the CO gas follows the rotation of the dust lane and of the stellar body of the galaxy hosting the radio source. In the innermost kiloparsec, the gas abruptly changes orientation and forms a circumnuclear disk (r ≲ 700 pc) with its major axis perpendicular to that of the outer disk. Against the compact radio emission of PKS B1718-649 (r 2 pc), we detect an absorption line at red-shifted velocities with respect to the systemic velocity (Δv = +365 ± 22 km s-1). This absorbing CO gas could trace molecular clouds falling onto the central super-massive black hole. A comparison with the near-infrared H2 1-0 S(1) observations shows that the clouds must be close to the black hole (r ≲ 75 pc). The physical conditions of these clouds are different from the gas at larger radii, and are in good agreement with the predictions for the conditions of the gas when cold chaotic accretion triggers an active galactic nucleus. These observations on the centre of PKS B1718-649 provide one of the best indications that a population of cold clouds is falling towards a radio AGN, likely fuelling its activity. The reduced datacube is only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/614/A42

Gamma-Ray Flaring Activity from the Gravitationally Lensed Blazar PKS 1830-211 Observed by Fermi LAT

Energy Technology Data Exchange (ETDEWEB)

Abdo, A. A.; et al.

2015-01-23

The Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope routinely detects the MeV-peaked flat-spectrum radio quasar PKS 1830–211 (z = 2.507). Its apparent isotropic γ-ray luminosity (E > 100 MeV), averaged over ~3 years of observations and peaking on 2010 October 14/15 at 2.9 × 10(50) erg s(–)(1), makes it among the brightest high-redshift Fermi blazars. No published model with a single lens can account for all of the observed characteristics of this complex system. Based on radio observations, one expects time-delayed variability to follow about 25 days after a primary flare, with flux about a factor of 1.5 less. Two large γ-ray flares of PKS 1830–211 have been detected by the LAT in the considered period, and no substantial evidence for such a delayed activity was found. This allows us to place a lower limit of about 6 on the γ-ray flux ratio between the two lensed images. Swift XRT observations from a dedicated Target of Opportunity program indicate a hard spectrum with no significant correlation of X-ray flux with the γ-ray variability. The spectral energy distribution can be modeled with inverse Compton scattering of thermal photons from the dusty torus. The implications of the LAT data in terms of variability, the lack of evident delayed flare events, and different radio and γ-ray flux ratios are discussed. Microlensing effects, absorption, size and location of the emitting regions, the complex mass distribution of the system, an energy-dependent inner structure of the source, and flux suppression by the lens galaxy for one image path may be considered as hypotheses for understanding our results.

An unusually strong Einstein ring in the radio source PKS1830-211

International Nuclear Information System (INIS)

Jauncey, D.L.

1991-01-01

RADIO observations of the strong, flat-spectrum radio source PKS1830-211 revealed a double structure, with a separation of 1 arcsec, suggesting that it might be a gravitationally lensed object. We have now obtained high-resolution radio images of PKS1830-211 from several interferometric radiotelescope networks, which show an unusual elliptical ring-like structure connecting the two brighter components. The presence of the ring, and the similarity of the two brighter spots, argue strongly that this is indeed a gravitationally lensed system, specifically an Einstein ring in which lens and lensed object are closely aligned. Although the source is close to the galactic plane, it seems that both the lens and background (lensed) object are extragalactic. This object is one hundred times brighter than either of the two previously discovered radio Einstein rings, and is among the six brightest flat-spectrum sources in the sky. Its brightness makes it a peculiar object: it must involve either a chance alignment of a lensing object with an unusually bright background source, or an alignment with a less bright object but amplified to an unusual degree. (author)

New bounds on axionlike particles from the Fermi Large Area Telescope observation of PKS 2155 -304

Science.gov (United States)

Zhang, Cun; Liang, Yun-Feng; Li, Shang; Liao, Neng-Hui; Feng, Lei; Yuan, Qiang; Fan, Yi-Zhong; Ren, Zhong-Zhou

2018-03-01

The axionlike particle (ALP)-photon mixing in the magnetic field around γ -ray sources or along the line of sight could induce oscillation between photons and ALPs, which then causes irregularities in the γ -ray spectra. In this work we search for such spectral irregularities in the spectrum of PKS 2155 -304 using 8.6 years of data from the Fermi Large Area Telescope (Fermi-LAT). No significant evidence for the presence of ALP-photon oscillation is obtained, and the parameter space of ALPs is constrained. The exclusion region sensitively depends on the poorly known magnetic field of the host galaxy cluster of PKS 2155 -304 . If the magnetic field is as high as ˜10 μ G , the "holelike" parameter region allowed in Ref. [1] can be ruled out.

Multi-Wavelength Variability in PKS 2155-304 Y. G. Zheng1,2, L ...

Indian Academy of Sciences (India)

2009), we attempt to model the multi-wavelength variability in PKS 2155-304. We assume that the acceleration process is a stochastic process and we describe it as the diffusion of the particle momentum. Throughout the paper, we assume the. Hubble constant H0 = 70 km s−1. Mpc. −1. , the matter energy density M = 0.27,.

Multifrequency observations of the Blazar PKS 0537-441 in a moderately active state

International Nuclear Information System (INIS)

Tanzi, E.G.; Chiappetti, L.; Barr, P.; Bouchet, P.; Cristiani, S.; EXOSAT Observatory, Darmstadt, West Germany; European Southern Observatory, La Silla, Chile)

1986-01-01

PKS 0537-441 was observed during an active state in February 1985 at infrared, optical, UV, and X-ray frequencies. Comparison with earlier measurements indicates that the source brightened by a factor of approximately 2 in all bands. This suggests that the same spatial region may be responsible for the emission in the whole spectral range observed. 19 references

Multifrequency observations of the Blazar PKS 0537-441 in a moderately active state

Energy Technology Data Exchange (ETDEWEB)

Tanzi, E.G.; Chiappetti, L.; Barr, P.; Bouchet, P.; Cristiani, S.

1986-12-01

PKS 0537-441 was observed during an active state in February 1985 at infrared, optical, UV, and X-ray frequencies. Comparison with earlier measurements indicates that the source brightened by a factor of approximately 2 in all bands. This suggests that the same spatial region may be responsible for the emission in the whole spectral range observed. 19 references.

First detection in gamma-rays of a young radio galaxy: Fermi -LAT observations of the compact symmetric object PKS 1718−649

Energy Technology Data Exchange (ETDEWEB)

Migliori, G.; Loh, A.; Corbel, S. [Laboratoire AIM (CEA/IRFU—CNRS/INSU—Université Paris Diderot), CEA DSM/SAp, F-91191 Gif-sur-Yvette (France); Siemiginowska, A.; Sobolewska, M. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Ostorero, L. [Dipartimento di Fisica, Università degli Studi di Torino and Istituto Nazionale di Fisica Nucleare (INFN), Via P. Giuria 1, I-10125 Torino (Italy); Stawarz, Ł., E-mail: giulia.migliori@cea.fr [Astronomical Observatory, Jagiellonian University, ul. Orla 171, 30-244 Kraków (Poland)

2016-04-20

We report the γ -ray detection of a young radio galaxy, PKS 1718−649, belonging to the class of compact symmetric objects (CSOs), with the Large Area Telescope (LAT) on board the Fermi satellite. The third Fermi Gamma-ray LAT catalog (3FGL) includes an unassociated γ -ray source, 3FGL J1728.0−6446, located close to PKS 1718−649. Using the latest Pass 8 calibration, we confirm that the best-fit 1 σ position of the γ -ray source is compatible with the radio location of PKS 1718−649. Cross-matching of the γ -ray source position with the positions of blazar sources from several catalogs yields negative results. Thus, we conclude that PKS 1718−649 is the most likely counterpart to the unassociated LAT source. We obtain a detection test statistics TS ∼ 36 (>5 σ ) with a best-fit photon spectral index Γ = 2.9 ± 0.3 and a 0.1–100 GeV photon flux density F {sub 0.1−100} {sub GeV} = (11.5 ± 0.3) × 10{sup −9} ph cm{sup −2} s{sup −1}. We argue that the linear size (∼2 pc), the kinematic age (∼100 years), and the source distance ( z = 0.014) make PKS 1718−649 an ideal candidate for γ -ray detection in the framework of the model proposing that the most compact and the youngest CSOs can efficiently produce GeV radiation via inverse-Compton scattering of the ambient photon fields by the radio lobe non-thermal electrons. Thus, our detection of the source in γ -rays establishes young radio galaxies as a distinct class of extragalactic high-energy emitters and yields a unique insight on the physical conditions in compact radio lobes interacting with the interstellar medium of the host galaxy.

Galaxy at a redshift of 3.215 - further studies of the PKS 1614+051 system

International Nuclear Information System (INIS)

Djorgovski, S.; Strauss, M.A.; Spinrad, H.; Mccarthy, P.; Perley, R.A.; California Univ., Berkeley; National Radio Astronomy Observatory, Charlottesville, VA)

1987-01-01

A narrow-emission-line companion of the quasar PKS 1614+051 was reported earlier as a probable galaxy at a redshift of 3.218, which would have made it by far the most distant galaxy known at the time. New radio and optical imaging, and optical and near-IR spectroscopy of the PKS 1614+051 system is reported here. It is argued that the data support and reinforce the original interpretation of the companion object as a mildly active galaxy, possibly a marginal Seyfert 2. The object has a detectable and marginally resolved optical continuum, but was not detected at radio wavelengths. The ionization state is low, and the emission lines are fairly narrow. The improved redshift for the companion, based on the Ly-alpha line alone, is 3.215 + or - 0.002. New Ly-alpha images show interesting morphology of extended emission-line gas, suggestive of a possible tidal interaction with the neighboring QSO. 24 references

Unveiling the nature of the γ-ray emitting active galactic nucleus PKS 0521-36

International Nuclear Information System (INIS)

D'Ammando, F.; Istituto Nazionale di Astrofisica; Orienti, M.; Tavecchio, F.; Ghisellini, G.

2015-01-01

PKS 0521-36 is an active galactic nucleus (AGN) with uncertain classification. Here, we investigate the properties of this source from radio to γ-rays. The broad emission lines in the optical and ultraviolet bands and steep radio spectrum indicate a possible classification as an intermediate object between broad-line radio galaxies (BLRG) and steep spectrum radio quasars (SSRQ). On pc-scales PKS 0521-36 shows a knotty structure similar to misaligned AGN. The core dominance and the γ-ray properties are similar to those estimated for other SSRQ and BLRG detected in γ-rays, suggesting an intermediate viewing angle with respect to the observer. In this context the flaring activity detected from this source by Fermi-Large Area Telescope between 2010 June and 2012 February is very intriguing. We discuss the γ-ray emission of this source in the framework of the structured jet scenario, comparing the spectral energy distribution (SED) of the flaring state in 2010 June with that of a low state. We present three alternative models corresponding to three different choices of the viewing angles θv = 6°, 15°, and 20°. We obtain a good fit for the first two cases, but the SED obtained with θv = 15° if observed at a small angle does not resemble that of a typical blazar since the synchrotron emission should dominate by a large factor (~100) the inverse Compton component. This suggests that a viewing angle between 6° and 15° is preferred, with the rapid variability observed during γ-ray flares favouring a smaller angle. However, we cannot rule out that PKS 0521-36 is the misaligned counterpart of a synchrotron-dominated blazar.

Effects of [123I]ADAM, a serotonin transporter radiopharmaceutical, on pregnant Sprague–Dawley rats

International Nuclear Information System (INIS)

Chang, K.W.; Lin, M.C.; Lee, S.Y.; Chen, H.Y.; Chen, C.C.; Fu, Y.K.

2012-01-01

Serotonin transport abnormalities are implicated in neuropsychiatric disorders. [ 123 I]ADAM ([ 123 I]-2-([2-({dimethylamino}methyl)phenyl]thio)-5-iodophenylamine) is a novel radiotracer that targets serotonin transporters. We assessed the toxicity of [ 123 I]ADAM (18.5 MBq) administered in early- and late-phases (8 and 14 day postfertilization, respectively) of pregnancy. The mortality, clinical status, and gross necropsy were measured in pregnant rats, and the fertility index was measured in rat offspring (weight, clinical observations). We found no dosing-related clinical signs. In conclusion, [ 123 I]ADAM was not toxic in an animal pregnancy model.

Effects of disrupting the polyketide synthase gene WdPKS1 in Wangiella [Exophiala] dermatitidis on melanin production and resistance to killing by antifungal compounds, enzymatic degradation, and extremes in temperature

Directory of Open Access Journals (Sweden)

Mandal Piyali

2006-06-01

Full Text Available Abstract Background Wangiella dermatitidis is a human pathogenic fungus that is an etiologic agent of phaeohyphomycosis. W. dermatitidis produces a black pigment that has been identified as a dihydroxynaphthalene melanin and the production of this pigment is associated with its virulence. Cell wall pigmentation in W. dermatitidis depends on the WdPKS1 gene, which encodes a polyketide synthase required for generating the key precursor for dihydroxynaphthalene melanin biosynthesis. Results We analyzed the effects of disrupting WdPKS1 on dihydroxynaphthalene melanin production and resistance to antifungal compounds. Transmission electron microscopy revealed that wdpks1Δ-1 yeast had thinner cell walls that lacked an electron-opaque layer compared to wild-type cells. However, digestion of the wdpks1Δ-1 yeast revealed small black particles that were consistent with a melanin-like compound, because they were acid-resistant, reacted with melanin-binding antibody, and demonstrated a free radical signature by electron spin resonance analysis. Despite lacking the WdPKS1 gene, the mutant yeast were capable of catalyzing the formation of melanin from L-3,4-dihyroxyphenylalanine. The wdpks1Δ-1 cells were significantly more susceptible to killing by voriconazole, amphotericin B, NP-1 [a microbicidal peptide], heat and cold, and lysing enzymes than the heavily melanized parental or complemented strains. Conclusion In summary, W. dermatitidis makes WdPKS-dependent and -independent melanins, and the WdPKS1-dependent deposition of melanin in the cell wall confers protection against antifungal agents and environmental stresses. The biological role of the WdPKS-independent melanin remains unclear.

X-ray variability of the BL Lacertae object PKS 2155 - 304 in the 0.1-6 keV range

International Nuclear Information System (INIS)

Morini, M.; Chiappetti, L.; Maccagni, D.; Maraschi, L.; Molteni, D.; CNR, Istituto di Fisica Cosmica, Milan, Italy; CNR, Istituto di Fisica Cosmica; Milano Universita, Italy; Palermo Universita, Italy)

1986-01-01

Observations of the bright BL Lac object PKS 2155 - 304 obtained at 1-6 keV using the ME argon counters and channel-multiplier array at the focus of the Exosat LE telescope, in conjunction with the 0.05-2-keV-bandpass 3000-A Lexan filter, during a total of 30 h in October-November 1983 and November 1984 are reported. The data are presented in tables and graphs and characterized. Findings discussed include an overall variation of a factor of 10, one factor-of-four increase over 4 h, and maximum luminosity variation dL/dt = 2 x 10 to the 42nd erg/s sq for H = 100 km/s Mpc (corresponding to a lower limit of mass of 10 to the 8th solar mass and a gravitational radius of 3 x 10 to the 13th cm). The implications of these results for theoretical models of the X-ray emission source are considered. 17 references

First discovery of two polyketide synthase genes for mitorubrinic acid and mitorubrinol yellow pigment biosynthesis and implications in virulence of Penicillium marneffei.

Directory of Open Access Journals (Sweden)

Patrick C Y Woo

Full Text Available BACKGROUND: The genome of P. marneffei, the most important thermal dimorphic fungus causing respiratory, skin and systemic mycosis in China and Southeast Asia, possesses 23 polyketide synthase (PKS genes and 2 polyketide synthase nonribosomal peptide synthase hybrid (PKS-NRPS genes, which is of high diversity compared to other thermal dimorphic pathogenic fungi. We hypothesized that the yellow pigment in the mold form of P. marneffei could also be synthesized by one or more PKS genes. METHODOLOGY/PRINCIPAL FINDINGS: All 23 PKS and 2 PKS-NRPS genes of P. marneffei were systematically knocked down. A loss of the yellow pigment was observed in the mold form of the pks11 knockdown, pks12 knockdown and pks11pks12 double knockdown mutants. Sequence analysis showed that PKS11 and PKS12 are fungal non-reducing PKSs. Ultra high performance liquid chromatography-photodiode array detector/electrospray ionization-quadruple time of flight-mass spectrometry (MS and MS/MS analysis of the culture filtrates of wild type P. marneffei and the pks11 knockdown, pks12 knockdown and pks11pks12 double knockdown mutants showed that the yellow pigment is composed of mitorubrinic acid and mitorubrinol. The survival of mice challenged with the pks11 knockdown, pks12 knockdown and pks11pks12 double knockdown mutants was significantly better than those challenged with wild type P. marneffei (P<0.05. There was also statistically significant decrease in survival of pks11 knockdown, pks12 knockdown and pks11pks12 double knockdown mutants compared to wild type P. marneffei in both J774 and THP1 macrophages (P<0.05. CONCLUSIONS/SIGNIFICANCE: The yellow pigment of the mold form of P. marneffei is composed of mitorubrinol and mitorubrinic acid. This represents the first discovery of PKS genes responsible for mitorubrinol and mitorubrinic acid biosynthesis. pks12 and pks11 are probably responsible for sequential use in the biosynthesis of mitorubrinol and mitorubrinic acid

Multicurie, transportable, integrally shielded 123Xe → 123I generator and processing system for high-purity iodine-123 production

International Nuclear Information System (INIS)

Lagunas-Solar, M.C.; Thibeau, H.L.; Goodart, C.E.; Little, F.E.; Navarro, N.J.; Hartnett, D.E.

1985-01-01

An integrally shielded 123 Xe → 123 I generator system has been designed and tested under production conditions for its suitability as a multicurie handling device from which to produce radiopharmaceutical-quality high-purity no-carrier-added (NCA) 123 I. The 123 Xe → 123 I generator system is expected to provide an alternative to current techniques and to increase the availability and reliability of high-purity 123 I made via the 127 I(p,5n) 123 Xe → 123 I nuclear reaction. The generator system is based on the Crocker Nuclear Laboratory's continuous-flow production system which has been operating since 1974 for the multicurie production of 123 I. The generator system, which consists of an integrally shielded xenon trap and separate loading and processing apparatuses, is simple and reliable to operate, can be adapted to computerized control, and provides a safe working environment for the repeated handling of multicurie amounts of Xe-I radioactivities

Results of the first simultaneous X-ray, optical, and radio campaign on the blazar PKS 1622-297

NARCIS (Netherlands)

Meyer, Angela Osterman; Miller, H. Richard; Marshall, Kevin; Ryle, Wesley T.; Aller, Hugh; Aller, Margo; McFarland, John P.; Pollock, Joseph T.; Reichart, Daniel E.; Crain, J. Adam; Ivarsen, Kevin M.; LaCluyze, Aaron P.; Nysewander, Melissa C.

Coordinated X-ray, optical, and radio observations of the blazar PKS 1622-297 were obtained during a three-week campaign in 2006 using the Rossi X-Ray Timing Explorer (RXTE), the University of Michigan Radio Astronomy Observatory, and optical telescopes at Cerro Tololo Inter-American Observatory.

Multifrequency observations of the BL Lacertae object PKS 0537 - 441

Science.gov (United States)

Maraschi, L.; Treves, A.; Schwartz, D. A.; Tanzi, E. G.

1985-01-01

PKS 0537 - 441 was repeatedly observed in the UV band with the International Ultraviolet Explorer and in the X-ray with the Einstein Observatory. On September 27, 1980, simultaneous observations in the two bands were obtained. Near-infrared photometry preceding and following the simultaneous observations by about one month is available from the literature, as is radio monitoring at 408 and 5000 MHz. Comparison of the observed X-ray flux with that predicted by the standard synchrotron self-Compton formalism, with a source dimension deduced from radio variability at 5 GHz, indicates that this component of the radio emission must be moving at relativistic speed with an effective projected Doppler beaming factor of about 10.

Multifrequency observations of the BL Lacertae object PKS 0537 - 441

Energy Technology Data Exchange (ETDEWEB)

Maraschi, L.; Treves, A.; Schwartz, D.A.; Tanzi, E.G.

1985-07-01

PKS 0537 - 441 was repeatedly observed in the UV band with the International Ultraviolet Explorer and in the X-ray with the Einstein Observatory. On September 27, 1980, simultaneous observations in the two bands were obtained. Near-infrared photometry preceding and following the simultaneous observations by about one month is available from the literature, as is radio monitoring at 408 and 5000 MHz. Comparison of the observed X-ray flux with that predicted by the standard synchrotron self-Compton formalism, with a source dimension deduced from radio variability at 5 GHz, indicates that this component of the radio emission must be moving at relativistic speed with an effective projected Doppler beaming factor of about 10. 28 references.

Multifrequency observations of the BL Lacertae object PKS 0537 - 441

International Nuclear Information System (INIS)

Maraschi, L.; Treves, A.; Schwartz, D.A.; Tanzi, E.G.; CNR, Istituto di Fisica Cosmica, Milan, Italy; Harvard-Smithsonian Center for Astrophysics, Cambridge, MA)

1985-01-01

PKS 0537 - 441 was repeatedly observed in the UV band with the International Ultraviolet Explorer and in the X-ray with the Einstein Observatory. On September 27, 1980, simultaneous observations in the two bands were obtained. Near-infrared photometry preceding and following the simultaneous observations by about one month is available from the literature, as is radio monitoring at 408 and 5000 MHz. Comparison of the observed X-ray flux with that predicted by the standard synchrotron self-Compton formalism, with a source dimension deduced from radio variability at 5 GHz, indicates that this component of the radio emission must be moving at relativistic speed with an effective projected Doppler beaming factor of about 10. 28 references

UV spectrum of the BL Lac object PKS 0521-36

Energy Technology Data Exchange (ETDEWEB)

Danziger, I.J. (European Southern Observatory, Garching (Germany, F.R.)); Bergeron, J. (Centre National de la Recherche Scientifique, 75 - Paris (France). Inst. d' Astrophysique); Fosbury, R.A.E. (Royal Greenwich Observatory, Hailsham (UK)); Maraschi, L.; Treves, A. (Consiglio Nazionale delle Ricerche, Milan (Italy). Lab. di Fisica Cosmica; Milan Univ. (Italy). Ist. di Fisica); Tanzi, E.G. (Consiglio Nazionale delle Ricerche, Milan (Italy). Lab. di Fisica Cosmica)

1983-05-01

Ultraviolet observations (1200 to 3000 A) with the IUE satellite of the BL Lac object PKS 0521-36 are presented. The only emission line which appears clearly in the spectrum is Ly..cap alpha.., which is asymmetric with a component displaced approx. 3000 km s/sup -1/ to the red. The intensity of the line and the upper limits on other lines are compared with the model calculations on QSOs and Seyfert nuclei by Kwan and Krolik. The continuous energy distribution is discussed, combining non-simultaneous observations from the ultraviolet to the infrared. The spectral range of the non-thermal source from far IR to far UV can be described by a single power law of index -1.5.

Energy distribution and variability of BL Lac objects. The cases of PKS 2155-304 and 3C 66A

International Nuclear Information System (INIS)

Maraschi, L.; Maccagni, D.; Tanzi, E.G.; Treves, A.

1983-01-01

The BL Lacertae objects, PKS 2155-304 and 3C66A have been observed in the ultraviolet and the X-ray region. The radiation flux in both regions are discussed with respect to its energy and time dependence. (Auth.)

Iodine-123 (123I) is promising radiopharmaceutical in the radionuclide diagnostics

International Nuclear Information System (INIS)

Tazhedinov, I.T.

2003-01-01

In the paper some advantages of the radiopharmaceuticals with 123 I against 99m Tc preparations are shown. It is noted that the 123 I is the most favourable among cyclotron radionuclides for radionuclide diagnostics by it nuclear-physical characteristics. With application of 123 I it is possible to attain a significant progress in the thyroid examination. 123 I labelled preparations should have a high bond strength providing the high information valuation of examinations

123I-IMP SPECT studies in schizophrenia and atypical psychosis

International Nuclear Information System (INIS)

Hayashi, Takuji; Suga, Hidemichi

1993-01-01

According to the classification of Mitsuda, 23 patients with endogenous psychosis aged 40 years or younger, presenting with hallucination and delusion, were classified as having schizophrenia (n=12) or atypical psychosis (n=11). These patients were studied by single photon emission computed tomography (SPECT) with N-isopropyl-p-I-123-iodoamphetamine (I-123 IMP). Sixteen healthy persons served as controls. Early and delayed SPECT images were obtained 30 min and 4 hr, respectively, after intravenous injection of I-123 IMP. The group of schizophrenic patients had markedly decreased uptake of I-123 in the basal ganglia, as well as the right temporal and left occipital areas on both early and delayed images. In the group of atypical psychosis patients, however, decreased uptake of I-123 was noted in both the right basal ganglia and left occipital area on early images, but none of such findings were seen on delayed images. Regarding the uptake ratio in the frontal area on both early and delayed images, there were significant differences between the two groups. These findings have important implications for the different etiology of both disease types: not only functional disturbance in the frontal area but also irreversible changes may be involved in the occurrence of schizophrenia, and functional disturbance particularly in the right basal ganglia may be involved in the occurrence of atypical psychosis. (N.K.)

PKS 2005-489 at VHE: four years of monitoring with HESS and simultaneous multi-wavelength observations

Science.gov (United States)

H.E.S.S. Collaboration; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Barres de Almeida, U.; Bazer-Bachi, A. R.; Becherini, Y.; Behera, B.; Benbow, W.; Bernlöhr, K.; Bochow, A.; Boisson, C.; Bolmont, J.; Borrel, V.; Brucker, J.; Brun, F.; Brun, P.; Bühler, R.; Bulik, T.; Büsching, I.; Boutelier, T.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Chounet, L.-M.; Clapson, A. C.; Coignet, G.; Costamante, L.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; O'C. Drury, L.; Dubois, F.; Dubus, G.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fiasson, A.; Förster, A.; Fontaine, G.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Göring, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Hofverberg, P.; Holleran, M.; Hoppe, S.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jung, I.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Kerschhaggl, M.; Khangulyan, D.; Khélifi, B.; Keogh, D.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Lamanna, G.; Lenain, J.-P.; Lohse, T.; Marandon, V.; Martineau-Huynh, O.; Marcowith, A.; Masbou, J.; Maurin, D.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; Olive, J.-F.; de Oña Wilhelmi, E.; Orford, K. J.; Ostrowski, M.; Panter, M.; Paz Arribas, M.; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raubenheimer, B. C.; Raue, M.; Rayner, S. M.; Renaud, M.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Sahakian, V.; Santangelo, A.; Schlickeiser, R.; Schöck, F. M.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Shalchi, A.; Sikora, M.; Skilton, J. L.; Sol, H.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Superina, G.; Szostek, A.; Tam, P. H.; Tavernet, J.-P.; Terrier, R.; Tibolla, O.; Tluczykont, M.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Venter, L.; Vialle, J. P.; Vincent, P.; Vivier, M.; Völk, H. J.; Volpe, F.; Wagner, S. J.; Ward, M.; Zdziarski, A. A.; Zech, A.

2010-02-01

Aims: Our aim is to study the very high energy (VHE; E>100 GeV) γ-ray emission from BL Lac objects and the evolution in time of their broad-band spectral energy distribution (SED). Methods: VHE observations of the high-frequency peaked BL Lac object PKS 2005-489 were made with the High Energy Stereoscopic System (HESS) from 2004 through 2007. Three simultaneous multi-wavelength campaigns at lower energies were performed during the HESS data taking, consisting of several individual pointings with the XMM-Newton and RXTE satellites. Results: A strong VHE signal, ~17σ total, from PKS 2005-489 was detected during the four years of HESS observations (90.3 h live time). The integral flux above the average analysis threshold of 400 GeV is ~3% of the flux observed from the Crab Nebula and varies weakly on time scales from days to years. The average VHE spectrum measured from ~300 GeV to ~5 TeV is characterized by a power law with a photon index, Γ = 3.20± 0.16_stat± 0.10_syst. At X-ray energies the flux is observed to vary by more than an order of magnitude between 2004 and 2005. Strong changes in the X-ray spectrum (ΔΓX ≈ 0.7) are also observed, which appear to be mirrored in the VHE band. Conclusions: The SED of PKS 2005-489, constructed for the first time with contemporaneous data on both humps, shows significant evolution. The large flux variations in the X-ray band, coupled with weak or no variations in the VHE band and a similar spectral behavior, suggest the emergence of a new, separate, harder emission component in September 2005. Supported by CAPES Foundation, Ministry of Education of Brazil.Now at Harvard-Smithsonian Center for Astrophysics, Cambridge, USA.Now at W.W. Hansen Experimental Physics Laboratory & Kavli Institute for Particle Astrophysics and Cosmology, Stanford University, Stanford, USA.

The UV spectrum of the BL Lac object PKS 0521-36

International Nuclear Information System (INIS)

Danziger, I.J.; Bergeron, J.; Maraschi, L.; Treves, A.; Milan Univ.; Tanzi, E.G.

1983-01-01

Ultraviolet observations (1200 to 3000 A) with the IUE satellite of the BL Lac object PKS 0521-36 are presented. The only emission line which appears clearly in the spectrum is Lyα, which is asymmetric with a component displaced approx. 3000 km s - 1 to the red. The intensity of the line and the upper limits on other lines are compared with the model calculations on QSOs and Seyfert nuclei by Kwan and Krolik. The continuous energy distribution is discussed, combining non-simultaneous observations from the ultraviolet to the infrared. The spectral range of the non-thermal source from far IR to far UV can be described by a single power law of index -1.5. (author)

Production of 123I

International Nuclear Information System (INIS)

Britto, J.L.Q. de; Silva, A.G. da; Teixeira, F.C.M.; Costa e Silva, A.; Souza, A.S.F. de

1981-01-01

The 12 I is prepared by 122 Te( 3 He, 2n) 123 Xe sup(β+) → 123 I reaction. The remotization of the Xe diffusion and capture system and the retired of the 123 I produced by the 123 Xe precursory decaying. (E.G.) [pt

OPTICAL AND INFRARED PHOTOMETRY OF THE BLAZAR PKS 0537-441: LONG AND SHORT TIMESCALE VARIABILITY

International Nuclear Information System (INIS)

Impiombato, D.; Treves, A.; Covino, S.; Foschini, L.; Fugazza, D.; Pian, E.; Tosti, G.; Ciprini, S.; Nicastro, L.

2011-01-01

We present a large collection of photometric data on the blazar PKS 0537-441 in the VRIJHK bands taken in 2004-2009. At least three flare-like episodes with months duration and >3 mag amplitude are apparent. The spectral energy distribution is consistent with a power law, and no indication of a thermal component is found. We searched for short timescale variability, and an interesting event was identified in the J band, with a duration of ∼25 minutes.

Investigating the emission mechanisms of the jet in the quasar PKS 1127-145

Science.gov (United States)

Duffy, Ryan T.; Siemiginowska, A.; Kashyap, V.; Stein, N.; Migliori, G.

2014-01-01

There is currently uncertainty surrounding the emission mechanism for X-ray photons in quasar jets, with both Inverse Compton Scattering from the Cosmic Microwave Background (IC/CMB) and synchrotron models considered possibilities. We use a 100 ks observation (Siemiginowska et al 2007) of the redshift z=1.18, radio-loud quasar PKS 1127-145 taken by the Chandra X-ray Observatory, with the hope of accurately measuring the offsets between radio and X-ray radiation peaks in order to establish the emission process for this jet. PKS 1127-145 is a bright quasar with a long jet which has several bright knots and complex morphology, making it a perfect source for this investigation. We use a Bayesian statistical method called Low-Count Image Restoration and Analysis (LIRA, Connors & van Dyk 2007, Esch et al 2004) to investigate the quasar jet. This fits the parameters of a multiscale model to the data by employing a Markov Chain Monte Carlo process. LIRA has shown the location of some jet X-ray components, although further simulations must be undertaken to determine whether these are statistically significant. We also study these jet X-ray components in both hard and soft X-ray bands in order to gain more information on the energy of the emitted photons. References: Connors, A., & van Dyk, D. A. 2007, Statistical Challenges in Modern Astronomy IV, 371, 101 Esch, D.N., Connors, A., Karovska, M., & van Dyk, D.A. 2004, ApJ, 610, 1213 Siemiginowska, A., Stawarz, L., Cheung, C.C., et al. 2007, ApJ, 657, 145

Cyclotron production of high-purity 123I for medical applications via the 127I(p,5n)123Xe → 123I nuclear reaction

International Nuclear Information System (INIS)

Lagunas-Solar, M.C.

1985-01-01

The use of iodine-123 in nuclear medicine procedures is well documented in the scientific literature. Also, several methods for its production based on accelerator techniques have been described. Indirectly made 123 I via the 127 I(p,5n) 123 Xe → 123 I reaction produces 123 I of > 99.9% radionuclidic purity, with only 125 I ( 123 I production were developed at the University of California at Davis, where since 1974 the 76-in. isochronous cyclotron of the Crocker Nuclear Laboratory has been used for routine biweekly production of high-purity no-carrier-added 123 I

Multifrequency VLA observations of PKS 0745-191: the archetypal 'cooling flow' radio source?

International Nuclear Information System (INIS)

Baum, S.A.; O'Dea, C.P.

1991-01-01

We present 90-, 20-, 6- and 2-cm VLA observations of the high radio luminosity, cooling flow radio source PKS 0745-191. We find that the radio source has a core with a very steep spectrum and diffuse emission with an even steeper spectrum without clear indications of the jets, hotspots or double lobes found in other radio sources of comparable luminosity. The appearance of the source is highly dependent on frequency and resolution. This dependence reflects both the diffuse nature of the extended emission and the steep, but position-dependent, spectrum of the radio emission. (author)

[sup 123]I-IMP SPECT studies in schizophrenia and atypical psychosis

Energy Technology Data Exchange (ETDEWEB)

Hayashi, Takuji; Suga, Hidemichi (Aichi Medical University, Nagakute (Japan))

1993-05-01

According to the classification of Mitsuda, 23 patients with endogenous psychosis aged 40 years or younger, presenting with hallucination and delusion, were classified as having schizophrenia (n=12) or atypical psychosis (n=11). These patients were studied by single photon emission computed tomography (SPECT) with N-isopropyl-p-I-123-iodoamphetamine (I-123 IMP). Sixteen healthy persons served as controls. Early and delayed SPECT images were obtained 30 min and 4 hr, respectively, after intravenous injection of I-123 IMP. The group of schizophrenic patients had markedly decreased uptake of I-123 in the basal ganglia, as well as the right temporal and left occipital areas on both early and delayed images. In the group of atypical psychosis patients, however, decreased uptake of I-123 was noted in both the right basal ganglia and left occipital area on early images, but none of such findings were seen on delayed images. Regarding the uptake ratio in the frontal area on both early and delayed images, there were significant differences between the two groups. These findings have important implications for the different etiology of both disease types: not only functional disturbance in the frontal area but also irreversible changes may be involved in the occurrence of schizophrenia, and functional disturbance particularly in the right basal ganglia may be involved in the occurrence of atypical psychosis. (N.K.).

Variability of the BL Lacertae objects PKS 2155 - 304 and OJ 287 in the far-ultraviolet

International Nuclear Information System (INIS)

Maraschi, L.; Treves, A.; Tagliaferri, G.; Tanzi, E.G.; CNR, Istituto di Fisica Cosmica, Milan, Italy)

1986-01-01

All the ultraviolet spectra of the two bright BL Lacertae objects PKS 2155 - 304 and OJ 287 taken with the International Ultraviolet Explorer in the period 1978-1984 are examined. For each spectrum the best-fitting power law is determined and a correlation between spectral slope and intensity is searched for. The correlation, if present, is weak. This is discussed in terms of models of the continuum emission of active galactic nuclei. 31 references

Variability of the BL Lacertae objects PKS 2155 - 304 and OJ 287 in the far-ultraviolet

Energy Technology Data Exchange (ETDEWEB)

Maraschi, L.; Treves, A.; Tagliaferri, G.; Tanzi, E.G.

1986-05-01

All the ultraviolet spectra of the two bright BL Lacertae objects PKS 2155 - 304 and OJ 287 taken with the International Ultraviolet Explorer in the period 1978-1984 are examined. For each spectrum the best-fitting power law is determined and a correlation between spectral slope and intensity is searched for. The correlation, if present, is weak. This is discussed in terms of models of the continuum emission of active galactic nuclei. 31 references.

H.E.S.S. discovery of very high energy γ-ray emission from PKS 0625-354

Science.gov (United States)

H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Andersson, T.; Angüner, E. O.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chalme-Calvet, R.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Chrétien, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Cui, Y.; Davids, I. D.; Decock, J.; Degrange, B.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O'C.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Hadasch, D.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holler, M.; Horns, D.; Ivascenko, A.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kerszberg, D.; Khélifi, B.; Kieffer, M.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu; Kosack, K.; Krakau, S.; Kraus, M.; Krayzel, F.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morâ, K.; Moulin, E.; Murach, T.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Öttl, S.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Romoli, C.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zabalza, V.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.

2018-05-01

PKS 0625-354 (z = 0.055) was observed with the four High Energy Stereoscopic System (H.E.S.S.) telescopes in 2012 during 5.5 h. The source was detected above an energy threshold of 200 GeV at a significance level of 6.1σ. No significant variability is found in these observations. The source is well described with a power-law spectrum with photon index Γ = 2.84 ± 0.50stat ± 0.10syst and normalization (at E0 = 1.0 TeV) N0(E0) = (0.58 ± 0.22stat ± 0.12syst) × 10-12 TeV-1 cm-2 s-1. Multiwavelength data collected with Fermi-LAT, Swift-XRT, Swift-UVOT, ATOM and WISE are also analysed. Significant variability is observed only in the Fermi-LAT γ-ray and Swift-XRT X-ray energy bands. Having a good multiwavelength coverage from radio to very high energy, we performed a broad-band modelling from two types of emission scenarios. The results from a one zone lepto-hadronic and a multizone leptonic models are compared and discussed. On the grounds of energetics, our analysis favours a leptonic multizone model. Models associated to the X-ray variability constraint support previous results, suggesting a BL Lac nature of PKS 0625-354 with, however, a large-scale jet structure typical of a radio galaxy.

The Gamma-Ray Emitting Radio-Loud Narrow-Line Seyfert 1 Galaxy PKS 2004-447 II. The Radio View

Science.gov (United States)

Schulz, R.; Kreikenbohm, A.; Kadler, M.; Ojha, R.; Ros, E.; Stevens, J.; Edwards, P. G.; Carpenter, B.; Elsaesser, D.; Gehrels, N.;

DETECTION OF CA II ABSORPTION BY A HIGH-VELOCITY CLOUD IN THE DIRECTION OF THE QUASAR PKS 0837-120

NARCIS (Netherlands)

ROBERTSON, JG; SCHWARZ, UJ; VANWOERDEN, H; MURRAY, JD; MORTON, DC; HULSBOSCH, ANM

1991-01-01

We present optical absorption spectroscopy of the Ca II K and H lines along the sight line to the quasar PKS 0837-120, which lies in the direction of a high-velocity cloud (HVC) detected in H I 21-cm emission at V(LSR) = + 105 km s-1. Our data show Ca II absorption due to the HVC as well as a lower

INTEGRAL observations of the GeV blazar PKS 1502+106 and the hard X-ray bright Seyfert galaxy Mkn 841

Czech Academy of Sciences Publication Activity Database

Pian, E.; Ubertini, P.; Bazzano, A.; Beckmann, V.; Eckert, D.; Ghisellini, G.; Pursimo, T.; Tagliaferri, G.; Tavecchio, F.; Türler, M.; Bianchi, S.; Bianchin, V.; Hudec, René; Maraschi, L.; Raiteri, C.M.; Soldi, S.; Treves, A.; Villata, M.

2011-01-01

Roč. 526, February (2011), A125/1-A125/7 ISSN 0004-6361 Grant - others:ESA(XE) ESA PECS project No.98023; GA ČR(CZ) ga102/09/0997 Institutional research plan: CEZ:AV0Z10030501 Keywords : active galaxies * blazar PKS 1502+106 Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.587, year: 2011

Engineering Environmentally-Stable Proteases to Specifically Neutralize Protein Toxins

Science.gov (United States)

2012-10-14

B4 B5 B6 B9 F hours 37˚C ~ 350nM pN1009-pH0405 (3f09) 300mM KPi , 200mM N3 10, 8, 6, 4, 2, 0 pM pT2032 0 5000 1 104 1.5 104 2 104 2.5 104 55 60 65...70 75 80 3D25S1_2_3 B7 B8 B9 F hours 37˚C ~ 350nM pN1009-pH0405 (3f09) 300mM KPi , 200mM N3 1, 0.1, 0 pM pT2032 Figure 4 Key finding: We can

Clinical uses of I-123 produced by 127I(p, 5n)123Xe to 123I reaction in NIRS

International Nuclear Information System (INIS)

Saegusa, Kenji; Arimizu, Noboru; Uchiyama, Guio; Tateno, Yukio; Rikitake, Tomoyuki.

1978-01-01

123 I capsules produced by NIRS which are believed to be uncontaminated by radioactive impurities other than 125 I were compared with commercial 123 I capsules regarding gamma-ray spectra, thyroid phantoms and clinical scintigrams. Absorbed radiation doses of 123 I contaminated with nuclides other than 123 I to thyroid and whole body were also estimated. Regarding gamma-ray spectra, any nuclides other than 125 I(0.53%) did not contaminate in 123 I produced by NIRS, and it was superior to commercial capsules. Regarding phantoms and clinical scintigrams, background counts around the thyroid gland seemed to be slightly higher in commercial capsules than that produced by NIRS because of contamination with other nuclides. Exposed doses in thyroid and whole body were counted. Ratios in thyroid and whole body were increased by 30% and 9%, respectively in 123 I produced by NIRS because of contamination with 0.53% of 125 I in the event that the intake ratio of thyroid was determined as 25%. In commercial capsules the doses in thyroid and whole body were increased by 500% and 150%, respectively. Doses of commercial capsules and NIRS capsules were 7.87 rad and 1.72 rad, respectively per 100 μCi in thyroid. The ratio of NIRS capsules to commercial capsules in thyroid was 1/4.6, and that in the whole body was less than 1/2. (Ichikawa, K.)

A MULTIWAVELENGTH STUDY OF THE HIGH SURFACE BRIGHTNESS HOT SPOT IN PKS 1421-490

International Nuclear Information System (INIS)

Godfrey, L. E. H.; Bicknell, G. V.; Lovell, J. E. J.; Jauncey, D. L.; Gelbord, J.; Schwartz, D. A.; Birkinshaw, M.; Worrall, D. M.; Marshall, H. L.; Georganopoulos, M.; Perlman, E. S.; Murphy, D. W.

2009-01-01

Long Baseline Array imaging of the z = 0.663 broadline radio galaxy PKS 1421-490 reveals a 400 pc diameter high surface brightness hot spot at a projected distance of ∼40 kpc from the active galactic nucleus. The isotropic X-ray luminosity of the hot spot, L 2-10keV = 3 x 10 44 ergs s -1 , is comparable to the isotropic X-ray luminosity of the entire X-ray jet of PKS 0637-752, and the peak radio surface brightness is hundreds of times greater than that of the brightest hot spot in Cygnus A. We model the radio to X-ray spectral energy distribution using a one-zone synchrotron self-Compton model with a near equipartition magnetic field strength of 3 mG. There is a strong brightness asymmetry between the approaching and receding hotspots and the hot spot spectrum remains flat (α ∼ 0.5) well beyond the predicted cooling break for a 3 mG magnetic field, indicating that the hotspot emission may be Doppler beamed. A high plasma velocity beyond the terminal jet shock could be the result of a dynamically important magnetic field in the jet. There is a change in the slope of the hotspot radio spectrum at GHz frequencies, which we model by incorporating a cutoff in the electron energy distribution at γ min ∼ 650, with higher values implied if the hotspot emission is Doppler beamed. We show that a sharp decrease in the electron number density below a Lorentz factor of 650 would arise from the dissipation of bulk kinetic energy in an electron/proton jet with a Lorentz factor Γ jet ∼> 5.

Discovery of Very High Energy Gamma Rays from PKS 1424+240 and Multiwavelength Constraints on its Redshift

Energy Technology Data Exchange (ETDEWEB)

Acciari, V.A.; /Harvard-Smithsonian Ctr. Astrophys.; Aliu, E.; /Delaware U., Bartol Inst.; Arlen, T.; /UCLA; Aune, T.; /UC, Santa Cruz; Bautista, M.; /McGill U.; Beilicke, M. /Washington U., St. Louis; Benbow, W.; /Harvard-Smithsonian Ctr. Astrophys.; Bottcher, M.; /Ohio U.; Boltuch, D.; /Delaware U., Bartol Inst.; Bradbury, S.M.; /Leeds U.; Buckley, J.H.; /Washington U., St. Louis; Bugaev, V.; /Washington U., St. Louis; Byrum, K.; /Argonne; Cannon, A.; /University Coll., Dublin; Cesarini, A.; /Natl. U. of Ireland, Galway; Chow, Y.C.; /UCLA; Ciupik, L.; /Roosevelt U., Chicago; Cogan, P.; /McGill U.; Cui, W.; /Purdue U.; Duke, C.; /Grinnell Coll.; Falcone, A.; /Penn State U. /Purdue U. /Utah U. /Roosevelt U., Chicago /Harvard-Smithsonian Ctr. Astrophys. /Purdue U. /Natl. U. of Ireland, Galway /Utah U. /University Coll., Dublin /McGill U. /Roosevelt U., Chicago /McGill U. /Delaware U., Bartol Inst. /Utah U. /Chicago U., EFI /Iowa State U. /Roosevelt U., Chicago /DePauw U. /Utah U. /Pittsburg State U. /Washington U., St. Louis /Iowa State U. /Natl. U. of Ireland, Galway /Utah U. /McGill U. /Washington U., St. Louis /McGill U. /McGill U. /Purdue U. /Anderson U. /Galway-Mayo Inst. of Tech. /Iowa State U. /UCLA; /more authors..

2012-04-05

We report the first detection of very-high-energy (VHE) gamma-ray emission above 140GeV from PKS 1424+240, a BL Lac object with an unknown redshift. The photon spectrum above 140GeV measured by VERITAS is well described by a power law with a photon index of 3.8 {+-}0.5{sub stat} {+-} 0.3{sub syst} and a flux normalization at 200 GeV of (5.1 {+-} 0.9{sub stat} {+-} 0.5{sub syst}) x 10{sup -11} TeV{sup -1} cm{sup -2} s{sup -1}, where stat and syst denote the statistical and systematical uncertainty, respectively. The VHE flux is steady over the observation period between MJD 54881 and 55003 (2009 February 19 to June 21). Flux variability is also not observed in contemporaneous high energy observations with the Fermi Large Area Telescope (LAT). Contemporaneous X-ray and optical data were also obtained from the Swift XRT and MDM observatory, respectively. The broadband spectral energy distribution (SED) is well described by a one-zone synchrotron self-Compton (SSC) model favoring a redshift of less than 0.1. Using the photon index measured with Fermi in combination with recent extragalactic background light (EBL) absorption models it can be concluded from the VERITAS data that the redshift of PKS 1424+240 is less than 0.66.

DISCOVERY OF VERY HIGH ENERGY GAMMA RAYS FROM PKS 1424+240 AND MULTIWAVELENGTH CONSTRAINTS ON ITS REDSHIFT

International Nuclear Information System (INIS)

Acciari, V. A.; Benbow, W.; Aliu, E.; Boltuch, D.; Arlen, T.; Chow, Y. C.; Aune, T.; Bautista, M.; Cogan, P.; Beilicke, M.; Buckley, J. H.; Bugaev, V.; Boettcher, M.; Bradbury, S. M.; Byrum, K.; Cannon, A.; Cesarini, A.; Ciupik, L.; Cui, W.; Duke, C.

2010-01-01

We report the first detection of very high energy 83 Gamma-ray emission above 100 GeV. (VHE) gamma-ray emission above 140 GeV from PKS 1424+240, a BL Lac object with an unknown redshift. The photon spectrum above 140 GeV measured by VERITAS is well described by a power law with a photon index of 3.8 ± 0.5 stat ± 0.3 syst and a flux normalization at 200 GeV of (5.1 ± 0.9 stat ± 0.5 syst ) x 10 -11 TeV -1 cm -2 s -1 , where stat and syst denote the statistical and systematical uncertainties, respectively. The VHE flux is steady over the observation period between MJD 54881 and 55003 (from 2009 February 19 to June 21). Flux variability is also not observed in contemporaneous high-energy observations with the Fermi Large Area Telescope. Contemporaneous X-ray and optical data were also obtained from the Swift XRT and MDM observatory, respectively. The broadband spectral energy distribution is well described by a one-zone synchrotron self-Compton model favoring a redshift of less than 0.1. Using the photon index measured with Fermi in combination with recent extragalactic background light absorption models it can be concluded from the VERITAS data that the redshift of PKS 1424+240 is less than 0.66.

7 CFR 1280.123 - State.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false State. 1280.123 Section 1280.123 Agriculture... INFORMATION ORDER Lamb Promotion, Research, and Information Order Definitions § 1280.123 State. State means each of the 50 States and the District of Columbia. ...

Quasi-simultaneous ultraviolet, optical, and infrared observations of the BL Lacertae object PKS 0048-09

International Nuclear Information System (INIS)

Falomo, R.; Bouchet, P.; Maraschi, L.; Treves, A.; Tanzi, E.G.

1988-01-01

This paper reports on quasi-simultaneous UV, optical, and IR observations of the BL Lac object PKS 0048-09, carried out on January 7-9, 1987, when the object was in a moderately high optical state. The data were used to derive a detailed energy distribution from about 10 to the 14th to about 2.5 x 10 to the 15th Hz. A comparison of observations obtained on January 7-9, 1987, with observations on September 12, 1986, pertaining to a lower state of the source, indicates spectral hardening with increasing intensity on time scales of months. 26 references

Quasi-simultaneous ultraviolet, optical, and infrared observations of the BL Lacertae object PKS 0048-09

Energy Technology Data Exchange (ETDEWEB)

Falomo, R.; Bouchet, P.; Maraschi, L.; Treves, A.; Tanzi, E.G.

1988-12-01

This paper reports on quasi-simultaneous UV, optical, and IR observations of the BL Lac object PKS 0048-09, carried out on January 7-9, 1987, when the object was in a moderately high optical state. The data were used to derive a detailed energy distribution from about 10 to the 14th to about 2.5 x 10 to the 15th Hz. A comparison of observations obtained on January 7-9, 1987, with observations on September 12, 1986, pertaining to a lower state of the source, indicates spectral hardening with increasing intensity on time scales of months. 26 references.

7 CFR 1260.123 - Research.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false Research. 1260.123 Section 1260.123 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE BEEF PROMOTION AND RESEARCH Beef Promotion and Research Order Definitions § 1260.123 Research. Research means studies relative to the...

Iodine-123 iodobenzofuran (I-123 IBF) SPECT in patients with parkinsonism

Energy Technology Data Exchange (ETDEWEB)

Nakabeppu, Yoshiaki; Nakajo, Masayuki; Mitsuda, Mitsuru; Tsuchimochi, Shinsaku; Tani, Atsushi; Osame, Mitsuhiro [Kagoshima Univ. (Japan). Faculty of Medicine

1999-12-01

Iodine-123 benzofuran (I-123 IBF) is a dopaminergic antagonist which is suitable for SPECT imaging of D2 receptors. The purpose of this study is to evaluate the potential usefulness of semi-quantitative parameters obtained from brain SPECT data of I-123 IBF for differential diagnosis in patients with parkinsonism (PN). Subjects were 10 patients with PN: 2 patients with striato-nigral degeneration (SND), 5 patients with Parkinson's disease (PD), 2 patients with progressive supranuclear palsy (PSP) and one patient with olivo-ponto-cerebellar atrophy (OPCA). The data were acquired with a triple-head gamma camera at 2 hours after intravenous injection of 167 MBq of I-123 IBF. Transverse images were reconstructed by means of filtered backprojection, and attenuation correction was performed by Chang's method ({mu}=0.08). The basal ganglia-to-frontal cortex ratio (GFR) and the basal ganglia-to-occipital cortex ratio (GOR) on slices of 5 different thicknesses were calculated. The GFR and GOR were lower in the SND group than in the other disease groups in all slices with different thicknesses (7.2 mm, 14.4 mm, 21.6 mm, 28.8 mm and 43.2 mm). The semiquantitative parameters (GFR and GOR) obtained from brain SPECT data at 2 hours after intravenous injection of I-123 IBF may be useful for differential diagnosis in patients with PN. (author)

Iodine-123 iodobenzofuran (I-123 IBF) SPECT in patients with parkinsonism

International Nuclear Information System (INIS)

Nakabeppu, Yoshiaki; Nakajo, Masayuki; Mitsuda, Mitsuru; Tsuchimochi, Shinsaku; Tani, Atsushi; Osame, Mitsuhiro

1999-01-01

Iodine-123 benzofuran (I-123 IBF) is a dopaminergic antagonist which is suitable for SPECT imaging of D2 receptors. The purpose of this study is to evaluate the potential usefulness of semi-quantitative parameters obtained from brain SPECT data of I-123 IBF for differential diagnosis in patients with parkinsonism (PN). Subjects were 10 patients with PN: 2 patients with striato-nigral degeneration (SND), 5 patients with Parkinson's disease (PD), 2 patients with progressive supranuclear palsy (PSP) and one patient with olivo-ponto-cerebellar atrophy (OPCA). The data were acquired with a triple-head gamma camera at 2 hours after intravenous injection of 167 MBq of I-123 IBF. Transverse images were reconstructed by means of filtered backprojection, and attenuation correction was performed by Chang's method (μ=0.08). The basal ganglia-to-frontal cortex ratio (GFR) and the basal ganglia-to-occipital cortex ratio (GOR) on slices of 5 different thicknesses were calculated. The GFR and GOR were lower in the SND group than in the other disease groups in all slices with different thicknesses (7.2 mm, 14.4 mm, 21.6 mm, 28.8 mm and 43.2 mm). The semiquantitative parameters (GFR and GOR) obtained from brain SPECT data at 2 hours after intravenous injection of I-123 IBF may be useful for differential diagnosis in patients with PN. (author)

29 CFR 570.123 - Agriculture.

Science.gov (United States)

2010-07-01

... 29 Labor 3 2010-07-01 2010-07-01 false Agriculture. 570.123 Section 570.123 Labor Regulations... Provisions of the Fair Labor Standards Act of 1938, as Amended Exemptions § 570.123 Agriculture. (a) Section... agriculture outside of school hours for the school district where such employee is living while he is so...

Suzaku View of the Swift/BAT Active Galactic Nuclei. V. Torus Structure of Two Luminous Radio-Loud Active Galactic Nuclei (3C 206 and PKS 0707-35)

Science.gov (United States)

Tazaki, Fumie; Ueda, Yoshihiro; Terashima, Yuichi; Mushotzky, Richard F.; Tombesi, Francesco

2013-01-01

We present the results from broadband X-ray spectral analysis of 3C 206 and PKS 0707-35 with Suzaku and Swift/BAT, two of the most luminous unobscured and obscured radio-loud active galactic nuclei (AGNs) with hard X-ray luminosities of 10(sup 45.5) erg per second and 10(sup 44.9) erg per second (14-195 keV), respectively. Based on the radio core luminosity, we estimate that the X-ray spectrum of 3C 206 contains a significant (60% in the 14-195 keV band) contribution from the jet, while it is negligible in PKS 0707-35.We can successfully model the spectra with the jet component (for 3C 206), the transmitted emission, and two reflection components from the torus and the accretion disk. The reflection strengths from the torus are found to be R(sub torus)(=Omega/2pi) = 0.29 +/- 0.18 and 0.41 +/- 0.18 for 3C 206 and PKS 0707-35, respectively, which are smaller than those in typical Seyfert galaxies. Utilizing the torus model by Ikeda et al., we quantify the relation between the half-opening angle of a torus (theta(sub oa)) and the equivalent width of an iron-K line. The observed equivalent width of 3C 206, less than 71 eV, constrains the column density in the equatorial plane to N(sup eq)(sub H) lesst han 10(sup 23) per square centimeter, or the half-opening angle to theta(sub oa) greater than 80 deg. if N(sup eq)(sub H) = 10(sup 24) per square centimeter is assumed. That of PKS 0707-35, 72 +/- 36 eV, is consistent with N(sup eq)(sub H) 10(sup 23) per square centimeter. Our results suggest that the tori in luminous radio-loud AGNs are only poorly developed. The trend is similar to that seen in radio-quiet AGNs, implying that the torus structure is not different between AGNs with jets and without jets.

Metabolism of 123I-FP-CIT in humans

International Nuclear Information System (INIS)

Tanaka, Akihiro; Okano, Kyoko; Tamagami, Hiroshi

1999-01-01

The metabolism of N-(3-fluoropropyl)-2β-carbomethoxy-3β-(4-iodophenyl)nortropane ( 123 I) ( 123 I-FP-CIT) in healthy humans was studied. Plasma and urine samples, obtained after i.v. administration of 123 I-FP-CIT, were analyzed using the two-dimensional thin-layer chromatography technique. Eleven radiochemical components were detected in both plasma and urine, and four of them were the parent 123 I-FP-CIT and its metabolites, N-(3-fluoropropyl)-2β-carboxy-3β-(4-iodophenyl)nortropane ( 123 I) ( 123 I-acid), 2β-carboxy-3β-(4-iodophenyl)nortropane ( 123 I) ( 123 I-nor-acid) and 2β-carbomethoxy-3β-(4-iodophenyl)nortropane ( 123 I) ( 123 I-nor-CIT). These four identified radiochemical components occupied about 80% or more in ratio of the radiochemical components in the plasma and urine. In the metabolites of 123 I-FP-CIT, the high polar metabolites- 123 I-acid and 123 I-nor-acid-were found to be the major components, while lipophilic 123 I-nor-CIT was a minor component. Free iodide ( 123 I - ) was not found in the plasma or urine. Thus, the main metabolic reactions which 123 I-FP-CIT undergoes in humans seem to be hydrolysis of the ester bond and N-dealkylation. In vivo deiodination of 123 I-FP-CIT was found to be minimum. Current results suggest that the metabolites of 123 I-FP-CIT hardly influence evaluation of the dopamine transporter in the human brain. (author)

[A Phase 1 study of beta-methyl-p-(123I)-iodophenyl-pentadecanoic acid (123I-BMIPP)].

Science.gov (United States)

Torizuka, K; Yonekura, Y; Nishimura, T; Tamaki, N; Uehara, T; Ikekubo, K; Hino, M

1991-07-01

Phase 1 study of beta-methyl-p-(123I)-iodophenylpentadecanoic acid (123I-BMIPP), a new radiopharmaceutical developed for the evaluation of myocardial fatty acid metabolism, was performed in six normal volunteers to evaluate its biodistribution and safety. After intravenous injection of 111 MBq of 123I-BMIPP, the agent accumulated to the myocardium rapidly (5.4 +/- 0.6% at 1.5 hr after injection) and was washed-out slowly (5.1 +/- 0.4% at 3.0hr). 123I-BMIPP demonstrated no significant accumulation to any specific organs other than myocardium, liver and muscle. Myocardium was clearly visualized in the planar and SPECT images obtained 30 min and 3 hrs after injection. The absorption doses from 123I-BMIPP estimated by MIRD method were lower than those from 201Tl in all organs. Neither adverse reactions nor abnormal clinical laboratory findings were found in the safety evaluation. These results suggest 123I-BMIPP is a promising agent for evaluating myocardial fatty acid metabolism.

Penentuan Kadar Air Dan Kadar Kotoran Minyak Inti Sawit Di PTPN III PKS Kebun Rambutan – Tebing Tinggi

OpenAIRE

Nadapdap, Nova Dana Isabela

2010-01-01

PTPN III PKS Kebun Rambutan – tebing tinggi is factory which manufactures CPO starting from fresh fruit bunch to be crude oil.And the second product produced by PTPN III is Palm kernel.The proses of palm kernel oil within several steps are separation,solution,drying and storage.In other to be distributed,palm kernel must the following the quality specification free fatty acid 0,5 %,water content 7,0 %,pollutant content 6,0 %,ang these are the standart for obtaining high quality palm kernel.An...

N-isopropyl-p-[I[sup 123

Energy Technology Data Exchange (ETDEWEB)

Tada, Hiroshi; Morooka, Keiichi; Arimoto, Kiyoshi; Matsuo, Takiko; Takagi, Kazue; Yanagawa, Etsuko (Toho Univ., Tokyo (Japan). School of Medicine)

1992-09-01

We studied the clinical usefulness of I[sup 123]-IMP SPECT in 50 pediatric patients with CNS disorders, which were categorized into the convulsive disorder group (n=20), the cerebrovascular disorder group (n=10), the acute encephalopathy or CNS infection group (n=10), the metabolic or degenerative disorder group (n=6), the congenital abnormality group (n=2) and the migraine group (n=2). The findings obtained were compared with those of cranial CT. I[sup 123]-IMP SPECT revealed abnormal findings in 45 out of the 50 patients (90%), although cranial CT showed abnormal findings in only 24 patients (48%). This difference was statistically significant (p<0.01). In all groups except the migraine, we could find abnormal findings in more than 90% of the patients. Out of 28 patients without focal findings on the initial CT scanning. I[sup 123]-IMP SPECT showed focal abnormalities in 26 patients (93%). Moreover in many patients with focal neurological abnormalities, we found focal abnormalities of I[sup 123]-IMP SPECT related with neurological abnormalities of the patients. From these findings, we think I[sup 123]-IMP SPECT might be superior to CT scanning in examining a localized lesion. It was found that in many patients with focal abnormalities in CT scanning, I[sup 123]-IMP SPECT showed larger abnormalities in CT scanning. By using I[sup 123]-IMP SPECT we might be able to study the blood perfusional state surrounding the abnormal area shown by CT. In 3 patients with acute cerebrovascular disorders, I[sup 123]-IMP SPECT revealed abnormal findings 3 to 11 days earlier than cranial CT. I[sup 123]-IMP SPECT might be useful for early recognition of the pathological state. From these experiences, we concluded that I[sup 123]-IMP SPECT was useful for studying the pathophysiology of CNS disorders in children. (author).

First Nustar Observations of the Bl Lac-Type Blazar Pks 2155-304: Constraints on the Jet Content and Distribution of Radiating Particles

DEFF Research Database (Denmark)

Madejski, G. M.; Nalewajko, K.; Madsen, K. K.

2016-01-01

We report the first hard X-ray observations with NuSTAR of the BL Lac-type blazar PKS 2155-304, augmented with soft X-ray data from XMM-Newton and γ-ray data from the Fermi Large Area Telescope, obtained in 2013 April when the source was in a very low flux state. A joint NuSTAR and XMM spectrum, ...

Production and application of 123I-labeled M-iodobenzylguanidine (123I-MIBG)

International Nuclear Information System (INIS)

Washburn, L.C.; Khosla, R.C.; Williams, C.C.; Gelfand, M.J.; Maxon, H.R.

1993-01-01

For the past two years the authors have been producing 123 I-MIBG for diagnosis and evaluation of neural crest tumors in both pediatric and adult patients. The method of Mock and Weiner (Appl. Radiat. Isot. 39:939-942, 1988) was used. Out of 89 attempted runs, 87 were successful in meeting the 90% radiochemical purity required for patient administration; both failures occurred during the first six months of the project. The 87 runs provided 144 pediatric doses and 48 adult doses. The radiochemical yield, not corrected for decay, was 67.7 ± 10.3% (mean ± S.D.). The radiochemical purity of the successful runs was 99.3 ± 1.3%, with 71 of the 87 runs giving a radiochemical purity of >99%. The radionuclidic purity of the I-123, obtained as sodium [ 123 I]iodide from Nordion International, was 99.985 ± 0.008%. Bacterial endotoxins, determined by the Limulus amebocyte lysate technique, were below the detectable level of 0.31 EU/mL for all batches of 123 I-MIBG. Sterility tests using both trypticase soy broth and fluid thioglycollate medium were negative for all batches except two, which showed growth of nonpathogenic microorganisms probably introduced during inoculation of the culture medium. 123 I-MIBG has thus been reliably prepared in high yield and excellent purity, and it has proved to be a valuable agent for diagnosis and evaluation of neural crest tumors in both children and adults

Renovascular hypertension screening with iodine-123 orthoiodohippurate

International Nuclear Information System (INIS)

Oppenheim, B.E.; Appledorn, C.R.; Mock, B.H.; Yune, H.Y.; Grim, C.E.

1985-01-01

Screening of 123 hypertensive patients for renovascular disease was carried out through renal studies, performed with iodine-123 ortho-iodohippurate (OIH), consisting of 214 studies performed with high-purity 123 I-OIH and 10 studies performed with 123 I-OIH contaminated with 124 I. Standard dynamic renal images and renogram curves were supplemented by functional renal images generated by computer. For the same radiation dose to the bladder, the number of detected photons with contaminated 123 I-OIH is only about one-third of that for high-purity 123 I-OIH so that for comparable studies one must use at least twice the dose with the former agent as compared with the latter. The study was hampered by erratic delivery of 123 I-OIH, which demonstrated the need for a reliable source

Modeling linear and cyclic PKS intermediates through atom replacement.

Science.gov (United States)

Shakya, Gaurav; Rivera, Heriberto; Lee, D John; Jaremko, Matt J; La Clair, James J; Fox, Daniel T; Haushalter, Robert W; Schaub, Andrew J; Bruegger, Joel; Barajas, Jesus F; White, Alexander R; Kaur, Parminder; Gwozdziowski, Emily R; Wong, Fiona; Tsai, Shiou-Chuan; Burkart, Michael D

2014-12-03

The mechanistic details of many polyketide synthases (PKSs) remain elusive due to the instability of transient intermediates that are not accessible via conventional methods. Here we report an atom replacement strategy that enables the rapid preparation of polyketone surrogates by selective atom replacement, thereby providing key substrate mimetics for detailed mechanistic evaluations. Polyketone mimetics are positioned on the actinorhodin acyl carrier protein (actACP) to probe the underpinnings of substrate association upon nascent chain elongation and processivity. Protein NMR is used to visualize substrate interaction with the actACP, where a tetraketide substrate is shown not to bind within the protein, while heptaketide and octaketide substrates show strong association between helix II and IV. To examine the later cyclization stages, we extended this strategy to prepare stabilized cyclic intermediates and evaluate their binding by the actACP. Elongated monocyclic mimics show much longer residence time within actACP than shortened analogs. Taken together, these observations suggest ACP-substrate association occurs both before and after ketoreductase action upon the fully elongated polyketone, indicating a key role played by the ACP within PKS timing and processivity. These atom replacement mimetics offer new tools to study protein and substrate interactions and are applicable to a wide variety of PKSs.

[99mTc]/[123I] Simultaneous dual-isotope brain striatum phantom SPECT study: preparing for simultaneous [99mTc]TRODAT-1/[123I]-IBZM pre- and post-synaptic dopamine imaging

International Nuclear Information System (INIS)

Kao, PF; Hsu, HT; Tzen, KY; Wey, SP

2004-01-01

Introduction: The brain dopamine transporters (DAT) and dopamine D2 receptors are implicated in all kinds of movement disorders. Both sites are also targets for drug treatment, Therefore, brain dopamine system is important in both basic and clinical neurological researches. Kung HF et al. developed [ 99m Tc]TRODAT-l for DAT and [ 123 I]IBZM for D2 receptor SPECT imaging in living human brain. In this work, the possibility of doing [ 99m Tc]TRODAT-1/[ 123 I]IBZM simultaneous dual-isotope SPECT for both DAT/D2 receptor imaging was studied. The SPECT acquisition protocol, the percent of 99m Tc/ 123 I energy cross contamination, and the reproducibility of striatal /background ratios were studied with a striatal phantom to confirm the accuracy of 99m Tc/ 123 I dual-isotope simultaneous SPECT technique. Materials and Methods: In each set of experiment, the 4 striatum (target) chambers and the rest of the brain (background) were filled with solutions containing 99m Tc only, 123 I only, and both isotopes. Several sets of experiment with different target/background ratios were tested. For SPECT image acquisition, a triple-head gamma camera equipp with high resolution fan-beam collimators (Siemens Multi-SPECT3). Energy window settings of a 15% centered window at 140KeV for 99m Tc and a 10% asymmetric window with a lower bound at 159KeV for 123 I were used. After filtered backprojection and Chang's attenuation correction, regions of interest were defined at the bilateral basal ganglia and occipital areas. The reproducibility of counting activity and the different target/background ratios from each isotope were observed. Results: The results of the study revealed that the energy crossed contaminations from I-123 into Tc- 99m and vice verse were 22±12.4 % and 0.4±1.0 %, respectively. The correlation of striatum/background ratios between single isotope and simultaneous was excellent (R2 = 0.99). The success of this simultaneous dual-isotope SPECT technique is suggestive of the

10 CFR 71.123 - Test control.

Science.gov (United States)

2010-01-01

... 10 Energy 2 2010-01-01 2010-01-01 false Test control. 71.123 Section 71.123 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) PACKAGING AND TRANSPORTATION OF RADIOACTIVE MATERIAL Quality Assurance § 71.123 Test control. The licensee, certificate holder, and applicant for a CoC shall establish a test...

N-isopropyl-p-[I123] iodoamphetamine single photon emission computed tomography (I123-IMP SPECT) and child neurology

International Nuclear Information System (INIS)

Tada, Hiroshi; Morooka, Keiichi; Arimoto, Kiyoshi; Matsuo, Takiko; Takagi, Kazue; Yanagawa, Etsuko

1992-01-01

We studied the clinical usefulness of I 123 -IMP SPECT in 50 pediatric patients with CNS disorders, which were categorized into the convulsive disorder group (n=20), the cerebrovascular disorder group (n=10), the acute encephalopathy or CNS infection group (n=10), the metabolic or degenerative disorder group (n=6), the congenital abnormality group (n=2) and the migraine group (n=2). The findings obtained were compared with those of cranial CT. I 123 -IMP SPECT revealed abnormal findings in 45 out of the 50 patients (90%), although cranial CT showed abnormal findings in only 24 patients (48%). This difference was statistically significant (p 123 -IMP SPECT showed focal abnormalities in 26 patients (93%). Moreover in many patients with focal neurological abnormalities, we found focal abnormalities of I 123 -IMP SPECT related with neurological abnormalities of the patients. From these findings, we think I 123 -IMP SPECT might be superior to CT scanning in examining a localized lesion. It was found that in many patients with focal abnormalities in CT scanning, I 123 -IMP SPECT showed larger abnormalities in CT scanning. By using I 123 -IMP SPECT we might be able to study the blood perfusional state surrounding the abnormal area shown by CT. In 3 patients with acute cerebrovascular disorders, I 123 -IMP SPECT revealed abnormal findings 3 to 11 days earlier than cranial CT. I 123 -IMP SPECT might be useful for early recognition of the pathological state. From these experiences, we concluded that I 123 -IMP SPECT was useful for studying the pathophysiology of CNS disorders in children. (author)

40 CFR 123.61 - Approval process.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Approval process. 123.61 Section 123... REQUIREMENTS Program Approval, Revision, and Withdrawal § 123.61 Approval process. (a) After determining that a...; and (6) Briefly outline the fundamental aspects of the State's proposed program, and the process for...

Swift detections of the flaring blazar GAIA 18ayp (PKS 2333-415) in X-rays and the UV

Science.gov (United States)

Grupe, Dirk; Komossa, S.; Angioni, R.; Schartel, N.

2018-04-01

We report Swift observations of the z=1.41 QSO GAIA 18ayp (PKS 2333-415) which was detected by GAIA in an optically flaring state on 2018-April-14. Swift observed GAIA 18ayp on 2018 April 23 for a total of 1.4 ks. The QSO is clearly detected in X-rays and the UV. The X-ray position found using the enhanced XRT position (Goad et al. 2007, Evans et al. 2009) is RA-2000 = 23 36 34.1, Dec-2000 = -41 15 21.4 with an uncertainty of 3.0".

Renal function study using I-123-OIH

International Nuclear Information System (INIS)

Yamashita, Masato; Osaka, Yosio; Aikawa, Ichiro

1989-01-01

Twenty-eight renal function studies were performed in 24 patients with renal diseases with I-123 orthoiodohippurate (I-123 OIH). Neither side effects nor abnormal laboratory values were attributable to I-123 OIH. Imaging with Tc-99m diethylene triaminepentaacetic acid (DTPA) was also performed in 20 patients within one week after I-123 imaging. Findings with I-123 OIH and Tc-99m DTPA were similar in all except for two patients. The two patients had received cadaveric renal transplantation. One patient presented with acute tubular necrosis and the other with chronic renal rejection. In these patients, I-123 imaging showed vascular stricture and Tc-99m imaging showed a decreased glomerular function. Because I-123 OIH and Tc-99m DTPA had different pharmacodynamics, combined use of the two imaging agents may be useful in evaluating renal rejection or acute tubular necrosis. (N.K.)

Fermi Non-detections of Four X-Ray Jet Sources and Implications for the IC/CMB Mechanism

Science.gov (United States)

Breiding, Peter; Meyer, Eileen T.; Georganopoulos, Markos; Keenan, M. E.; DeNigris, N. S.; Hewitt, Jennifer

2017-11-01

Since its launch in 1999, the Chandra X-ray observatory has discovered several dozen X-ray jets associated with powerful quasars. In many cases, the X-ray spectrum is hard and appears to come from a second spectral component. The most popular explanation for the kpc-scale X-ray emission in these cases has been inverse-Compton (IC) scattering of Cosmic Microwave Background (CMB) photons by relativistic electrons in the jet (the IC/CMB model). Requiring the IC/CMB emission to reproduce the observed X-ray flux density inevitably predicts a high level of gamma-ray emission, which should be detectable with the Fermi Large Area Telescope (LAT). In previous work, we found that gamma-ray upper limits from the large-scale jets of 3C 273 and PKS 0637-752 violate the predictions of the IC/CMB model. Here, we present Fermi/LAT flux density upper limits for the X-ray jets of four additional sources: PKS 1136-135, PKS 1229-021, PKS 1354+195, and PKS 2209+080. We show that these limits violate the IC/CMB predictions at a very high significance level. We also present new Hubble Space Telescope observations of the quasar PKS 2209+080 showing a newly detected optical jet, and Atacama Large Millimeter/submillimeter Array band 3 and 6 observations of all four sources, which provide key constraints on the spectral shape that enable us to rule out the IC/CMB model.

Striatal uptake of I-123-β-CIT and I-123-IBZM in patients with extrapyramidal symptoms

International Nuclear Information System (INIS)

Bettin, S.; Kaempfer, I.; Seese, A.; Schaefer, A.; Reuter, M.; Loessner, J.; Dietrich, J.; Wagner, A.; Knapp, W.H.

1997-01-01

Aim: This pilot study deals with the question whether characteristic changes in local cerebral dopamine transporter function and D 2 -receptor binding capacity can be shown with SPET, in idiopathic Parkinson syndrome (IPS) and secondary Parkinson syndrome (SPS). Methods: In 16 patients (6 with IPS, 6 with SPS except Wilsons's disease, and 4 with Wilson's disease) SPET studies were performed using I-123-β-CIT and I-123-IBZM and a dual-head gamma camera. Images were obtained 20-24 h and 2 h post injection, respectively. For semiquantitative analysis count density ratios of basal ganglia (BG) and cerebellum (CER) were determined for I-123-β-CIT and ratios between BG and medial frontal cortex (MFC) for I-123-IBZM. Results: The BG/CER ratio in the I-123-β-CIT studies averaged 3.04±0.83 in IPS and 7.73±3.28 in SPS (p [de

Characterization of SGN-CD123A, A Potent CD123-Directed Antibody-Drug Conjugate for Acute Myeloid Leukemia.

Science.gov (United States)

Li, Fu; Sutherland, May Kung; Yu, Changpu; Walter, Roland B; Westendorf, Lori; Valliere-Douglass, John; Pan, Lucy; Cronkite, Ashley; Sussman, Django; Klussman, Kerry; Ulrich, Michelle; Anderson, Martha E; Stone, Ivan J; Zeng, Weiping; Jonas, Mechthild; Lewis, Timothy S; Goswami, Maitrayee; Wang, Sa A; Senter, Peter D; Law, Che-Leung; Feldman, Eric J; Benjamin, Dennis R

2018-02-01

Treatment choices for acute myelogenous leukemia (AML) patients resistant to conventional chemotherapies are limited and novel therapeutic agents are needed. IL3 receptor alpha (IL3Rα, or CD123) is expressed on the majority of AML blasts, and there is evidence that its expression is increased on leukemic relative to normal hematopoietic stem cells, which makes it an attractive target for antibody-based therapy. Here, we report the generation and preclinical characterization of SGN-CD123A, an antibody-drug conjugate using the pyrrolobenzodiazepine dimer (PBD) linker and a humanized CD123 antibody with engineered cysteines for site-specific conjugation. Mechanistically, SGN-CD123A induces activation of DNA damage response pathways, cell-cycle changes, and apoptosis in AML cells. In vitro , SGN-CD123A-mediated potent cytotoxicity of 11/12 CD123 + AML cell lines and 20/23 primary samples from AML patients, including those with unfavorable cytogenetic profiles or FLT3 mutations. In vivo , SGN-CD123A treatment led to AML eradication in a disseminated disease model, remission in a subcutaneous xenograft model, and significant growth delay in a multidrug resistance xenograft model. Moreover, SGN-CD123A also resulted in durable complete remission of a patient-derived xenograft AML model. When combined with a FLT3 inhibitor quizartinib, SGN-CD123A enhanced the activity of quizartinib against two FLT3-mutated xenograft models. Overall, these data demonstrate that SGN-CD123A is a potent antileukemic agent, supporting an ongoing trial to evaluate its safety and efficacy in AML patients (NCT02848248). Mol Cancer Ther; 17(2); 554-64. ©2017 AACR . ©2017 American Association for Cancer Research.

Heterologous Gene Expression of N-Terminally Truncated Variants of LipPks1 Suggests a Functionally Critical Structural Motif in the N-terminus of Modular Polyketide Synthase

DEFF Research Database (Denmark)

Yuzawa, Satoshi; Bailey, Constance B.; Fujii, Tatsu A.

2017-01-01

Streptomyces-derived, Well-characterized modular, polyketide synthase (PKS). Using this enzyme as a model, we experimentally investigated the effects of alternative TSSs using a heterologous host, Streptomyces venezuelae. One of the TSSs employed boosted the protein level by 59-fold and the product yield by 23...

32 CFR 701.123 - PA fees.

Science.gov (United States)

2010-07-01

... 32 National Defense 5 2010-07-01 2010-07-01 false PA fees. 701.123 Section 701.123 National... OFFICIAL RECORDS AVAILABILITY OF DEPARTMENT OF THE NAVY RECORDS AND PUBLICATION OF DEPARTMENT OF THE NAVY DOCUMENTS AFFECTING THE PUBLIC DON Privacy Program § 701.123 PA fees. The PA fee schedule is only applicable...

Error analysis of the finite element and finite volume methods for some viscoelastic fluids

Czech Academy of Sciences Publication Activity Database

Lukáčová-Medviďová, M.; Mizerová, H.; She, B.; Stebel, Jan

2016-01-01

Roč. 24, č. 2 (2016), s. 105-123 ISSN 1570-2820 R&D Projects: GA ČR(CZ) GAP201/11/1304 Institutional support: RVO:67985840 Keywords : error analysis * Oldroyd-B type models * viscoelastic fluids Subject RIV: BA - General Mathematics Impact factor: 0.405, year: 2016 http://www.degruyter.com/view/j/jnma.2016.24.issue-2/jnma-2014-0057/jnma-2014-0057. xml

Biocombinatorial Engineering of Fungal PKS-NRPS Hybrids for Production of Novel Synthetic Natural Products

DEFF Research Database (Denmark)

Nielsen, Maria Lund

encoding a PKS-NRPS hybrid responsible for the production of a medically relevant compound in Talaromyces atroroseus. To the best of my knowledge, this study represents the first example of reverse engineering of a Talaromyces species. In the fourth study (chapter 5), I used the CRISPR-Cas9 system...... structure optimization. Within the last decade, an alternative approach for expanding natural product chemodiversity has been applied. This strategy, known as combinatorial biosynthesis, involves the re-engineering of biosynthetic pathways and ultimately the rational engineering of new natural product...... analogs. This field, however, has proved very challenging and many engineering efforts have resulted in enzymatic loss-of-function or reduced yields. Thus, the future success in combinatorial biosynthetic studies requires a thorough understanding of the structure and function of biosynthetic enzymes...

Examining the nature of very-high-energy gamma-ray emission from the AGN PKS 1222+216 and 3C 279

Science.gov (United States)

Price, Sharleen; Brill, Ari; Mukherjee, Reshmi; VERITAS

2018-01-01

Blazars are a type of active galactic nuclei (AGN) that emit jets of ionized matter which move towards the Earth at relativistic speeds. In this research we carried out a study of two objects, 3C 279 and PKS 1222+216, which belong to the subset of blazars known as FSRQs (flat spectrum radio quasars), the most powerful TeV-detected sources at gamma-ray energies with bolometric luminosities exceeding 1048 erg/s. The high-energy emission of quasars peaks in the MeV-GeV band, making these sources very rarely detectable in the TeV energy range. In fact, only six FSRQs have ever been detected in this range by very-high-energy gamma-ray telescopes. We will present results from observing campaigns on 3C 279 in 2014 and 2016, when the object was detected in high flux states by Fermi-LAT. Observations include simultaneous coverage with the Fermi-LAT satellite and the VERITAS ground-based array spanning four decades in energy from 100 MeV to 1 TeV. We will also report VERITAS observations of PKS 1222+216 between 2008 and 2017. The detection/non-detection of TeV emission during flaring episodes at MeV energies will further contribute to our understanding of particle acceleration and gamma-ray emission mechanisms in blazar jets.

Dosimetry of iodine-123 for newborn and infant

International Nuclear Information System (INIS)

Guilhem, M.T.; Therain, F.

1987-01-01

Iodine-123 ( 123 I) is a radionuclide of choice of neonatal hypothyroidism diagnosis. It is important to know infant main organs adsorbed doses during a thyroid scan with 123 I. Absorbed doses are already available for adults: for infants, they must be transformed taking account of organs sizes and inter-organs distances. Calculations are done for commercially available 123 I(p,2n) and 123 I(p,5n). Important contamination of 124 I in 123 I(p,2n) increases considerably the absorbed-dose during thyroid scan of a newborn (the ratio 124 I/ 123 I doubles every 15h). For routinely used activities, thyroid absorbed dose, 24 h after end of production, is fifteen times higher with 123 I(p,5n) than with 99m Tc: for one month old child; total body absorbed dose is of the same order of magnitude [fr

Molecular hydrogen in the z = 2.811 absorbing material toward the quasar PKS 0528-250

International Nuclear Information System (INIS)

Levshakov, S.A.; Varshalovich, D.A.

1985-01-01

Among the previously unidentified absorbtion features in the spectrum of the quasar PKS 0528-250 obtained by previous authors tentative evidence has been found for H 2 lines at the same redshift (z = 2.811) as that of the well-known absorption-line system. The column density of molecules has been estimated from the curve of growth; the fraction of H 2 appears to be about 2 x 10 -5 . The ortho- to para-H 2 ratio corresponds to the excitation temperature of Tsub(ex)(H 2 ) = 300 +- 150 K, though the upper rotational levels J >= 3 turn out be overpopulated. The results obtained seem to provide substantial evidence for the existence of molecular hydrogen at the early cosmological epoch with z approx. 3. (author)

On the intrinsic spectrum of PKS 2155-304 from H.E.S.S. 2003 data

International Nuclear Information System (INIS)

Costamante, L.; Benbow, W.; Horns, D.; Reimer, A.; Reimer, O.

2005-01-01

In 2003, PKS 2155-304 has been significantly detected by H.E.S.S. at Very High Energies (VHE), with an average spectrum of Γ = 3.3. Due to absorption by the Extragalactic Background Light (EBL), the intrinsic spectrum is heavily modified both in shape and intensity. To correct for this effect, and locate the Inverse Compton (IC) peak of the Spectral Energy Distribution (SED), we used three EBL models (representatives of three different flux levels for the stellar peak component). The resulting TeV spectrum has a peak around 1 TeV for stellar peak fluxes above the Primack (2001) calculation, while the spectrum is steeper than Γ = 2 (thus locating the IC peak 19 (for historical SED fluxes and 2 hours variability timescale)

Multi-Frequency Monitoring of the Flat Spectrum Radio Quasar PKS 1222+216 in 2008–2015

Directory of Open Access Journals (Sweden)

Ivan Troitskiy

2016-11-01

Full Text Available We analyze the broadband activity of the flat spectrum radio quasar PKS 1222+216 from 2008 to 2015 using multi-frequency monitoring which involves γ-ray data from the Fermi Large Area Telescope, total intensity and linear polarization observations from different optical telescopes in R band, and imaging of the inner jet structure with the Very Long Baseline Array (VLBA at 43 GHz. During the observations, the source showed several dramatic flares at γ rays and optical bands, with the rising branch of a γ-ray flare accompanied by a rapid rotation of the polarization position angle (EVPA, a fast increase of the degree of polarization in the optical band, brightening of the VLBI core, and appearance of a new superluminal component in the parsec-scale jet. The rapid variability of the optical linear polarization may be explained by a strong turbulence in the jet plasma. We find a correlation between the γ rays, optical R band, and 43 GHz variability on a long-term scale (months and years, and a good general alignment between EVPAs in R band and at 43 GHz, while the correlation between short-term variations (days and weeks is weaker. Synchronous activity across the bands supports the idea that the emission regions responsible for the γ-ray and optical flares are co-spatial and located in the vicinity of the mm-wave core of the parsec-scale jet. However, these connections do not completely explain the challenging behaviour of PKS 1222+216, since there are some γ-ray flares which are not accompanied by jet events, and vice versa. We need a continuation of multi-frequency monitoring along with high resolution imaging of the parsec-scale jet to understand in detail the origin of high energy emission in blazars.

Industrial system for producing iodine-123

International Nuclear Information System (INIS)

Brantley, J.C.

1985-01-01

An industrial system to produce iodine-123 required a complex set of steps involving new approaches by the Food and Drug Administration, difficult distribution procedures, and evidence from potential users that either very pure iodine-123 or inexpensive iodine-123 is needed. Industry has shown its willingness to invest in new radionuclides but needs strong evidence as to product potential to justify those investments

POLARIMETRY AND THE HIGH-ENERGY EMISSION MECHANISMS IN QUASAR JETS: THE CASE OF PKS 1136-135

Energy Technology Data Exchange (ETDEWEB)

Cara, Mihai; Perlman, Eric S. [Department of Physics and Space Sciences, Florida Institute of Technology, 150 W. University Blvd., Melbourne, FL 32901 (United States); Uchiyama, Yasunobu [SLAC/KIPAC, Stanford University, 2575 Sand Hill Road, M/S 209, Menlo Park, CA 94025 (United States); Cheung, Chi C. [Space Science Division, Naval Research Laboratory, Washington, DC 20375 (United States); Coppi, Paolo S. [Yale University, Department of Astronomy, P.O. Box 208101, New Haven, CT 06520-8101 (United States); Georganopoulos, Markos [Department of Physics, University of Maryland, Baltimore County, 1000 Hilltop Circle, Baltimore, MD 21250 (United States); Worrall, Diana M.; Birkinshaw, Mark [Department of Physics, University of Bristol, Bristol, BS8 1TL (United Kingdom); Sparks, William B. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Marshall, Herman L. [Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Stawarz, Lukasz [Institute of Space Astronautical Science, JAXA, 3-1-1 Yoshinodai, Chuo-Ku, Sagamihara, Kanagawa 252-5210 (Japan); Begelman, Mitchell C. [Department of Astrophysical and Planetary Sciences, UCB 391, University of Colorado, Boulder, CO 80309-0391 (United States); O' Dea, Christopher P. [Laboratory for Multiwavelength Astrophysics, School of Physics and Astronomy, Rochester Institute of Technology, 84 Lomb Memorial Dr., Rochester, NY 14623-5603 (United States); Baum, Stefi A. [Chester F. Carlson Center for Imaging Science, Rochester Institute of Technology, 54 Lomb Memorial Dr., Rochester, NY 14623-5604 (United States)

2013-08-20

Since the discovery of kiloparsec-scale X-ray emission from quasar jets, the physical processes responsible for their high-energy emission have been poorly defined. A number of mechanisms are under active debate, including synchrotron radiation, inverse-Comptonized cosmic microwave background (IC/CMB) emission, and other Comptonization processes. In a number of cases, the optical and X-ray emission of jet regions are inked by a single spectral component, and in those, high-resolution multi-band imaging and polarimetry can be combined to yield a powerful diagnostic of jet emission processes. Here we report on deep imaging photometry of the jet of PKS 1136-135 obtained with the Hubble Space Telescope. We find that several knots are highly polarized in the optical, with fractional polarization {Pi} > 30%. When combined with the broadband spectral shape observed in these regions, this is very difficult to explain via IC/CMB models, unless the scattering particles are at the lowest-energy tip of the electron energy distribution, with Lorentz factor {gamma} {approx} 1, and the jet is also very highly beamed ({delta} {>=} 20) and viewed within a few degrees of the line of sight. We discuss both the IC/CMB and synchrotron interpretation of the X-ray emission in the light of this new evidence, presenting new models of the spectral energy distribution and also the matter content of this jet. The high polarizations do not completely rule out the possibility of IC/CMB optical-to-X-ray emission in this jet, but they do strongly disfavor the model. We discuss the implications of this finding, and also the prospects for future work.

The ultraviolet to infrared energy distribution of the BL Lacertae object PKS 0422+00 at two different brightness levels

Energy Technology Data Exchange (ETDEWEB)

Falomo, R.; Bouchet, P.; Maraschi, L.; Treves, A.; Tanzi, E.G. (Padova, Osservatorio Astronomico, Padua (Italy) European Southern Observatory, La Silla (Chile) Milano Universita, Milan (Italy) CNR, Istituto di Fisica Cosmica, Milan (Italy))

1989-10-01

The BL Lacertae object PKS 0422+00 was observed with IUE (International Ultraviolet Explorer) on August 31-September 1, 1987, when the visual magnitude of the object was V = 16.2, and again about 4 months later (January 10, 1988) during an active state (V = 15.6). Quasi-simultaneous optical to infrared observations allow deriving a detailed spectral flux distribution from 8 x 10 to the 13th to 2.5 x 10 the 15th Hz, for each epoch. Fits in terms of broken power laws and logarithmic parabolas are discussed. 32 refs.

The ultraviolet to infrared energy distribution of the BL Lacertae object PKS 0422+00 at two different brightness levels

International Nuclear Information System (INIS)

Falomo, R.; Bouchet, P.; Maraschi, L.; Treves, A.; Tanzi, E.G.

1989-01-01

The BL Lacertae object PKS 0422+00 was observed with IUE (International Ultraviolet Explorer) on August 31-September 1, 1987, when the visual magnitude of the object was V = 16.2, and again about 4 months later (January 10, 1988) during an active state (V = 15.6). Quasi-simultaneous optical to infrared observations allow deriving a detailed spectral flux distribution from 8 x 10 to the 13th to 2.5 x 10 the 15th Hz, for each epoch. Fits in terms of broken power laws and logarithmic parabolas are discussed. 32 refs

18 CFR 284.123 - Rates and charges.

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Rates and charges. 284.123 Section 284.123 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION... AUTHORITIES Certain Transportation by Intrastate Pipelines § 284.123 Rates and charges. (a) General rule...

49 CFR 38.123 - Restrooms.

Science.gov (United States)

2010-10-01

... 49 Transportation 1 2010-10-01 2010-10-01 false Restrooms. 38.123 Section 38.123 Transportation Office of the Secretary of Transportation AMERICANS WITH DISABILITIES ACT (ADA) ACCESSIBILITY... measured to the top of the toilet seat. Seats shall not be sprung to return to a lifted position. (3) A...

19 CFR 123.31 - Merchandise in transit.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Merchandise in transit. 123.31 Section 123.31... TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through the United States § 123.31 Merchandise in transit. (a) From one contiguous country to another. Merchandise may be transported in transit...

19 CFR 123.21 - Merchandise in transit.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Merchandise in transit. 123.21 Section 123.21... TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.21 Merchandise in transit. (a) Status. Merchandise may be transported from one port to another in the United...

29 CFR 780.123 - Raising of bees.

Science.gov (United States)

2010-07-01

... 29 Labor 3 2010-07-01 2010-07-01 false Raising of bees. 780.123 Section 780.123 Labor Regulations... Raising of Livestock, Bees, Fur-Bearing Animals, Or Poultry § 780.123 Raising of bees. The term “raising of * * * bees” refers to all of those activities customarily performed in connection with the...

Clinical utility of N-isopropyl-p-[123I] iodoamphetamine (123I-IMP) for SPECT in epileptic children

International Nuclear Information System (INIS)

Taki, Kuniyasu; Seto, Hikaru; Futatsuya, Ryusuke; Kakishita, Masao; Seki, Hiroyasu.

1989-01-01

A regional cerebral perfusion study was performed in epileptic children using single photon emission computed tomography (SPECT) and N-isopropyl-p-[ 123 I] iodoamphetamine ( 123 I-IMP). A total of 22 patients with epilepsy underwent both a 123 I-IMP brain perfusion study and X-ray CT. Eighteen had positive and four had negative perfusion study results. Of the eighteen patients with positive perfusion study results, two were positive on X-ray CT. In these two patients, the areas of perfusion defects were larger than those of low density on X-ray CT. In only four patients did the areas of perfusion defects correspond to the sites of abnormal EEG. In conclusion, 123 I-IMP perfusion study is of great clinical value in pediatric epileptic cases. (author)

Production of 123 I for medical diagnosis application

International Nuclear Information System (INIS)

Britto, J.L.Q. de.

1982-01-01

A method for production of carrier free 123 I with high radionuclidic purity in which the processing is done remotely was developed at Instituto de Engenharia Nuclear in Rio de Janeiro. The 123 I is produced in the decay of 123 Xe which is obtained through the reaction 122 Te ( 3 He, 2 n) 123 Xe with 30 MeV 3 He beams of IEN's variable energy cyclotron. The irradiated natural Te O 2 target is heated in a furnace at 675 0 C and the diffused out 123 Xe is adsorbed in a copper trap maintained at -196 0 C. The 123 Xe is allowed to decay during 6.3 hours and the 123 I produced washed out of the trap with a 0.1 N solution of NaOH. All the process is remotely controlled by using electric and pneumatic systems as well as manipulators and tongs. The quality control was achieved by atomic absorption and gamma-ray spectroscopy. (author)

POLARIMETRY AND THE HIGH-ENERGY EMISSION MECHANISMS IN QUASAR JETS: THE CASE OF PKS 1136–135

International Nuclear Information System (INIS)

Cara, Mihai; Perlman, Eric S.; Uchiyama, Yasunobu; Cheung, Chi C.; Coppi, Paolo S.; Georganopoulos, Markos; Worrall, Diana M.; Birkinshaw, Mark; Sparks, William B.; Marshall, Herman L.; Stawarz, Lukasz; Begelman, Mitchell C.; O'Dea, Christopher P.; Baum, Stefi A.

2013-01-01

Since the discovery of kiloparsec-scale X-ray emission from quasar jets, the physical processes responsible for their high-energy emission have been poorly defined. A number of mechanisms are under active debate, including synchrotron radiation, inverse-Comptonized cosmic microwave background (IC/CMB) emission, and other Comptonization processes. In a number of cases, the optical and X-ray emission of jet regions are inked by a single spectral component, and in those, high-resolution multi-band imaging and polarimetry can be combined to yield a powerful diagnostic of jet emission processes. Here we report on deep imaging photometry of the jet of PKS 1136–135 obtained with the Hubble Space Telescope. We find that several knots are highly polarized in the optical, with fractional polarization Π > 30%. When combined with the broadband spectral shape observed in these regions, this is very difficult to explain via IC/CMB models, unless the scattering particles are at the lowest-energy tip of the electron energy distribution, with Lorentz factor γ ∼ 1, and the jet is also very highly beamed (δ ≥ 20) and viewed within a few degrees of the line of sight. We discuss both the IC/CMB and synchrotron interpretation of the X-ray emission in the light of this new evidence, presenting new models of the spectral energy distribution and also the matter content of this jet. The high polarizations do not completely rule out the possibility of IC/CMB optical-to-X-ray emission in this jet, but they do strongly disfavor the model. We discuss the implications of this finding, and also the prospects for future work

Assessment of cerebral benzodiazepine receptor distribution in anxiety disorders by 123I-iomazenil-SPECT. Comparison to cerebral perfusion scintigraphy by 123I-IMP

International Nuclear Information System (INIS)

Uchiyama, Mayuki; Sue, Hironari; Fukumitsu, Nobuyoshi; Mori, Yutaka; Kawakami, Kenji

1997-01-01

123 I-Iomazenil ( 123 I-IMZ) and 123 I-IMP imaging were performed in 5 patients with anxiety disorder (PAD) and 6 normal volunteers (NV). On 123 I-IMZ delayed imaging, the 2 PAD showed abnormally decreased findings. In anxiety disorder, decreased accumulation on 123 I-IMZ delayed images was seen in left hippocampus and parahippocampal gyrus in one patient, in right frontal and temporal lobe and left occipital pole in the other. Compared with NV, PAD had lower 123 I-IMZ uptake on delayed image in right upper and left lower frontal cortices, indicating the involvement of the benzodiazepine receptor complex in anxiety disorder. Compared with grading for anxiety disorder with Hamilton anxiety scale (HAS) and delayed to early count ratios of 123 I-IMZ, negative correlation (R 123 I-IMP image, positive correlation (R>0.7) was recognized in the hippocampus, the parahippocampal gyrus, the lower outer temporal cortex and the lower frontal cortex. (author)

40 CFR 123.3 - Coordination with other programs.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Coordination with other programs. 123.3 Section 123.3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS STATE PROGRAM REQUIREMENTS General § 123.3 Coordination with other programs. Issuance of State permits...

Labeling of indocyanine green with carrier-free iodine-123

International Nuclear Information System (INIS)

Ansari, A.N.; Lambrecht, R.M.; Redvanly, C.S.; Wolf, A.P.

1976-01-01

The method is described for labeling indocyanine green (ICG) with carrier-free iodine-123 by condensing xenon-123 on crystals of ICG followed by permitting decay of the 123 Xe a sufficient length of time to produce 123 I-electronically excited ions and atoms which subsequently label ICG. 4 claims, no drawings

Quantitative SPECT reconstruction of iodine-123 data

International Nuclear Information System (INIS)

Gilland, D.R.; Jaszczak, R.J.; Greer, K.L.; Coleman, R.E.

1991-01-01

Many clinical and research studies in nuclear medicine require quantitation of iodine-123 ( 123 I) distribution for the determination of kinetics or localization. The objective of this study was to implement several reconstruction methods designed for single-photon emission computed tomography (SPECT) using 123 I and to evaluate their performance in terms of quantitative accuracy, image artifacts, and noise. The methods consisted of four attenuation and scatter compensation schemes incorporated into both the filtered backprojection/Chang (FBP) and maximum likelihood-expectation maximization (ML-EM) reconstruction algorithms. The methods were evaluated on data acquired of a phantom containing a hot sphere of 123 I activity in a lower level background 123 I distribution and nonuniform density media. For both reconstruction algorithms, nonuniform attenuation compensation combined with either scatter subtraction or Metz filtering produced images that were quantitatively accurate to within 15% of the true value. The ML-EM algorithm demonstrated quantitative accuracy comparable to FBP and smaller relative noise magnitude for all compensation schemes

Multiwavelength Observations of the Powerful Gamma-ray Quasar PKS 1510-089: Clues on the Jet Composition

Energy Technology Data Exchange (ETDEWEB)

Kataoka, J.; Madejski, G.; Sikora, M.; Roming, P.; Chester, M.M.; Grupe, D.; Tsubuku, Y.; Sato, R.; Kawai, N.; Tosti, G.; Impiombato, D.; Kovalev, Y.Y.; Kovalev, Y.A.; Edwards, Philip G.; Wagner, S.J.; Moderski, R.; Stawarz, L.; Takahashi, T.; Watanabe, S.

2007-09-28

We present the results from a multiwavelength campaign conducted in August 2006 of the powerful {gamma}-ray quasar PKS 1510--089 (z = 0.361). This campaign commenced with a deep Suzaku observation lasting three days for a total exposure time of 120 ks, and continued with Swift monitoring over 18 days. Besides Swift observations, which sampled the optical/UV flux in all 6 UVOT filters as well as the X-ray spectrum in the 0.3--10 keV energy range, the campaign included ground-based optical and radio data, and yielded a quasi-simultaneous broad-band spectral energy distribution from 109 Hz to 1019 Hz. Thanks to its low instrumental background, the Suzaku observation provided a high S/N X-ray spectrum, which is well represented by an extremely hard power-law with photon index {Gamma}{approx_equal}1.2, augmented by a soft component apparent below 1 keV, which is well described by a black-body model with temperature kT {approx_equal}0.2 keV. Monitoring by Suzaku revealed temporal variability which is different between the low and high energy bands, again suggesting the presence of a second, variable component in addition to the primary power-law emission. We model the broadband spectrum of PKS 1510--089 assuming that the high energy spectral component results from Comptonization of infrared radiation produced by hot dust located in the surrounding molecular torus. In the adopted internal shock scenario, the derived model parameters imply that the power of the jet is dominated by protons but with a number of electrons/positrons exceeding a number of protons by a factor {approx} 10. We also find that inhomogeneities responsible for the shock formation, prior to the collision may produce bulk-Compton radiation which can explain the observed soft X-ray excess and possible excess at {approx} 18 keV. We note, however, that the bulk-Compton interpretation is not unique, and the observed soft excess could arise as well via some other processes discussed briefly in the text.

Ginkgo biloba extract alters the binding of the sodium [123I] iodide (Na123I) on blood constituents

International Nuclear Information System (INIS)

Aleixo, Luiz Cláudio Martins; Moreno, Silvana Ramos Farias; Freitas, Rosimeire de Souza; Thomaz, Hélio; Santos-Filho, Sebastião David

2012-01-01

We evaluated the in vitro effect of an aqueous extract of Ginkgo biloba (EGb) on the distribution in blood cells (BC) and plasma (P) and on the binding of Na 123 I to the blood constituents using precipitation with trichloroacetic acid. The radioactivity percentages insoluble (SF) and insoluble fraction (IF) of blood constituents were determined. The EGb interfered (p 123 I in the P (from 69.64 to 86.13) and BC (from 30.36 to 13.87) and altered the fixation of the Na 123 I in IF-P and in IF-BC. - Highlights: ► Interaction between the Ginkgo biloba and blood constituents radiolabeled. ► Modification of the binding of sodium iodide (Na 123 I) to the blood constituents. ► This alteration should have influence in a diagnosis of nuclear medicine.

Analisa Kadar Silika Pada Air Umpan Ketel Dan Air Boiler Dengan Alat Lovibond Di Pks PT. Perkebunan Nusantara IV Dolok Ilir

OpenAIRE

Simamora, Evi Novita F.

2016-01-01

Analysis was performed on a silica content of boiler feed water and boiler water at the PKS PT. PTPN IV Dolok Ilir. Samples taken from the boiler feed water tank heated while the boiler water sample taken from the heating pipes in the boiler drum. Silica content in the sample is determined by comparison with a reagent Ammonium molybdat, HCL 1: 1, and oxalic acid. The determinations were performed over a period of 18 to 27 February 2015. The results showed that the silica content of boiler fee...

10 CFR 1040.123 - Consolidated or joint hearings.

Science.gov (United States)

2010-01-01

... ACTIVITIES Enforcement Opportunity for Hearing § 1040.123 Consolidated or joint hearings. In cases in which... 10 Energy 4 2010-01-01 2010-01-01 false Consolidated or joint hearings. 1040.123 Section 1040.123... departments or agencies, where applicable, provide for the conduct of consolidated or joint hearings and for...

15-(para-[123I]iodophenyl) pentadecanoic acid obtained using mercuration and subsequent [123I] radioiodination

International Nuclear Information System (INIS)

Dougan, H.; Vincent, J.S.; Lyster, D.M.

1989-01-01

The present work explores the basic reactions necessary for the preparation of [ 123 I] 15-(paraiodophenyl)-pentadecanoic acid (IPPA) from organo mercury compounds. It was found that the essential reactions occur readily and with good yield. The steps were as follows: phenyl pentadecanoic acid or its ethyl ester may be mercurated using Hg(TFA) 2 in TFA solvent, and the para-chloromercury compounds may be recovered. [ 123 I] radioiodination may be carried out in a variety of solvents in the presence of chloramine T. When radioiodination was conducted at room temperature the isomeric purity of the ester or fatty acid was found to be 99.9% para. The results indicate that poor solubility of certain mercurated pentadecanoic acid compounds will limit the development of a kit for [ 123 I]IPPA. (author) 16 refs.; 2 tabs

X-ray monitoring of the radio and γ-ray loud Narrow-Line Seyfert 1 Galaxy PKS2004–447

Directory of Open Access Journals (Sweden)

Kreikenbohm A.

2013-12-01

Full Text Available We present preliminary results of the X-ray analysis of XMM-Newton and Swift observations as part of a multi-wavelength monitoring campaign in 2012 of the radio-loud narrow line Seyfert 1 galaxy PKS 2004–447. The source was recently detected in γ-rays by Fermi/LAT among only four other galaxies of that type. The 0:5 – 10 keV X-ray spectrum is well-described by a simple absorbed powerlaw (Γ ∼ 1.6. The source brightness exhibits variability on timescales of months to years with indications for spectral variability, which follows a “bluer-when-brighter” behaviour, similar to blazars.

Optical Polarimetry and Radio Observations of PKS1510-089 between 2009 and 2013

Directory of Open Access Journals (Sweden)

Pedro P. B. Beaklini

2018-02-01

Full Text Available The blazar PKS 1510-089 has shown intense activity at γ -rays in the recent years. In this work, we discussed the results of our 7 mm radio continuum and optical polarimetric monitoring between 2009 and 2013. In 2009, we detected a large rotation of the optical polarization angle that we attributed to the ejection of new polarized components. In 2011, after the occurrence of several γ -rays flares, the radio emission started to increase, reaching values never observed before. We interpreted this increase as the consequence of the superposition of several new components ejected during the γ -rays flares. A delay was measured between the maximum in the radio emission and the γ -ray flares, which favors models involving expanding components like the shock-in-jet models. Finally, we tried to understand the polarization angle variability behavior filling the gaps in our observations with published results of other polarimetric campaigns, and using the criterion of minimum variation in the polarization angle between successive observations to solve the 180° multiplicity.

A New Type of Synthesis of 1,2,3-Thiadiazole and 1,2,3-Diazaphosphole Derivatives Via-Hurd-Mori Cyclization

Directory of Open Access Journals (Sweden)

Mona A. Hosny

2012-01-01

Full Text Available We present a short and efficient synthesis of the title compounds starting with cheap and readily available camphor and derivatives of acetophenone. The optimized sequence allows the large-scale preparation of this new type of synthesis in a few steps. New 1,2,3-thiadiazole and 1,2,3-diazaphosphole derivatives 11-20, were prepared from the ketones 1-5 via the corresponding semicarbazones 6-10. The Hurd-Mori and Lalezari methods were used, respectively, for the preparation of these 1,2,3-thiadiazole and 1,2,3-diazaphospholene derivatives. These derivatives exhibit anticancer effect due to their high potential biological activity.

27 CFR 28.123 - Export marks.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Export marks. 28.123..., or Transportation to a Manufacturing Bonded Warehouse § 28.123 Export marks. (a) General. In addition... filled under the provisions of part 24 of this chapter, the proprietor shall mark the word “Export” on...

21 CFR 123.7 - Corrective actions.

Science.gov (United States)

2010-04-01

... of their HACCP plans in accordance with § 123.6(c)(5), by which they predetermine the corrective... in accordance with § 123.10, to determine whether the HACCP plan needs to be modified to reduce the risk of recurrence of the deviation, and modify the HACCP plan as necessary. (d) All corrective actions...

27 CFR 31.123 - New corporation.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false New corporation. 31.123... Requiring Registration As A New Business § 31.123 New corporation. Where a new corporation is formed to take over and conduct the business of one or more corporations that have registered under this part, the new...

Production of 123I for medical use with small accelerators

International Nuclear Information System (INIS)

Beyer, G.J.; Pimentel, G.; Solin, O.; Heselius, S.J.; Taka, T.

1988-01-01

The possibilities of 123 I production with small accelerators are discussed. Among the possible nuclear reactions the 122 Te(d,n) 123 I and the 123 Te(p,n) 123 I reaction are of particular interest for those institutions, who do not run a cyclotron with particle energies for protons above 18-20 MeV. The use of TeO 2 as target material is advantaged over Te. The 123 I preparations contain resonable amounts of 130 I and 124 I. The most 'dangerous' impurity is 130 I due to its high energy gamma radiation. Nevertheless, high quality imagings may be obtained using medium or high energy collimators loosing some of the advantages of 123 I. The proposed approach is the only way to make 123 I available for a number of institutions or countries running small cyclotrons and for which commercial 123 I is difficult or impossible to obtain for economical or geographical reasons. (author)

Rhodamine-123: a p-glycoprotein marker complex with sodium lauryl sulfate.

Science.gov (United States)

Al-Mohizea, Abdullah M; Al-Jenoobi, Fahad Ibrahim; Alam, Mohd Aftab

2015-03-01

Aim of this study was to investigate the role of sodium lauryl sulfate (SLS) as P-glycoprotein inhibitor. The everted rat gut sac model was used to study in-vitro mucosal to serosal transport of Rhodamine-123 (Rho-123). Surprisingly, SLS decreases the serosal absorption of Rho-123 at all investigated concentrations. Investigation reveals complex formation between Rhodamine-123 and sodium lauryl sulfate. Interaction profile of SLS & Rho-123 was studied at variable SLS concentrations. The SLS concentration higher than critical micelle concentration (CMC) increases the solubility of Rho-123 but could not help in serosal absorption, on the contrary the absorption of Rho-123 decreased. Rho-123 and SLS form pink color complex at sub-CMC. The SLS concentrations below CMC decrease the solubility of Rho-123. For further studies, Rho-123 & SLS complex was prepared by using solvent evaporation technique and characterized by using differential scanning calorimeter (DSC). Thermal analysis also proved the formation of complex between SLS & Rho-123. The P values were found to be significant (<0.05) except group comprising 0.0001% SLS, and that is because 0.0001% SLS is seems to be very low to affect the solubility or complexation of Rho-123.

Myocardial scintigraphy with I-123 labeled fatty acids

International Nuclear Information System (INIS)

Dudczak, R.

1983-01-01

This study presents experimental and clinical data in the use of I-123 labeled aromatic and aliphatic fatty acids. I-123 p-phenylpentadecanoic acid (p-IPPA) and I-123 heptadecanoic acid (HDA) were applied for myocardial scintigraphy. The feasibility of p-IPPA and HDA for myocardial scintigraphy was substantiated in animal experiments. Clinical studies were performed in patients with coronary artery disease (CAD) and cardiomyopathy (CMP). In CAD the results of fatty acid studies were compared with those of Tl-201. I-123 labeled fatty acids proved to be a useful tool for myocardial scintigraphy. The possibility to evaluate non invasively the myocardial metabolic function in man may add a complementary diagnostic tool in the clinical follow up of patients with heart disease. In CAD studies with I-123 p-IPPA and I-123 HDA might provide a means to assess the degree of myocardial viability and to identify a subgroup of patients who are at increased risk for irreversible myocardial damage. In patients with CMP it is probable that these studies may be used as a means of separating groups of patients with this disease. (Author)

Ion chemistry of 1H-1,2,3-triazole.

Science.gov (United States)

Ichino, Takatoshi; Andrews, Django H; Rathbone, G Jeffery; Misaizu, Fuminori; Calvi, Ryan M D; Wren, Scott W; Kato, Shuji; Bierbaum, Veronica M; Lineberger, W Carl

2008-01-17

A combination of experimental methods, photoelectron-imaging spectroscopy, flowing afterglow-photoelectron spectroscopy and the flowing afterglow-selected ion flow tube technique, and electronic structure calculations at the B3LYP/6-311++G(d,p) level of density functional theory (DFT) have been employed to study the mechanism of the reaction of the hydroxide ion (HO-) with 1H-1,2,3-triazole. Four different product ion species have been identified experimentally, and the DFT calculations suggest that deprotonation by HO- at all sites of the triazole takes place to yield these products. Deprotonation of 1H-1,2,3-triazole at the N1-H site gives the major product ion, the 1,2,3-triazolide ion. The 335 nm photoelectron-imaging spectrum of the ion has been measured. The electron affinity (EA) of the 1,2,3-triazolyl radical has been determined to be 3.447 +/- 0.004 eV. This EA and the gas-phase acidity of 2H-1,2,3-triazole are combined in a negative ion thermochemical cycle to determine the N-H bond dissociation energy of 2H-1,2,3-triazole to be 112.2 +/- 0.6 kcal mol-1. The 363.8 nm photoelectron spectroscopic measurements have identified the other three product ions. Deprotonation of 1H-1,2,3-triazole at the C5 position initiates fragmentation of the ring structure to yield a minor product, the ketenimine anion. Another minor product, the iminodiazomethyl anion, is generated by deprotonation of 1H-1,2,3-triazole at the C4 position, followed by N1-N2 bond fission. Formation of the other minor product, the 2H-1,2,3-triazol-4-ide ion, can be rationalized by initial deprotonation of 1H-1,2,3-triazole at the N1-H site and subsequent proton exchanges within the ion-molecule complex. The EA of the 2H-1,2,3-triazol-4-yl radical is 1.865 +/- 0.004 eV.

A singular enzymatic megacomplex from Bacillus subtilis.

Science.gov (United States)

Straight, Paul D; Fischbach, Michael A; Walsh, Christopher T; Rudner, David Z; Kolter, Roberto

2007-01-02

Nonribosomal peptide synthetases (NRPS), polyketide synthases (PKS), and hybrid NRPS/PKS are of particular interest, because they produce numerous therapeutic agents, have great potential for engineering novel compounds, and are the largest enzymes known. The predicted masses of known enzymatic assembly lines can reach almost 5 megadaltons, dwarfing even the ribosome (approximately 2.6 megadaltons). Despite their uniqueness and importance, little is known about the organization of these enzymes within the native producer cells. Here we report that an 80-kb gene cluster, which occupies approximately 2% of the Bacillus subtilis genome, encodes the subunits of approximately 2.5 megadalton active hybrid NRPS/PKS. Many copies of the NRPS/PKS assemble into a single organelle-like membrane-associated complex of tens to hundreds of megadaltons. Such an enzymatic megacomplex is unprecedented in bacterial subcellular organization and has important implications for engineering novel NRPS/PKSs.

HUBUNGAN ANTARA PARTISIPASI BIDAN PRAKTIK MANDIRI (BPM, PERJANJIAN KERJASAMA (PKS DAN SOSIALISASI DENGAN PELAKSANAAN PROGRAM JAMPERSAL DI KOTA BOGOR

Directory of Open Access Journals (Sweden)

Nawati Nawati

2016-04-01

Full Text Available Hubungan antara Partisipasi BPM, Perjanjian Kerjasama dan Sosialiasi dengan Pelaksanaan Program Jampersal di kota Bogor. Kesehatan merupakan bagian integal yang penting dalam pembangunan dan peningkatan kesejahteraan bangsa serta human capital investment baik jangka pendek maupun jangka panjang oleh karena itu pemerintah dalam suatu negara bertanggung jawab pada masalah kesehatan rakyatnya. Pemerintah sendiri adalah regulator dari penyelenggaraan pelayanan kesehatan untuk seluruh masyarakat, agar masyarakat mampu membayar kesehatan yang dibebankan kepadanya atau institusi tempat kerjanya. Tujuan penelitian ini adalah untuk diketahuinya hubungan antara Partisipasi BPM, Perjanjian Kerjasama dan Sosialiasi dengan Pelaksanaan Program Jampersal. Metode yang digunakan dalam penelitian ini adalah metode penelitian  analitik dengan pendekatan Cross sectional. Data dikumpulkan melalui wawancara dengan kuesioner pada bidan. Analisis data menggunakan uji Chi Square dan Regresi Logistik. Hasil analisis data didapatkan responden dengan OR:9,74 (95% CI:5,33-17,81 dan p-value= 0,000. Pada pendidikan responden mendapatkan nilai OR:4,56 (95% CI:3,22-16,24 dengan p-value= 0,000. Pada masa kerja responden dengan nilai OR:9,46 (95% CI:4,88-19,98 dengan p-value= 0,000. Pada karakteristik lama responden dengan OR: 66,93 (95% CI:5,89-173,07 dengan p-value= 0,000. Nilai sikap responden dengan OR:10,98 (95% CI:5,14-23,43 dengan p-value= 0,006. PKS dengan pelaksanakan Program Jampersal di Kota Bogor mempunyai nilai OR:9,46 (95% CI:4,48-19,98 dengan p-value= 0,000. Analisis multivariat ternyata variabel yang berhubungan bermakna dengan pelaksanaan program Jampersal adalah variabel PKS dengan nilai expB 3.833 p-value 0,036 dan sikap responden dengan nilai expB 3.032 dengan p-value 0,006. Dapat disimpulkan bahwa sikap responden memiliki perilaku positif dalam pelaksanaan Program Jampersal, variabel yang berhubungan bermakna dengan pelaksanaan Program Jampersal adalah

On the dose calculation at the cellular level and its implications for the RBE of {sup 99m}Tc and {sup 123}I

Energy Technology Data Exchange (ETDEWEB)

Freudenberg, R., E-mail: robert.freudenberg@uniklinikum-dresden.de; Runge, R.; Maucksch, U.; Berger, V.; Kotzerke, J. [University Hospital/Faculty of Medicine Carl Gustav Carus, Technische Universität Dresden, Department of Nuclear Medicine, Dresden, Saxony 01307 (Germany)

2014-06-15

Purpose: Based on the authors’ previous findings concerning the radiotoxicity of{sup 99m}Tc, the authors compared the cellular survival under the influence of this nuclide with that following exposure to the Auger electron emitter {sup 123}I. To evaluate the relative biological effectiveness (RBE) of both radionuclides, knowledge of the absorbed dose is essential. Thus, the authors present the dose calculations and discuss the results based on different models of the radionuclide distribution. Both different target volumes and the influence of the uptake kinetics were considered. Methods: Rat thyroid PC Cl3 cells in culture were incubated with either{sup 99m}Tc or {sup 123}I or were irradiated using 200 kV x-rays in the presence or absence of perchlorate. The clonogenic cell survival was measured via colony formation. In addition, the intracellular radionuclide uptake was quantified. Single-cell dose calculations were based on Monte Carlo simulations performed using Geant4. Results: Compared with external radiation using x-rays (D{sub 37} = 2.6 Gy), the radionuclides {sup 99m}Tc (D{sub 37} = 3.5 Gy), and {sup 123}I (D{sub 37} = 3.8 Gy) were less toxic in the presence of perchlorate. In the absence of perchlorate, the amount of activity a{sub 37} that was necessary to reduce the surviving fraction (SF) to 0.37 was 22.8 times lower for {sup 99m}Tc and 12.4 times lower for {sup 123}I because of the dose increase caused by intracellular radionuclide accumulation. When the cell nucleus was considered as the target for the dose calculation, the authors found a RBE of 2.18 for {sup 99m}Tc and RBE = 3.43 for {sup 123}I. Meanwhile, regarding the dose to the entire cell, RBE = 0.75 for {sup 99m}Tc and RBE = 1.87 for {sup 123}I. The dose to the entire cell was chosen as the dose criterion because of the intracellular radionuclide accumulation, which was found to occur solely in the cytoplasm. The calculated number of intracellular decays per cell was (975 ± 109) decays

Simultaneous X-ray, ultraviolet, and optical observations of the BL Lacertae object PKS 2155-304

International Nuclear Information System (INIS)

Treves, A.; Morini, M.; Chiappetti, L.; Fabian, A.; Falomo, R.

1989-01-01

A series of observations at optical, UV, and X-ray frequencies of PKS 2155-304, one of the brightest BL Lac objects is reported. Spectral fits given for various epochs show that the medium energy data are well fitted by single power laws plus absorption, with energy index between 1.5 and 2. Marginal evidence for an absorption edge at about 7 keV is found, as is evidence for some spectral depression at about 1 keV. This may be modeled with an edge at 660 + or - 26 eV with optical depth tau = 1.8 + or - 0.2. Energy distributions on several occasions are reconstructed, and the optical, UV, and X-ray intensities are found to be correlated in all cases but one. The variability amplitudes decrease and the time scales increase with decreasing frequency. These results indicate a synchrotron origin for the X-rays and distinct but connected emission regions for the X-ray, UV, and optical bands. 46 refs

Hot seeding using large Y-123 seeds

International Nuclear Information System (INIS)

Scruggs, S J; Putman, P T; Zhou, Y X; Fang, H; Salama, K

2006-01-01

There are several motivations for increasing the diameter of melt textured single domain discs. The maximum magnetic field produced by a trapped field magnet is proportional to the radius of the sample. Furthermore, the availability of trapped field magnets with large diameter could enable their use in applications that have traditionally been considered to require wound electromagnets, such as beam bending magnets for particle accelerators and electric propulsion. We have investigated the possibility of using large area epitaxial growth instead of the conventional point nucleation growth mechanism. This process involves the use of large Y123 seeds for the purpose of increasing the maximum achievable Y123 single domain size. The hot seeding technique using large Y-123 seeds was employed to seed Y-123 samples. Trapped field measurements indicate that single domain samples were indeed grown by this technique. Microstructural evaluation indicates that growth can be characterized by a rapid nucleation followed by the usual peritectic grain growth which occurs when large seeds are used. Critical temperature measurements show that no local T c suppression occurs in the vicinity of the seed. This work supports the suggestion of using an iterative method for increasing the size of Y-123 single domains that can be grown

12 CFR 225.123 - Activities closely related to banking.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Activities closely related to banking. 225.123 Section 225.123 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL... Holding Companies Interpretations § 225.123 Activities closely related to banking. (a) Effective June 15...

Labeling and quality control of 123I-MIBG

International Nuclear Information System (INIS)

Figols de Barboza, Marycel Rosa

2002-01-01

This report describes a method to facilitate routine production of 123 I-MIBG in Radiopharmacy Centre of IPEN-CNEN/SP. Iodine-123 radioisotope is produced in the form of sodium iodide in Cyclone-30 (IBA) at IPEN-CNEN/SP through proton irradiation of gaseous 124 Xe target. The labelling procedure uses MIBG-sulphate and leads to 123 I-MIBG with radiochemical purity at least 98% and specific activity of 300-380 MBq/mg

Dicty_cDB: SFC123 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFC123 (Link to dictyBase) - - - Contig-U16368-1 SFC123E (Link...) Clone ID SFC123 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Ori...CVPHHDGCGNIQCPWGHYCVNEHGKCRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICT...CRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICTIINGHPTCIR...(bits) Value N D13973 |D13973.1 Dictyostelium discoideum DNA for Dp87 protein, complete cds. 1643 0.0 5 BJ17

The effect of aging and smoking on N-isopropyl-p-[123I]iodoamphetamine (123I-IMP) accumulation in the human lung

International Nuclear Information System (INIS)

Hara, Masafumi; Tomiguchi, Seiji; Kojima, Akihiro; Nakashima, Rumi; Ooyama, Youichi; Takahashi, Mutsumasa; Matsumoto, Masanori.

1994-01-01

123 I-IMP clearance on dynamic lung scintigraphy was studied by two exponential compartments analysis in order to evaluate the effects of aging and smoking on the pulmonary function. Twenty-four patients (14 smokers and 10 non-smokers), referred for 123 I-IMP brain perfusion study, underwent lung dynamic scintigraphy for 42 min immediately after 123 I-IMP injection. In the non-smoking group 123 I-IMP lung clearance was delayed with aging. A significant correlation was found between aging and clearance rate in the lung. There was also a significant difference in the clearance rates between smoker and non-smoker groups. These findings suggest that smoking and aging affect the pulmonary function. (author)

Recent developments in the field of 123I-radiopharmaceuticals

International Nuclear Information System (INIS)

Machulla, H.J.; Knust, E.J.

1984-01-01

Due to its advantageous nuclear physical properties iodine-123 is an excellent label for radiopharmaceuticals very well suited for measurements by γ-cameras and single-photon emission tomography. The development of 123 I-radiopharmaceuticals should be based on a clear biochemical concept, reliable labelling procedures and careful pharmacokinetic studies in order to evaluate the physiological behaviour of the radioiodinated compounds being analogues of metabolic substrates. The development of 123 I-labelled fatty acids and biogenic amines clearly proved the successful use of 123 I for labelling compounds applied in medical diagnosis. (orig.) [de

40 CFR 123.46 - Individual control strategies.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Individual control strategies. 123.46... PROGRAM REQUIREMENTS Transfer of Information and Permit Review § 123.46 Individual control strategies. (a..., approval, and implementation an individual control strategy for each point source identified by the State...

Investigation of 123I production using electron accelerator

International Nuclear Information System (INIS)

Avetisyan, Albert; Avagyan, Robert; Dallakyan, Ruben; Avdalyan, Gohar; Dobrovolsky, Nikolay; Gavalyan, Vasak; Kerobyan, Ivetta; Harutyunyan, Gevorg

2017-01-01

The possibility of 123 I isotope production with the help of the high-intensity bremsstrahlung photons produced by the electron beam of the LUE50 linear electron accelerator at the A.I. Alikhanyan National Science Laboratory (Yerevan Physics Institute [YerPhI]) is considered. The production method has been established and shown to be successful. The 124 Xe(γ,n) 123 Xe → 123 I nuclear reaction has been investigated and the cross-section was calculated by nuclear codes TALYS 1.6 and EMPIRE 3.2. The optimum parameter of the thickness of the target was determined by GEANT4 code. For the normalized yield of 123 I, the value of 143 Bq/(mg·μA·h) has been achieved.

Assessment of cerebral benzodiazepine receptor distribution in anxiety disorders by {sup 123}I-iomazenil-SPECT. Comparison to cerebral perfusion scintigraphy by {sup 123}I-IMP

Energy Technology Data Exchange (ETDEWEB)

Uchiyama, Mayuki; Sue, Hironari; Fukumitsu, Nobuyoshi; Mori, Yutaka; Kawakami, Kenji [Jikei Univ., Tokyo (Japan). School of Medicine

1997-01-01

{sup 123}I-Iomazenil ({sup 123}I-IMZ) and {sup 123}I-IMP imaging were performed in 5 patients with anxiety disorder (PAD) and 6 normal volunteers (NV). On {sup 123}I-IMZ delayed imaging, the 2 PAD showed abnormally decreased findings. In anxiety disorder, decreased accumulation on {sup 123}I-IMZ delayed images was seen in left hippocampus and parahippocampal gyrus in one patient, in right frontal and temporal lobe and left occipital pole in the other. Compared with NV, PAD had lower {sup 123}I-IMZ uptake on delayed image in right upper and left lower frontal cortices, indicating the involvement of the benzodiazepine receptor complex in anxiety disorder. Compared with grading for anxiety disorder with Hamilton anxiety scale (HAS) and delayed to early count ratios of {sup 123}I-IMZ, negative correlation (R<-0.7) was recognized hippocampus and parahippocampal gyrus, frontal and occipital cortices. Compared between HAS and the count ratio to the cerebellum on {sup 123}I-IMP image, positive correlation (R>0.7) was recognized in the hippocampus, the parahippocampal gyrus, the lower outer temporal cortex and the lower frontal cortex. (author)

The z = 1.6748 C I Absorber Toward the QSO PKS 1756+237

Science.gov (United States)

Roth, Katherine C.; Bauer, James M.; Jim, Kevin T. C.

We have detected C I ground-state absorption at zabs = 1.6748 toward the QSO PKS 1756+237 (zem = 1.725), making this only the fourth known C I QSO absorber. The absence of excited-state fine-structure C I lines is compatible with the redshifted Cosmic Microwave Background Radiation at an expected temperature of TCMBR (1+z) = 7.291 K (Mather et al. 1994, ApJ, 354, L37). We find a 2 σ upper-limit on the C I excitation temperature of Tex <= 7.73(+0.53, -0.46) K (Roth & Bauer 1999, ApJ, submitted). Our Keck HIRES spectra (8.3 km s-1 FWHM) obtained in May 1997 also reveal the existence of Ni II and Fe II lines with a sub-solar Ni/Fe abundance ratio, presumably indicative of dust. We have obtained deep, high resolution (0.3'' FWHM) images in H+K' with the UH 2.2m Tip-Tilt system of the QSO field in order to identify the system responsible for the zabs = 1.6748 absorption. We detect two faint candidate systems within 1.5'' and 3'' (≅ 15 and 30 kpc, Hcirc = 65) of the QSO.

7 CFR 1955.123 - Sale procedures (chattel).

Science.gov (United States)

2010-01-01

... 7 Agriculture 14 2010-01-01 2009-01-01 true Sale procedures (chattel). 1955.123 Section 1955.123 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS... be notified of the opportunity to appeal in accordance with subpart B of part 1900 of this chapter...

40 CFR 123.23 - Attorney General's statement.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Attorney General's statement. 123.23... PROGRAM REQUIREMENTS State Program Submissions § 123.23 Attorney General's statement. (a) Any State that seeks to administer a program under this part shall submit a statement from the State Attorney General...

9 CFR 113.123 - Salmonella Dublin Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Dublin Bacterin. 113.123... Inactivated Bacterial Products § 113.123 Salmonella Dublin Bacterin. Salmonella Dublin Bacterin shall be prepared from a culture of Salmonella dublin which has been inactivated and is nontoxic. Each serial of...

16 CFR 1.23 - Quantity limit rules.

Science.gov (United States)

2010-01-01

... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Quantity limit rules. 1.23 Section 1.23 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE GENERAL... Robinson-Patman Act. These rules have the force and effect of law. [32 FR 8444, June 13, 1967. Redesignated...

V123 Beam Synchronous Encoder Module

International Nuclear Information System (INIS)

Kerner, T.; Conkling, C. R.; Oerter, B.

1999-01-01

The V123 Synchronous Encoder Module transmits events to distributed trigger modules and embedded decoders around the RHIC rings where they are used to provide beam instrumentation triggers [1,2,3]. The RHIC beam synchronous event link hardware is mainly comprised of three VMEbus board designs, the central input modules (V201), and encoder modules (V123), and the distributed trigger modules (V124). Two beam synchronous links, one for each ring, are distributed via fiberoptic and fanned out via twisted wire pair cables. The V123 synchronizes with the RF system clock derived from the beam bucket frequency and a revolution fiducial pulse. The RF system clock is used to create the beam synchronous event link carrier and events are synchronized with the rotation fiducial. A low jitter RF clock is later recovered from this carrier by phase lock loops in the trigger modules. Prioritized hardware and software triggers fill up to 15 beam event code transmission slots per revolution while tracking the ramping RF acceleration frequency and storage frequency. The revolution fiducial event is always the first event transmitted which is used to synchronize the firing of the abort kicker and to locate the first bucket for decoders distributed about the ring

Iodine-123 metaiodobenzylguanidine scintigraphy and iodine-123 ioflupane single photon emission computed tomography in Lewy body diseases: complementary or alternative techniques?

Science.gov (United States)

Treglia, Giorgio; Cason, Ernesto; Cortelli, Pietro; Gabellini, Anna; Liguori, Rocco; Bagnato, Antonio; Giordano, Alessandro; Fagioli, Giorgio

2014-01-01

To compare myocardial sympathetic imaging using (123)I-Metaiodobenzylguanidine (MIBG) scintigraphy and striatal dopaminergic imaging using (123)I-Ioflupane (FP-CIT) single photon emission computed tomography (SPECT) in patients with suspected Lewy body diseases (LBD). Ninety-nine patients who performed both methods within 2 months for differential diagnosis between Parkinson's disease (PD) and other parkinsonism (n = 68) or between dementia with Lewy bodies (DLB) and other dementia (n = 31) were enrolled. Sensitivity, specificity, accuracy, positive and negative predictive values of both methods were calculated. For (123) I-MIBG scintigraphy, the overall sensitivity, specificity, accuracy, positive and negative predictive values in LBD were 83%, 79%, 82%, 86%, and 76%, respectively. For (123)I-FP-CIT SPECT, the overall sensitivity, specificity, accuracy, positive and negative predictive values in LBD were 93%, 41%, 73%, 71%, and 80%, respectively. There was a statistically significant difference between these two methods in patients without LBD, but not in patients with LBD. LBD usually present both myocardial sympathetic and striatal dopaminergic impairments. (123)I-FP-CIT SPECT presents high sensitivity in the diagnosis of LBD; (123)I-MIBG scintigraphy may have a complementary role in differential diagnosis between PD and other parkinsonism. These scintigraphic methods showed similar diagnostic accuracy in differential diagnosis between DLB and other dementia. Copyright © 2012 by the American Society of Neuroimaging.

50 CFR 14.123 - Care in transit.

Science.gov (United States)

2010-10-01

... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false Care in transit. 14.123 Section 14.123 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR TAKING... transit. (a) A primate shall be observed for signs of distress and given food and water according to the...

27 CFR 22.123 - Losses on premises.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Losses on premises. 22.123... OF THE TREASURY LIQUORS DISTRIBUTION AND USE OF TAX-FREE ALCOHOL Losses § 22.123 Losses on premises. (a) Recording of losses. A permittee shall determine and record, in the records prescribed by subpart...

17 CFR 12.3 - Business address; hours.

Science.gov (United States)

2010-04-01

... REPARATIONS General Information and Preliminary Consideration of Pleadings § 12.3 Business address; hours. The... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Business address; hours. 12.3..., DC 20581. It is open each day, except Saturdays, Sundays, and legal public holidays, from 8:15 a.m...

Medical necessity for shorter lived radionuclides, specifically pure Iodine-123

International Nuclear Information System (INIS)

DeNardo, G.L.; DeNardo, S.J.; Hines, H.H.; Lagunas-Solar, M.C.; Jungerman, J.A.

1985-01-01

Iodine-123 has physical and radiochemical characteristics ideal for most tracer procedures performed in patients. Its use is generally preferable to the use of 131 I for diagnosis. The potential for 123 I can be realized only if a radiopharmaceutical of lesser radionuclide contamination is generally and economically available. Iodine-123 produced by direct methods has significant disadvantages relative to quality of procedure and radiation dosimetry. Our experience with 123 I(p,5n) during the past 12 years causes us to vigorously encourage general availability of an 123 I radiopharmaceutical of this quality. Using this product, the authors have prepared radiopharmaceuticals for use in the study of cancer, coagulation, and renal and thyroid diseases

40 CFR 90.123 - Denial, revocation of certificate of conformity.

Science.gov (United States)

2010-07-01

... conformity. 90.123 Section 90.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Emission Standards and Certification Provisions § 90.123 Denial, revocation of certificate of conformity... conformity if the Administrator finds any one of the following infractions to be substantial: (1) The engine...

Radioiodinated Rhodamine-123: a potential cationic hepatobiliary imaging agent

International Nuclear Information System (INIS)

Moonen, P.; Gorree, G.C.M.; Hoekstra, A.

1987-01-01

The labelling of the cationic dye Rhodamine-123 with 125 I is described. The biodistribution of the iodinated Rhodamine-123 has been determined at different time intervals after intravenous injection into fasted rats. It turned out that the dye is predominantly cleared by the liver and discharged into the bile. The bile acid taurocholate did not enhance the rate of excretion of 125 I-Rhodamine-123. (author)

21 CFR 123.11 - Sanitation control procedures.

Science.gov (United States)

2010-04-01

... records are subject to the requirements of § 123.9. (d) Relationship to HACCP plan. Sanitation controls may be included in the HACCP plan, required by § 123.6(b). However, to the extent that they are monitored in accordance with paragraph (b) of this section they need not be included in the HACCP plan, and...

Imaging with 123I labelled fatty acids

International Nuclear Information System (INIS)

Dudczak, R.

1985-01-01

This report describes the clinical results obtained with radioiodinated aromatic and aliphatic fatty acids. The radiopharmaceuticals were 123 I labelled p-phenylpentadecanoic (p-IPPA) and 123 I labelled heptadecanoic acid (HDA). The possibility to evaluate the myocardial metabolic function in man noninvasively add a complementary diagnostic tool in the clinical follow-up of patients with heart disease. (Auth.)

Human absorbed dose calculations for 123I labeled phenyl pentadecanoic acid

International Nuclear Information System (INIS)

Kulkarni, P.V.; Clark, G.; Corbett, J.R.; Willerson, J.T.; Parkey, R.W.

1986-01-01

I-123 labeled fatty acids have been proposed for studying myocardial metabolism by scintigraphic methods. With the availability of clean I-123 and the advent of single photon emission tomography, I-123 labeled fatty acids would be well suited to study regional myocardial viability or metabolism in humans. The authors have studied I-125 and I-123 labeled iodophenyl pentadecanoic acid (IPPA) in rats and dogs. Clinical studies are in progress with I-123 (IPPA). They have studied the pharmacokinetics of this tracer in male Sprague-Dawley rats at 0.25, 0.5, 1, 3, 6, and 24 hours postinjection. The cumulated doses, due to both pure I-123 and a version contaminated with 1.4% I-125, in various organs and the total body in humans are estimated. The average dose to organs for humans injected with I-123 IPPA with pure I-123 and contaminated I-123 respectively, are (rads to organ per mCi injected): heart wall (0.0507, 0.0514), liver (0.0792, 0.0875), kidneys (0.0479, 0.0561), thyroid (0.0517, 0.0638), ovaries (0.0427, 0.0561), testes (0.0307, 0.0309), total body (0.0386, 0.0392). 12 references, 9 figures, 5 tables

Dynamic myocardial scintigraphy with 123I-labelled free fatty acids

International Nuclear Information System (INIS)

Wall, E.E. van der.

1981-01-01

In this thesis, long-chain radioiodinated free fatty acids ( 123 I-FFA), 16-iodo- 123 I-cis-Δ 9 -hexadecenoic acid ( 123 I-HA) and 17-iodo- 123 I-heptade-canoic acid ( 123 I-Hsup(o)A), were employed for myocardial scintigraphy in patients with coronary artery disease. The results indicate that clearance of 123 I-FFA from the myocardium is dependent on the nature of ischemic injury. Clearance is delayed if the injury is reversible and accelerated in case of irreversible ischemia. Mechanisms responsible for divergent behaviour of FFA in patients with acute myocardial infarction versus patients with angina pectoris are purely speculative. This differential clearance from normally perfused, transiently ischemic and infarcted myocardium has practical application. The test provides a means to assess the nature of ischemic injury rapidly. These findings may have major consequences for logical management of patients presenting with chest pain and suspected coronary artery disease. (Auth.)

(123I)-IMP SPECT findings in Machado-Joseph disease

International Nuclear Information System (INIS)

Suzuki, Masahiko

1997-01-01

Single photon emission computed tomography (SPECT) with N-isopropyl-p-( 123 I)iodoamphetamine (IMP) was used to study the dynamics of cerebellar and brainstem metabolic function in patients with Mochado-Joseph disease (MJD), the diagnosis of which was confirmed with genetic analysis. The SPECT data obtained was analyzed semiquantitatively. In patients with MJD, ( 123 I)-IMP accumulation in the cerebellum and brainstem was decreased, and the degree of decrease reflected the clinical severity of MJD. When MJD was mild, the decrease in ( 123 I)-IMP accumulation was much greater in the brainstem than in the cerebellum. However, the decrease in ( 123 I)-IMP accumulation in the cerebellum and brainstem was not correlated with the severity of atrophy or with the number of CAG repeats. ( 123 I)-IMP SPECT was useful for evaluating the decrease in cerebellum and brainstem function in patients with MJD. Results of this study suggest that the functional decrease in MJD may begin in the brainstem. (author)

[11 C]Rhodamine-123: Synthesis and biodistribution in rodents

International Nuclear Information System (INIS)

Bao Xiaofeng; Lu Shuiyu; Liow, Jeih-San; Morse, Cheryl L.; Anderson, Kacey B.; Zoghbi, Sami S.; Innis, Robert B.; Pike, Victor W.

2012-01-01

Introduction: Rhodamine-123 is a known substrate for the efflux transporter, P-glycoprotein (P-gp). We wished to assess whether rhodamine-123 might serve as a useful substrate for developing probes for imaging efflux transporters in vivo with positron emission tomography (PET). For this purpose, we aimed to label rhodamine-123 with carbon-11 (t 1/2 = 20.4 min) and to study its biodistribution in rodents. Methods: [ 11 C]Rhodamine-123 was prepared by treating rhodamine-110 (desmethyl-rhodamine-123) with [ 11 C]methyl iodide. The biodistribution of this radiotracer was studied with PET in wild-type mice and rats, in efflux transporter knockout mice, in wild-type rats pretreated with DCPQ (an inhibitor of P-gp) or with cimetidine (an inhibitor of organic cation transporters; OCT), and in P-gp knockout mice pretreated with cimetidine. Unchanged radiotracer in forebrain, plasma and peripheral tissues was also measured ex vivo at 30 min after radiotracer administration to wild-type and efflux transporter knockout rodents. Results: [ 11 C]Rhodamine-123 was obtained in 4.4% decay-corrected radiochemical yield from cyclotron-produced [ 11 C]carbon dioxide. After intravenous administration of [ 11 C]rhodamine-123 to wild-type rodents, PET and ex vivo measurements showed radioactivity uptake was very low in brain, but relatively high in some other organs such as heart, and especially liver and kidney. Inhibition of P-gp increased uptake in brain, heart, kidney and liver, but only by up to twofold. Secretion of radioactivity from kidney was markedly reduced by OCT knockout or pretreatment with cimetidine. Conclusions: [ 11 C]Rhodamine-123 was unpromising as a PET probe for P-gp function and appears to be a strong substrate of OCT in kidney. Cimetidine appears effective for blocking OCT in kidney in vivo.

40 CFR 91.123 - Denial, revocation of certificate of conformity.

Science.gov (United States)

2010-07-01

... conformity. 91.123 Section 91.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Certification Provisions § 91.123 Denial, revocation of certificate of conformity. (a) If, after review of the... conformity if the Administrator finds any one of the following infractions to be substantial: (1) The engine...

Myocardial kinetics of 123I-labeled-16-hexadecanoic acid

International Nuclear Information System (INIS)

Okada, R.D.; Elmaleh, D.; Werre, G.S.; Strauss, H.W.; Massachusetts General Hospital, Boston

1983-01-01

To determine if the myocardial clearance of omega 123 I-16-hexadecanoic acid ( 123 I-HDA) is affected by decreased coronary blodood flow, six anesthetized dogs had partial occlusion of the left anterior descending coronary artery. One hour later, 113 Sn-microspheres were injected into the left atrium, followed immediately by the IV administration of 123 I-HDA. Following injection, regional myocardial 123 I activities were monitored continuously with miniature cadmium telluride radiation detectors placed against the endocardium in both ischemic and nonischemic zones. After 3 h continuous monitoring, 46 Sc-microspheres were injected into the left atrium and the dogs were killed. Ischemic and nonischemic areas of myocardium were sectioned and counted in a well counter. (orig./WL)

Iodine-123 and bromine-75 production and development program at Juelich

International Nuclear Information System (INIS)

Stoecklin, G.

1985-01-01

The iodine-123 and bromine-75 production and development program at the Nuclear Research Center in Juelich as of 1982 is described, and examples of recent 123 I- and 75 Br-analogue tracers that have been developed to the level of clinical trial are given. Iodine-123 is produced via the 127 I(d,6n) 123 Xe → 123 I process and by the 124 Te(p,2n) 123 I and 122 Te(d,n) 123 I reactions. These production methods are critically reviewed. Bromine-75-labeled benzodiazenes have been prepared for in vivo mapping of benzodiazepine receptor sites. The 7-( 75 Br)-5-(2-fluorophenyl)-1-methyl-1,3-dihydro-2H-1,4-benzodiazepine-2-one (BFB) was prepared with a specific activity of > 10 4 Ci/mmole. Finally, preparation and applications of the halogenated amino acid L-3-( 123 I)-iodo-α-methyltyrosine (IMT) and the analogous 75 Br compound (BMT) are reported. Both IMT and BMT have been successfully applied for pancreas imaging and tomography, and IMT has been used for imaging both melanotic and amelanotic malignant melanoma of the eye

123I research and production at Brookhaven

International Nuclear Information System (INIS)

Mausner, L.F.; Srivastava, S.C.; Mirzadeh, S.; Meinken, G.E.; Prach, T.

1985-01-01

The procedures for preparing high purity 123 I at the BLIP using the 127 I(p,5n) 123 Xe reaction on an NaI target are described. The activity is supplied in a glass ampoule with anhydrous 123 I deposited on the interior walls, allowing maximum flexibility in subsequent iodinations. Preliminary experience with a continuous flow target is also described. The results of a series of measurements of specific activity by neutron activation, x-ray fluorescence, uv absorption, and wet chemistry generally showed no detectable carrier. HPLC methods to analyse the chemical form of radioiodine and to characterize various iodinated radiopharmaceuticals have been developed. These methods provide higher sensitivity, speed and resolution than commonly used techniques. 19 refs., 6 figs., 2 tabs

Melt processing of Yb-123 tapes

International Nuclear Information System (INIS)

Athur, S. P.; Balachandran, U.; Salama, K.

2000-01-01

The innovation of a simple, scalable process for manufacturing long-length conductors of HTS is essential to potential commercial applications such as power cables, magnets, and transformers. In this paper the authors demonstrate that melt processing of Yb-123 tapes made by the PIT route is an alternative to the coated conductor and Bi-2223 PIT tape fabrication techniques. Ag-clad Yb-123 tapes were fabricated by groove rolling and subsequently, melt processed in different oxygen partial pressures in a zone-melting furnace with a gradient of 140 C/cm. The transition temperatures measured were found to be around 81 K undermost processing conditions. EPMA of the tapes processed under different conditions show the 123 phase to be Ba deficient and Cu and Yb rich. Critical current was measured at various temperatures from 77 K to 4.2 K. The J c increased with decrease in pO 2 . The highest I c obtained was 52 A at 4.2 K

49 CFR 37.123 - ADA paratransit eligibility: Standards.

Science.gov (United States)

2010-10-01

... 49 Transportation 1 2010-10-01 2010-10-01 false ADA paratransit eligibility: Standards. 37.123... INDIVIDUALS WITH DISABILITIES (ADA) Paratransit as a Complement to Fixed Route Service § 37.123 ADA... complementary paratransit service shall provide the service to the ADA paratransit eligible individuals...

EVIDENCE FOR TWO LOGNORMAL STATES IN MULTI-WAVELENGTH FLUX VARIATION OF FSRQ PKS 1510-089

Energy Technology Data Exchange (ETDEWEB)

Kushwaha, Pankaj; Misra, Ranjeev [Inter University Center for Astronomy and Astrophysics, Pune 411007 (India); Chandra, Sunil; Singh, K. P. [Department of Astronomy and Astrophysics, Tata Institute of Fundamental Research, Mumbai 400005 (India); Sahayanathan, S. [Astrophysical Sciences Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Baliyan, K. S., E-mail: pankajk@iucaa.in [Physical Research Laboratory, Ahmedabad 380009 (India)

2016-05-01

We present a systematic characterization of multi-wavelength emission from blazar PKS 1510-089 using well-sampled data at near-infrared (NIR), optical, X-ray, and γ -ray energies. The resulting flux distributions, except at X-rays, show two distinct lognormal profiles corresponding to a high and a low flux level. The dispersions exhibit energy-dependent behavior except in the LAT γ -ray and optical B-band. During the low level flux states, it is higher toward the peak of the spectral energy distribution, with γ -ray being intrinsically more variable followed by IR and then optical, consistent with mainly being a result of varying bulk Lorentz factor. On the other hand, the dispersions during the high state are similar in all bands except the optical B-band, where thermal emission still dominates. The centers of distributions are a factor of ∼4 apart, consistent with anticipation from studies of extragalactic γ -ray background with the high state showing a relatively harder mean spectral index compared to the low state.

I-123 IMP SPECT in Parkinson's disease

International Nuclear Information System (INIS)

Kawabata, Keita; Tachibana, Kyudai; Sugita, Minoru

1990-01-01

To examine semiquantitatively regional cerebral blood flow, SPECT with N-isopropyl-p-[I-123]iodoamphetamine (I-123 IMP) was undertaken in 17 patients with Parkinson's disease. Seven patients with Alzheimer's disease and 9 senile control subjects were also imaged for comparison. Both the Parkinson's disease group and the Alzheimer's disease group had a decreased uptake of I-123 IMP in the frontal lobe, in comparison with the control group. A remarkably decreased uptake was seen in the lateral and parietal lobes in the group of Parkinson's disease associated with dementia, as well as in the Alzheimer's disease group. A significantly decreased uptake was observed in the frontal lobe, lateral lobe, thalamus, and basal ganglia in the Parkinson's disease group, irrespective of the presence or absence of dementia. For Parkinson's disease associated with dementia, there was much more significant decrease in I-123 IMP uptake. The pattern of regional cerebral blood flow in the Alzheimer's disease group was analogous to that in the Parkinson's disease group associated with dementia. This supports the hypothesis that Alzheimer's disease may be somewhat involved in the occurrence of dementia for Parkinson's disease. (N.K.)

Decreased ipsilateral [123I]iododexetimide binding to cortical muscarinic receptors in unilaterally 6-hydroxydopamine lesioned rats

International Nuclear Information System (INIS)

Knol, Remco J.J.; Bruin, Kora de; Opmeer, Brent; Voorn, Pieter; Jonker, Allert J.; Eck-Smit, Berthe L.F. van; Booij, Jan

2014-01-01

Introduction: Dysfunction of the cholinergic neurotransmitter system is present in Parkinson’s disease, Parkinson’s disease related dementia and dementia with Lewy bodies, and is thought to contribute to cognitive deficits in these patients. In vivo imaging of the cholinergic system in these diseases may be of value to monitor central cholinergic disturbances and to select cases in which treatment with cholinesterase inhibitors could be beneficial. The muscarinic receptor tracer [ 123 I]iododexetimide, predominantly reflecting M 1 receptor binding, may be an appropriate tool for imaging of the cholinergic system by means of SPECT. In this study, we used [ 123 I]iododexetimide to study the effects of a 6-hydroxydopamine lesion (an animal model of Parkinson’s disease) on the muscarinic receptor availability in the rat brain. Methods: Rats (n = 5) were injected in vivo at 10–13 days after a confirmed unilateral 6-hydroxydopamine lesion. Muscarinic receptor availability was measured bilaterally in multiple brain areas on storage phosphor images by region of interest analysis. Results: Autoradiography revealed a consistent and statistically significant lower [ 123 I]iododexetimide binding in all examined neocortical areas on the ipsilateral side of the lesion as compared to the contralateral side. In hippocampal and subcortical areas, such asymmetry was not detected. Conclusions: This study suggests that evaluation of muscarinic receptor availability in dopamine depleted brains using [ 123 I]iododexetimide is feasible. We conclude that 6-hydroxydopamine lesions induce a decrease of neocortical muscarinic receptor availability. We hypothesize that this arises from down regulation of muscarinic postsynaptic M 1 receptors due to hyperactivation of the cortical cholinergic system in response to dopamine depletion. Advances in knowledge: In rats, dopamine depletion provokes a decrease in neocortical muscarinic receptor availability, which is evaluable by [ 123 I

23 CFR 771.123 - Draft environmental impact statements.

Science.gov (United States)

2010-04-01

... 23 Highways 1 2010-04-01 2010-04-01 false Draft environmental impact statements. 771.123 Section... ENVIRONMENT ENVIRONMENTAL IMPACT AND RELATED PROCEDURES § 771.123 Draft environmental impact statements. (a) A... significant impacts on the environment. When the applicant, after consultation with any project sponsor that...

[sup 123]I-iodobenzoylglucosamines: glucose analogues for heart imaging

Energy Technology Data Exchange (ETDEWEB)

Lutz, T [British Columbia Univ., Vancouver, BC (Canada). Dept. of Pharmaceutical Sciences; Dougan, H [TRIUMF, Vancouver, BC (Canada); Rihela, T; Vo, C V [Vancouver General Hospital (Canada). Div. of Nuclear Medicine; Lyster, D M [British Columbia Univ., Vancouver, BC (Canada). Dept. of Pharmaceutical Sciences Vancouver General Hospital (Canada). Div. of Nuclear Medicine

1993-01-01

The ortho-, meta- and para-[[sup 123]I]-2-deoxy-2-N-(iodobenzoyl)-D-glucosamine (BGA) derivatives were investigated to determine the effect of iodine position and lipophilicity on tissue distribution. There was no correlation between tissue uptake and lipophilicity. Maximum uptake was observed for o-BGA displaying a heart:blood ratio of 36.0 at 18 hours post injection. Yeast hexokinase phosphorylation studies in vitro and an in vivo insulin experiment were carried out on o-BGA. No phosphorylation was detected, but the insulin study indicated that o-BGA uses the glucose transporter. o-BGA showed maximum tissue uptake in mice at an optimal specific activity of 0.004mg/[mu]Ci. Mouse biodistribution studies of o-[[sup 123]I]-iodobenzamide(o-[sup 123]IBA) indicated that the glucose moiety of o-BGA may be involved in the heart accumulation process in mice. Heart tissue extraction studies showed unmetabolized o-[[sup 123]I]BGA was the predominant species. A rabbit image of o-[[sup 123]I]BGA, recorded at 14 hours post injection, showed significant heart uptake. (author).

21 CFR 123.5 - Current good manufacturing practice.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Current good manufacturing practice. 123.5 Section...) FOOD FOR HUMAN CONSUMPTION FISH AND FISHERY PRODUCTS General Provisions § 123.5 Current good manufacturing practice. (a) Part 110 of this chapter applies in determining whether the facilities, methods...

19 CFR 123.41 - Truck shipments transiting Canada.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Truck shipments transiting Canada. 123.41 Section... OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO United States and Canada In-Transit Truck Procedures § 123.41 Truck shipments transiting Canada. (a) Manifest required. Trucks with merchandise...

7 CFR 457.123 - Almond crop insurance provisions.

Science.gov (United States)

2010-01-01

... 7 Agriculture 6 2010-01-01 2010-01-01 false Almond crop insurance provisions. 457.123 Section 457... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.123 Almond crop insurance provisions. The Almond Crop Insurance Provisions for the 2008 and succeeding crop years are as follows: FCIC...

I-123-insulin: A new marker for hepatoma

International Nuclear Information System (INIS)

Sodoyez, J.C.; Goffaux, F.S.; Fallais, C.; Bourgeois, P.

1984-01-01

Previous studies have demonstrated that carrier-free I-123-Tyr Al4 insulin was taken up by the liver (by a saturable mechanism) and by the kidneys (by a non saturable mechanism). Autoradiographs of rat liver after injection of I-125-insulin showed that binding specifically occurred at the plasma membrane of the hepatocytes. I-123-Insulin binding to the hepatocyte plasma membrane appeared mediated by specific receptors. Indeed it was blocked by antibodies to the insulin receptors and by an excess of native insulin. Futhermore insulin derivatives with low biological potency (proinsulin and desoctapeptide insulin) did not inhibit I-123-insulin binding to the hepatocytes. I-123-Insulin (1.3 mCi) was I.V. injected into a patient in whom the right liver lobe was normal (normal uptake of Tc-99m-colloid sulfur) but the left liver lobe was occupied by a voluminous hepatoma (no uptake of Tc-99m-colloid sulfur). Liver blood supply was also studied by Tc-99m-pyrophosphate-labeled red cells. Computer analysis of the data revealed that compared to the normal liver lobe, binding of I-123-insulin to the hepatoma was more precocious (vascularization through the hepatic artery and not the portal vein), more intense and more prolonged (half-lives were 6 min in the normal liver and 14 min in the hepatoma). These results are consistent with characteristics of hepatoma cells in culture in which high insulin binding capacity contrasts with a markedly decreased insulin degrading activity. It is concluded that I-123-insulin may be used as a specific marker of hepatoma in man

Switchable Synthesis of 4,5-Functionalized 1,2,3-Thiadiazoles and 1,2,3-Triazoles from 2-Cyanothioacetamides under Diazo Group Transfer Conditions.

Science.gov (United States)

Filimonov, Valeriy O; Dianova, Lidia N; Galata, Kristina A; Beryozkina, Tetyana V; Novikov, Mikhail S; Berseneva, Vera S; Eltsov, Oleg S; Lebedev, Albert T; Slepukhin, Pavel A; Bakulev, Vasiliy A

2017-04-21

High yield solvent-base-controlled, transition metal-free synthesis of 4,5-functionalized 1,2,3-thiadiazoles and 1,2,3-triazoles from 2-cyanothioacetamides and sulfonyl azides is described. Under diazo transfer conditions in the presence of a base in an aprotic solvent 2-cyanothioacetamides operating as C-C-S building blocks produce 5-amino-4-cyano-1,2,3-thiadiazoles exclusively. The use of alkoxide/alcohol system completely switches the reaction course due to the change of one of the reaction centers in the 2-cyanothioacetamide (C-C-N building block) resulting in the formation of 5-sulfonamido-1,2,3-triazole-4-carbothioamide sodium salts as the only products. The latter serve as good precursors for 5-amino-1,2,3-thiadiazole-4-carboximidamides, the products of Cornforth-type rearrangement occurring in neutral protic medium or under acid conditions. According to DFT calculations (B3LYP/6-311+G(d,p)) the rearrangement proceeds via intermediate formation of a diazo compound, and can be catalyzed by acids via the protonation of oxygen atom of the sulfonamide group.

14 CFR 415.123 - Computing systems and software.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Computing systems and software. 415.123... Launch Vehicle From a Non-Federal Launch Site § 415.123 Computing systems and software. (a) An applicant's safety review document must describe all computing systems and software that perform a safety...

Diagnosis of pheochromocytoma using (123I)-compared with (131I)-metaiodobenzylguanidine scintigraphy

International Nuclear Information System (INIS)

Furuta, Nozomu; Kiyota, Hiroshi; Yoshigoe, Fukuo; Hasegawa, Norio; Ohishi, Yukihiko

1999-01-01

Patient with pheochromocytoma (PCT) cannot be cured without operation, therefore, preoperative determination of the localization of PCT should be performed accurately. ( 131 I)-Metaiodobenzylguanidine (MIBG) scintigraphy is a gold standard for the diagnosis of PCT. However, ( 123 I)-MIBG is also found to accumulate in PCT. In order to clarify the usefulness of ( 123 I)-MIBG scintigraphy for the local detection of PCT, we compared the distribution of ( 123 I)- and ( 131 I)-MIBG in patients with or without PCT. ( 131 I)- and ( 123 I)-MIBG scintigraphy was performed in 29 and 16 patients, respectively. In the former group, 14 patients had PCT, 12 had hypertension without any adrenal disorder and three had other diseases. In the latter group, eight patients had PCT, two had hypertension without any adrenal disorder and six had other diseases. The sensitivity, specificity and accuracy of ( 123 I)- with ( 131 I)-MIBG scintigraphy were compared. The sensitivity of ( 131 I)- and ( 123 I)-MIBG scintigraphy was 85.7 and 90%, respectively. The specificity of each test was 100%. The accuracy of ( 131 I)- and ( 123 I)-MIBG scintigraphy was 93.1 and 95%, respectively. The quality of images obtained using ( 123 I)-MIBG was better than with ( 131 I)-MIBG, because ( 123 I)-MIBG generated a higher dose of γ-rays with a higher specificity than ( 131 I)-MIBG. In addition, normal adrenal grands were visualized in 50% of patients tested with ( 123 I)-MIBG scintigraphy. These results indicate that ( 123 I)-MIBG scintigraphy is a valuable tool for the local detection of PCT, as is ( 131 I)-MIBG scintigraphy. Furthermore, it is possible that ( 123 I)-MIBG can be used as an alternative to ( 131 I)-MIBG for the detection of PCT. Our study was not a prospective study and the background of the patients was not matched. Further prospective studies are needed in order to determine the efficacy of ( 123 I)-MIBG scintigraphy for the diagnosis of PCT. (author)

Effect of light rare earth doping in 123 high temperature supercoductors

Directory of Open Access Journals (Sweden)

M. Mirzadeh

2006-09-01

Full Text Available   We have studied the structural and electrical properties of Gd(Ba2-xLaxCu3O7+δ [Gd(BaLa123], Gd(Ba2-xNdxCu3O7+δ [Gd(BaNd123], and Nd(Ba2-xPrxCu3O7+δ [Nd(BaPr123] compounds with 0.0≤x≤0.8 prepared by the standard solid-state reaction. The XRD patterns show that all of the samples with x≤0.5 are isosructure 123 phase, but in Gd(BaNd123 and Nd(BaPr123 there are several impurity peaks in the XRD patterns for x≥0.6. We estimated the xcsolubility=1.1, 0.6 and 0.55 in Gd(BaLa123, Nd(BaPr123, and Gd(BaNd123, respectively. The resistivity increases with the increase of doping. The decrease of Tc with the increase of Pr doping is faster than Nd and La doping. The normal-state resistivity is fitted for two and three dimensional variable range hopping (2D&amp3D-VRH and Coulomb gap (CG regimes, separately. Our results indicate that the dominant mechanism for x≥xcSIT is 3D-VRH. The broadening of magnetoresistance have been investigated by TAFC and AH models. The pinning energy and Josephson coupling energy, decrease with the increase of applied magnetic field as U~H-β, these values also decrease with doping concentration Pr is more effective than Nd and La.

40 CFR 81.123 - Southeastern Oklahoma Intrastate Air Quality Control Region.

Science.gov (United States)

2010-07-01

... Quality Control Region. 81.123 Section 81.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Air Quality Control Regions § 81.123 Southeastern Oklahoma Intrastate Air Quality Control Region. The Southeastern Oklahoma Intrastate Air Quality Control Region consists of the territorial area encompassed by the...

Localization of mitochondria in living cells with rhodamine 123.

Science.gov (United States)

Johnson, L V; Walsh, M L; Chen, L B

1980-01-01

The laser dye rhodamine 123 is shown to be a specific probe for the localization of mitochondria in living cells. By virtue of its selectivity for mitochondria and its fluorescent properties, the detectability of mitochondria stained with rhodamine 123 is significantly improved over that provided by conventional light microscopic techniques. With the use of rhodamine 123, it is possible to detect alterations in mitochondrial distribution following transformation by Rous sarcoma virus and changes in the shape and organization of mitochondria induced by colchicine treatment. Images PMID:6965798

Very Rapid High-amplitude Gamma-Ray Variability in Luminous Blazar PKS 1510-089 Studied with Fermi-LAT

Energy Technology Data Exchange (ETDEWEB)

Saito, S.; Stawarz, L.; Tanaka, Y.T.; Takahashi, T.; Madejski, G.; D' Ammando, F.

2013-03-20

Here we report on the detailed analysis of the γ-ray light curve of a luminous blazar PKS 1510-089 observed in the GeV range with the Large Area Telescope (LAT) onboard the Fermi satellite during the period 2011 September - December. By investigating the properties of the detected three major flares with the shortest possible time binning allowed by the photon statistics, we find a variety of temporal characteristics and variability patterns. This includes a clearly asymmetric profile (with a faster flux rise and a slower decay) of the flare resolved on sub-daily timescales, a superposition of many short uncorrelated flaring events forming the apparently coherent longer-duration outburst, and a huge single isolated outburst unresolved down to the timescale of three-hours. In the latter case we estimate the corresponding γ-ray flux doubling timescale to be below one hour, which is extreme and never previously reported for any active galaxy

5 CFR 610.123 - Travel on official time.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Travel on official time. 610.123 Section... DUTY Weekly and Daily Scheduling of Work Work Schedules § 610.123 Travel on official time. Insofar as practicable travel during nonduty hours shall not be required of an employee. When it is essential that this...

RADIO-LOUD NARROW-LINE SEYFERT 1 AS A NEW CLASS OF GAMMA-RAY ACTIVE GALACTIC NUCLEI

International Nuclear Information System (INIS)

Abdo, A. A.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Bloom, E. D.; Borgland, A. W.; Cameron, R. A.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Bonamente, E.; Brigida, M.; Bruel, P.; Burnett, T. H.; Caliandro, G. A.

2009-01-01

We report the discovery with Fermi/LAT of γ-ray emission from three radio-loud narrow-line Seyfert 1 galaxies: PKS 1502+036 (z = 0.409), 1H 0323+342 (z = 0.061), and PKS 2004 - 447 (z = 0.24). In addition to PMN J0948+0022 (z = 0.585), the first source of this type to be detected in γ rays, they may form an emerging new class of γ-ray active galactic nuclei (AGNs). These findings can have strong implications on our knowledge about relativistic jets and the unified model of the AGN.

/sup 123m/Te-labeled biochemicals and method of preparation

International Nuclear Information System (INIS)

Knapp, F.

1980-01-01

A process for preparing a /sup 123m/Te-labeled organic compound of the formula R-/sup 123m/Te-CH 2 -R', R being alkyl, substituted alkyl, aryl or substituted aryl and R' being a steroidal side chain, alkyl amino acid or amino acid group, said process comprising the steps of: (A) reaching a /sup 123m/Te-symmetric diorgano ditelluride, R 2 /sup 123m/Te 2 , R being alkyl, substituted alkyl, aryl or substituted aryl, with a hydride reducing agent and a source of alkali metal ions to form an alkali metal organo telluride M-/sup 123m/Te-R; (B) reacting said alkali metal organo telluride with a primary halogenated organic compound R/sub a/'-X, R/sub a/' being a 17 alkyl steroid group having 1-4 carbon atoms in said alkyl group, an alkyl amino acid group, or a group hydrolyzable to an alkyl amino acid group

Sintering of YBaCu0, implications of the phase diagram

International Nuclear Information System (INIS)

Gervais, M.; Douy, A.; Dubois, B.; Coutures, J.P.; Odier, P.

1989-01-01

The motivations of this experimental work are to underline the implications between the phases diagram constitution and the sintering of YBaCu0 superconductors. This preliminary work is focussed on the solid → liquid transformations of this system, in the vicinity of the (123) phase. Two transformations are observed at 915 and 935 0 C depending of the composition of the compound. They both have an important role on the sintering process and the chemical homogeneity of the ceramic. No such transformations seems to occur in the domain (123)-(211)-BaCu0 2 , the sintered sample has therefore a better chemical homogeneity [fr

Effect of growth anisotropy on the morphology and property of directionally solidified RE123

International Nuclear Information System (INIS)

Nakamura, Yuichi; Shibusawa, Akira; Ooishi, Yoshihiro; Misu, Tomohiko; Inada, Ryoji; Oota, Akio

2005-01-01

The REBa 2 Cu 3 O y (RE123: RE = Y, Sm, Gd etc.) superconducting current lead is a favorable application due to the high J c properties and low thermal conductivity. Since the RE123 crystal shows the anisotropy in the J c properties as well as the mechanical properties, the ab-plane of the crystal parallel to the growth direction is preferable. The preferential growth direction during directional solidification is determined by the growth anisotropy in the early stage of the growth. In order to get the fundamental information to control the growth orientation, we investigated the growth rates of the Gd123 and Sm123 crystals against the undercooling and the continuous growth condition of Sm123 in directional solidification process. The growth rates of Sm123 and Gd123 were found to be about 5-10 times larger than that of Y123 at the same undercooling. The Sm123 showed the continuous growth structure up to 15 mm/h for fiber samples and up to 10 mm/h for 2 mm circle rods by the zone melting process. These pulling rates for continuous growth are larger than those of Y123 although the difference in growth rates between Sm123 and Y123 is much larger than this difference

Biosynthesis of t-Butyl in Apratoxin A: Functional Analysis and Architecture of a PKS Loading Module.

Science.gov (United States)

Skiba, Meredith A; Sikkema, Andrew P; Moss, Nathan A; Lowell, Andrew N; Su, Min; Sturgis, Rebecca M; Gerwick, Lena; Gerwick, William H; Sherman, David H; Smith, Janet L

2018-04-27

The unusual feature of a t-butyl group is found in several marine-derived natural products including apratoxin A, a Sec61 inhibitor produced by the cyanobacterium Moorea bouillonii PNG 5-198. Here we determine that the apratoxin A t-butyl group is formed as pivaloyl acyl carrier protein (ACP) by AprA, the polyketide synthase (PKS) loading module of the apratoxin A biosynthetic pathway. AprA contains an inactive "pseudo" GCN5-related N-acetyltransferase domain (ΨGNAT) flanked by two methyltransferase domains (MT1 and MT2) that differ distinctly in sequence. Structural, biochemical, and precursor incorporation studies reveal that MT2 catalyzes unusually coupled decarboxylation and methylation reactions to transform dimethylmalonyl-ACP, the product of MT1, to pivaloyl-ACP. Further, pivaloyl-ACP synthesis is primed by the fatty acid synthase malonyl acyltransferase (FabD), which compensates for the ΨGNAT and provides the initial acyl-transfer step to form AprA malonyl-ACP. Additionally, images of AprA from negative stain electron microscopy reveal multiple conformations that may facilitate the individual catalytic steps of the multienzyme module.

[Evaluation of myocardial uptake of beta-methyl-(123I)-iodophenylpentadecanoic acid (123I-BMIPP)].

Science.gov (United States)

Momose, M; Kobayashi, H; Saito, K; Matsumoto, N; Maki, M; Hosoda, S; Kusakabe, K

1994-12-01

To evaluate the myocardial uptake of beta-methyl-(123I)-iodophenylpentadecanoic acid (123I-BMIPP), nineteen patients with ischemic heart disease including left ventricular hypertrophy (mean age 63 +/- 7.8, 14 males and 5 females) underwent BMIPP myocardial scintigraphy. Myocardial uptake (MU) of BMIPP to the total injected dose was calculated from anterior view of the planar image in all subjects, and was compared with plasma glucose (BS), triglyceride (TG), and free fatty acid (FFA). It was also compared with left ventricular mass (LVM) calculated with echocardiography. MU was not related to BS, TG, and FFA, however had the positive correlation with LVM (r = 0.676, p < 0.01). Myocardial uptake per left ventricular mass (MU/LVM) had the negative correlation with LVM (r = -0.671, p < 0.01). Further studies for the significance of MU/LVM will be required.

Evaluation of myocardial uptake of β-methyl-(123I)-iodophenylpentadecanoic acid (123II-BMIPP)

International Nuclear Information System (INIS)

Momose, Mitsuru; Kobayashi, Hideki; Matsumoto, Nobusuke; Maki, Masako; Kusakabe, Kiyoko; Saito, Katsumi; Hosoda, Saichi.

1994-01-01

To evaluate the myocardial uptake of β-methyl-( 123 I)-iodophenylpentadecanoic acid ( 123 I-BMIPP), nineteen patients with ischemic heart disease including left ventricular hypertrophy (mean age 63±7.8, 14 males and 5 females) underwent BMIPP myocardial scintigraphy. Myocardial uptake (MU) of BMIPP to the total injected dose was calculated from anterior veiw of the planar image in all subjects, and was compared with plasma glucose (BS), triglyceride (TG), and free fatty acid (FFA). It was also compared with left ventricular mass (LVM) calculated with echocardiography. MU was not related to BS, TG, and FFA, however had the positive correlation with LVM (r=0.676, p<0.01). Myocardial uptake per left ventricular mass (MU/LVM) had the negative correlation with LVM (r=-0.671, p<0.01). Further studies for the significance of MU/LVM will be required. (author)

Feasibility of dual radionuclide brain imaging with I-123 and Tc-99m

International Nuclear Information System (INIS)

Ivanovic, M.; Weber, D.A.; Loncaric, S.; Franceschi, D.

1994-01-01

A study was conducted to evaluate the feasibility of simultaneous dual radionuclide brain imaging with 123 I and 99m Tc using photopeak image subtraction techniques or offset photopeak image acquisition. The contribution of the photons from one radionuclide to a second radionuclide's photopeak energy window (crosstalk) was evaluated for SPECT and planar imaging of a brain phantom containing 123 I and 99m Tc for a range of activity levels and distribution properties approximating those in rCBF images of the adult human brain. Crosstalk was evaluated for 10% symmetrical energy windows centered on the 123 I and 99m Tc photopeaks and for 10% energy windows asymmetrically placed to the left and right of the center of the respective photopeaks. It was observed that the centered photopeak windows, 99m Tc crosstalk in the 123 I window is 8.9% of the 99m Tc seen in the 99m Tc window and ranges from 37.5% to 75.0% of the 123 I in the 123 I window. 123 I crosstalk is 37.8% of the 123 I seen in the 123 I window and ranges from 4.4% to 8.9% of the 99m Tc seen in the 99m Tc window. The spatial distribution of a radionuclide's crosstalk photons differs from that observed in the radionuclide's photopeak window. A 99m Tc photopeak window offset to the left does not decrease 123 I crosstalk, and the percentage of 99m Tc scattered photons is significantly increased in the window. Offsetting the 123 I window to the right decreases 99m Tc crosstalk to 9.0% to 17.9% of the 123 I counts, but decreases 123 I sensitivity by 39.9%. Offsetting both photopeak windows to the right decreases the 99m Tc scattered photons in the 99m Tc window, but increases 123 I crosstalk to 17.0% to 33.8% of the 99m Tc counts

Crossing the Technology Adoption Chasm: Implications for DoD

Science.gov (United States)

2008-06-30

elli= cowpea varieties for extension education in Southwestern Nigeria. The Journal of Agricultural Education and Extension, 12(3), 195-200. O’Rourke...Adekoya, A.E. (2006). Implication of farmers’ propensity to discontinue adoption of downey-mildew resistant maize and improved cowpea varieties for... Cowpea (Farmer) Feedback Provision (-) Marketability Varieties Input Availability (+) Dependent Variable = De-adoption of Cowpea

Clinical evaluation of 123I-BMIPP myocardial scintigraphy in patients with hypertrophic cardiomyopathy

International Nuclear Information System (INIS)

Ohtsuki, Katsuichi; Sugihara, Hiroki; Umamoto, Ikuo

1992-01-01

123 I-β-methyl-p-iodophenylpentadecanoic acid ( 123 I-BMIPP) myocardial scintigraphy was performed in 13 patients with hypertrophic cardiomyopathy and compared with 201 Tl myocardial scintigraphy performed within 3 months for evaluating the clinical significance of 123 I-BMIPP myocardial scintigraphy. SPECT images were divided into 13 segments and segmental images were visually scored on a 4 (increased tracer uptake) to 0 (severely decreased tracer uptake) scale according to the tracer uptake. In comparison of 123 I-BMIPP early images and 201 Tl perfusion images, mismatches were seen in about 70% of all segments. The number of segments demonstrating lower myocardial uptake of 123 I-BMIPP was larger than that of 201 Tl. In hypertrophic regions, the tracer uptake of 123 I-BMIPP early images was significantly lower than that of 201 Tl images and the lower uptake of 123 I-BMIPP delayed images was more marked. In non-hypertrophic regions, no significant difference was seen between the tracer uptakes of 123 I-BMIPP early images and 201 Tl images but the tracer uptake of 123 I-BMIPP delayed images was significantly lower than that of 201 Tl images. The mismatch between the tracer uptakes of 123 I-BMIPP images and 201 Tl images was thought to be a reflection of disordered myocardial fatty acid metabolism. 'Washout', the difference between the tracer uptakes of 123 I-BMIPP early images and delayed images was also thought to be a reflection of disordered myocardial fatty acid metabolism. These results suggest that 123 I-BMIPP is a promising radiopharmaceutical for evaluating disordered myocardial fatty acid metabolism in patients with HCM. (author)

[(123)I]FP-CIT ENC-DAT normal database

DEFF Research Database (Denmark)

Tossici-Bolt, Livia; Dickson, John C; Sera, Terez

2017-01-01

BACKGROUND: [(123)I]FP-CIT is a well-established radiotracer for the diagnosis of dopaminergic degenerative disorders. The European Normal Control Database of DaTSCAN (ENC-DAT) of healthy controls has provided age and gender-specific reference values for the [(123)I]FP-CIT specific binding ratio...... quantifications methods, BRASS and Southampton, and explores the performance of the striatal phantom calibration in their harmonisation. RESULTS: BRASS and Southampton databases comprising 123 ENC-DAT subjects, from gamma cameras with parallel collimators, were reconstructed using filtered back projection (FBP......) and iterative reconstruction OSEM without corrections (IRNC) and compared against the recommended OSEM with corrections for attenuation and scatter and septal penetration (ACSC), before and after applying phantom calibration. Differences between databases were quantified using the percentage difference...

Investigation of regional cerebral blood flow in alcoholic Korsakoff's syndrome with 123I-IMP SPECT

International Nuclear Information System (INIS)

Nakamura, Makoto; Nomura, Soichiro; Kato, Motoichiro; Nakazawa, Tsuneyuki.

1995-01-01

Regional cerebral blood flow (rCBF) was determined quantitatively by single photon emission computed tomography (SPECT) using N-isopropyl-p-[ 123 I]iodoamphetamine ( 123 I-IMP) in 6 patients with alcoholic Korsakoff's syndrome (A group). The findings were compared with concurrently available findings from 6 alcoholic patients with no evidence of cerebral disordres such as Korsakoff's syndrome and dementia (B group) and 4 healthy persons (C group). In both A and B groups, diffuse decrease in blood flow was significantly observed in the entire brain, as compared with the C group; no significant difference in the decreased blood flow existed between the A and B groups. According to the WAIS results, the patients in the A group were classified as 'typical Korsakoff's syndrome' (full IQ of 90 or more) and as 'serious Korsakoff's syndrome' (full IQ of 89 or less). rCBF in the thalamus was significantly lower in the A group of patients with typical Korsakoff's syndrome than the B group. These findings may reflect the variety of alcoholic Korsakoff's syndrome. This may also have an implication for the possible classification of several types in this syndrome. (N.K.)

40 CFR 96.123 - CAIR permit contents and term.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false CAIR permit contents and term. 96.123 Section 96.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... necessary to facilitate coordination of the renewal of the CAIR permit with issuance, revision, or renewal...

Cardiac Iodine-123 metaiodobenzylguanidine (123I-MIBG) scintigraphy parameter predicts cardiac and cerebrovascular events in type 2 diabetic patients without structural heart disease

International Nuclear Information System (INIS)

Yufu, Kunio; Takahashi, Naohiko; Okada, Norihiro; Shinohara, Tetsuji; Nakagawa, Mikiko; Hara, Masahide; Yoshimatsu, Hironobu; Saikawa, Tetsunori

2012-01-01

Cardiac iodine-123 metaiodobenzylguanidine ( 123 I-MIBG) scintigraphy is an established method of assessment of cardiovascular sympathetic function. The aim of the present study was to investigate the long-term cardiovascular predictive value of cardiac 123 I-MIBG scintigraphy parameters in Japanese type 2 diabetic patients without structural heart disease. Cardiac 123 I-MIBG scintigraphy in 108 patients with type 2 diabetes who did not have structural heart disease, was evaluated. The washout rate (WR) was considered enhanced if it was ≥40%. Accurate follow-up information for 4.6 years was obtained in 54 enhanced WR patients (27 male; mean age, 61±11 years) and in 54 sex- and age-matched preserved WR patients (27 male; mean age, 61±10 years). Major adverse cardiac and cerebrovascular events (MACCE) were investigated. During follow-up, 10 enhanced WR patients developed MACCE including cardiac death, coronary revascularization, stroke, and congestive heart failure, while MACCE occurred in only 3 male patients. The Kaplan-Meier curves indicated that enhanced WR patients had higher incidence of MACCE than those with preserved WR (P 123 I-MIBG scintigraphy at baseline has long-term cardiovascular predictive value in Japanese patients with type 2 diabetes without structural heart disease. (author)

Apparatus of hot cell for iodine-123 production

International Nuclear Information System (INIS)

Almeida, G.L. de; Rautenberg, F.A.; Souza, A.S.F. de.

1986-01-01

The hot cell installation at IEN cyclotron (Brazilian-CNEN) for sup(123)I production is presented. Several devices, such as, tube furnace coupling system, tube furnace driving system, sup(123)I target transfer system, product extraction system, furnace control system, and effluent systems, were constructed and modified for implanting process engineering. The requirements of safety engineering for operation process were based on ALARA concept. (M.C.K.)

The Discovery of a Microarcsecond Quasar: J1819+3845.

Science.gov (United States)

Dennett-Thorpe; de Bruyn AG

2000-02-01

We report on the discovery of a source that exhibits over 300% amplitude changes in radio flux density on the period of hours. This source, J1819+3845, is the most extremely variable extragalactic source known in the radio sky. We believe these properties are due to interstellar scintillation and show that the source must emit at least 55% of its flux density within a radius of fewer than 16 µas at 5 GHz. The apparent brightness temperature is greater than 5x1012 K, and the source may be explained by a relativistically moving source with a Doppler factor of approximately 15. The scattering occurs predominantly in material only a few tens of parsecs from the Earth, which explains its unusually rapid variability. If the source PKS 0405-385 is similarly affected by local scattering material, Doppler factors of approximately 1000 are not required to explain this source. The discovery of a second source whose properties are well modeled by interstellar scintillation strengthens the argument for this as the cause for much of the variation seen in intraday variables.

47 CFR 80.123 - Service to stations on land.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 5 2010-10-01 2010-10-01 false Service to stations on land. 80.123 Section 80... STATIONS IN THE MARITIME SERVICES Operating Requirements and Procedures Special Procedures-Public Coast Stations § 80.123 Service to stations on land. Marine VHF public coast stations, including AMTS coast...

40 CFR 97.123 - CAIR permit contents and term.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false CAIR permit contents and term. 97.123 Section 97.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... facilitate coordination of the renewal of the CAIR permit with issuance, revision, or renewal of the CAIR NOX...

Clinical applications of brain spect with N-isopropyl-123I-p-iodoamphetamine

International Nuclear Information System (INIS)

Moretti, J.L.; Sergent, A.; Raynaud, C.; Baron, J.C.; Samson, Y.; Lassen, N.; Bourdoiseau, M.

1985-01-01

Single-photon emission computed tomography (SPECT) with N-isopropyl- 123 I-p-iodoamphetamine (IAMP-I-123) was used for 250 patients suffering from brain disorders, comprising brain tumours (36), normal-pressure hydrocephalus (NPH) (23), cerebrovascular pathologies (127) and partial epilepsy (64). Brain tumours were found to be hypoactive, whatever the grade and nature. Frontal hypoactivity was found in NPH patients, and IAMP-I-123 perfusion was improved after cerebral spinal fluid (CSF) lumbar drainage, giving a good predictive criterion of clinical outcome after CSF diversion. For cerebrovascular disorders, it was possible to obtain with IAMP-I-123 SPECT larger pictures of hypoactive areas than the pictures of hypodense lesions obtained with X-ray CT scans; other hypoactive areas that could not be observed with CT were also delineated by IAMP-I-123 SPECT. The hypoactive areas found in constituted infarctions can present two types of kinetics - those which are 'persistent' (still present on delayed scans performed 5 h after IAMP-I-123 injection) and those which disappear with time, thereby suggesting hypofunctional parenchyma without tissue impairment. IAMP-I-123 SPECT was proved to be useful in assessing ischaemia, especially in reversible ischaemia patients, by defining the affected arterial territory and guiding complementary arteriographic exploration in view of surgical procedures. IAMP-I-123 SPECT was able to accurately delineate the affected parenchymal areas. It could also be of help in the follow-up of the efficiency of drug therapy and surgery, and it can be regarded as a good predictive criterion for stroke rehabilitation. The results obtained with IAMP-I-123 indicate that the lesional and epileptogenic areas in epileptic patients are hypoactive. The localization of these territories by IAMP-I-123 SPECT correlates well with other, more accurate, neuroradiological and stereotactic techniques. (author)

DNA and chromosome breaks induced by 123I-estrogen in CHO cells

International Nuclear Information System (INIS)

Schwartz, J.L.

1997-01-01

The effects of the Auger electron-emitting isotope I-123, covalently bound to estrogen, on DNA single- and double-strand breakage and on chromosome breakage was determined in estrogen positive Chinese hamster ovary (CHO-ER) cells. Exposure to the 123 I-estrogen induced both single- and double-strand breaks with a ratio of single- to double-strand breaks of 2.2. The corresponding ratio with 60 Co gamma rays was 15.6. The dose-response was biphasic suggesting that either receptor sites are saturated at high does, or that there is a nonrandom distribution of breaks induced by the 123 I-estrogen. The 123 I-estrogen treatment induced chromosome aberrations with an efficiency of about 1 aberration for each 1,000 disintegrations per cell. This corresponds to the mean lethal dose of 123 I-estrogen for these cells suggesting that the lethal event induced by the Auger electron emitter bound to estrogen is a chromosome aberration. Most of the chromosome-type aberrations were dicentrics and rings, suggesting that 123 I-estrogen-induced chromosome breaks are rejoined. The F-ratio, the ratio of dicentrics to centric rings, was 5.8 ± 1.7, which is similar to that seen with high LET radiations. Their results suggest that I-123 bound to estrogen is an efficient clastogenic agent, that the cytotoxic damage produced by I-123 bound to estrogen is very like high LET-induced damage, and the I-123 in the estrogen-receptor-DNA complex is probably in close proximity to the sugar-phosphate backbone of the DNA

I-123 IMP brain scintigraphies in asphyxiated newborns

International Nuclear Information System (INIS)

Maeda, Hisatoshi; Konishi, Yukuo; Kuriyama, Masanori; Ishii, Yasushi; Sudo, Masakatsu

1987-01-01

Brain scintigraphies with N-Isopropyl (I-123) p-Iodoamphetamine (I-123 IMP) were conducted in eight patients who had asphyxia at the time of birth. Two patients, 15 and 26 year-old, had local defects and diffuse low cerebral uptakes. Two children, 70 day and 2 year-old, had no cerebral uptake. Brain scintigraphies were carried out twice in three among four newborns. Only slight I-123 IMP brain uptakes were observed in the first 10 days. The lateral views of the brain scintigraphies showed increased uptake in the middle region of the brain between 10 to 30 days and reached almost equally distributed in frontal, middle and posterior regions after 30 days. These results were thought to represent rather developmental changes of the cerebral blood flow after ischemic attacks at birth. (author)

Successful therapy with hemoperfusion and plasma exchange in acute 1,2,3-trichloropropane poisoning.

Science.gov (United States)

Liu, P; Liang, Y-G; Meng, Q-Y; Zhang, C-G; Wang, H-C; Zhang, X-G; Li, G; Liu, Z-Y; He, Y-Z

2012-05-01

1,2,3-trichloropropane (1,2,3-TCP) is commonly used as an intermediate in pesticide and an industrial specialty solvent. Acute 1,2,3-TCP poisoning is rare but a medical emergency. Sporadic cases of toxic hepatic injury from 1,2,3-TCP in humans have been reported. Liver is a target organ for 1,2,3-TCP toxicity, which may ensue in a short period after ingestion. A specific antidote against 1,2,3-TCP is not available. So it is important to distinguish that a patient with 1,2,3-TCP poisoning constitutes a medical emergency. In this case study, the poisoned patient's clinical condition and laboratory values improved gradually after she received hemoperfusion (HP) and plasma exchange, which indicated that the therapy with HP and plasma exchange were helpful in the treatment of 1,2,3-TCP poisoning.

Clinical evaluation of 123I-IMP SPECT in patients with various neurological diseases

International Nuclear Information System (INIS)

Yoneda, Naoto

1993-01-01

Single photon emission computed tomography with N-isopropyl-p-[ 123 I] iodoamphetamine ( 123 I-IMP SPECT) was performed in 57 patients with various neurological disease, and compared with the findings of brain CT, MRI, and EEG. The author also evaluated the relationship between the findings on 123 I-IMP SPECT and the condition of the control of the attack after treatment with antiepileptic drugs in idiopathic epileptic patients. Abnormality of accumulation of 123 I-IMP SPECT was observed in 62.3% of all cases. Focal abnormality was detected in 28.3% of all cases by brain CT and 54.1% by MRI. The detectability of focal abnormality in brain CT and MRI was found to be lower than that of 123 I-TMP SPECT. There was very little significance in detectability between 123 I-IMP SPECT and EEG. But it infers that 123 I-IMP SPECT can detect the subictal state in epileptic patients. One comparative study of the relationship between the findings on 123 I-IMP SPECT and the condition of the control of the attack by antiepileptic drugs in patients with idiopathic epilepsy, abnormality of 123 I-IMP SPECT findings was found to be higher in patients who were not controlled sufficiently than in patients who were controlled sufficiently, and a significant difference is found by X 2 test. 123 I-IMP SPECT is useful for the evaluation of treatment in patients with epilepsy. (author)

Serologic follow-up of IgG responses against recombinant mycobacterial proteins ML0405, ML2331 and LID-1 in a leprosy hyperendemic area in Venezuela

Directory of Open Access Journals (Sweden)

Elsa Rada

2012-12-01

Full Text Available Leprosy is a slowly evolving disease that occurs mainly in adults. In this study, the Mamaría Village, state of Portuguesa was selected because it had one of the highest prevalence rates (13.25% of leprosy cases in 1997. Between 1998-2004, 20.2% of the 89 cases registered in this village were less than 15 years old and 61.8% were males. Pau-cibacillary (PB lesions were the predominant clinical forms identified, although also multibacillary (MB forms were found. Additionally, 76% of the patients were bacteriologically negative. At the time of diagnosis, 75% of the patients presented with grade 0 disabilities, 23% with grade 1 and 2% with grade 2. Serum samples were collected from 18 PB and 15 MB patients, in addition to 14 family contacts, at the beginning and end of treatment. All the groups were re-evaluated during a three-year period (2008-2011. The proteins used for evaluation were ML0405, ML2331 and LID-1. These mycobacterial proteins were highly specific for Mycobacterium leprae and the IgG responses decreased in both MB and PB patients during multidrug treatment. Our results suggest that these antigens could be used as markers for successful treatment of non-reactional lepromatous patients.

Labeling of 3H11 With 123I and Its Biodistribution

International Nuclear Information System (INIS)

Qin Hongbin; Yin Wei; Gao Huibo; Chen Daming; Qi Benzhong; Jin Xiaohai; Bai Hongsheng; Zhang Wenhui; Yang Zhi

2010-01-01

3H11 was labeled with 123 I by Iodogen method,and the labeling product were purified with PD-10 column. The labeling yield and the radiochemical purity of the product was determined by paper chromatography. The biodistribution of 123 I-3H11 in normal mice was car ride out as well. The optimal experimental conditions of 123 I-3H11 was as follow: Iodogen 10 μg, 3H11 30 μg, Na 123 I solution 20 μL (13.3 MBq), PBS 100 μL (pH 7.4, 0.2 mol/L), the normal temperature for 8 min. The labeling yield of 123 I-3H11 was 70%-80%. After stored at 4 degree C for 48 h in human serum,the radiochemical purity was more than 92%. The results of biodistribution showed that the clearance of radiolabeled antibody in blood (half time, T 1/2 ) was 12.25±0.25 h, and the radioactivity in the stomach was up taken obviously. The above results indicated that 123 I-3H11 appears to show some potential as gastric cancer imaging diagnostic agent. (authors)

Basic studies on the hepatobiliary scintigraphy with 123I-rose bengal

International Nuclear Information System (INIS)

Narabayashi, Isamu; Ito, Yasuhiko; Otsuka, Nobuaki; Muranaka, Akira; Konno, Katsunobu.

1979-01-01

The purpose of this investigation is to evaluate the values of 123 I-rose bengal. sup(99m)Tc-labels for the hepatobiliary radiopharmaceutical are not fully satisfied because of greater urinary excretion, especially in cases of hyperbilirubinemia. 123 I is a lower gamma ray energy emitter more suitable for imaging and has a short half life with 13 hours. Commercially obtained rose bengal was purified using Sephadex G-25 column on gelfiltration. 123 I-rose bengal was prepared using iodine exchange reaction between nonradioactive rose bengal and Na 123 I. Radiochemical purity of 123 I-rose bengal was examined by paper chromatography. Biological distribution of 123 I-rose bengal in rabbits at 1 hours after intravenous injection indicated that the tracer was cleared from the blood to the liver, thereafter excreted into the small intestine through the common bile duct. Hepatic uptake and excretion of activity has been measured for 60 minutes using a scintillation camera in conjunction with a VTR system. There existed no significant relative to those of 131 I-rose bengal. Serial scintigraphic images showed satisfactorily better images even in a rabbit with complete obstructive jaundice. (author)

Effects of cigarette smoking on I-123 IMP clearance from the lung

International Nuclear Information System (INIS)

Katoh, Kunihiko; Takahashi, Tsuneo

1990-01-01

N-isopropyl-p-I-123-iodoamphetamine (I-123 IMP), originally developed as a brain scanning agent, is also taken up by the lung. To evaluate the cigarette smoking on the uptake of IMP by the lung, we studied I-123 IMP clearance from the lung on 14 volunteers; 5 non-smokers and 9 smokers. After the injection of 111 MBq (3mCi) of I-123 IMP into the medial cubital vein, the time-activity curve for 60 minutes and the regional activity using 1 frame per minute and a 64 x 64 matrix was obtained. I-123 IMP clearance curve was described as follows: C(t)=A 1 e -k1t +A 2 e -k2t (A 1 , A 2 : intercepts, and k 1 , k 2 : slopes of the exponential components). I-123 IMP clearance was delayed in smokers, and k 2 was smaller in smokers. Also a significant correlations between k 1 , k 2 , and the number of cigarettes smoked per day were found. In conclusion, this study suggests that the delayed clearance and retention of I-123 IMP in the lung indicate the lung metabolic disorders due to cigarette smoking. (author)

Diagnostic value of asymmetric striatal D2 receptor upregulation in Parkinson's disease: an [123I]IBZM and [123I]FP-CIT SPECT study

International Nuclear Information System (INIS)

Verstappen, C.C.P.; Bloem, B.R.; Haaxma, C.A.; Horstink, M.W.I.M.; Oyen, W.J.G.

2007-01-01

Striatal postsynaptic D 2 receptors in Parkinson's disease (PD) are thought to be upregulated in the first years of the disease, especially contralateral to the clinically most affected side. The aim of this study was to evaluate whether the highest striatal D 2 binding is found contralateral to the most affected side in PD, and whether this upregulation can be used as a diagnostic tool. Cross-sectional survey was undertaken of 81 patients with clinically asymmetric PD, without antiparkinsonian drugs and with a disease duration of ≤5 years and 26 age-matched controls. Striatal D 2 binding was assessed with [ 123 I]IBZM SPECT, and severity of the presynaptic dopaminergic lesion with [ 123 I]FP-CIT SPECT. The mean striato-occipital ratio of [ 123 I]IBZM binding was significantly higher in PD patients (1.56 ±0.09) than in controls (1.53 ±0.06). In PD patients, higher values were found contralateral to the clinically most affected side (1.57 ±0.09 vs 1.55 ±0.10 ipsilaterally), suggesting D 2 receptor upregulation, and the reverse was seen using [ 123 I]FP-CIT SPECT. However, on an individual basis only 56% of PD patients showed this upregulation. Our study confirms asymmetric D 2 receptor upregulation in PD. However, the sensitivity of contralateral higher striatal [ 123 I]IBZM binding is only 56%. Therefore, the presence of contralateral higher striatal IBZM binding has insufficient diagnostic accuracy for PD, and PD cannot be excluded in patients with parkinsonism and no contralateral upregulation of D 2 receptors, assessed with [ 123 I]IBZM SPECT. (orig.)

Iodine-123-labelled serum amyloid P component scintigraphy in amyloidosis

International Nuclear Information System (INIS)

Saile, R.; Deveaux, M.; Marchandise, X.; Duquesnoy, B.

1993-01-01

This study describes the results of scintigraphy with iodine-123-labelled serum amyloid P component (SAP) as a means of establishing the distribution of organ involvement in amyloidosis. The significance of 123 I-SAP scans obtained in 15 patients with biopsy-proven AA or AL amyloidosis is discussed. Biopsy-proven amyloidosis was typically confirmed by scintigraphy, though such confirmation was not obtained in the kidneys in six patients with histological proof of extensive renal amyloid deposition. This lack of uptake may have been due to the accumulation of a major part of the 123 I-SAP in the spleen and/or liver. Twenty-four hour whole-body retention of 123 I-SAP was higher in patients with amyloidosis than in controls. Twenty-four hour tracer accumulation of the radioactivity in the extravascular compartment was notably greater in patients than in controls and appeared to be a good diagnostic criterion. We conclude that 123 I-SAP scintigraphy may be helpful for the evaluation of organ involvement not only in patients with biopsy-proven amyloidosis but also when a biopsy cannot be performed or when a strong suspicion of amyloidosis exists in spite of repeated negative biopsises. (orig.)

Some observations on the use of iodine-123 for thyroid imaging

International Nuclear Information System (INIS)

Ryo, U.Y.; Pinsky, S.

1985-01-01

Efficacy of /sup 99m/Tc and 123 I for thyroid imaging was studied in 122 subjects with a variety of thyroid abnormalities. Both agents produced images that were equivalent in quality in 51 subjects, the image with 123 I was in better quality in 22, and the /sup 99m/Tc image was better in 9. In the remaining 40 cases, discordant findings existed between the 123 I image and /sup 99m/Tc image. In the majority of cases, i.e., 32 or 40, the discrepancy was caused by hot or warm lesions on the /sup 99m/Tc image that became cold or normal (nonvisualization) on the 123 I image. Advantages with /sup 99m/Tc appeared to be (1) the saving of time and cost for patients and physicians and (2) superior sensitivity in detecting thyroid lesions, whereas the advantages with 123 I appeared to be better quality of thyroid images and accurate representation of function of thyroid nodules

Myocardial turnover rates of I-123 heptadecanoic acid (HDA)

International Nuclear Information System (INIS)

Dudczak, R.; Schmoliner, R.; Kletter, K.; Derfler, D.K.; Frischauf, H.; Angelberger, P.; Losert, U.

1982-01-01

Myocardial scintigraphy was performed with I-123 labeled HDA in patients with coronary artery disease (CAD, n=37), cardiomyopathy (COCM, n=7) and controls (n=10). These results were compared with coronary angiography, Tl 201 scintigraphy and radionuclide angiography. Results from animal experiments (intracoronary application in calfes) and patient studies supported the assumption that myocardial scintigraphy with I-123 HDA reveals information about myocardial fatty acid utilisation. Summarizing all clinical results using I-123 HDA showed that from the myocardial accumulation pattern of the labeled fatty acid, as well as from Tl 201 perfusion scintigraphy, the value of the regional elimination rate (t/2) could not be predicted. In patients with COCM the mean t/2 was prolonged, but overlapped with controls. In ischemic regions ''shortened'', normal and prolonged elimination rates were found. These findings were related to the observed wall motion and the calculated regional ejection fraction (r=0.73, p<0.001). This data indicate, that I-123 HDA add a further aspect in nuclear cardiology; the results obtained bear a relation to the functional state of the diseased heart

[Relationship between HLA-DRB1 genotypes and efficacy of oral type II collagen treatment using chicken cartilage soup in rheumatoid arthritis].

Science.gov (United States)

Toda, Y; Takemura, S; Morimoto, T; Ogawa, R

1997-02-01

The correlation between the efficacy of type II collagen (C II) treatment of the rheumatoid arthritis (RA) and the existence of HLA-DRB 1 * 0405 allele was investigated in two groups of patients; the first group had HLA-DRB 1 * 0405 allele (the 0405 group) and the second had no such allele (the non-0405 group). Thirty-eight RA patients were given a chicken cartilage soup containing heat degenerated C II (the CII group) or a placebo soup (the placebo group) for three months. The 38 cases were composed of 11 cases in the 0405/C II group, 9 in the 0405/placebo group, 11 in the non-0405/C II group, 9 cases in the non-0405/placebo group. In the C II group, there was a significant increase in the anti-human C II IgA antibody serum titers (p = 0.003) and significant decrease in the anti-human C II IgG titer (p II and 0405/placebo groups (p of the swollen joints = 0.03, and p of the tender joints = 0.03), and between the 0405/C II and non-0405/C II groups (p = 0.006 and 0.01, respectively). We concluded that oral C II could have a therapeutic efficacy in RA patients with HLA-DRB 1 * 0405 allele.

30 CFR 250.123 - Will MMS allow gas storage on unleased lands?

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Will MMS allow gas storage on unleased lands? 250.123 Section 250.123 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR... § 250.123 Will MMS allow gas storage on unleased lands? You may not store gas on unleased lands unless...

Upper mantle dynamics of Bangladesh by splitting analysis of core-mantle refracted SKS, PKS, and SKKS phases

Science.gov (United States)

Tiwari, Ashwani Kant; Bhushan, Kirti; Eken, Tuna; Singh, Arun

2018-06-01

New shear wave splitting measurements are obtained from the Bengal Basin using core-mantle refracted SKS, PKS, and SKKS phases. The splitting parameters, namely time delays (δ t) and fast polarization directions (ϕ), were estimated through analysis of 54 high-quality waveforms (⩾ 2.5 signal to noise ratio) from 30 earthquakes with magnitude ⩾ 5.5 recorded at ten seismic stations deployed over Bangladesh. No evidence of splitting was found, which indicates azimuthal isotropy beneath the region. These null measurements can be explained by either vertically dipping anisotropic fast axes or by the presence of multiple horizontal anisotropic layers with different fast polarization directions, where the combined effect results in a null characterization. The anisotropic fabric preserved from rifting episodes of Antarctica and India, subduction-related dynamics of the Indo-Burmese convergence zone, and northward movement of the Indian plate creating shear at the base of the lithosphere can explain the observed null measurements. The combined effect of all these most likely results in a strong vertical anisotropic heterogeneity, creating the observed null results.

123I and 13I purification for biomolecules labelling

International Nuclear Information System (INIS)

Catanoso, Marcela Forli

2011-01-01

The 123 I and 131 I are iodine radioisotopes widely used in Nuclear Medicine. The radioisotope 123 I is used in diagnosis through the SPECT technique and is routinely produced at IPEN in cyclotron through the reaction: '1 24 Xe (p, 2n) '1 23 Cs -> 123 Xe -> 123 I. The radioisotope 131 I is used both in diagnosis and therapy due to its physical characteristics of decay by β - and its γ-ray emissions that are softened with the use of specific collimators for diagnosis. It is routinely produced at IPEN using the nuclear reactor through the indirect reaction: 130 Te (n, γ) -> 131 Te -> 131 I, irradiating compounds containing Te. The radiopharmaceuticals prepared with these radioisotopes go through rigorous quality control tests and the chemical purity of the primary radioisotopes 123 I and 131 I are within the permissible limits currently defined. However, the presence of some chemical contaminants can prejudice the biomolecules labeling (monoclonal antibodies and peptides), that will produce radiopharmaceuticals of first generation to the oncology area. The aim of this work was to obtain a new purification method of these radioisotopes, allowing the labeling of biomolecules and also to established a process control on those radioisotopes. The methodology was separated on 3 steps: Evaluation of '1 23 I e 131 I radionuclidic purity using a hyper pure germanium detector, chemical purity using ICP-OES and the retention and elution study of 131 I in several absorbers to choose the most appropriate for the purification tests analyzing the behavior of the possible contaminants. The radionuclidic analyses showed the presence of Te and Co on 131 I samples and Te, Tc e Co on 123 I samples. The chemical purity analyses showed the presence of Al and Mo in 123 I, coming from the window material of the target holder and the presence of Al and Te in 131 I samples, coming from the target holder and the target, respectively. The retention and elution study selected the most

Acute 1,2,3-trichloropane poisoning: a case report and literature review.

Science.gov (United States)

Han, Hui

2010-12-01

1,2,3-Trichloropropane is widely used in industrial and agricultural production. However 1,2,3-trichloropropane poisoning has been rarely encountered in clinical practices. Here, a 45-year-old farmer who suffered fulminant hepatic failure due to ingestion of 1,2,3-trichloropropane has been reported and literature about 1,2,3-trichloropane poisoning has been reviewed. For this case, reduced glutathione, vitamin K, pantoprazole were infused intravenously, and transfusion of blood plasma, platelets and red blood cells were carried out. Unfortunately, the patient's family gave up treatment and they left the hospital with the patient because of the low chance of recovery 20 hr after admission. Based on blood toxicology screening, patient history and rapid deterioration of the patient, the cause of fulminant hepatic failure was determined to be acute intoxication of 1,2,3-trichloropropane by unintentional toxicity. 1,2,3-trichloropropane has histopathological toxic effects on many organs and this toxic effect occurs within a short period after ingestion, with liver as the major affected organ. © 2010 The Author. Basic & Clinical Pharmacology & Toxicology © 2010 Nordic Pharmacological Society.

I-123(131)-metyrapone for imaging of the adrenal cortex

International Nuclear Information System (INIS)

Zolle, I.; Bergmann, H.; Hoefer, R.; Robien, W.

1982-01-01

Attempts to label metyrapone with radioiodine resulted in the synthesis of 4'-bromometyrapone that is labelled with I-123(131) by halogen exchange before use. The synthesis of I-123(131)-metyrapone involves 4 intermediate compounds. 4'-bromometyrapone serves as a precursor with indefinite shelf-life that is labelled selectively in the 4'-position of ring B. Studies of the biodistribution of I-131-metyrapone indicate the highest concentration in the adrenal gland 10-20 min after injection, peak uptake in the normal adrenal corresponds to 0.2% of the administered dose. In hyperfunctioning adrenals the uptake is higher. In a patient with bilateral modular hyperplasia, 0.8% of the injected radioactivity were measured in the enlarged adrenals at 2 resp. 2.8 hrs after injection of I-123-metyrapone. We have performed the first adrenal scintigram on the same patient with 1.25 mCi of I-123-metyrapone. (Author)

Synthesis of 123I-16 iodo estradiol

International Nuclear Information System (INIS)

Therain, F.; Gros, J.; Souchu, A.

1982-01-01

16α iodo estradiol has been demonstrated to have as good an affinity as estradiol for estrogen-receptors and, labeled with iodine 123, may provide a good scanning agent fot visualisation of tissues containing estrogen-repectors, especially mammary tumors. 123 I-16α iodo estradiol has been synthesized by an halogen exchange of 16ν bromo estradiol according to the procedure described by Hochberg for 125 I-16α iodo estradiol labeling. Radiochemical yields are much lower than with iodine 125 (1 to 30%) and extremely variable. Specific activity range from 1,000 to 2,000 Ci/mmole [fr

Iodine-123 program at the TRIUMF laboratory

International Nuclear Information System (INIS)

Vincent, J.S.

1985-01-01

A research program for the production and utilization of iodine-123 is described. From 1979 to 1982 the spallation of elemental cesium by 500-MeV protons was used to provide 100 mCi/hr at the end of bombardment (EOB). Contaminants were 3% iodine-125 and 0.15% tellurium-121 at EOB + 36 hr. The material from weekly runs was used by remote clinics in Canada for evaluation as a radiochemical and for labeling studies. A new facility at TRIUMF will be operational in 1983 to produce iodine-123 by the (p,5n) reaction

Coulomb excitation of {sup 123}Cd

Energy Technology Data Exchange (ETDEWEB)

Hartig, Anna-Lena; Kroell, Thorsten; Ilieva, Stoyanka; Boenig, Sabine; Thuerauf, Michael [IKP, TU Darmstadt (Germany); Simpson, Gary; Drouet, Floriane; Ramdhane, Mourad [LPSC, Grenoble (France); Georgiev, Georgi [CSNSM, Orsay (France); Kesteloot, Nele; Wrzosek-Lipska, Kasia [KU, Leuven (Belgium); Jungclaus, Andrea; Illana Sison, Andres [CSIC, Madrid (Spain); Balabanski, Dimiter [INRNE-BAS, Sofia (Bulgaria); Warr, Nigel [Koeln Univ. (Germany). IKP; Voulot, Didier; Wenander, Fredrik; Marsh, Bruce [CERN, Geneva (Switzerland)

2013-07-01

On the neutron-rich side of the valley of stability in the vicinity of the double magic nucleus {sup 132}Sn one can find the {sup 123}Cd isotope. Surprisingly the neutron-rich even-A Cd isotopes in this region are showing signs of collectivity beyond that calculated by modern shell-model predictions. In order to gain a deeper insight in this phenomenon we started to extend these studies to odd-A Cd isotopes. As first isotope the exotic nucleus {sup 123}Cd was produced for safe Coulomb excitation by the ISOLDE facility at CERN and post-accelerated by REX-ISOLDE. The γ-decay from excited states was detected with the MINIBALL array. A report on the status of the ongoing analysis is given.

Tentative detection of warm intervening gas towards PKS 0548-322 with XMM-Newton

Energy Technology Data Exchange (ETDEWEB)

Barcons, X.

2005-03-17

We present the results of a long ({approx} 93 ksec) XMM-Newton observation of the bright BL-Lac object PKS 0548-322 (z = 0.069). Our Reflection Grating Spectrometer (RGS) spectrum shows a single absorption feature at an observed wavelength {lambda} = 23.33 {+-} 0.01 {angstrom} which we interpret as OVI K{alpha} absorption at z = 0.058, i.e., {approx} 3000 km s{sup -1} from the background object. The observed equivalent width of the absorption line {approx} 30m {angstrom}, coupled with the lack of the corresponding absorption edge in the EPIC pn data, implies a column density N{sub OVI} {approx} 2 x 10{sup 16} cm{sup -2} and turbulence with a Doppler velocity parameter b > 100 km s{sup -1}. Within the limitations of our RGS spectrum, no OVII or OV K{alpha} absorption are detected. Under the assumption of ionization equilibrium by both collisions and the extragalactic background, this is only marginally consistent if the gas temperature is {approx} 2.5 x 10{sup 5} K, with significantly lower or higher values being excluded by our limits on OV or OVII. If confirmed, this would be the first X-ray detection of a large amount of intervening warm absorbing gas through OVI absorption. The existence of such a high column density absorber, much stronger than any previously detected one in OVI, would place stringent constraints on the large-scale distribution of baryonic gas in the Universe.

The z = 0.8596 damped Ly-alpha absorbing galaxy toward PKS 0454+039

Science.gov (United States)

Steidel, Charles C.; Bowen, David V.; Blades, J. Chris; Dickenson, Mark

1995-01-01

We present Hubble Space Telescope (HST) and ground-based data on the Z(sub abs) = 0.8596 metal-line absorption system along the line of sight to PKS 0454+0356. The system is a moderate-redshift damped Ly-alpha system, with N(H I) = (5.7 +/- 0.3) x 10(exp 20)/sq cm as measured from the Faint Object Spectrograph (FOS) spectrum. We also present ground-based images which we use to identify the galaxy which most probably gives rise to the damped system; the most likely candidate is relatively underluminous by QSO absorber standards M(sub B) approximately -19.0 for A(sub 0) = 0.5 and H(sub 0) = 50 km/s/Mpc) and lies approximately 8.5/h kpc in projection from the QSO sight line. Ground-based measurements of Zn II, Cr II, and Fe II absorption lines from this system allow us to infer abundances of (Zn/H) = -1.1, (Cr/H) = -1.2, and (Fe/H) = -1.2 indicating overall metallicity similar to damped systems at z is greater than 2, and that the depletion of Cr and Fe onto dust grains may be even less important than in many of the high-redshift systems of comparable metallicity. Limits previously placed on the 21 cm optical depth in the z = 0.8596 system, together with our new N(H I) measurement, suggest a very high spin temperature for the H I, T(sub s) is greater than 580 K.

Clinical evaluation of sup 123 I-BMIPP myocardial scintigraphy in patients with hypertrophic cardiomyopathy

Energy Technology Data Exchange (ETDEWEB)

Ohtsuki, Katsuichi; Sugihara, Hiroki; Umamoto, Ikuo (Kyoto Prefectural Univ. of Medicine (Japan)) (and others)

1992-02-01

{sup 123}I-{beta}-methyl-p-iodophenylpentadecanoic acid ({sup 123}I-BMIPP) myocardial scintigraphy was performed in 13 patients with hypertrophic cardiomyopathy and compared with {sup 201}Tl myocardial scintigraphy performed within 3 months for evaluating the clinical significance of {sup 123}I-BMIPP myocardial scintigraphy. SPECT images were divided into 13 segments and segmental images were visually scored on a 4 (increased tracer uptake) to 0 (severely decreased tracer uptake) scale according to the tracer uptake. In comparison of {sup 123}I-BMIPP early images and {sup 201}Tl perfusion images, mismatches were seen in about 70% of all segments. The number of segments demonstrating lower myocardial uptake of {sup 123}I-BMIPP was larger than that of {sup 201}Tl. In hypertrophic regions, the tracer uptake of {sup 123}I-BMIPP early images was significantly lower than that of {sup 201}Tl images and the lower uptake of {sup 123}I-BMIPP delayed images was more marked. In non-hypertrophic regions, no significant difference was seen between the tracer uptakes of {sup 123}I-BMIPP early images and {sup 201}Tl images but the tracer uptake of {sup 123}I-BMIPP delayed images was significantly lower than that of {sup 201}Tl images. The mismatch between the tracer uptakes of {sup 123}I-BMIPP images and {sup 201}Tl images was thought to be a reflection of disordered myocardial fatty acid metabolism. 'Washout', the difference between the tracer uptakes of {sup 123}I-BMIPP early images and delayed images was also thought to be a reflection of disordered myocardial fatty acid metabolism. These results suggest that {sup 123}I-BMIPP is a promising radiopharmaceutical for evaluating disordered myocardial fatty acid metabolism in patients with HCM. (author).

The Root Hair Specific SYP123 Regulates the Localization of Cell Wall Components and Contributes to Rizhobacterial Priming of Induced Systemic Resistance

Directory of Open Access Journals (Sweden)

Cecilia Rodriguez-Furlán

2016-07-01

Full Text Available Root hairs are important for nutrient and water uptake and are also critically involved the interaction with soil inhabiting microbiota. Root hairs are tubular-shaped outgrowths that emerge from trichoblasts. This polarized elongation is maintained and regulated by a robust mechanism involving the endomembrane secretory and endocytic system. Members of the syntaxin family of SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptor in plants (SYP, have been implicated in regulation of the fusion of vesicles with the target membranes in both exocytic and endocytic pathways. One member of this family, SYP123, is expressed specifically in the root hairs and accumulated in the growing tip region. This study shows evidence of the SYP123 role in polarized trafficking using knockout insertional mutant plants. We were able to observe defects in the deposition of cell wall proline rich protein PRP3 and cell wall polysaccharides. In a complementary strategy, similar results were obtained using a plant expressing a dominant negative soluble version of SYP123 (SP2 fragment lacking the transmembrane domain. The evidence presented indicates that SYP123 is also regulating PRP3 protein distribution by recycling by endocytosis. We also present evidence that indicates that SYP123 is necessary for the response of roots to plant growth promoting rhizobacterium (PGPR in order to trigger trigger induced systemic response (ISR. Plants with a defective SYP123 function were unable to mount a systemic acquired resistance (SAR in response to bacterial pathogen infection and induced systemic resistance (ISR upon interaction with rhizobacteria. These results indicated that SYP123 was involved in the polarized localization of protein and polysaccharides in growing root hairs and that this activity also contributed to the establishment of effective plant defense responses. Root hairs represent very plastic structures were many biotic and abiotic factors

Clinical significance of I-123 IMP brain SPECT in children with brain diseases

International Nuclear Information System (INIS)

Takishima, Teruo; Machida, Kikuo; Honda, Norinari; Mamiya, Toshio; Takahashi, Taku; Kamano, Tsuyoshi; Hasegawa, Noriko

1990-01-01

Single photon emission computed tomography (SPECT) of the brain using N-isopropyl p-I-123-iodoamphetamine (I-123 IMP) was performed in 43 children with suspected brain diseases. Forty-three children (25 males and 18 females), with an age range of 24 days-15 years (mean: 6.6 years), were included in the study. Six patients were subsequently diagnosed as normal. Early SPECT of the brain was performed 30 minutes after intravenous administration of 74-111 MBq (2-3 mCi) I-123 IMP using a rotating gamma camera equipped with a 30-degree slant hole and medium energy collimator. Transverse images were reconstructed by Shepp-Logan filtered back projection method with attenuation correction after spatial filtering using an 8th order Butterworth-Wiener filter. Findings of I-123 IMP SPECT were compared with those of X-ray computed tomography (CT) and electroencephalography (EEG). The results showed that in I-123 IMP SPECT, abnormality was found in 30 out of 37 children with brain diseases. The incidence of abnormal findings in the 37 patients was 81% in I-123 IMP SPECT, 61% in X-ray CT, and 78% in EEG; in both cryptogenic and secondary epilepsy, the incidence of abnormality was higher in I-123 IMP SPECT than in X-ray CT. (70% and 94% vs 50% and 81% respectively), and epileptic foci detected by EEG did not correspond with defects found using I-123 IMP SPECT in 27% of the patients; and in asphyxiated infants, a high incidence of abnormality was observed on both I-123 IMP SPECT (86%) and X-ray CT (86%). In conclusion, I-123 IMP SPECT is a clinically useful examination in children with brain disease. (author)

Radiosynthesis of 123I-labeled hesperetin for biodistribution study of orally administered hesperetin

International Nuclear Information System (INIS)

Jongho Jeon; So-Young Ma; Dae Seong Choi; Beom-Su Jang; Jung Ae Kang; You Ree Nam; Seonhye Yoon; Sang Hyun Park; Korea University of Science and Technology, Daejeon

2015-01-01

The purpose of this study is to synthesize 123 I-labeled hesperetin and to investigate its in vivo behavior. The optimized labeling condition provided two isomers of 123 I-labeled hesperetin with high radiochemical yields and radiochemical purities. Both 123 I-labeled products were orally administered to normal ICR mice, and the initial result showed that most of 123 I activity was detected in the stomach and the intestines. A part of 123 I-labeled hesperetin was absorbed from the small intestine to bloodstream and then it was distributed in normal organs. The results in the present study provided an efficient radiolabeling method of flavonoid and quantitative organ distribution of orally administered hesperetin. (author)

Iodine-123 in Western Europe

International Nuclear Information System (INIS)

Qaim, S.M.; Stoecklin, G.; Weinreich, R.

1976-08-01

The major object of this panel was to obtain information on the state of art of Iodine-123 production in Western Europe. Technical, medical and organizational problems were discussed extensively during the one-day meeting and a stimulating exchange of information between the various 123 I-producers and users has been initiated. Some specific examples of medical application were also included in order to get a feeling of the degree of acceptance by the medical community and the demand for this isotope. The meeting clearly demonstrated the great demand for this isotope but it also showed that the present rate of production is well below the demand. In order to fill this gap, not only further technical development is needed but also the organizational question of distribution has to be solved, perhaps within a network of collaborating cyclotrons, a task which is considerably more difficult in Western Europe than in the USA. (orig./HP) [de

Genome-Wide Identification and Evolutionary Analysis of Sarcocystis neurona Protein Kinases.

Science.gov (United States)

Murungi, Edwin K; Kariithi, Henry M

2017-03-21

The apicomplexan parasite Sarcocystis neurona causes equine protozoal myeloencephalitis (EPM), a degenerative neurological disease of horses. Due to its host range expansion, S. neurona is an emerging threat that requires close monitoring. In apicomplexans, protein kinases (PKs) have been implicated in a myriad of critical functions, such as host cell invasion, cell cycle progression and host immune response evasion. Here, we used various bioinformatics methods to define the kinome of S. neurona and phylogenetic relatedness of its PKs to other apicomplexans. We identified 97 putative PKs clustering within the various eukaryotic kinase groups. Although containing the universally-conserved PKA (AGC group), S. neurona kinome was devoid of PKB and PKC. Moreover, the kinome contains the six-conserved apicomplexan CDPKs (CAMK group). Several OPK atypical kinases, including ROPKs 19A, 27, 30, 33, 35 and 37 were identified. Notably, S. neurona is devoid of the virulence-associated ROPKs 5, 6, 18 and 38, as well as the Alpha and RIO kinases. Two out of the three S. neurona CK1 enzymes had high sequence similarities to Toxoplasma gondii TgCK1-α and TgCK1-β and the Plasmodium PfCK1. Further experimental studies on the S. neurona putative PKs identified in this study are required to validate the functional roles of the PKs and to understand their involvement in mechanisms that regulate various cellular processes and host-parasite interactions. Given the essentiality of apicomplexan PKs in the survival of apicomplexans, the current study offers a platform for future development of novel therapeutics for EPM, for instance via application of PK inhibitors to block parasite invasion and development in their host.

Genome-Wide Identification and Evolutionary Analysis of Sarcocystis neurona Protein Kinases

Directory of Open Access Journals (Sweden)

Edwin K. Murungi

2017-03-01

Full Text Available The apicomplexan parasite Sarcocystis neurona causes equine protozoal myeloencephalitis (EPM, a degenerative neurological disease of horses. Due to its host range expansion, S. neurona is an emerging threat that requires close monitoring. In apicomplexans, protein kinases (PKs have been implicated in a myriad of critical functions, such as host cell invasion, cell cycle progression and host immune response evasion. Here, we used various bioinformatics methods to define the kinome of S. neurona and phylogenetic relatedness of its PKs to other apicomplexans. We identified 97 putative PKs clustering within the various eukaryotic kinase groups. Although containing the universally-conserved PKA (AGC group, S. neurona kinome was devoid of PKB and PKC. Moreover, the kinome contains the six-conserved apicomplexan CDPKs (CAMK group. Several OPK atypical kinases, including ROPKs 19A, 27, 30, 33, 35 and 37 were identified. Notably, S. neurona is devoid of the virulence-associated ROPKs 5, 6, 18 and 38, as well as the Alpha and RIO kinases. Two out of the three S. neurona CK1 enzymes had high sequence similarities to Toxoplasma gondii TgCK1-α and TgCK1-β and the Plasmodium PfCK1. Further experimental studies on the S. neurona putative PKs identified in this study are required to validate the functional roles of the PKs and to understand their involvement in mechanisms that regulate various cellular processes and host-parasite interactions. Given the essentiality of apicomplexan PKs in the survival of apicomplexans, the current study offers a platform for future development of novel therapeutics for EPM, for instance via application of PK inhibitors to block parasite invasion and development in their host.

Myocardial metabolism of 123I-BMIPP under low-dose dobutamine infusion: implications for clinical SPECT imaging of ischemic heart disease

International Nuclear Information System (INIS)

Hosokawa, Ryohei; Fujita, Masatoshi; Kambara, Naoshige; Ohba, Muneo; Tadamura, Eiji; Kimura, Takeshi; Kita, Toru; Nohara, Ryuji; Hirai, Taku; Fujibayashi, Yasuhisa

2005-01-01

123 I-(p-iodophenyl)-3-(R,S)-methylpentadecanoic acid ( 123 I-BMIPP) is a fatty acid analog for single-photon emission computed tomography (SPECT) imaging that is mainly stored in the triglyceride pool. Low-dose dobutamine infusion has been reported to improve BMIPP uptake in the stunned myocardium, but the mechanism underlying this effect remains unclear. The purpose of this study was therefore to investigate the myocardial metabolism of 123 I-BMIPP in the stunned myocardium under low-dose dobutamine infusion, and to elucidate the mechanism by which dobutamine improves BMIPP uptake. Using open-chest dogs, stunned myocardium was induced by occlusion of the left anterior descending artery (LAD) for 30 min, with subsequent reperfusion (ischemia group, n=6). After direct injection of BMIPP into the LAD, myocardial extraction and retention were examined and metabolites evaluated (using high-performance liquid chromatography) during dobutamine infusion. The results in the ischemia group were compared with findings obtained in a control group under dobutamine infusion (n=6). Dobutamine infusion significantly increased both the rapid extraction (within 30 s) of BMIPP into the myocardium (control vs ischemia group: 48±19% vs 66±14%, p<0.05) and its subsequent retention (73±13% vs 85±8%, p<0.05). The metabolites from the myocardium consisted of back diffusion of nonmetabolized BMIPP, the alpha-oxidation metabolite, intermediate metabolites, and the full-oxidation metabolite. Among these metabolites, the full-oxidation metabolite decreased significantly (from 34.0±20.0% to 15.8±9.3%, p<0.05) in the stunned regions, though back diffusion of nonmetabolized BMIPP increased (from 51.3±21.9% to 71.3±10.1%, p<0.05). These results indicate that increased uptake of BMIPP in stunned myocardium is mainly due to decreased beta-oxidation in tissue and increased shunt retention of BMIPP in the triglyceride pool, and thereby provide further insight into the pathophysiology of

21 CFR 516.123 - Informal conferences regarding agency administrative actions.

Science.gov (United States)

2010-04-01

... exemption, determining that a qualified expert panel does not meet the selection criteria, denying a request... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Informal conferences regarding agency administrative actions. 516.123 Section 516.123 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH...

Evaluation of myocardial uptake of {beta}-methyl-({sup 123}I)-iodophenylpentadecanoic acid ({sup 123}II-BMIPP)

Energy Technology Data Exchange (ETDEWEB)

Momose, Mitsuru; Kobayashi, Hideki; Matsumoto, Nobusuke; Maki, Masako; Kusakabe, Kiyoko [Tokyo Women`s Medical Coll. (Japan); Saito, Katsumi; Hosoda, Saichi

1994-12-01

To evaluate the myocardial uptake of {beta}-methyl-({sup 123}I)-iodophenylpentadecanoic acid ({sup 123}I-BMIPP), nineteen patients with ischemic heart disease including left ventricular hypertrophy (mean age 63{+-}7.8, 14 males and 5 females) underwent BMIPP myocardial scintigraphy. Myocardial uptake (MU) of BMIPP to the total injected dose was calculated from anterior veiw of the planar image in all subjects, and was compared with plasma glucose (BS), triglyceride (TG), and free fatty acid (FFA). It was also compared with left ventricular mass (LVM) calculated with echocardiography. MU was not related to BS, TG, and FFA, however had the positive correlation with LVM (r=0.676, p<0.01). Myocardial uptake per left ventricular mass (MU/LVM) had the negative correlation with LVM (r=-0.671, p<0.01). Further studies for the significance of MU/LVM will be required. (author).

Kinetics of 17-(123I) iodoheptadecanoic acid in myocardium of rats

International Nuclear Information System (INIS)

Reske, S.N.; Auner, G.; Winkler, C.

1983-01-01

Myocardial uptake and turnover of 17-( 123 I)-iodoheptadecanoic acid, injected i.v., was studied in rats. Kinetics of radioactivity incorporated into myocardial tissue and heart lipids as well as myocardial radioactivity recovered as 123 I iodide were determined. Maximal heart uptake of IHA (7.9% dose/g) heart was observed as early as 30 sec., p.i., followed by monocomponent elimination period. Already 10 to 30 sec p.i. 70 to 80% of total myocardial radioactivity was recovered as 123 I iodide. IHA was incorporated only in modest amounts into myocardial phospholipids and triglycerides. Time course of total myocardial radioactivity grossly paralleled to that recovered as 123 I iodide. These findings indicate stringent limitations in utility of IHA as a tracer for assessment of β-oxidation. (author)

Iodine-123-labeled meta-iodobenzylguanidine myocardial scintigraphy evaluation of Machado-Joseph disease

International Nuclear Information System (INIS)

Kazuta, Toshinari; Hayashi, Michiyuki; Yoshita, Mitsuhiro; Hirai, Shunsaku

1998-01-01

Iodine-123-labeled meta-iodobenzylguanidine (( 123 I)MIBG), an analogue of guanetidine, is used as a tracer for evaluation of the function of sympathetic neurons. To investigate cardiac sympathetic function in Machado-Joseph disease (MJD), ( 123 I)MIBG myocardial scintigraphy was performed in 12 patients with MJD and 20 controls. In planar imaging studies, the heart to the mediastinum of the average count ratio (H/M) was calculated for both early and delayed images. The mean values of H/M in delayed images of MJD was lower than those of controls (p 123 I)MIBG myocardial scintigraphy in MJD can be seen earlier than abnormal sudomotor system detected by SSR. (author)

21 CFR 163.123 - Sweet chocolate.

Science.gov (United States)

2010-04-01

... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.123 Sweet chocolate. (a... specified in paragraph (b)(3) of this section are used in the breakfast cocoa, the label shall bear an...

Search for a narrow baryonic state decaying to pKS0 and p‾KS0 in deep inelastic scattering at HERA

Directory of Open Access Journals (Sweden)

H. Abramowicz

2016-08-01

Full Text Available A search for a narrow baryonic state in the pKS0 and p‾KS0 system has been performed in ep collisions at HERA with the ZEUS detector using an integrated luminosity of 358pb−1 taken in 2003–2007. The search was performed with deep inelastic scattering events at an ep centre-of-mass energy of 318GeV for exchanged photon virtuality, Q2, between 20 and 100GeV2. Contrary to evidence presented for such a state around 1.52 GeV in a previous ZEUS analysis using a sample of 121 pb−1 taken in 1996–2000, no resonance peak was found in the p(p‾KS0 invariant-mass distribution in the range 1.45–1.7 GeV. Upper limits on the production cross section are set.

Myocardial imaging with 9-[Te-123m]tellurapheptadecanoic acid

International Nuclear Information System (INIS)

Elmaleh, D.R.; Knapp, F.F.; Yasuda, T.; Coffey, J.L.; Kopiwoda, S.; Okada, R.; Strauss, W.H.

1981-01-01

The distribution of radioactivity in the myocardium of rats and dogs infarcted by ligation of the left anterior coronary artery has been determined after intravenous injection of 9-[Te-123m]telluraheptadecanoic acid (Te-123m HDA). In rats the normal myocardium concentrated radioactivity (3.7% +/- 0.28 injected dose/g) to nearly three times that in the zones of infarction (1.12% +/- 0.18 dose/g). The focal defects detected in the gamma-camera images of rats and dogs correspond well with areas of infarction identified in the excised hearts by staining with triphenyltetrazolium chloride. The distribution of radioactivity from Te-123m HDA in dog hearts sectioned at autopsy showed a linear correlation (r = 0.94) with blood flow as determined with scandium-46-labeled microspheres

Investigation of regional cerebral blood flow in alcoholic Korsakoff`s syndrome with {sup 123}I-IMP SPECT

Energy Technology Data Exchange (ETDEWEB)

Nakamura, Makoto; Nomura, Soichiro [Tachikawa Hospital, Tokyo (Japan); Kato, Motoichiro; Nakazawa, Tsuneyuki

1995-05-01

Regional cerebral blood flow (rCBF) was determined quantitatively by single photon emission computed tomography (SPECT) using N-isopropyl-p-[{sup 123}I]iodoamphetamine ({sup 123}I-IMP) in 6 patients with alcoholic Korsakoff`s syndrome (A group). The findings were compared with concurrently available findings from 6 alcoholic patients with no evidence of cerebral disordres such as Korsakoff`s syndrome and dementia (B group) and 4 healthy persons (C group). In both A and B groups, diffuse decrease in blood flow was significantly observed in the entire brain, as compared with the C group; no significant difference in the decreased blood flow existed between the A and B groups. According to the WAIS results, the patients in the A group were classified as `typical Korsakoff`s syndrome` (full IQ of 90 or more) and as `serious Korsakoff`s syndrome` (full IQ of 89 or less). rCBF in the thalamus was significantly lower in the A group of patients with typical Korsakoff`s syndrome than the B group. These findings may reflect the variety of alcoholic Korsakoff`s syndrome. This may also have an implication for the possible classification of several types in this syndrome. (N.K.).

21 CFR 123.10 - Training.

Science.gov (United States)

2010-04-01

... HACCP principles to fish and fishery product processing at least equivalent to that received under... standardized curriculum. (a) Developing a HACCP plan, which could include adapting a model or generic-type HACCP plan, that is appropriate for a specific processor, in order to meet the requirements of § 123.6(b...

Serial lung imaging with 123I-IMP in localized pulmonary lesions

International Nuclear Information System (INIS)

Nakajo, Masayuki; Shimada, Jurio; Shimozono, Michiko; Uchiyama, Noriaki; Hiraki, Yoshiyuki; Shinohara, Shinji.

1988-01-01

123 I-IMP (N-isopropyl-p-[ 123 I]-iodoamphetamine) dynamic (1 frame/min for 25 mins), 30-min and 4-hr static lung imaging was performed in a total of 65 patients with roentgenographic evidence of localized pulmonary lesion (12 with pneumonia, one with lung abscess, 5 with pulmonary tuberculosis, 3 with pneumoconiosis, one with lung fluke disease and 43 with various histological types of primary lung cancer). The findings in 65 of 70 (95 %) lesions in the initial 1 or 2-min dynamic 123 I-IMP images were analogous to those obtained by 99m Tc-MAA lung perfusion imaging and decreased activity was observed in 68 of 70 (97 %) lesions, suggesting that the initial images mainly reflected the relative distribution of pulmonary arterial blood flow. However, 123 I-IMP accumulated differently according to the pathological conditions afterwards. Decrease activity from 123 I-IMP was contineously observed in a cavity of the lung abscess, 2 of 2 tuberculomas, 3 of 7 large nodules of pneumoconiosis and all of the 42 cancerous lesions which were possible to be evaluated. Gradual increased in activity relative to that of ''normal lung fields'' was observed in all 14 lesions of pneumonia; pneumonic lesions of the lung abscess, tuberculosis and lung fluke disease; 4 of 7 large nodules of pneumoconiosis; all of 8 atelectatic lesions and 32 of 44 areas surrounding cancers (most of them had roentgenographic evidence of infiltrating shadows). Thus 123 I-IMP accumulated increasingly in pneumonic and atelectatic lesions, while it appeared not to accumulate in such lesions replacing lung tissues as cavity, caseous and fibrous lesions and primary lung cancers. 123 I-IMP can be used as a new lung imaging agent to provide diagnostic informations on the property of pulmonary lesions. (author)

19 CFR 123.27 - Feeding and watering animals in Canada.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Feeding and watering animals in Canada. 123.27...; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.27 Feeding and watering animals in Canada. If animals in sealed conveyances or compartments...

123I-β-CIT SPECT imaging study in early Parkinson's disease

International Nuclear Information System (INIS)

Li Peiyong

1998-01-01

Purpose: To investigate the loss of dopamine transporters in hemi-Parkinson's disease (PD) using 123 I-β-CIT/SPECT. Methods: Seven patients with hemi-Parkinson's disease and 7 age- and sex- matched healthy subjects were studied by 123 I-β-CIT/SPECT. Striatal specific uptake of 123 I-β-CIT was calculated in the ratio of striatal uptake to cerebellar uptake. Results: Mean striatal specific uptake of 123 I-β-CIT in healthy subjects was 3.0 +- 0.5 and 5.5 +- 0.6 at 3h and 18h after injection. Striatal specific uptake in contralateral to the clinical symptom side was 2.0 +- 0.8 and 3.1 +- 0.4; in ipsilateral striatum was 2.3 +- 0.4 and 4.0 +- 0.5. There was a significant reduction of striatal tracer uptake in PD patients compared to the controls. Patient age correlated with the reduction in contralateral striatum but did not correlate with that in ipsilateral striatum. Conclusions: Striatal dopamine transporters bilaterally lost in early PD patients. 123 I-β-CIT uptake in contralateral striatum was reduced more severely than in ipsilateral striatum

Development of the radiosynthesis of high-specific-activity 123I-NKJ64

International Nuclear Information System (INIS)

Tavares, Adriana Alexandre S.; Jobson, Nicola K.; Dewar, Deborah; Sutherland, Andrew; Pimlott, Sally L.

2011-01-01

Introduction: 123 I-NKJ64, a reboxetine analogue, is currently under development as a potential novel single photon emission computed tomography radiotracer for imaging the noradrenaline transporter in brain. This study describes the development of the radiosynthesis of 123 I-NKJ64, highlighting the advantages and disadvantages, pitfalls and solutions encountered while developing the final radiolabelling methodology. Methods: The synthesis of 123 I-NKJ64 was evaluated using an electrophilic iododestannylation method, where a Boc-protected trimethylstannyl precursor was radioiodinated using peracetic acid as an oxidant and deprotection was investigated using either trifluoroacetic acid (TFA) or 2 M hydrochloric acid (HCl). Results: Radioiodination of the Boc-protected trimethylstannyl precursor was achieved with an incorporation yield of 92±6%. Deprotection with 2 M HCl produced 123 I-NKJ64 with the highest radiochemical yield of 98.05±1.63% compared with 83.95±13.24% with TFA. However, the specific activity of the obtained 123 I-NKJ64 was lower when measured after using 2 M HCl (0.15±0.23 Ci/μmol) as the deprotecting agent in comparison to TFA (1.76±0.60 Ci/μmol). Further investigation of the 2 M HCl methodology found a by-product, identified as the deprotected proto-destannylated precursor, which co-eluted with 123 I-NKJ64 during the high-performance liquid chromatography (HPLC) purification. Conclusions: The radiosynthesis of 123 I-NKJ64 was achieved with good isolated radiochemical yield of 68% and a high specific activity of 1.8 Ci/μmol. TFA was found to be the most suitable deprotecting agent, since 2 M HCl generated a by-product that could not be fully separated from 123 I-NKJ64 using the HPLC methodology investigated. This study highlights the importance of HPLC purification and accurate measurement of specific activity while developing new radiosynthesis methodologies.

I sup(123) target transfer system

International Nuclear Information System (INIS)

Almeida, G.L. de; Rautenberg, F.A.

1986-01-01

The construction of target transfer system using a robot into hot cell of IEN cyclotron (Brazilian-CNEN) for sup(123)I production is presented. The system operation is described, and the advantages are shown. (M.C.K.)

123I-BMIPP delayed scintigraphic imaging in patients with chronic heart failure

International Nuclear Information System (INIS)

Kida, Keisuke; Akashi, Yoshihiro J.; Yoneyama, Kihei; Shimokawa, Mitsuhiro; Musha, Haruki

2008-01-01

The objective of the present study was to clarify the ability of 123 I-beta-methyl-iodophenylpentadecanoic acid ( 123 I-BMIPP) to evaluate the heart-to-mediastinum (H/M) ratio and myocardial global washout rate (WR) in patients with chronic heart failure (CHF). The severity of CHF was evaluated on the basis of the New York Heart Association (NYHA) classification. Twenty patients with CHF (13 with idiopathic dilated cardiomyopathy and 7 with ischemic cardiomyopathy) and 11 age-matched controls underwent myocardial radionuclide imaging. Scintigraphic images were obtained from each participant at the early (30 min following radio-isotope injection) and late (4 h) phases using 123 I-BMIPP. The H/M ratio and WR were calculated from planar images. Concentrations of plasma brain natriuretic peptide (BNP) were measured prior to the scintigraphic study. The 123 I-BMIPP uptake of early H/M and global WR did not significantly differ among groups, but uptake of delayed H/M was significantly lower in patients with NYHA class III than in controls (control 2.47±0.39; class III 1.78±0.28 P 123 I-BMIPP uptake of delayed H/M enhances the image of CHF severity. The myocardial WR of 123 I-BMIPP also effectively depicted the severity of CHF. (author)

13 CFR 123.500 - Definitions.

Science.gov (United States)

2010-01-01

... Reservist Economic Injury Disaster Loans § 123.500 Definitions. The following terms have the same meaning wherever they are used in this subpart: (a) Essential employee is an individual (whether or not an owner of... economic injury means an economic harm to the small business such that it cannot: (1) Meet its obligations...

EFFECT OF A PLURONIC® P123 FORMULATION ON THE NITRIC OXIDE-GENERATING DRUG JS-K

Science.gov (United States)

Kaur, Imit; Kosak, Ken M.; Terrazas, Moises; Herron, James N.; Kern, Steven E.; Boucher, Kenneth M.; Shami, Paul J.

2014-01-01

Purpose O2-(2,4-dinitrophenyl)1-[(4-ethoxycarbonyl)piperazin-1-yl]diazen-1-ium-1,2-diolate] or JS-K is a nitric oxide-producing prodrug of the arylated diazeniumdiolate class with promising anti-tumor activity. JS-K has challenging solubility and stability properties. We aimed to characterize and compare Pluronic® P123-formulated JS-K (P123/JS-K) with free JS-K. Methods We determined micelle size, shape, and critical micelle concentration of Pluronic® P123. Efficacy was evaluated in vitro using HL-60 and U937 cells and in vivo in a xenog raft in NOD/SCID IL2Rγnull mice using HL-60 cells. We compared JS-K and P123/JS-K stability in different media. We also compared plasma protein binding of JS-K and P123/JS-K. We determined the binding and Stern Volmer constants, and thermodynamic parameters. Results Spherical P123/JS-K micelles were smaller than blank P123. P123/JS-K formulation was more stable in buffered saline, whole blood, plasma and RPMI media as compared to free JS-K. P123 affected the protein binding properties of JS-K. In vitro it was as efficacious as JS-K alone when tested in HL-60 and U937 cells and in vivo greater tumor regression was observed for P123/JS-K treated NOD/SCID IL2Rγnull mice when compared to free JS-K-treated NOD/SCID IL2Rγnull mice. Conclusions Pluronic® P123 solubilizes, stabilizes and affects the protein binding characteristics of JS-K. P123/JS-K showed more in vivo anti-tumor activity than free JS-K. PMID:25330743

Abnormal I-123 HIPDM images in various disease entities

International Nuclear Information System (INIS)

Shih, W.J.; Magoun, S.; Coupal, J.J.; Clark, D.B.; Dekosky, S.T.; Kung, H.F.; Beihn, R.; Ryo, U.Y.

1987-01-01

Eighty patients who were referred from neurology service for evaluation of stroke, Alzheimer disease (AD), and/or other neurologic diseases underwent the study. Four views of planar images were obtained following the intravenous injection of 3-5 mCi of I-123 HIPDM. SPECT images were then obtained using a camera interfaced to a PDP-11 computer. Forty of the 80 patients had scintigraphic findings of stroke, which correlated well with head CT/cerebral angiogram. Sixteen patients with AD had good correlation between the degree of temporoparietal abnormality in the images. Severe AD and severe stroke patients almost always had a positive planar image. Normal I-123 HIPDM localization in the brain requires intact cerebral flow and cerebral neuronal function. A focal area of decreased I-123 HIPDM localization may represent either interruption of blood flow or neurochemical dysfunction

Development of I-123 labeled angiostatin as a novel cancer imaging agent

International Nuclear Information System (INIS)

Lee, Kyung Han; Lee, Sang Yoon; Choe, Yearn Seong; Paik, Jin Young; Kim, Sun A; Han, Yu Mi; Kim, Byung Tae

2000-01-01

Since angiostatin is a promising anticancer agent that target tumor endothelial cells, it may have advantages over many current tumor imaging agents by overcoming problems such as poor delivery or multi-drug resistance. We therefore synthesized radiolabeled agniostatin and tested it in vivo. 123 -angiostatin was synthesized using the Bolton Hunter method. 123 I labeled plasminogen lysin-binding-site (LBS) was also synthesized. Blood clearance of he radiotracer was measured in SD rats, while tissue distribution was assessed in ICR mice at 1,4, and 18 hr. Pinhole scintigraphy was performed in SD rats and in nude mice bearing RR 1022 tumors at various time points. Radiochemical yield of 123 I-angiostatin approximated 20%. In vivo distribution demonstrated stability of the label for at least 20 hr. 123 I-angiostatin was cleared from the circulation in a biexponential manner with rapid early clearance followed by a slower rate of elimination Tissue distribution in mice showed the highest uptake in the kidneys which was the major route of excretion. This was followed by the lung, liver, and myocardium whose uptake of 1.5∼2% ID/gm at 1 hrs gradually decreased over time (all p 123 I-angiostatin and 123 I-LBS images in SD rates showed a similar distribution. Blood pool activity gradually cleared while tumor uptake increased over time, resulting in a high tumor to non tumor ratio at 20 hr. 123 I-angiostatin has promising potential as a new tumor imaging agent. Further study is warranted to assess its mechanism of uptake and precise role in cancer imaging

Uterine uptake of iodine-123 metaiodobenzylguanidine during the menstrual phase of uterine cycle

International Nuclear Information System (INIS)

Bomanji, J.; Britton, K.E.

1987-01-01

Radioiodinated I-123 metaiodobenzylguanidine (MIBG) has been used for diagnostic purposes for detection of apudomas. In this paper normal physiological uptake of I-123 MIBG by the uterus during the menstrual phase of the uterine cycle is reported. It is likely that I-123 MIBG can be used to evaluate some of the problems in this context

Uterine uptake of iodine-123 metaiodobenzylguanidine during the menstrual phase of uterine cycle

Energy Technology Data Exchange (ETDEWEB)

Bomanji, J.; Britton, K.E.

1987-08-01

Radioiodinated I-123 metaiodobenzylguanidine (MIBG) has been used for diagnostic purposes for detection of apudomas. In this paper normal physiological uptake of I-123 MIBG by the uterus during the menstrual phase of the uterine cycle is reported. It is likely that I-123 MIBG can be used to evaluate some of the problems in this context.

Cardiac iodine-123 metaiodobenzylguanidine uptake in animals with diabetes mellitus and/or hypertension

International Nuclear Information System (INIS)

Dubois, E.A.; Kam, K.L.; Somsen, G.A.; Boer, G.J.; Bruin, K. de; Batink, H.D.; Pfaffendorf, M.; Royen, E.A. van; Zwieten, P.A. van

1996-01-01

The aim of the present study was to evaluate the use of the noradrenaline analogue iodine-123 metaiodobenzylguanidine ([ 123 I]MIBG) for the assessment of cardiac sympathetic activity in the presence of diabetes mellitus and/or hypertension in animal models. One model used Wistar-Kyoto rats (WKY) and spontaneously hypertensive rats (SHR) rendered diabetic at 12 weeks of age by an intravenous injection of streptozotocin (STZ). The other model used lean and obese Zucker rats. In all groups basic haemodynamic values were established and animals received an intravenous injection of 50 μCi [ 123 I]MIBG. Initial myocardial uptake and washout rates of [ 123 I]MIBG were measured scintigraphically during 4 h. After sacrifice, plasma noradrenaline and left cardiac ventricular β-adrenoceptor density was determined. The diabetic state, both in STZ-treated rats (direct induction) and in obese Zucker rats (genetic induction), appeared to induce a lower cardiac density of β-adrenoceptors, indicative of increased sympathetic activity. Cardiac [ 123 I]MIBG then showed increased washouts, thereby confirming enhanced noradrenergic activity. This parallism of results led to the conclusion that [ 123 I]MIBG wash-out measurements could provide an excellent tool to assess cardiac sympathetic activity noninvasively. However, in hypertension (WKY vs SHR), both parameters failed to show parallelism: no changes in β-adrenoceptor density were found, whereas [ 123 I]MIBG wash-out rate was increased. Thus, either [ 123 I]MIBG washout or β-adrenoceptor density may not be a reliable parameter under all circumstances to detect changes in the release of noradrenaline. (orig./MG)

A modified method for preparation of 123I-HDA

International Nuclear Information System (INIS)

Chen Fang; Decristoforo, C.; Staeger, A.; Fridrich, L.

1994-01-01

A modified method for preparation of 123 I-Heptadecanoic acid ( 123 I-HDA) is described. The labelling yield is 92.8%(n = 32, 85%-97%)by heating time of 15 minutes. The overall recovery is about 70%. The time for the whole preparation is about 90 min. The method described is reliable, and convenient. A carrier free and precursor free product of high purity can be prepared in a reasonable short time

7 CFR 28.123 - Costs of practical forms of cotton standards.

Science.gov (United States)

2010-01-01

... 7 Agriculture 2 2010-01-01 2010-01-01 false Costs of practical forms of cotton standards. 28.123 Section 28.123 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE COMMODITY STANDARDS AND STANDARD...

Imaging tissue hypoxia: clinical and pre-clinical experience with 123IAZA

International Nuclear Information System (INIS)

Wiebe, L.I.

1997-01-01

The molecular mechanisms that underline the selective binding of iodazomycin arabinoside, IAZA, and related nitromidazoles are reviewed as a basis for interpretation of preclinical and clinical data for hypoxic binding of radioiodinated IAZA. Clinical data are presented for 123 IAZA uptake in a number of pathologies including metastatic tumours, peripheral vascular disease in diabetes, muscle stress and rheumatoid arthritis. The results of studies to determine the influence of tumour type on uptake of 123 I-IAZA in patients with a variety of deep-seated solid tumours will be presented. Correlations of hypoxia-dependent binding with 99m Tc-HMPAO perfusion images will be reviewed and early correlations of uptake to treatment response in cancer will be presented. Unusual features of 123 I-IAZA biodistribution will also be discussed together with detailed pharmacokinetic and radiation dosimetry data for '2 123 I- IAZA in normal volunteers

Level structure in 123Xe

International Nuclear Information System (INIS)

Luukko, A.; Hattula, J.; Helppi, H.; Knuuttila, O.

1980-09-01

The level structure of 123 Xe has been studied with 122 Te( 3 He,2n) and 123 Te( 3 He,3n) reactions using in-beam γ-ray spectroscopic methods. Band-like level structures based on the unique-parity hsub(11/2) neutron state and different low-j states are observed. The isomeric state proposed earlier is established at 185.4 keV with a half-life of 5.6+-0.3 μs, and a new spin assignment of 7/2 - is proposed for this level. A triaxial-rotor-model calculation has been performed to interprete the negative-parity level system. Because of the 7/2 - state, we do not obtain a consistent description of the negative-parity states with the triaxial rotor model, unlike the heavier odd-A Xe nuclei. On the other hand, the positive-parity level structures are interpreted in terms of the core-quasiparticle model supposing a vibrational core. This indicates different core shapes for the positive- and negative-parity level systems. (author)

Simultaneous 99mTc and 123I dual-isotope brain striatal phantom single photon emission computed tomography: validation of 99mTc-TRODAT-1 and 123I-IBZM simultaneous dopamine system brain imaging.

Science.gov (United States)

Kao, Pan-Fu; Wey, Shiaw-Pyng; Yang, An-Shoei

2009-11-01

[2[[2-[[[3-(4-chlorophenyl)-8-methyl-8-azabicyclo[3,2,1]-oct-2-yl]-methyl](2-mercaptoethyl)-amino]ethyl]amino]ethanethiolato(3-)-N2,N2',S2,S2]oxo-[1R-exo-exo)])-[99mTc]-technetium (99mTc-TRODAT-1) and 123I-iodobenzamide (123I-IBZM) are radiotracers for brain dopamine pre- and postsynaptic neuron imaging. The purpose of this study was to evaluate imaging parameters and crossed energy interference using simultaneous single photon emission computed tomography (SPECT) 99mTc and 123I data acquisition. A five-compartment brain striatal phantom was filled with 99mTc and/or 123I radioactive solutions with different striatal-to-background ratios, ranging from 3:1 to 9:1. SPECT data were acquired with energy window settings of 15% for the centered window at 140 keV for 99mTc and a 10% asymmetric window at 159 keV for 123I. The experiments were carried out using either individual (99mTc or 123I only) or both radionuclides. The striatal-to-background ratios and energy crossed interference between 99mTc and 123I were calculated. The phantom SPECT images demonstrated that the energy crossed interferences from 123I to 99mTc, and vice versa, were 22 +/- 12.4% and 0.4 +/- 1.0%, respectively. A net interference of 7.1 +/- 4.0% for the counts in the 15% centered 99mTc window can be expected from 123I and a net interference of 1.6 +/- 3.3% for the counts in the 10% asymmetric 123I window was derived from 99mTc. The correlation of striatal-to-background ratios between single isotope and simultaneous dual-isotope was excellent (R2 = 0.99). The imaging parameters used in this simultaneous dualisotope SPECT imaging could be used in future clinical practice for imaging patients with movement disorders by using 99mTc-TRODAT-1 and 123I-IBZM. The striatal-to-background ratios were not affected by the crossed interference between 99mTc and 123I.

Simultaneous 99mTC and 123I Dual-Isotope Brain Striatal Phantom Single Photon Emission Computed Tomography: Validation of 99mTC-Trodat-1 and 123I-IBZM Simultaneous Dopamine System Brain Imaging

Directory of Open Access Journals (Sweden)

Pan-Fu Kao

2009-11-01

Full Text Available [2[[2-[[[3-(4-chlorophenyl-8-methyl-8-azabicyclo[3,2,1]-oct-2-yl]-methyl](2-mercaptoethylamino]ethyl]amino]ethanethiolato(3--N2,N2′,S2,S2]oxo-[1R-exo-exo]-[99mTc]-technetium (99mTc-TRODAT-1 and 123I-iodobenzamide (123I-IBZM are radiotracers for brain dopamine preand postsynaptic neuron imaging. The purpose of this study was to evaluate imaging parameters and crossed energy interference using simultaneous single photon emission computed tomography (SPECT 99mTc and 123I data acquisition. A five-compartment brain striatal phantom was filled with 99mTc and/or 123I radioactive solutions with different striatal-to-background ratios, ranging from 3:1 to 9:1. SPECT data were acquired with energy window settings of 15% for the centered window at 140 keV for 99mTc and a 10% asymmetric window at 159 keV for 123I. The experiments were carried out using either individual (99mTc or 123I only or both radionuclides. The striatal-to-background ratios and energy crossed interference between 99mTc and 123I were calculated. The phantom SPECT images demonstrated that the energy crossed interferences from 123I to 99mTc, and vice versa, were 22 ± 12.4% and 0.4 ± 1.0%, respectively. A net interference of 7.1 ± 4.0% for the counts in the 15% centered 99mTc window can be expected from 123I and a net interference of 1.6 ± 3.3% for the counts in the 10% asymmetric 123I window was derived from 99mTc. The correlation of striatal-to-background ratios between single isotope and simultaneous dual-isotope was excellent (R2 = 0.99. The imaging parameters used in this simultaneous dual-isotope SPECT imaging could be used in future clinical practice for imaging patients with movement disorders by using 99mTc-TRODAT-1 and 123I-IBZM. The striatal-to-background ratios were not affected by the crossed interference between 99mTc and 123I.

40 CFR 89.123 - Amending the application and certificate of conformity.

Science.gov (United States)

2010-07-01

... certificate of conformity. 89.123 Section 89.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... of conformity. (a) The manufacturer of nonroad compression-ignition engines must notify the... be made to a product line covered by a certificate of conformity. This notification must include a...

Microautoradiography of [123I]ADAM in mice treated with fluoxetine and serotonin reuptake inhibitors

International Nuclear Information System (INIS)

Ye, X.-X.; Chen, J.-C.; Liu, R.-S.; Wey, S.-P.; Lee, J.-S.; Chen, C.-C.; Fu, Y.-K.; Ting, Gann; Hwang, J.-J.

2004-01-01

A radiopharmaceutical, 123 I-labeled 2-((2-((dimethylamino)methyl)phenyl)thio)-5-iodophenylamine ([ 123 I]ADAM), has been developed recently for evaluation of how serotonin transporters (SERT) function in the brain. However, the detailed biodistribution and specific binding in certain brain areas are not well investigated. In this study, both phosphor plate imaging and microautoradiography were applied to explore the binding characteristics of [ 123 I]ADAM in SERT neurons. The effect of two psychotropics and one narcotic on the binding of [ 123 I]ADAM to SERT was also studied. Fluoxetine and desipramine, both are psychotropics and specific SERT ligands and decreased the affinity of [ 123 I]ADAM, while p-chloroamphetamine (PCA), a narcotic, destroyed most of serotonergic neurons, as well as reducing the concentration of serotonin and the number of SERT in the brain as shown by the biodistribution of [ 123 I]ADAM. Significant and selective accumulation of [ 123 I]ADAM in the areas from midbrain to brain stem in normal mice with maximum target-to-background ratio was found at 90 minutes postinjection. A rapid clearance of [ 131 I]ADAM at 120 minutes postinjection was found in the CA1, CA3 and ThN brain areas. In addition, the inhibition effect on binding ability of [ 123 I]ADAM to SERT by the psychotropics and the narcotic was found to have the order of: PCA > fluoxetine > desipramine

The significance of 123I-BMIPP delayed scintigraphic imaging in cardiac patients.

Science.gov (United States)

Akashi, Yoshihiro J; Kida, Keisuke; Suzuki, Kae; Inoue, Koji; Kawasaki, Kensuke; Yamauchi, Masahiro; Musha, Haruki; Anker, Stefan D

2007-04-25

Earlier studies have not fully investigated the significance of radionuclide planar imaging in cardiac patients using the fatty acid analogue 123I-beta-methyl-iodophenylpentadecanoic acid (123I-BMIPP). This study was to clarify the effectiveness of 123I-BMIPP in assessing the heart-to-mediastinum ratio (H/M) and myocardial washout rate (WR) in patients with heart disease. Myocardial 123I-BMIPP imaging was performed in 33 patients (20 with chronic heart failure [CHF] and 13 with stable angina pectoris [AP]) and 11 control subjects. Myocardial 123I-BMIPP planner images were obtained 30 min (early image) and 4 h (delayed image) after tracer injection. The left ventricular ejection fraction (LVEF) was measured by quantitative gated single photon emission computed tomography. The concentration of plasma brain natriuretic peptide (BNP) was measured before the scintigraphic study. (1) Delayed H/M was much lower in CHF than in AP (1.93 +/- 0.37 vs. 2.21 +/- 0.38, p acid metabolism disorders in patients with heart disease in both masked and unmasked conditions.

Noninvasive evaluation of nicotinic acetylcholine receptor availability in mouse brain using single-photon emission computed tomography with [123I]5IA

International Nuclear Information System (INIS)

Matsuura, Yuki; Ueda, Masashi; Higaki, Yusuke; Watanabe, Keiko; Habara, Shogo; Kamino, Shinichiro; Saji, Hideo; Enomoto, Shuichi

2016-01-01

Introduction: Nicotinic acetylcholine receptors (nAChRs) are of great interest because they are implicated in higher brain functions. Nuclear medical imaging is one of the useful techniques for noninvasive evaluation of physiological and pathological function in living subjects. Recent progress in nuclear medical imaging modalities enables the clear visualization of the organs of small rodents. Thus, translational research using nuclear medical imaging in transgenic mice has become possible and helps to elucidate human disease pathology. However, imaging of α4β2 nAChRs in the mouse brain has not yet been performed. The purpose of this study was to assess the feasibility of single-photon emission computed tomography (SPECT) with 5-[ 123 I]iodo-3-[2(S)-azetidinylmethoxy]pyridine ([ 123 I]5IA) for evaluating α4β2 nAChR availability in the mouse brain. Methods: A 60-min dynamic SPECT imaging session of α4β2 nAChRs in the mouse brain was performed. The regional distribution of radioactivity in the SPECT images was compared to the density of α4β2 nAChRs measured in an identical mouse. Alteration of nAChR density in the brains of Tg2576 mice was also evaluated. Results: The mouse brain was clearly visualized by [ 123 I]5IA-SPECT and probe accumulation was significantly inhibited by pretreatment with (−)-nicotine. The regional distribution of radioactivity in SPECT images showed a significant positive correlation with α4β2 nAChR density measured in an identical mouse brain. Moreover, [ 123 I]5IA-SPECT was able to detect the up-regulation of α4β2 nAChRs in the brains of Tg2576 transgenic mice. Conclusions: [ 123 I]5IA-SPECT imaging would be a promising tool for evaluating α4β2 nAChR availability in the mouse brain and may be useful in translational research focused on nAChR-related diseases.

{sup 123}I and {sup 13I} purification for biomolecules labelling; Purificacao de {sup 123}I e {sup 131}I para marcacao de biomoleculas

Energy Technology Data Exchange (ETDEWEB)

Catanoso, Marcela Forli

2011-07-01

The {sup 123}I and {sup 131}I are iodine radioisotopes widely used in Nuclear Medicine. The radioisotope {sup 123}I is used in diagnosis through the SPECT technique and is routinely produced at IPEN in cyclotron through the reaction: '1{sup 24}Xe (p, 2n) '1{sup 23}Cs -> {sup 123}Xe -> {sup 123}I. The radioisotope {sup 131}I is used both in diagnosis and therapy due to its physical characteristics of decay by {beta}{sup -} and its {gamma}-ray emissions that are softened with the use of specific collimators for diagnosis. It is routinely produced at IPEN using the nuclear reactor through the indirect reaction: {sup 130}Te (n, {gamma}) ->{sup 131}Te -> {sup 131}I, irradiating compounds containing Te. The radiopharmaceuticals prepared with these radioisotopes go through rigorous quality control tests and the chemical purity of the primary radioisotopes {sup 123}I and {sup 131}I are within the permissible limits currently defined. However, the presence of some chemical contaminants can prejudice the biomolecules labeling (monoclonal antibodies and peptides), that will produce radiopharmaceuticals of first generation to the oncology area. The aim of this work was to obtain a new purification method of these radioisotopes, allowing the labeling of biomolecules and also to established a process control on those radioisotopes. The methodology was separated on 3 steps: Evaluation of '1{sup 23}I e {sup 131}I radionuclidic purity using a hyper pure germanium detector, chemical purity using ICP-OES and the retention and elution study of {sup 131}I in several absorbers to choose the most appropriate for the purification tests analyzing the behavior of the possible contaminants. The radionuclidic analyses showed the presence of Te and Co on {sup 131}I samples and Te, Tc e Co on {sup 123}I samples. The chemical purity analyses showed the presence of Al and Mo in {sup 123}I, coming from the window material of the target holder and the presence of Al and Te in {sup

Metabolism and autoradiographic evaluation of [{sup 18}F]FE-CIT: a Comparison with [{sup 123}I]{beta}-CIT and [{sup 123}I]FP-CIT

Energy Technology Data Exchange (ETDEWEB)

Ettlinger, Dagmar E. [Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Haeusler, Daniela; Wadsak, Wolfgang [Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Girschele, Friedrich; Sindelar, Karoline M. [Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Mien, Leonhard-Key [Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Ungersboeck, Johanna [Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Viernstein, Helmut; Kletter, Kurt; Dudczak, Robert [Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Mitterhauser, Markus [Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria)], E-mail: markus.mitterhauser@meduniwien.ac.at

2008-05-15

Purpose: Since the late 1980s, cocaine analogues based on the phenyltropane structure, such as [{sup 11}C]CFT and [{sup 123}I]{beta}-CIT have been used for the imaging of the dopamine transporter. FE-CIT (fluoropropyl ester) and FP-CIT (N-fluoropropyl derivative) are further analogues. The aim of this study was to (1) evaluate and compare the metabolic stability of {beta}-CIT, FP-CIT and FE-CIT against carboxyl esterases and (2) evaluate selectivity of [{sup 18}F]FE-CIT compared to [{sup 123}I]{beta}-CIT and [{sup 123}I]FP-CIT using autoradiography. Methods: In vitro enzymatic hydrolysis assays were performed using different concentrations of {beta}-CIT, FE-CIT and FP-CIT with constant concentrations of carboxyl esterase. Autoradiography was performed on coronal 20-{mu}m rat brain sections incubated with different radioactivity concentrations of [{sup 123}I]{beta}-CIT, [{sup 123}I]FP-CIT or [{sup 18}F]FE-CIT and, additionally, with 3-amino-4-(2-dimethylaminomethyl-phenylsulfanyl)-benzonitrile [serotonin transporter (SERT)] and nisoxetine [norepinephrine transporter (NET)] for blocking experiments. Results: In vitro assays showed Michaelis-Menten constants of 175 {mu}mol ({beta}-CIT), 183 {mu}mol (FE-CIT) and 521 {mu}mol (FP-CIT). Limiting velocities were 0.1005 {mu}mol/min ({beta}-CIT), 0.1418 {mu}mol/min (FE-CIT) and 0.1308 {mu}mol/min (FP-CIT). This indicates a significantly increased stability of FP-CIT, whereas carboxyl esterase stability of {beta}-CIT and FE-CIT showed no significant difference. Autoradiographic analyses revealed a good correlation between dopamine transporter (DAT)-rich regions and the uptake pattern of FE-CIT. Blocking experiments showed a higher DAT selectivity for [{sup 18}F]FE-CIT than for the other two tracers. Conclusion: We found that (1) the metabolic stability of FE-CIT was comparable to that of {beta}-CIT, whereas FP-CIT showed higher resistance to enzymatic hydrolysis; and (2) the overall uptake pattern of [{sup 18}F]FE-CIT on

Scintigraphy of cerebral blood flow with N-isopropyl-p-[123I]-iodoamphetamine in cerebrovascular accident

International Nuclear Information System (INIS)

Sone, Teruki; Fukunaga, Masao; Otsuka, Nobuaki

1985-01-01

In 20 patients with cerebrovascular accident, cerebral blood flow was estimated with N-isopropyl-p-[ 123 I]-iodoamphetamine ( 123 I-IMP) using a rotating gamma camera, and the findings were compared with those of X-CT or angiography. 123 I-IMP study demonstrated the areas of diminished cerebral blood flow in 14 cases. X-CT also demonstrated lesions in 14 cases, however, 123 I-IMP study delineated the lesions more precisely corresponding to the neurological findings. In cases with cerebellar hemorrhage or reversible ischemic neurological deficit (RIND), the lesion could be established only by 123 I-IMP study. It was demonstrated by 123 I-IMP study that vascular stenosis or abnormal vessels seen on angiography in patients with vertebro-basilar insufficiency or venous angioma was not necessarily accompanied by diminished blood flow. It was shown that scintigraphy with 123 I-IMP was a non-invasive, safe and extremely useful method to estimate the regional cerebral blood flow. (author)

Morphological stability of Sm123 superconductor during peritectic solidification from Sm211 + L mixture

International Nuclear Information System (INIS)

Sumida, Masaki; Shiohara, Yuh; Umeda, Takateru

2000-01-01

The interface stability of the Sm 123 superconductor was analyzed in accordance with the constitutional undercooling criterion. As the single-crystal growth of the 123 phase is largely dependent on the growth-interface stability, a quantitative analysis was very much required. From this analysis, it was clarified that the constitutional undercooling must exist in the liquid when the 123 growth interface comes close to a 211 particle during the peritectic solidification. It was also predicted that the larger 211 particle radius, smaller volume fraction of the 211 particles, larger growth rate, or smaller imposed temperature gradient would cause easy occurrence of the constitutional undercooling ahead of the 123 growth interface. Taking into account the nucleation at the L/211 interface just ahead of the 123 growth front due to the constitutional undercooling, the transition of 123 growth from a planar-interface morphology to an equiaxed blocky morphology was investigated quantitatively and qualitatively

Evaluation of the sympathetic nervous system in silent ischemia with 123I-metaiodobenzylguanidine (MIBG)

International Nuclear Information System (INIS)

Guertner, C.; Schacherer, C.; Krause, B.J.; Zickmann, J.; Klepzig, H. Jr.; Hoer, G.

1996-01-01

Stress and rest myocardial perfusion scintigraphy using either Thallium-201 or 99m Tc-isonitrile was performed in SPECT technique in order to localize ischemia or scar associated perfusion defects. 15 min and 4 h p.i. static anterior 123 I-MIBG uptake was acquired. In order to localize norepinephrine depletion 4 h p.i. additional 123 I-MIBG SPECT acquistion was performed. Incidence of arrhythmias was investigated by Holter ECG. Patients with diabetes mellitus were excluded. SPECT images showed in all patients regional 123 I-MIBG depletion which corresponded with scintigraphically infarcted or ischemic regions. Well perfused myocardial regions matched with regular 123 I-MIBG utpake. There was no evidence of increased arrhythmias in long-term ECG. The finding of regular 123 I-MIBG uptake in well-perfused myocardium and infarction- or ischemia-associated regional 123 I-MIBG depletion confirms that silent ischemia is not caused by a global sympathetic nervous dysfunction in a sense of cardiac polyneuropathy. (orig.) [de

Tellurium-123m-labeled isosteres of palmitoleic and oleic acids show high myocardial uptake

International Nuclear Information System (INIS)

Knapp, F.F. Jr.; Ambrose, K.R.; Callahan, A.P.; Grigsby, R.A.; Irgolic, K.J.

1979-01-01

These studies were directed at determining if the telluro fatty acids prepared by the isosteric replacement of the Δ 9 -double bonds of oleic and palmitoleic acids with /sup 123m/Te would show heart uptake in rats. The isostere of palmitoleic acid, 9-tellurapentadecanoic acid(II), was prepared by basic hydrolysis of the product formed by the coupling of /sup 123m/Te-sodium hexyl tellurol with methyl-8-bromooctadecanoate. Similarly, the isostere of oleic acid, 9-telluraheptadecanoic acid(IV), was prepared by the same route beginning with the reaction of /sup 123m/Te-sodium octyl tellurol with methyl-8-bromooctadecanoate. Both /sup 123m/Te-(II) and /sup 123m/Te-(IV) showed remarkably high heart uptake in rats (2 to 3% dose/gm) ten minutes after intravenous administration, and the heart/blood ratios were high (20-30/1). Finally, the hearts of rats injected with /sup 123m/Te-(IV) have been clearly imaged with a rectilinear scanner

Production of high purity iodine-123 from xenon-124 at energies between 15 and 34 MeV

International Nuclear Information System (INIS)

Firouzbakht, M.L.; Teng Renrui; Schlyer, D.J.; Wolf, A.P.

1987-01-01

The production of I-123 from the proton bombardment of isotopically enriched Xe-124 is reported over the energy range of 15 to 34 MeV via the 124 Xe (p,pn) 123 Xe (β + , 2.1 hr) → 123 I and 124 Xe (p,2n) 123 Cs (β + , 6 min) → 123 Xe (β + , 2.1 hr) → 123 I pathways. The thick target yields for this target are tabulated and compared to theoretical cross-section calculations of the nuclear reactions leading to the production of Xe-123. The radiochemical purity of the I-123 is greater than 99.9% and the contamination of I-125 is below detectable limits (< 0.1%) at 6.6 hrs after the end of bombardment. (orig.)

Decreased striatal dopamine transporter binding assessed with [123I] FP-CIT in first-episode schizophrenic patients with and without short-term antipsychotic-induced parkinsonism.

Science.gov (United States)

Mateos, Jose J; Lomeña, Francisco; Parellada, Eduardo; Font, Mireia; Fernandez, Emili; Pavia, Javier; Prats, Alberto; Pons, Francisca; Bernardo, Miquel

2005-09-01

Drug-induced parkinsonism (DIP) is one of the main causes of treatment drop-out in schizophrenic patients causing a high incidence of relapse that leads patients to a bad clinical prognosis. The dopaminergic nigrostriatal pathway is involved in the movement control, so the study of the dopamine transporter (DAT) could be of great value to determine its implication in the appearance of DIP. The goal of the study is to determine the striatal DAT binding assessed with [(123)I] FP-CIT SPECT in first-episode neuroleptic-naive schizophrenic in-patients with DIP after short-term antipsychotic treatment. The [(123)I] FP-CIT binding ratios of ten schizophrenic in-patients who developed DIP during the first 4-week period of risperidone treatment (6+/-2 mg/day) were compared with ten schizophrenic in-patients treated with the same doses of risperidone and who do not developed DIP and with ten age-matched healthy subjects. Quantitative analyses of SPECTs were performed using regions of interest located in caudate, putamen and occipital cortex. Parkinsonism was assessed by the Simpson-Angus Scale and the psychopathological status by the Clinical General Impression and Positive and Negative Syndrome Scales. Whole striatal [(123)I] FP-CIT binding ratios were significantly lower in patients with and without DIP than in healthy subjects (p<0.001). This was also observed in whole putamen (p<0.001) and caudate nucleus (p<0.001). Females showed higher whole striatal [(123)I] FP-CIT binding ratios than males (p<0.05). No differences in psychopathological scales were observed between patients with and without DIP. Our first-episode schizophrenic patients with and without DIP after short-term risperidone treatment have a decreased striatal DAT binding assessed with [(123)I] FP-CIT. This alteration could be related to the schizophrenic disease or may be secondary to the antipsychotic treatment.

Myocardial metabolism of {sup 123}I-BMIPP under low-dose dobutamine infusion: implications for clinical SPECT imaging of ischemic heart disease

Energy Technology Data Exchange (ETDEWEB)

Hosokawa, Ryohei; Fujita, Masatoshi; Kambara, Naoshige; Ohba, Muneo; Tadamura, Eiji; Kimura, Takeshi; Kita, Toru [Kyoto University Graduate School of Medicine, Department of Cardiovascular Medicine, and Nuclear Medicine, Kyoto (Japan); Nohara, Ryuji [The Tazuke Kofukai Medical Research Institute, Department of Cardiology, Kitano Hospital, Osaka (Japan); Hirai, Taku [Kinki University School of Medicine, Department of Cardiology, Nara Hospital, Nara (Japan); Fujibayashi, Yasuhisa [Fukui Medical University, Molecular Imaging, Biomedical Imaging Research Center, Fukui (Japan)

2005-01-01

{sup 123}I-(p-iodophenyl)-3-(R,S)-methylpentadecanoic acid ({sup 123}I-BMIPP) is a fatty acid analog for single-photon emission computed tomography (SPECT) imaging that is mainly stored in the triglyceride pool. Low-dose dobutamine infusion has been reported to improve BMIPP uptake in the stunned myocardium, but the mechanism underlying this effect remains unclear. The purpose of this study was therefore to investigate the myocardial metabolism of {sup 123}I-BMIPP in the stunned myocardium under low-dose dobutamine infusion, and to elucidate the mechanism by which dobutamine improves BMIPP uptake. Using open-chest dogs, stunned myocardium was induced by occlusion of the left anterior descending artery (LAD) for 30 min, with subsequent reperfusion (ischemia group, n=6). After direct injection of BMIPP into the LAD, myocardial extraction and retention were examined and metabolites evaluated (using high-performance liquid chromatography) during dobutamine infusion. The results in the ischemia group were compared with findings obtained in a control group under dobutamine infusion (n=6). Dobutamine infusion significantly increased both the rapid extraction (within 30 s) of BMIPP into the myocardium (control vs ischemia group: 48{+-}19% vs 66{+-}14%, p<0.05) and its subsequent retention (73{+-}13% vs 85{+-}8%, p<0.05). The metabolites from the myocardium consisted of back diffusion of nonmetabolized BMIPP, the alpha-oxidation metabolite, intermediate metabolites, and the full-oxidation metabolite. Among these metabolites, the full-oxidation metabolite decreased significantly (from 34.0{+-}20.0% to 15.8{+-}9.3%, p<0.05) in the stunned regions, though back diffusion of nonmetabolized BMIPP increased (from 51.3{+-}21.9% to 71.3{+-}10.1%, p<0.05). These results indicate that increased uptake of BMIPP in stunned myocardium is mainly due to decreased beta-oxidation in tissue and increased shunt retention of BMIPP in the triglyceride pool, and thereby provide further insight

Brain SPECT with 123I-Lisurid in patients with Parkinson's disease and in controls

International Nuclear Information System (INIS)

Hierholzer, J.; Cordes, M.; Schelosky, L.; Richter, W.; Schrag, A.; Poewe, W.; Schulze, P.E.; Semmler, W.; Eichstaedt, H.; Felix, R.

1995-01-01

The goal was to visualize cerebral dopamine-D 2 receptors in 6 patients with Parkinson's disease and in 3 healthy controls using iodine-123-Lisuride-SPECT. In addition, we performed receptor-replacement studies using 123 I-Lisuride and cold Lisuride as competitive ligands. The highest uptake of 123 I-Lisuride was observed in the striatum, a region with known high dopamine receptor density. In two patients premedication with cold Lisuride displaced 123 I-Lisuride from the dopamine receptor. 123 I-Lisuride is valuable as a radiotracer in cerebral dopamine-D 2 receptor scintigraphy. Whether or not it is possible to determine dynamic changes of dopamine receptor density or function by receptor replacement studies needs further evaluation in larger patient populations. (orig.) [de

Effect of a Pluronic(®) P123 formulation on the nitric oxide-generating drug JS-K.

Science.gov (United States)

Kaur, Imit; Kosak, Ken M; Terrazas, Moises; Herron, James N; Kern, Steven E; Boucher, Kenneth M; Shami, Paul J

2015-04-01

O(2)-(2,4-dinitrophenyl)1-[(4-ethoxycarbonyl)piperazin-1-yl]diazen-1-ium-1,2-diolate] or JS-K is a nitric oxide-producing prodrug of the arylated diazeniumdiolate class with promising anti-tumor activity. JS-K has challenging solubility and stability properties. We aimed to characterize and compare Pluronic(®) P123-formulated JS-K (P123/JS-K) with free JS-K. We determined micelle size, shape, and critical micelle concentration of Pluronic(®) P123. Efficacy was evaluated in vitro using HL-60 and U937 cells and in vivo in a xenograft in NOD/SCID IL2Rγ (null) mice using HL-60 cells. We compared JS-K and P123/JS-K stability in different media. We also compared plasma protein binding of JS-K and P123/JS-K. We determined the binding and Stern Volmer constants, and thermodynamic parameters. Spherical P123/JS-K micelles were smaller than blank P123. P123/JS-K formulation was more stable in buffered saline, whole blood, plasma and RPMI media as compared to free JS-K. P123 affected the protein binding properties of JS-K. In vitro it was as efficacious as JS-K alone when tested in HL-60 and U937 cells and in vivo greater tumor regression was observed for P123/JS-K treated NOD/SCID IL2Rγ (null) mice when compared to free JS-K-treated NOD/SCID IL2Rγ (null) mice. Pluronic(®) P123 solubilizes, stabilizes and affects the protein binding characteristics of JS-K. P123/JS-K showed more in vivo anti-tumor activity than free JS-K.

21 CFR 123.6 - Hazard analysis and Hazard Analysis Critical Control Point (HACCP) plan.

Science.gov (United States)

2010-04-01

... Control Point (HACCP) plan. 123.6 Section 123.6 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF... Provisions § 123.6 Hazard analysis and Hazard Analysis Critical Control Point (HACCP) plan. (a) Hazard... fish or fishery product being processed in the absence of those controls. (b) The HACCP plan. Every...

Collimator Selection in Nuclear Medicine Imaging Using I-123 Generated by Te-124 Reaction

International Nuclear Information System (INIS)

Kim, Hee Joung; Son, Hye Kyung; Nam, Ki Pyo; Lee, Hee Kyung; Bong, Joung Kyun

1996-01-01

In the case of I-123 from the Te-124(p,2n)reaction, the radionuclidic impurity is the high-energy gamma-emitting I-124, which interferes greatly with nuclear medicine images. The choice of a collimator can affect the quality of clinical SPECT images of [I-123]MIBG, [I-123]μ-CIT, or [I-123]IPT. The tradeoffs that two different collimators make among spatial resolution, sensitivity, and scatter were studied by imaging a line source at 5 cm, 10 cm, 15 cm distance using a number of plexiglass sheets between source and collimator, petridish, two-dimensional Hoffman brain phantom, Jaszczak phantom, and three-dimensional Hoffman brain phantom after filling with I-123. (FWHM, FWTM, Sensitivity) for low-energy ultrahigh-resolution parallel-hole(LEUHRP) collimator and medium-energy general-purpose(MEGP) collimator were measured as (9.27 mm, 61.27 mm, 129 CPM/μCi) and (10.53 mm, 23.17 mm, 105CPM/μ/Ci), respectively. The image quality of two-dimensional Hoffman brain phantom with LEUHRP looked better than the one with MEGP. However, the image quality of Jaszczak phantom and three-dimensional Hoffman brain phantom with LEUHRP looked much worse than the one with MEGP because of scatter contributions in three-dimensional imaging situation. The results suggest that the MEGP is preferable to LEUHRP for three-dimensional imaging studies of [I-123]MIBG, [I-123] β-CIT, or [I-123] IPT.

Dopamine transporter density of the basal ganglia assessed with I-123 IPT SPECT in methamphetamine abusers

International Nuclear Information System (INIS)

Lee, Joo Ryung; Ahn, Byeong Cheol; Kewm, Do Hun

2005-01-01

Functional imaging of dopamine transporter (DAT) defines integrity of the dopaminergic system, and DAT is the target site of drugs of abuse such as cocaine and methamphetamine. Functional imaging the DAT may be a sensitive and selective indicator of neurotoxic change by the drug. The aim of the present study is to evaluate the clinical implications of qualitative/quantitative analyses of dopamine transporter imaging in methamphetamine abusers. Six detoxified methamphetamine abusers (abuser group) and 4 volunteers (control group) were enrolled in this study. Brain MRI was performed in all of abuser group. Abuser group underwent psychiatric and depression assessment using brief psychiatric rating scale (BPRS) and Hamilton depression rating scale (HAMD), respectively. All of the subjects underwent I-123 IPT SPECT (IPT SPECT). IPT SPECT image was analysed with visual qualitative method and quantitative method using basal ganglia dopamine transporter (DAT) specific/non-specific binding ratio (SBR). Comparison of DAT SBR between abuser and control groups was performed. We also performed correlation tests between psychiatric and depression assessment results and DAT SBR in abuser group. All of abuser group showed normal MRI finding, but had residual psychiatric and depressive symptoms, and psychiatric and depressive symptom scores were exactly correlated (r=1.0, ρ =0.005) each other. Five of them showed abnormal finding on qualitative visual I-123 IPT SPECT. Abuser group had lower basal ganglia DAT SBR than that of control (2.38 ± 0.20 vs 3.04 ± 0.27, ρ =0.000). Psychiatric and depressive symptoms were negatively well correlated with basal ganglia DAT SBR (r=-0.908, ρ =0.012, r=-0.924, ρ =0.009) This results suggest that dopamine transporter imaging using I-123 IPT SPECT may be used to evaluate dopaminergic system of the basal ganglia and the clinical status in methamphetamine abusers

Dopamine transporter density of the basal ganglia assessed with I-123 IPT SPECT in methamphetamine abusers

Energy Technology Data Exchange (ETDEWEB)

Lee, Joo Ryung; Ahn, Byeong Cheol [Kyungpook National University Medical School, Daegu (Korea, Republic of); Kewm, Do Hun [National Bugok Mental Hospital, Changryung (Korea, Republic of)] (and others)

2005-10-15

Functional imaging of dopamine transporter (DAT) defines integrity of the dopaminergic system, and DAT is the target site of drugs of abuse such as cocaine and methamphetamine. Functional imaging the DAT may be a sensitive and selective indicator of neurotoxic change by the drug. The aim of the present study is to evaluate the clinical implications of qualitative/quantitative analyses of dopamine transporter imaging in methamphetamine abusers. Six detoxified methamphetamine abusers (abuser group) and 4 volunteers (control group) were enrolled in this study. Brain MRI was performed in all of abuser group. Abuser group underwent psychiatric and depression assessment using brief psychiatric rating scale (BPRS) and Hamilton depression rating scale (HAMD), respectively. All of the subjects underwent I-123 IPT SPECT (IPT SPECT). IPT SPECT image was analysed with visual qualitative method and quantitative method using basal ganglia dopamine transporter (DAT) specific/non-specific binding ratio (SBR). Comparison of DAT SBR between abuser and control groups was performed. We also performed correlation tests between psychiatric and depression assessment results and DAT SBR in abuser group. All of abuser group showed normal MRI finding, but had residual psychiatric and depressive symptoms, and psychiatric and depressive symptom scores were exactly correlated (r=1.0, {rho} =0.005) each other. Five of them showed abnormal finding on qualitative visual I-123 IPT SPECT. Abuser group had lower basal ganglia DAT SBR than that of control (2.38 {+-} 0.20 vs 3.04 {+-} 0.27, {rho} =0.000). Psychiatric and depressive symptoms were negatively well correlated with basal ganglia DAT SBR (r=-0.908, {rho} =0.012, r=-0.924, {rho} =0.009) This results suggest that dopamine transporter imaging using I-123 IPT SPECT may be used to evaluate dopaminergic system of the basal ganglia and the clinical status in methamphetamine abusers.

Assessment of takotsubo (ampulla) cardiomyopathy using iodine-123 metaiodobenzylguanidine scintigraphy

Energy Technology Data Exchange (ETDEWEB)

Pessoa, Pinheiro M.C.; Xavier, Salles S.; Lima, Souza Leao R.; Mansur, J.; Almeida, Altino S. de; Carvalho, Pires A.C.; Gutfilen, B.; Fonseca, Barbosa L.M. da [Hospital Univ. Clementino Fraga Filho, Univ. Federal do Rio de Janeiro (Brazil). Dept. de Radiologia

2006-12-15

Purpose: To evaluate the role of cardiac sympathetic innervation in patients whose clinical features consisted of chest pain, transient ST-segment elevation, left ventricular apical akinesis, minimal elevation of cardiac enzymes, and onset of symptoms shortly after a severe stress condition. Material and Methods: Five female patients, mean age 67{+-}14 years, underwent thoracic {sup 123}I-MIBG (planar and SPECT) and 67Ga citrate (planar) scans within 5 days after the onset of symptoms. The {sup 123}I-MIBG myocardial washout rate between early (30 min) and delayed (3 hours) planar images was calculated. All patients presented findings consistent with takotsubo-like syndrome. Echocardiograms showed the characteristic wall motion pattern of significant apical dysfunction. Acute-phase coronary angiographies revealed a non-obstructive pattern. A peculiar apical akinesis and basal normokinesis were observed on the ventriculograms. Results: Impairment of cardiac neuronal uptake of {sup 123}I-MIBG based on a reduction of the heart-to-mediastinum uptake ratio was observed in all patients, while the washout rate was raised in four patients. All patients presented an apical uptake defect in the {sup 123}I-MIBG SPECT and planar images and a normal 67Ga scintigraphy. Conclusion: Our data indicate that ampulla cardiomyopathy (AC) is associated with a cardiac sympathetic innervation deficit characterized by a reduced global {sup 123}I-MIBG uptake and an apical uptake defect. The lack of 67Ga uptake in the acute phase of this syndrome indicates that AC is probably not associated with an inflammatory process.

123 I production using CV-28 cyclotron from IPEN-CNEN/SP

International Nuclear Information System (INIS)

Mestnik, S.A.C.; Mengatti, J.; Nieto, W.; Yanagawa, S.I.; Sumiya, L.C.A.; Silva, C.P.G.; Osso Junior, J.A.

1992-01-01

The main conditions for iodine 123 production by 124 Te (p,2 n) 123 I reaction were presented, using the cyclotron CV-28 at IPEN-CNEN/SP, with protons of E max = 24 MeV. Two types of targets (Te O 2 and Te O 2 + 2% Al 2 O 3 ) and the influence of Al 2 O 3 in iodine release were studied. After the selection, the 124 Te O 2 (96,2%) target, was melted in platinum support and irradiated with proton current until 12 mu A. The separation of 123 I was made by dry distillation, using induction furnace and O 2 atmosphere. (C.G.C.)

19 CFR 123.63 - Examination of baggage from Canada or Mexico.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Examination of baggage from Canada or Mexico. 123...; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Baggage § 123.63 Examination of baggage from Canada or Mexico. (a) Opening vehicle or compartment to examine baggage. Customs officers are...

Recent developments in melt processed Gd-123 and MgB2 materials at RTRI

International Nuclear Information System (INIS)

Muralidhar, M.; Fukumoto, Y.; Ishihara, A.; Suzuki, K.; Tomita, M.; Koblischka, M.R.; Yamamoto, A.; Kishio, K.

2014-01-01

Highlights: •Large size Gd-123 bulk material grown in air, using novel thin film Nd-123 seeds grown on MgO crystals. •Quality and uniformity of the Gd-123 materials are excellent. •Batch processed Gd-123 material was used for construction of chilled Maglev vehicle. •MgB 2 bulks can be utilized around 20 K similarly to the Gd-123 material at 77 K. -- Abstract: In this contribution we will report on the current status, recent developments in GdBa 2 Cu 3 O y “Gd-123” and MgB 2 material processing, characterization, and applications at the Railway Technical Research Institute (RTRI). Batch-processing of Gd-123 bulk material grown in air was performed using novel thin film Nd-123 seeds grown on MgO crystals. In this way, we are able to fabricate materials with good quality, and uniform performance. We examined the technology of the uniform performance of the large 45 mm diameter, single grain Gd-123 bulks for use in application of NMR. For this purpose, four 5 mm thick pieces are cut vertically from a single grain Gd-123 material and the magnetic field distribution is measured using a scanning hall sensor. We found that all four pieces are single domain and exhibit a quite uniform field distribution. Furthermore, the batch-processed bulk materials are used for the construction of a chilled Maglev vehicle. On the other hand, to optimize the trapped field performance of bulk MgB 2 material, several samples were prepared by solid state reaction at different temperatures ranging from 750 to 950 °C in pure argon atmosphere. X-ray diffraction results indicated that single phase and homogenous MgB 2 bulks are produced when sintering them around 775 °C. Further, atomic force microscopy (AFM) and scanning electron microscopy (SEM) indicated that an uniform grain size results by controlling the processing temperature. So, higher trapped fields can be achieved in sintered MgB 2 material

Dopamine transporter imaging in the aged rat: a [123I]FP-CIT SPECT study

International Nuclear Information System (INIS)

Niñerola-Baizán, Aida; Rojas, Santiago; Roé-Vellvé, Núria; Lomeña, Francisco; Ros, Domènec

2015-01-01

Introduction: Rodent models are extensively used to assess the biochemical and physiological changes associated with aging. They play a major role in the development of therapies for age-related pathologies such as Parkinson's disease. To validate the usefulness of these animal models in aging or age-related disease research, the consistency of cerebral aging processes across species must be evaluated. The dopaminergic system seems particularly susceptible to the aging process. One of the results of this susceptibility is a decline in striatal dopamine transporter (DAT) availability. Methods: We sought to ascertain whether similar age changes could be detected in-vivo in rats, using molecular imaging techniques such as single photon emission computed tomography (SPECT) with [ 123 I]FP-CIT. Results: A significant decrease of 17.21% in the striatal specific uptake ratio was observed in the aged rats with respect to the young control group. Conclusions: Our findings suggest that age-related degeneration in the nigrostriatal track is similar in humans and rats, which supports the use of this animal in models to evaluate the effect of aging on the dopaminergic system. Advances in Knowledge and Implications for patient Care: Our findings indicate that age-related degeneration in the nigrostriatal track is similar in humans and rats and that these changes can be monitored in vivo using small animal SPECT with [ 123 I]FP-CIT, which could facilitate the translational research in rat models of age related disorders of dopaminergic system

Serial lung imaging with /sup 123/I-IMP in localized pulmonary lesions

Energy Technology Data Exchange (ETDEWEB)

Nakajo, Masayuki; Shimada, Jurio; Shimozono, Michiko; Uchiyama, Noriaki; Hiraki, Yoshiyuki; Shinohara, Shinji.

1988-05-01

/sup 123/I-IMP (N-isopropyl-p-(/sup 123/I)-iodoamphetamine) dynamic (1 frame/min for 25 mins), 30-min and 4-hr static lung imaging was performed in a total of 65 patients with roentgenographic evidence of localized pulmonary lesion (12 with pneumonia, one with lung abscess, 5 with pulmonary tuberculosis, 3 with pneumoconiosis, one with lung fluke disease and 43 with various histological types of primary lung cancer). The findings in 65 of 70 (95 %) lesions in the initial 1 or 2-min dynamic /sup 123/I-IMP images were analogous to those obtained by /sup 99m/Tc-MAA lung perfusion imaging and decreased activity was observed in 68 of 70 (97 %) lesions, suggesting that the initial images mainly reflected the relative distribution of pulmonary arterial blood flow. However, /sup 123/I-IMP accumulated differently according to the pathological conditions afterwards. Decrease activity from /sup 123/I-IMP was contineously observed in a cavity of the lung abscess, 2 of 2 tuberculomas, 3 of 7 large nodules of pneumoconiosis and all of the 42 cancerous lesions which were possible to be evaluated. Gradual increased in activity relative to that of ''normal lung fields'' was observed in all 14 lesions of pneumonia; pneumonic lesions of the lung abscess, tuberculosis and lung fluke disease; 4 of 7 large nodules of pneumoconiosis; all of 8 atelectatic lesions and 32 of 44 areas surrounding cancers (most of them had roentgenographic evidence of infiltrating shadows). Thus /sup 123/I-IMP accumulated increasingly in pneumonic and atelectatic lesions, while it appeared not to accumulate in such lesions replacing lung tissues as cavity, caseous and fibrous lesions and primary lung cancers. /sup 123/I-IMP can be used as a new lung imaging agent to provide diagnostic informations on the property of pulmonary lesions.

123I-BMIPP delayed scintigraphic imaging in patients with chronic heart failure.

Science.gov (United States)

Kida, Keisuke; Akashi, Yoshihiro J; Yoneyama, Kihei; Shimokawa, Mitsuhiro; Musha, Haruki

2008-11-01

The objective of the present study was to clarify the ability of 123I-beta-methyl-iodophenylpentadecanoic acid (123I-BMIPP) to evaluate the heart-to-mediastinum (H/M) ratio and myocardial global washout rate (WR) in patients with chronic heart failure (CHF). The severity of CHF was evaluated on the basis of the New York Heart Association (NYHA) classification. Twenty patients with CHF (13 with idiopathic dilated cardiomyopathy and 7 with ischemic cardiomyopathy) and 11 age-matched controls underwent myocardial radionuclide imaging. Scintigraphic images were obtained from each participant at the early (30 min following radio-isotope injection) and late (4 h) phases using 123I-BMIPP. The H/M ratio and WR were calculated from planar images. Concentrations of plasma brain natriuretic peptide (BNP) were measured prior to the scintigraphic study. The 123I-BMIPP uptake of early H/M and global WR did not significantly differ among groups, but uptake of delayed H/M was significantly lower in patients with NYHA class III than in controls (control 2.47 +/- 0.39; class III 1.78 +/- 0.28, P < 0.05). The uptake of delayed H/M and global WR correlated with plasma log BNP in all participants (r = -0.38, P < 0.05; 0.43, P < 0.05, respectively). These data suggest that 123I-BMIPP uptake of delayed H/M enhances the image of CHF severity. The myocardial WR of 123I-BMIPP also effectively depicted the severity of CHF.

Disposition of nebulized pentamidine measured using the direct radiolabel 123I-iodopentamidine

International Nuclear Information System (INIS)

O'Doherty, M.J.; Nunan, T.O.; Bateman, N.T.; Thomas, S.H.L.; Page, C.J.; Blower, P.J.

1993-01-01

The pulmonary deposition of nebulized pentamidine (300 mg, Respirgard II nebulizer) was measured in seven human immunodeficiency virus (HIV)-positive men using a new radiopharmaceutical, 123 I-iodopentamidine. Mean total pulmonary deposition was 15.3 mg or 5.1% of the initial nebulizer dose. Further studies in two of the patients showed that at 24h, 87% of deposited 123 I was retained in the lungs. Small amounts of activity (expressed as a percentage of the initial nebulizer activity) were also detected over the thyroid (0.4%), bladder (1%) and gut (0.7%). The ratio of 123 I activity to pentamidine concentration was similar in the nebulizer solution and urine. These results suggest that 123 I-pentamidine may be sufficiently stable in vivo to be used to study the biodistribution of inhaled and parenteral pentamidine in humans. (author)

Human kinetic distribution of I-123 F(Ab')/sub 2/ and FAb compared to the parent I-123 intact antibody

International Nuclear Information System (INIS)

De Nardo, S.J.; De Nardo, G.L.; O'Grady, L.F.; Peng, J.S.; Macey, D.J.; Mills, S.L.; Caridiff, R.D.; Epstein, A.L.

1985-01-01

Studies of radiolabeled monoclonal antibodies are being performed by many investigators using a variety of molecular forms of the antibody. This study evaluates two I-123-labeled antibodies (Lym-1 IgG2a and B6.01 IgG1) and their I-123-labeled FAb and F(Ab')/sub 2/ for relative whole body distribution and kinetics, selected organ kinetics, and site of degradation. Evidence of immunocomplex formation, circulating antigen, and HAMA, were monitored by HPLC-TSK analysis and appropriate radioassays of the plasma. Each antibody and each I-123-labeled fragment has been evaluated in 5 patients. One patient had serial comparisons of the radiolabeled parent molecule, F(Ab')/sub 2/ (100μg and 5 mg) and FAb (100μg) of Lym-1. Blood clearance, urine excretion rate, and plasma and urine HPLC fractionation of the radioactive species were determined. Whole body clearance by total body scans and organ clearance were obtained by geometric mean of anterior and posterior areas of interest. The FAb and F(Ab')/sub 2/ fragments had similar blood pool recovery 5 minutes after the 5-minute injection. These were the same as blood levels when 5mg of intact I-123-labeled antibody was given. The second phase of the blood curves for F(Ab')/sub 2/ had a T1/2 of 35-40 hours and for FAb was 15-20 hours. Urine excretion varied, but agreed with total body loss from body scan information. The patient with serial studies had a 24-hour residual dose of 82% for FAb, 62% for 10μg for F(Ab')/sub 2/ and 61% for 5mg of F(Ab')/sub 2/. Renal uptake for all patients was higher and more persistent with both fragments than intact antibody, but hepatic uptake was less

Effects of cross talk on dual energy SPECT imaging between 123I-BMIPP and 201Tl

International Nuclear Information System (INIS)

Morita, Masato; Narita, Hitoshi; Yamamoto, Juro; Fukutake, Naoshige; Ohyanagi, Mitsumasa; Iwasaki, Tadaaki; Fukuchi, Minoru

1994-01-01

The study was undertaken to determine how much cross talk influences the visual assessment of dual energy single photon emission computed tomographic (SPECT) images with iodine 123 beta-methyl-p-iodophenylpentadecanoic acid (I-123 BMIPP) and thallium-201 in 15 patients with acute myocardial infarction. After single SPECT with I-123 BMIPP was undertaken, simultaneous dual SPECT with I-123 BMIPP and Tl-201 were undertaken in all patients. Three patients also underwent single SPECT with Tl-201. I-123 BMIPP and Tl-201 uptake was graded in four-score for the comparison between single and dual SPECT images. There was good correlation between dual energy SPECT and both single I-123 BMIPP SPECT (pS=0.97) and single Tl-201 SPECT (pS=0.59). Uptake scores were increased on dual energy SPECT, compared with single I-123 SPECT (8 out of 132 segments) and single Tl-201 SPECT (12 out of 36 segments). Overall, there was a comparatively well correlation between single SEPCT with either I-123 BMIPP or Tl-201 and dual energy SPECT images. However, one tracer uptake sometimes increased in the other tracer defect areas. This was noticeable when I-123 BMIPP exerted an effect on Tl-201. (N.K.)

Differentiation of Parkinson's Disease and Essential Tremor on I-123 IPT(I-123-N-(3-iodopropen-2-yl)-2β-carbomethoxy-3β-(4-cholorophenyl) tropane) Brain SPECT

International Nuclear Information System (INIS)

Pai, Moon Sun; Choi, Tae Hyun; Ahn, Sung Min; Choi, Jai Yong; Ryu, Won Gee; Lee, Jae Hoon; Ryu, Young Hoon

2009-01-01

The study was to assess I-123-N-(3-iodopropen-2-yl)-2[beta]-carbomethoxy-3[beta]-(4-cholorophenyl) tropane (IPT) SPECT in differential diagnosis among early stage of Parkinson's disease(PD) and essential tremor(ET) and normal control(NL) groups quantitatively. I-123 IPT brain SPECT of 50 NL, 20 early PD, 30 advanced PD, and 20 ET were performed at 20 minutes and 2 hours. Specific/nonspecific binding of striatum was calculated by using right and left striatal specific to occipital non-specific uptake ratio (striatum-OCC/OCC). Mean value of specific/nonspecific binding ratio was significantly different between advanced PD group and NL group. However, significant overlap of striatal specific/nonspecific binding ratio was observed between PD group and ET group. Bilateral striatal specific/nonspecific binding ratios were decreased in advanced PD. Lateralized differences in the striatal uptake of I-123 IPT correlated with asymmetry in clinical findings in PD group. I-123 IPT SPECT may be a useful method for the diagnosis of PD and objective evaluation of progress of clinical stages. Care should be made in the differential diagnosis of early stage of PD and other motor disturbances mimicking PD such as ET in view of significant overlap in striatal I-123 specific/nonspecific binding ratio

Synthesis and evaluation of iodine-123 labelled tricyclic tropanes as radioligands for the serotonin transporter

International Nuclear Information System (INIS)

Quinlivan, Mitchell; Mattner, Filomena; Papazian, Vahan; Zhou, Jia; Katsifis, Andrew; Emond, Patrick; Chalon, Sylvie; Kozikowski, Alan; Guilloteau, Denis; Kassiou, Michael

2003-01-01

The tricyclic tropane analogues (1S,3S,6R,10S)-(Z)-10-(benzoyloxymethyl)-9-(3-chloro-4-iodobenzylidene)-7 -azatricyclo[4.3.1.0 3,7 ]decane, 1, and (1S,3S,6R,10S)-(Z)-9-(3-chloro-4-iodobenzylidene)-7-azatricyclo[4.3.1.0 3,7 ] = decane-10-carboxylic acid methyl ester, 2, have been shown to be potent and selective serotonin transporter (SERT) ligands. They possess nanomolar affinity for the SERT (Ki = 0.06 nM and 1.8 nM respectively) and are suitable for radiolabelling using iodine-123. In the present study we prepared [ 123 I]1 and [ 123 I]2 from the appropriate tributylstannane precursors using acidic media with chloramine-T as the oxidising agent. The radiochemical yield obtained for [ 123 I]1 varied between 50-60% while for [ 123 I]2 the range was 65-80%. Both radioligands were obtained with radiochemical purity > 97% and specific activity estimated to be > 185 GBq/μmol. The biodistribution of [ 123 I]1 demonstrated low degree of brain penetration at 5 min (0.14%ID/g) with a homogenous distribution. The radioactivity cleared quickly from all brain regions with no preferential localization. In comparison, [ 123 I]2 demonstrated on average a higher brain uptake at 5 min (0.5%ID/g). However the distribution of radioactivity was homogenous and cleared to levels similar to [ 123 I]1 at 1 hr post-injection. Pre-administration of citalopram failed to show any significant inhibition of [ 123 I]2 uptake in the rat brain. The high lipophilicity of 1 and 2 (HPLC-derived log P 7.4 values of 6.41 and 4.25 respectively) and in vivo metabolism, seen by high thyroid uptake would explain the absence of any specific binding observed in the rat brain. In view of these results [ 123 I]1 and [ 123 I]2 do not appear to be suitable radioligands for in vivo studies of the SERT

Synthesis and evaluation of iodine-123 labelled tricyclic tropanes as radioligands for the serotonin transporter

Energy Technology Data Exchange (ETDEWEB)

Quinlivan, Mitchell; Mattner, Filomena; Papazian, Vahan; Zhou, Jia; Katsifis, Andrew; Emond, Patrick; Chalon, Sylvie; Kozikowski, Alan; Guilloteau, Denis; Kassiou, Michael E-mail: mkassiou@med.usyd.edu.au

2003-10-01

The tricyclic tropane analogues (1S,3S,6R,10S)-(Z)-10-(benzoyloxymethyl)-9-(3-chloro-4-iodobenzylidene)-7 -azatricyclo[4.3.1.0{sup 3,7}]decane, 1, and (1S,3S,6R,10S)-(Z)-9-(3-chloro-4-iodobenzylidene)-7-azatricyclo[4.3.1.0{sup 3,7}] = decane-10-carboxylic acid methyl ester, 2, have been shown to be potent and selective serotonin transporter (SERT) ligands. They possess nanomolar affinity for the SERT (Ki = 0.06 nM and 1.8 nM respectively) and are suitable for radiolabelling using iodine-123. In the present study we prepared [{sup 123}I]1 and [{sup 123}I]2 from the appropriate tributylstannane precursors using acidic media with chloramine-T as the oxidising agent. The radiochemical yield obtained for [{sup 123}I]1 varied between 50-60% while for [{sup 123}I]2 the range was 65-80%. Both radioligands were obtained with radiochemical purity > 97% and specific activity estimated to be > 185 GBq/{mu}mol. The biodistribution of [{sup 123}I]1 demonstrated low degree of brain penetration at 5 min (0.14%ID/g) with a homogenous distribution. The radioactivity cleared quickly from all brain regions with no preferential localization. In comparison, [{sup 123}I]2 demonstrated on average a higher brain uptake at 5 min (0.5%ID/g). However the distribution of radioactivity was homogenous and cleared to levels similar to [{sup 123}I]1 at 1 hr post-injection. Pre-administration of citalopram failed to show any significant inhibition of [{sup 123}I]2 uptake in the rat brain. The high lipophilicity of 1 and 2 (HPLC-derived log P{sub 7.4} values of 6.41 and 4.25 respectively) and in vivo metabolism, seen by high thyroid uptake would explain the absence of any specific binding observed in the rat brain. In view of these results [{sup 123}I]1 and [{sup 123}I]2 do not appear to be suitable radioligands for in vivo studies of the SERT.

THE NATURE OF A GALAXY ALONG THE SIGHT LINE TO PKS 0454+039

International Nuclear Information System (INIS)

Takamiya, Marianne; Chun, Mark; Kulkarni, Varsha P.; Gharanfoli, Soheila

2012-01-01

We report on the properties of a faint blue galaxy (G1) along the line of sight to the QSO PKS 0454+039 from spectroscopic and imaging data. We measured emission lines of Hα, [S II] λλ6716, 6732, and [N II] λ6584 in the spectrum of G1 obtained with the Gemini/GMOS instrument. The spectroscopic redshift of G1 is z = 0.0715 ± 0.0002. From the extinction-corrected Hα flux, we determine a modest star formation rate of SFR = 0.07 M ☉ yr –1 and a specific SFR of log (sSFR) –8.4. Using three different abundance indicators, we determine a nebular abundance 12 + log (O/H) ranging from 7.6 to 8.2. Based on the velocity dispersion inferred from the emission line widths and the observed surface brightness profile, we estimate the virial mass of G1 to be M vir ∼ 6.7 × 10 9 M ☉ with an effective radius of 2.0 kpc. We estimate the stellar mass of G1 using spectral energy distribution fitting to be M * ≈ 1.2 × 10 7 M ☉ and an r'-luminosity of L r' = 1.5x10 8 L ☉ . Overall, G1 is a faint, low-mass, low-metallicity Im/H II galaxy. We also report on the line flux limits of another source (G3) which is the most likely candidate for the absorber system at z = 0.8596. From the spectrum of the QSO itself, we report a previously undetected Mg II λλ2796, 2803 absorption line system at z = 1.245.

A new method for crosstalk correction in simultaneous dual-isotope myocardial imaging with Tl-201 and I-123

International Nuclear Information System (INIS)

Tsuji, Akinori; Kojima, Akihiro; Oyama, Yoichi; Tomiguchi, Seiji; Kira, Tomohiro; Takagi, Yoshikazu; Shimomura, Osamu; Takahashi, Mutsumasa; Matsumoto, Masanori

1999-01-01

We have developed a new method of crosstalk correction in simultaneous dual-isotope imaging with Tl-201 and I-123 by using crosstalk ratios and a blurring filter. Single isotope myocardial studies (10 for Tl-201 and 7 for I-123) were performed with a dual energy window acquisition mode and two low energy general-purpose collimators. Then two planar images acquired with dual energy windows for a Tl-201 line source and an I-123 line source were obtained to measure line spread functions (LSFs) and crosstalk ratios for each image. The line source experiments showed that the LSFs for the Tl-201 imaging window from the single Tl-201 source were very similar to those for the I-123 imaging window from the single Tl-201 source, but the LSFs for the Tl-201 imaging window from the single I-123 source had broad shapes which differed from those for the I-123 imaging window from the single I-123. To obtain accurate I-123 crosstalk images in the Tl-201 imaging window from the I-123 images in the I-123 imaging window, we designed a low-pass blurring filter. In 7 clinical I-123 MIBG studies, I-123 window images processed with this filter became very similar to the Tl-201 window image from the single I-123 source. The method proposed in this study can accurately correct the crosstalk in dual isotope studies with Tl-201 and I-123 and is easily applicable to conventional gamma camera systems with any dual energy window acquisition mode. (author)

Investigation of normal pressure hydrocephalus by sup 123 I-IMP SPECT

Energy Technology Data Exchange (ETDEWEB)

Kamiya, Ken; Yamashita, Nobuko; Nagai, Hajime [Nagoya City Univ. (Japan). Faculty of Medicine; Mizawa, Ikuo

1991-08-01

We evaluated N-isopropyl-p-({sup 123}I) iodoamphetamine ({sup 123}I-IMP) single photon emission computed tomography (SPECT) as a method for identifying normal pressure hydrocephalic (NPH) patients eligible for shunting procedures. {sup 123}I-IMP SPECT scans were taken before and after cerebrospinal fluid (CSF) taps in NPH cases. Post-subarachnoid hemorrhagic (SAH) patients showed apparent frontal blood flow reduction but non-SAH cases did not. The frontal blood flow increased in comparison with the temporal flow after CSF tapping in SAH cases who benefited most from shunting. Cerebral blood flow study before and after CSF removal is a potential method for classifying NPH patients likely to benefit from the shunting operation. (author).

19 CFR 123.72 - Written agreement requirement.

Science.gov (United States)

2010-04-01

... THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Land Border Carrier Initiative Program § 123.72... lading of illegal drugs while the conveyance is en route to the United States; (c) To conduct, to the...

Application of I-123 HIPDM as a lung imaging agent

Energy Technology Data Exchange (ETDEWEB)

Shih, W J; Coupal, J J; Dillon, M L; Kung, H F

1988-04-01

N,N,N'-Trimethyl-N'-(2-Hydroxyl-3-Methyl-5-/sup 123/I Iodobenzyl)-1,3-Propanediamine.Hcl (/sup 123/I-HIPDM) has been used for diagnosis of patients with strokes and demantias. Since this radiopharmaceutical is also accumulated in the lung, we routinely performed a lung image or images immediately prior to cerebral planar and SPECT images after a 3-5 mCi /sup 123/I-HIPDM injection. During the past 14 months, we obtained 78 (age from 41 to 92 years, average 66.7+-8.9 years; 64 males, 14 females) suspected stroke or dementia patients' lung images. All lung images were correlated to chest X-ray (CXR) or CT and other clinical data. Sixty five of 78 patients had normal lungs showing homogeneous distribution of activity throughout the lungs which correlated well to normal CXR and/or CT studies. Abnormal scintigraphic patterns of the 13 patients included lung defect (5 bronchogenic carcinoma with or without atelectasis) and decreased uptake in apices (8 chronic obstructive pulmonary disease). The findings of pulmonary intrathoracic pathologies on lung images with /sup 123/I-HIPDM suggests further evaluation of the agent for detection of localized pulmonary diseases and pulmonary physiological studies relating to amine metabolism.

20 CFR 1001.123 - Performance standards governing the assignment and role of Local Veterans' Employment...

Science.gov (United States)

2010-04-01

... assignment and role of Local Veterans' Employment Representatives (LVERs). 1001.123 Section 1001.123... Veterans and Eligible Persons § 1001.123 Performance standards governing the assignment and role of Local... one member of each State agency staff, preferably an eligible veteran, shall be designated and...

Thallium-201 diethyldithiocarbamate: an alternative to iodine-123 N-isopropyl-p-iodoamphetamine

NARCIS (Netherlands)

de Bruine, J. F.; van Royen, E. A.; Vyth, A.; de Jong, J. M.; van der Schoot, J. B.

1985-01-01

The study of cerebral blood flow by single photon emission computed tomography (SPECT) requires lipophilic radiopharmaceuticals. The high cost and limited availability of N-isopropyl-p-[I-123]-iodoamphetamine ( [123I]IMP) led us to search for alternatives. Following our recent development of

New preparation of (123I) iodolisuride from the 2-tri-n-butylstannalisuride derivative

International Nuclear Information System (INIS)

Mauclaire, L.; Loc'h, C.; Berthommier, E.; Ottaviani, M.; Boulanger, H.D.; Coulon, C.; Maziere, B.

1999-01-01

A simplified and efficient method is described for the preparation of [ 123 I]2-iodolisuride. The radioiodination of 3-(9,10-didehydro-6methyl-8a-ergolinyl)-1,1-diethylurea (lisuride) is based on tributyltin to 123 I exchange in oxidative conditions. After optimization of the reaction parameters [ 123 I]2-iodolisuride was obtained without high performance liquid chromatography purification with radiochemical yields >90% and a radiochemical purity higher than 95%. The specific activity of the product was more than 500 MBq/nmol. In vitro binding studies on striatal membranes and ex vivo autoradiography in rats showed that [ 123 I] or [ 125 I]2-iodolisuride prepared using this method, have the same radiopharmacological characteristics as radioiodinated iodolisuride prepared using the Iodogen[reg] method

Effects of cigarette smoking on iodine 123 N-isopropyl-f-iodoamphetamine clearance from the lung

International Nuclear Information System (INIS)

Kato, Kunihiko; Harada, Satoshi; Takahashi, Tsuneo; Katsuragawa, Shigehiko; Yanagisawa, Toru

1991-01-01

Iodine 123 N-isopropyl-p-iodoamphetamine ( 123 I-IMP), originally developed as a brain scanning agent, is also taken up by the lung. To evaluate the effects of cigarette smoking on the kinetics of IMP in the lung, we studied 123 I-IMP clearance from the lung in 18 volunteers (8 non-smokers and 10 smokers). After the injection of 111 MBq of 123 I-IMP into the medial cubital vein, the time-activity curve for 60 min and the regional activity using 1 frame per minute and a 64x64 matrix were obtained. The 123 I-IMP clearance curve was described as follows: C(t)=A 1 e ( -k 1 t)+A 2 e ( -k 2 t)(A 1 , A 2 : intercepts, and k 1 , k 2 : slopes of the exponential components). 123 I-IMP clearance was delayed in smokers, and k 2 was smaller in smokers. Also, a correlation between k 1 , k 2 , and the number of cigarettes smoked per day was found (r=-0.65, r=-0.74, respectively, P 123 I-IMP in the lung indicate lung metabolic disorders due to cigarette smoking. (orig.)

Structure-based nuclear import mechanism of histones H3 and H4 mediated by Kap123

Energy Technology Data Exchange (ETDEWEB)

An, Sojin [Department of Biological Chemistry, University of Michigan Medical School, Michigan, United States; Yoon, Jungmin [Structural Biology Laboratory of Epigenetics, Department of Biological Sciences, Graduate school of Nanoscience and Technology (World Class University), KI for the BioCentury, Korea Advanced Institute of Science and Technology, Daejeon, South Korea; Kim, Hanseong [Department of Biological Chemistry, University of Michigan Medical School, Michigan, United States; Song, Ji-Joon [Structural Biology Laboratory of Epigenetics, Department of Biological Sciences, Graduate school of Nanoscience and Technology (World Class University), KI for the BioCentury, Korea Advanced Institute of Science and Technology, Daejeon, South Korea; Cho, Uhn-soo [Department of Biological Chemistry, University of Michigan Medical School, Michigan, United States

2017-10-16

Kap123, a major karyopherin protein of budding yeast, recognizes the nuclear localization signals (NLSs) of cytoplasmic histones H3 and H4 and translocates them into the nucleus during DNA replication. Mechanistic questions include H3- and H4-NLS redundancy toward Kap123 and the role of the conserved diacetylation of cytoplasmic H4 (K5ac and K12ac) in Kap123-mediated histone nuclear translocation. Here, we report crystal structures of full-length Kluyveromyces lactis Kap123 alone and in complex with H3- and H4-NLSs. Structures reveal the unique feature of Kap123 that possesses two discrete lysine-binding pockets for NLS recognition. Structural comparison illustrates that H3- and H4-NLSs share at least one of two lysine-binding pockets, suggesting that H3- and H4-NLSs are mutually exclusive. Additionally, acetylation of key lysine residues at NLS, particularly H4-NLS diacetylation, weakens the interaction with Kap123. These data support that cytoplasmic histone H4 diacetylation weakens the Kap123-H4-NLS interaction thereby facilitating histone Kap123-H3-dependent H3:H4/Asf1 complex nuclear translocation.

Diagnostic value of myocardial tomographic imaging with 123I labelled BMIPP for exercise-induced angina pectoris

International Nuclear Information System (INIS)

Wang Lijuan; Kaname Akioka; Hiroyuki Yamagishi

1999-01-01

Objective: To evaluate the diagnostic value of resting myocardial tomographic imaging with 123 I labelled BMIPP ( 123 I-BMIPP SPECT) for exercise-induced angina pectoris by comparison with stress myocardial tomographic imaging with 201 Tl( 201 Tl SPECT). Methods: 123 I-BMIPP SPECT and 201 Tl SPECT were performed in 32 patients with exercise-induced angina pectoris and 12 normal controls. Left ventricle was divided into nine segments and uptake of 201 TL and 123 I-BMIPP was evaluated by four classes score method (defect score, DS). Results: In the patients with angina pectoris, segments of 201 Tl distribution abnormality were more than that of 123 I-BMIPP. Concordant rate between DS of the 20 '1Tl SPECT for detecting coronary artery stenosis were 62%, 92% and 70%, respectively, and 201 Tl SPECT were 84%, 83% and 84%, respectively. Sensitivity of 123 I-BMIPP SPECT was significantly lower than that of 201 Tl SPECT (P 123 I-BMIPP SPECT will be. Conclusions: The results indicated that to a certain extent, resting 123 I-BMIPP SPECT may has practical clinical value for detection of coronary artery stenosis, and determination of stenotic degree in the patients with exercise-induced angina pectoris

In vivo evaluation of [123I]mZIENT as a SPECT radioligand for the serotonin transporter

International Nuclear Information System (INIS)

Batis, Jeffery; Barret, Olivier; Alagille, David; Koren, Andrei O.; Stehouwer, Jeffrey S.; Cosgrove, Kelly; Goodman, Mark; Seibyl, John; Tamagnan, Gilles

2012-01-01

Introduction: In vivo imaging of the serotonin transporter continues to be a valuable tool in drug development and in monitoring diseases that alter serotonergic function. The purposes of this study were to: 1) evaluate the test/retest reproducibility of [ 123 I] 2β-Carbomethoxy-3β-(3′-((Z)-2-iodoethenyl)phenyl)nortropane ([ 123 I]mZIENT); and 2) to assess displacement of [ 123 I]mZIENT following administration of SERT specific drugs. Methods: Six female baboons (Papio anubis) were scanned following i.v. administration of [ 123 I]mZIENT. The regional binding potential (BP nd ) was determined using a simplified reference tissue model, with the cerebellum used as a reference region. The test/retest reproducibility of BP nd was determined following repeated injection of [ 123 I]mZIENT on a different day. To assess the displacement of [ 123 I]mZIENT from SERT, citalopram (0.01–5 mg/kg) or sertraline (0.01–0.5 mg/kg) was given as iv bolus at ∼ 4 h following administration of [ 123 I]mZIENT. Results: The test/retest variability of BP nd was less than 10% for all SERT-rich brain regions. Estimates of ED50 for displacement of [ 123 I]mZIENT in SERT-rich regions were consistent with previous reports for the [ 11 C] analog of [ 123 I]mZIENT. Both citalopram and sertraline displaced [ 123 I]mZIENT from SERT in a dose-dependent manner, with maximal observed displacements of greater than 80% in the diencephalon and greater than 75% in brainstem for both citalopram and sertraline. Conclusions: [ 123 I] mZIENT demonstrates good test–retest reproducibility; and initial displacement studies suggest that this compound is highly selective for SERT. Overall, this radioligand has favorable characteristics for use in drug development studies and/or longitudinal studies interrogating SERT.

SPECT 123-I-[FP-CIT] diagnostic in the presynaptic parkinsonism

International Nuclear Information System (INIS)

Piperkova, E.; Georgiev, R.; Dimitrova, M.; Daskalov, M.; Orosova, M.; Milanova, M.; Danon, S.

2005-01-01

Detection of loss off functional dopaminergic neurone terminals in the striatum of patients with clinically uncertain Parkinsonian Syndromes will help to differentiate the Essential Tremor (ET) from the Parkinson Syndromes related to idiopathic Parkinson's Disease (PD), Multiple System Atrophy (MSA) or Progressive Supranuclear Palsy (PSP). In these cases dopaminic medication should be avoided for patients not suffering from true parkinsonism.Objective of the study is to determine the utility of [ 123 I] FP-CIT SPECT in clinically uncertain Parkinsonian syndromes and their differentiation from ET. Materials and Methods: This prospective study involved 9 patients (4 males and 5 females, aged between 38 - 81 years) with clinically uncertain Parkinsonism. The main symptoms were tremor (n=8), gait alteration (n=6), bradykinesia (n=3) and Negro phenomena positive (n=2), or a combination of these symptoms (n=9), with subsequent follow-up of 7-8 months. Dopamine agonists and antagonists acting on the postsynaptic dopamine receptors were not accepted to interfere with 123 I-Ioflupane. All patients underwent appropriate thyroid blocking by oral administration of 120 mg potassium iodide before and after [ 123 ] I FP-CIT application. All patents underwent SPECT scans 3-4 hours after i.v. injection of 185 MBq [ 123 ] FP-CIT (DaTSCAN - Amersham) on a Diacam Gamma-Camera System (Siemens). To estimate [ 123 ] FP-CIT biodistribution whole-body scans were performed, 15 minutes and 2-3 hrs after the i.v. application of the tracer. The SPECT results were evaluated visually and semi quantitatively. The [ 123 ] FP-CIT uptake of the striatum (nucleus caudatus and putamen) was referenced to the occipital cortex and to the symmetrical ROI. The scanning procedure was completed according to strict conditions for symmetry and geometry. The filtering and reconstructing procedures if the images were performed individually for each patient to avoid artifacts and errors. In all patients CT scans

Effects of anesthetic agents on cellular 123I-MIBG transport and in vivo 123I-MIBG biodistribution

International Nuclear Information System (INIS)

Ko, Bong-Ho; Paik, Jin-Young; Jung, Kyung-Ho; Bae, Jun-Sang; Lee, Eun Jung; Choe, Yearn Seong; Kim, Byung-Tae; Lee, Kyung-Han

2008-01-01

Small animal imaging with meta-iodobenzylguanidine (MIBG) allows characterization of animal models, optimization of tumor treatment strategies, and monitoring of gene expression. Anesthetic agents, however, can affect norepinephrine (NE) transport and systemic sympathetic activity. We thus elucidated the effects of anesthetic agents on MIBG transport and biodistribution. SK-N-SH neuroblastoma and PC-12 pheochromocytoma cells were measured for 123 I-MIBG uptake after treatment with ketamine (Ke), xylazine (Xy), Ke/Xy, or pentobarbital (Pb). NE transporters were assessed by Western blots. Normal ICR mice and PC-12 tumor-bearing mice were injected with 123 I-MIBG 10 min after anesthesia with Ke/Xy, Ke, Xy, or Pb. Plasma NE levels and MIBG biodistribution were assessed. Cellular 123 I-MIBG uptake was dose-dependently inhibited by Ke and Xy but not by Pb. Treatment for 2 h with 300 μM Ke, Xy, and Ke/Xy decreased uptake to 46.0 ± 1.6, 24.8 ± 1.5, and 18.3 ± 1.6% of controls. This effect was completely reversed by fresh media, and there was no change in NE transporter levels. In contrast, mice anesthetized with Ke/Xy showed no decrease of MIBG uptake in target organs. Instead, uptakes and organ-to-blood ratios were increased in the heart, lung, liver, and adrenals. Plasma NE was notably reduced in the animals with corresponding decreases in blood MIBG, which partly contributed to the increase in target organ uptake. In spite of their inhibitory effect at the transporter level, Ke/Xy anesthesia is a satisfactory method for MIBG imaging that allows favorable target tissue uptake and contrast by reducing circulating NE and MIBG. (orig.)

Study of {sup 124} I contamination in {sup 123} I used in medical applications

Energy Technology Data Exchange (ETDEWEB)

El-Samman, H [Faculty of Science, Menoufia University, Shibin El-Kom (Egypt); Arafa, W [Physics Department, Faculty of Women, Ain Shams University, Cairo (Egypt)

1997-12-31

The decay of 0.2 mCi capsules of iodide ({sup 123} I) used for diagnostic purpose and delivered to hamad hospital in Qatar, was studied using HPGe detector of (30% efficiency and 1.8 KeV energy resolution), coupled to a computer based 4096 multichannel analyzer. The acquisition parameters were controlled by computer program. The gamma spectra were analyzed using well developed gamma spectrum analysis program gamanl. Results showed that the isotope used is not pure {sup 123} I but it is a mixture of {sup 123} I and {sup 124} I. The percentage of the unwanted {sup 124} I isotope was estimated to be 15%. The dose taken by the patient due to the unwanted {sup 124} I isotope was estimated. Half-lives time of the {sup 123} I and {sup 123} I isotopes were determined with high accuracy and compared to the published values. 3 tabs.

Identification and functional characterization of three type III polyketide synthases from Aquilaria sinensis calli

International Nuclear Information System (INIS)

Wang, Xiaohui; Zhang, Zhongxiu; Dong, Xianjuan; Feng, Yingying; Liu, Xiao; Gao, Bowen; Wang, Jinling; Zhang, Le; Wang, Juan; Shi, Shepo; Tu, Pengfei

2017-01-01

Type III polyketide synthases (PKSs) play an important role in biosynthesis of various plant secondary metabolites and plant adaptation to environmental stresses. Aquilaria sinensis (A. sinensis) is the main plant species for production of agarwood, little is known about its PKS family. In this study, AsCHS1 and two new type III PKSs, AsPKS1 and AsPKS2, were isolated and characterized in A. sinensis calli. The comparative sequence and phylogenetic analysis indicated that AsPKS1 and AsPKS2 belonged to non-CHS group different from AsCHS1. The recombinant AsPKS1 and AsPKS2 produced the lactone-type products, suggesting their different enzyme activities from AsCHS1. Three PKS genes had a tissues-specific pattern in A. sinensis. Moreover, we examined the expression profiles of three PKS genes in calli under different abiotic stresses and hormone treatments. AsCHS1 transcript was most significantly induced by salt stress, AsPKS1 abundance was most remarkably enhanced by CdCl 2 treatment, while AsPKS2 expression was most significantly induced by mannitol treatment. Furthermore, AsCHS1, AsPKS1 and AsPKS2 expression was enhanced upon gibberellins (GA3), methyl jasmonate (MeJA), or salicylic acid (SA) treatment, while three PKS genes displayed low transcript levels at the early stage under abscisic acid (ABA) treatment. In addition, three GFP:PKSs fusion proteins were localized in the cytoplasm and cell wall in Nicotiana benthamiana cells. These results indicated the multifunctional role of three type III PKSs in polyketide biosynthesis, plant resistance to abiotic stresses and signal transduction. - Highlights: • Two new PKS genes (AsPKS1 and AsPKS2) were isolated and characterized from A. sinensis. • The recombinant AsPKS1 and AsPKS2 catalyzed lactone-type products in vitro. • AsCHS1, AsPKS1 and AsPKS2 were involved in plant responses to abiotic stresses and hormone stimuli. • Our results also indicated that AsCHS1, AsPKS1 and AsPKS2 were predominantly localized

Dopamine transporter imaging with [123I]FP-CIT SPECT: potential effects of drugs

International Nuclear Information System (INIS)

Booij, Jan; Kemp, Paul

2008-01-01

[ 123 I]N-ω-fluoropropyl-2β-carbomethoxy-3β-{4-iodophenyl}nortropane ([ 123 I]FP-CIT) single photon emission computed tomography (SPECT) is a frequently and routinely used technique to detect or exclude dopaminergic degeneration by imaging the dopamine transporter (DAT) in parkinsonian and demented patients. This technique is also used in scientific studies in humans, as well as in preclinical studies to assess the availability of DAT binding in the striatum. In routine clinical studies, but also in scientific studies, patients are frequently on medication and sometimes even use drugs of abuse. Moreover, in preclinical studies, animals will be anesthetized. Prescribed drugs, drugs of abuse, and anesthetics may influence the visual interpretation and/or quantification of [ 123 I]FP-CIT SPECT scans. Here, we discuss the basic principle of how drugs and anesthetics might influence the visual interpretation and/or quantification of [ 123 I]FP-CIT SPECT scans. We also review drugs which are likely to have a significant influence on the visual interpretation and/or quantification of [ 123 I]FP-CIT SPECT scans. Additionally, we discuss the evidence as to whether frequently prescribed drugs in parkinsonian and demented patients may have an influence on the visual interpretation and/or quantification of [ 123 I]FP-CIT SPECT scans. Finally, we discuss our recommendations as to which drugs should be ideally withdrawn before performing a [ 123 I]FP-CIT SPECT scan for routine clinical purposes. The decision to withdraw any medication must always be made by the specialist in charge of the patient's care and taking into account the pros and cons of doing so. (orig.)

Development of I-123-labeled amines for brain studies: localization of I-123 iodophenylalkyl amines in rat brain

International Nuclear Information System (INIS)

Winchell, H.S.; Baldwin, R.M.; Lin, T.H.

1980-01-01

Localization in rat brain of forty iodophenylalkyl amines labeled with I-123 was evaluated in an attempt to develop I-123-labeled amines useful for brain studies. For the amines studied, the highest activity in brain and the brain-to-blood activity ratios ranked p > m > o as related to iodine position on the benzene ring: for alkyl groups the rank order was α-methylethyl > ethyl > methyl > none; for N additions it was single lipophilic group > H > two lipophilic groups. It is suggested that introduction of a halogen into the ring structure of many amines results in greater concentration of the agent in brain than is seen with the nonhalogenated parent compound. The agent N-isopropyl-p-iodoamphetamine was chosen for further study because, in the rat, it showed high brain activity (1.57%/g) and brain-blood ratio (12.6) at 5 min

Development of the radiosynthesis of high-specific-activity {sup 123}I-NKJ64

Energy Technology Data Exchange (ETDEWEB)

Tavares, Adriana Alexandre S., E-mail: a.tavares.1@research.gla.ac.u [Institute of Neuroscience and Psychology, College of Medical, Veterinary and Life Sciences, University of Glasgow, G12 8QQ Glasgow (United Kingdom); Jobson, Nicola K. [WestCHEM, School of Chemistry, The Joseph Black Building, University of Glasgow, G12 8QQ Glasgow (United Kingdom); Dewar, Deborah [Institute of Neuroscience and Psychology, College of Medical, Veterinary and Life Sciences, University of Glasgow, G12 8QQ Glasgow (United Kingdom); Sutherland, Andrew [WestCHEM, School of Chemistry, The Joseph Black Building, University of Glasgow, G12 8QQ Glasgow (United Kingdom); Pimlott, Sally L. [West of Scotland Radionuclide Dispensary, University of Glasgow and North Glasgow University Hospital NHS Trust, G11 6NT Glasgow (United Kingdom)

2011-05-15

Introduction: {sup 123}I-NKJ64, a reboxetine analogue, is currently under development as a potential novel single photon emission computed tomography radiotracer for imaging the noradrenaline transporter in brain. This study describes the development of the radiosynthesis of {sup 123}I-NKJ64, highlighting the advantages and disadvantages, pitfalls and solutions encountered while developing the final radiolabelling methodology. Methods: The synthesis of {sup 123}I-NKJ64 was evaluated using an electrophilic iododestannylation method, where a Boc-protected trimethylstannyl precursor was radioiodinated using peracetic acid as an oxidant and deprotection was investigated using either trifluoroacetic acid (TFA) or 2 M hydrochloric acid (HCl). Results: Radioiodination of the Boc-protected trimethylstannyl precursor was achieved with an incorporation yield of 92{+-}6%. Deprotection with 2 M HCl produced {sup 123}I-NKJ64 with the highest radiochemical yield of 98.05{+-}1.63% compared with 83.95{+-}13.24% with TFA. However, the specific activity of the obtained {sup 123}I-NKJ64 was lower when measured after using 2 M HCl (0.15{+-}0.23 Ci/{mu}mol) as the deprotecting agent in comparison to TFA (1.76{+-}0.60 Ci/{mu}mol). Further investigation of the 2 M HCl methodology found a by-product, identified as the deprotected proto-destannylated precursor, which co-eluted with {sup 123}I-NKJ64 during the high-performance liquid chromatography (HPLC) purification. Conclusions: The radiosynthesis of {sup 123}I-NKJ64 was achieved with good isolated radiochemical yield of 68% and a high specific activity of 1.8 Ci/{mu}mol. TFA was found to be the most suitable deprotecting agent, since 2 M HCl generated a by-product that could not be fully separated from {sup 123}I-NKJ64 using the HPLC methodology investigated. This study highlights the importance of HPLC purification and accurate measurement of specific activity while developing new radiosynthesis methodologies.

Rapid Multiwaveband Polarization Variability in the Quasar PKS 0420-014: Optical Emission from the Compact Radio Jet

Science.gov (United States)

D'Arcangelo, Francesca D.; Marscher, Alan P.; Jorstad, Svetlana G.; Smith, Paul S.; Larionov, Valeri M.; Hagen-Thorn, Vladimir A.; Kopatskaya, Eugenia N.; Williams, G. Grant; Gear, Walter K.

2007-04-01

An 11 day monitoring campaign in late 2005 reveals clear correlation in polarization between the optical emission and the region of the intensity peak (the ``pseudocore'') at the upstream end of the jet in 43 GHz VLBA (Very Long Baseline Array) images in the highly variable quasar PKS 0420-014. The electric-vector position angle (EVPA) of the pseudocore rotated by about 80° in four VLBA observations over a period of 9 days, matching the trend of the optical EVPA. In addition, the 43 GHz EVPAs agree well with the optical values when we correct the former for Faraday rotation. Fluctuations in the polarization at both wave bands are consistent with the variable emission arising from a standing conical shock wave that compresses magnetically turbulent plasma in the ambient jet. The volume of the variable component is the same at both wave bands, although only ~20% of the total 43 GHz emission arises from this site. The remainder of the 43 GHz flux density must originate in a separate region with very low polarization. If 0420-014 is a typical case, the nonthermal optical emission from blazars originates primarily in and near the pseudocore rather than closer to the central engine where the flow collimates and accelerates.

Autopsy validation of 123I-FP-CIT dopaminergic neuroimaging for the diagnosis of DLB.

Science.gov (United States)

Thomas, Alan J; Attems, Johannes; Colloby, Sean J; O'Brien, John T; McKeith, Ian; Walker, Rodney; Lee, Lean; Burn, David; Lett, Debra J; Walker, Zuzana

2017-01-17

To conduct a validation study of 123 I-N-fluoropropyl-2b-carbomethoxy-3b-(4-iodophenyl) nortropane ( 123 I-FP-CIT) SPECT dopaminergic imaging in the clinical diagnosis of dementia with Lewy bodies (DLB) with autopsy as the gold standard. Patients >60 years of age with dementia who had undergone 123 I-FP-CIT imaging in research studies and who had donated their brain tissue to the Newcastle Brain Tissue Resource were included. All had structured clinical research assessments, and clinical diagnoses were applied by consensus panels using international diagnostic criteria. All underwent 123 I-FP-CIT imaging at baseline, and scans were rated as normal or abnormal by blinded raters. Patients were reviewed in prospective studies and after death underwent detailed autopsy assessment, and neuropathologic diagnoses were applied with the use of standard international criteria. Fifty-five patients (33 with DLB and 22 with Alzheimer disease) were included. Against autopsy diagnosis, 123 I-FP-CIT had a balanced diagnostic accuracy of 86% (sensitivity 80%, specificity 92%) compared with clinical diagnosis, which had an accuracy of 79% (sensitivity 87%, specificity 72%). Among patients with DLB, 10% (3 patients) met pathologic criteria for Lewy body disease but had normal 123 I-FP-CIT imaging. This large autopsy analysis of 123 I-FP-CIT imaging in dementia demonstrates that it is a valid and accurate biomarker for DLB, and the high specificity compared with clinical diagnosis (20% higher) is clinically important. The results need to be replicated with patients recruited from a wider range of settings, including movement disorder clinics and general practice. While an abnormal 123 I-FP-CIT scan strongly supports Lewy body disease, a normal scan does not exclude DLB with minimal brainstem involvement. This study provides Class I evidence that 123 I-FP-CIT dopaminergic neuroimaging accurately identifies patients with DLB. Copyright © 2016 The Author(s). Published by Wolters Kluwer

Imaging tissue hypoxia: clinical and pre-clinical experience with {sup 123}IAZA

Energy Technology Data Exchange (ETDEWEB)

Wiebe, L.I. [University of Alberta, Edmonton (Canada). Noujaim Institute for Pharmaceutical Oncology Research, Faculty of Pharmacy and Pharmaceutical Sciences

1997-10-01

The molecular mechanisms that underline the selective binding of iodazomycin arabinoside, IAZA, and related nitromidazoles are reviewed as a basis for interpretation of preclinical and clinical data for hypoxic binding of radioiodinated IAZA. Clinical data are presented for {sup 123}IAZA uptake in a number of pathologies including metastatic tumours, peripheral vascular disease in diabetes, muscle stress and rheumatoid arthritis. The results of studies to determine the influence of tumour type on uptake of {sup 123} I-IAZA in patients with a variety of deep-seated solid tumours will be presented. Correlations of hypoxia-dependent binding with {sup 99m}Tc-HMPAO perfusion images will be reviewed and early correlations of uptake to treatment response in cancer will be presented. Unusual features of {sup 123}I-IAZA biodistribution will also be discussed together with detailed pharmacokinetic and radiation dosimetry data for `2{sup 123}I- IAZA in normal volunteers 27 refs., 1 fig.

Synthesis of [123I]IBZM: a reliable procedure for routine clinical studies

International Nuclear Information System (INIS)

Zea-Ponce, Yolanda; Laruelle, Marc

1999-01-01

The single photon emission computed tomography (SPECT) D 2 /D 3 receptor radiotracer [ 123 I]IBZM, is prepared by electrophilic radioiodination of the precursor BZM with high-purity sodium [ 123 I]iodide in the presence of diluted peracetic acid. However, in our hands, the most commonly used procedure for this radiosynthesis produced variable and inconsistent labeling yields, to such extent that it became inappropriate for routine clinical studies. Our goal was to modify the labeling procedure, to obtain consistently better labeling and radiochemical yields. The best conditions found for the radioiodination were as follows: 50 μg precursor in 50 μL EtOH mixed with buffer pH 2; Na[ 123 I]I in 0.1 M NaOH ( 123 I]I solution the yields were consistent but lower. For example, for volumes between 417 and 523 μL the labeling yield was 61±5% (n=21), radiochemical yield was 56± 5% and radiochemical purity was 98±1%

Microautoradiography of [{sup 123}I]ADAM in mice treated with fluoxetine and serotonin reuptake inhibitors

Energy Technology Data Exchange (ETDEWEB)

Ye, X.-X.; Chen, J.-C.; Liu, R.-S.; Wey, S.-P.; Lee, J.-S.; Chen, C.-C.; Fu, Y.-K.; Ting, Gann; Hwang, J.-J. E-mail: jjhwang@ym.edu.tw

2004-07-01

A radiopharmaceutical, {sup 123}I-labeled 2-((2-((dimethylamino)methyl)phenyl)thio)-5-iodophenylamine ([{sup 123}I]ADAM), has been developed recently for evaluation of how serotonin transporters (SERT) function in the brain. However, the detailed biodistribution and specific binding in certain brain areas are not well investigated. In this study, both phosphor plate imaging and microautoradiography were applied to explore the binding characteristics of [{sup 123}I]ADAM in SERT neurons. The effect of two psychotropics and one narcotic on the binding of [{sup 123}I]ADAM to SERT was also studied. Fluoxetine and desipramine, both are psychotropics and specific SERT ligands and decreased the affinity of [{sup 123}I]ADAM, while p-chloroamphetamine (PCA), a narcotic, destroyed most of serotonergic neurons, as well as reducing the concentration of serotonin and the number of SERT in the brain as shown by the biodistribution of [{sup 123}I]ADAM. Significant and selective accumulation of [{sup 123}I]ADAM in the areas from midbrain to brain stem in normal mice with maximum target-to-background ratio was found at 90 minutes postinjection. A rapid clearance of [{sup 131}I]ADAM at 120 minutes postinjection was found in the CA1, CA3 and ThN brain areas. In addition, the inhibition effect on binding ability of [{sup 123}I]ADAM to SERT by the psychotropics and the narcotic was found to have the order of: PCA > fluoxetine > desipramine.

Comparison of I-123 IMP cerebral uptake and MR spectroscopy following experimental carotid occlusion

International Nuclear Information System (INIS)

Holman, B.L.; Jolesz, F.A.; Polak, J.F.; Kronauge, J.F.; Adams, D.F.

1985-01-01

Both I-123 IMP scintigraphy and MRI have been suggested as sensitive detectors of changes shortly after acute cerebral infarction. We compared the uptake of N-isopropyl I-123 p-iodoamphetamine (IMP) and MR spectroscopy of the brain after internal carotid artery ligation. Thirteen gerbils were lightly anesthetized with ether. After neck dissection, an internal carotid artery was occluded. After 2.8 hours, 100 muCi I-123 IMP was injected intravenously into the 13 experimental animals plus three controls. Seven gerbils remained asymptomatic while six developed hemiparesis. At 3 hours after ligation, the animals were killed. The brains were bisected and T1 and T2 relaxation times were determined for the right and left hemispheres by MR spectroscopy immediately after dissection. I-123 IMP uptake was then determined in the samples. Interhemispheric differences in uptake for I-123 IMP were 0.1 +/- 1.7% (SEM) in the control, 33.5 +/- 10% in the asymptomatic and 54.6 +/- 9.7% in the symptomatic animals. Significant differences were seen with I-123 IMP in 6/7 asymptomatic and 6/6 symptomatic animals. In conclusion, I-123 is more sensitive than T1 or T2 relaxation times for the detection of cerebral perfusion abnormalities. Prolongation in T1 and T2 relaxation times correlates closely with increased brain tissue water content and the development of symptoms, indicators of structural brain damage and probable infarction

123I-Mibg scintigraphy and 18F-Fdg-Pet imaging for diagnosing neuroblastoma

Science.gov (United States)

Bleeker, Gitta; Tytgat, Godelieve Am; Adam, Judit A; Caron, Huib N; Kremer, Leontien Cm; Hooft, Lotty; van Dalen, Elvira C

2015-01-01

Background Neuroblastoma is an embryonic tumour of childhood that originates in the neural crest. It is the second most common extracranial malignant solid tumour of childhood. Neuroblastoma cells have the unique capacity to accumulate Iodine-123-metaiodobenzylguanidine (123I-MIBG), which can be used for imaging the tumour. Moreover, 123I-MIBG scintigraphy is not only important for the diagnosis of neuroblastoma, but also for staging and localization of skeletal lesions. If these are present, MIBG follow-up scans are used to assess the patient's response to therapy. However, the sensitivity and specificity of 123I-MIBG scintigraphy to detect neuroblastoma varies according to the literature. Prognosis, treatment and response to therapy of patients with neuroblastoma are currently based on extension scoring of 123I-MIBG scans. Due to its clinical use and importance, it is necessary to determine the exact diagnostic accuracy of 123I-MIBG scintigraphy. In case the tumour is not MIBG avid, fluorine-18-fluorodeoxy-glucose (18F-FDG) positron emission tomography (PET) is often used and the diagnostic accuracy of this test should also be assessed. Objectives Primary objectives: 1.1 To determine the diagnostic accuracy of 123I-MIBG (single photon emission computed tomography (SPECT), with or without computed tomography (CT)) scintigraphy for detecting a neuroblastoma and its metastases at first diagnosis or at recurrence in children from 0 to 18 years old. 1.2 To determine the diagnostic accuracy of negative 123I-MIBG scintigraphy in combination with 18F-FDG-PET(-CT) imaging for detecting a neuroblastoma and its metastases at first diagnosis or at recurrence in children from 0 to 18 years old, i.e. an add-on test. Secondary objectives: 2.1 To determine the diagnostic accuracy of 18F-FDG-PET(-CT) imaging for detecting a neuroblastoma and its metastases at first diagnosis or at recurrence in children from 0 to 18 years old. 2.2 To compare the diagnostic accuracy of 123I

Clinical application of l-123 MlBG cardiac imaging

International Nuclear Information System (INIS)

Kang, Do Young

2004-01-01

Cardiac neurotransmission imaging allows in vivo assessment of presynaptic reuptake, neurotransmitter storage and postsynaptic receptors. Among the various neurotransmitter, I-123 MlBG is most available and relatively well-established. Metaiodobenzylguanidine (MIBG) is an analogue of the false neurotransmitter guanethidine. It is taken up to adrenergic neurons by uptake-1 mechanism as same as norepinephrine. As tagged with I-123, it can be used to image sympathetic function in various organs including heart with planar or SPECT techniques. I-123 MIBG imaging has a unique advantage to evaluate myocardial neuronal activity in which the heart has no significant structural abnormality or even no functional derangement measured with other conventional examination. In patients with cardiomyopathy and heart failure, this imaging has most sensitive technique to predict prognosis and treatment response of betablocker or ACE inhibitor. In diabetic patients, it allow very early detection of autonomic neuropathy. In patients with dangerous arrhythmia such as ventricular tachycardia or fibrillation, MIBG imaging may be only an abnormal result among various exams. In patients with ischemic heart disease, sympathetic derangement may be used as the method of risk stratification. In heart transplanted patients, sympathetic reinnervation is well evaluated. Adriamycin-induced cardiotoxicity is detected earlier than ventricular dysfunction with sympathetic dysfunction. Neurodegenerative disorder such as Parkinson's disease or dementia with Lewy bodies has also cardiac sympathetic dysfunction. Noninvasive assessment of cardiac sympathetic nerve activity with l-123 MlBG imaging may be improve understanding of the pathophysiology of cardiac disease and make a contribution to predict survival and therapy efficacy

Clinical application of l-123 MlBG cardiac imaging

Energy Technology Data Exchange (ETDEWEB)

Kang, Do Young [College of Medicine, Donga Univ., Busan (Korea, Republic of)

2004-10-01

Cardiac neurotransmission imaging allows in vivo assessment of presynaptic reuptake, neurotransmitter storage and postsynaptic receptors. Among the various neurotransmitter, I-123 MlBG is most available and relatively well-established. Metaiodobenzylguanidine (MIBG) is an analogue of the false neurotransmitter guanethidine. It is taken up to adrenergic neurons by uptake-1 mechanism as same as norepinephrine. As tagged with I-123, it can be used to image sympathetic function in various organs including heart with planar or SPECT techniques. I-123 MIBG imaging has a unique advantage to evaluate myocardial neuronal activity in which the heart has no significant structural abnormality or even no functional derangement measured with other conventional examination. In patients with cardiomyopathy and heart failure, this imaging has most sensitive technique to predict prognosis and treatment response of betablocker or ACE inhibitor. In diabetic patients, it allow very early detection of autonomic neuropathy. In patients with dangerous arrhythmia such as ventricular tachycardia or fibrillation, MIBG imaging may be only an abnormal result among various exams. In patients with ischemic heart disease, sympathetic derangement may be used as the method of risk stratification. In heart transplanted patients, sympathetic reinnervation is well evaluated. Adriamycin-induced cardiotoxicity is detected earlier than ventricular dysfunction with sympathetic dysfunction. Neurodegenerative disorder such as Parkinson's disease or dementia with Lewy bodies has also cardiac sympathetic dysfunction. Noninvasive assessment of cardiac sympathetic nerve activity with l-123 MlBG imaging may be improve understanding of the pathophysiology of cardiac disease and make a contribution to predict survival and therapy efficacy.

[123I]FP-CIT binding in rat brain after acute and sub-chronic administration of dopaminergic medication

International Nuclear Information System (INIS)

Lavalaye, J.; Knol, R.J.J.; Bruin, K. de; Reneman, L.; Booij, J.; Janssen, A.G.M.

2000-01-01

The recently developed radioligand [ 123 I]FP-CIT is suitable for clinical single-photon emission tomography (SPET) imaging of the dopamine (DA) transporter in vivo. To date it has remained unclear whether dopaminergic medication influences the striatal [ 123 I]FP-CIT binding. The purpose of this study was to investigate the influence of this medication on [ 123 I]FP-CIT binding in the brain. We used an animal model in which we administered dopaminomimetics, antipsychotics and an antidepressant. In vivo [ 123 I]FP-CIT binding to the DA and serotonin transporters was evaluated after sub-chronic and acute administration of the drugs. The administered medication induced small changes in striatal [ 123 I]FP-CIT binding which were not statistically significant. As expected, the DA reuptake blocker GBR 12,909 induced a significant decrease in [ 123 I]FP-CIT binding. [ 123 I]FP-CIT binding in the serotonin-rich hypothalamus was decreased only after acute administration of fluvoxamine. The results of this study suggest that dopaminergic medication will not affect the results of DA transporter SPET imaging with [ 123 I]FP-CIT. (orig.)

Studies of rhodamine-123: effect on rat prostate cancer and human prostate cancer cells in vitro.

Science.gov (United States)

Arcadi, J A; Narayan, K S; Techy, G; Ng, C P; Saroufeem, R M; Jones, L W

1995-06-01

The effect of the lipophilic, cationic dye, Rhodamine-123 (Rh-123), on prostate cancer in rats, and on three tumor cell lines in vitro is reported here. The general toxicity of Rh-123 in mice has been found to be minimal. Lobund-Wistar (L-W) rats with the autochthonous prostate cancer of Pollard were treated for six doses with Rh-123 at a dose of 15 mg/kg subcutaneously every other day. Microscopic examination of the tumors revealed cellular and acinar destruction. The effectiveness of Rh-123 as a cytotoxic agent was tested by clonogenic and viability assays in vitro with three human prostate cancer cell lines. Severe (60-95%) growth inhibition was observed following Rh-123 exposure for 2-5 days at doses as low as 1.6 micrograms/ml in all three prostate cancer cell lines.

Recent developments in melt processed Gd-123 and MgB{sub 2} materials at RTRI

Energy Technology Data Exchange (ETDEWEB)

Muralidhar, M., E-mail: miryala1@rtri.or.jp [Railway Technology Research Institute (RTRI), Applied Superconductivity, Materials Technology Division, 2-8-38 Hikari-cho, Kokubunji-shi, Tokyo 185-8540 (Japan); Fukumoto, Y.; Ishihara, A.; Suzuki, K.; Tomita, M. [Railway Technology Research Institute (RTRI), Applied Superconductivity, Materials Technology Division, 2-8-38 Hikari-cho, Kokubunji-shi, Tokyo 185-8540 (Japan); Koblischka, M.R. [Institute of Experimental Physics, Saarland University, P.O. Box 151150, D-66041 Saarbrucken (Germany); Yamamoto, A.; Kishio, K. [Department of Applied Chemistry, Faculty of Engineering, University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-656 (Japan)

2014-01-15

Highlights: •Large size Gd-123 bulk material grown in air, using novel thin film Nd-123 seeds grown on MgO crystals. •Quality and uniformity of the Gd-123 materials are excellent. •Batch processed Gd-123 material was used for construction of chilled Maglev vehicle. •MgB{sub 2} bulks can be utilized around 20 K similarly to the Gd-123 material at 77 K. -- Abstract: In this contribution we will report on the current status, recent developments in GdBa{sub 2}Cu{sub 3}O{sub y} “Gd-123” and MgB{sub 2} material processing, characterization, and applications at the Railway Technical Research Institute (RTRI). Batch-processing of Gd-123 bulk material grown in air was performed using novel thin film Nd-123 seeds grown on MgO crystals. In this way, we are able to fabricate materials with good quality, and uniform performance. We examined the technology of the uniform performance of the large 45 mm diameter, single grain Gd-123 bulks for use in application of NMR. For this purpose, four 5 mm thick pieces are cut vertically from a single grain Gd-123 material and the magnetic field distribution is measured using a scanning hall sensor. We found that all four pieces are single domain and exhibit a quite uniform field distribution. Furthermore, the batch-processed bulk materials are used for the construction of a chilled Maglev vehicle. On the other hand, to optimize the trapped field performance of bulk MgB{sub 2} material, several samples were prepared by solid state reaction at different temperatures ranging from 750 to 950 °C in pure argon atmosphere. X-ray diffraction results indicated that single phase and homogenous MgB{sub 2} bulks are produced when sintering them around 775 °C. Further, atomic force microscopy (AFM) and scanning electron microscopy (SEM) indicated that an uniform grain size results by controlling the processing temperature. So, higher trapped fields can be achieved in sintered MgB{sub 2} material.

Thermodynamic study of 1,2,3-triphenylbenzene and 1,3,5-triphenylbenzene

International Nuclear Information System (INIS)

Ribeiro da Silva, Manuel A.V.; Santos, Luis M.N.B.F.; Lima, Luis M. Spencer S.

2010-01-01

The energetic study of 1,2,3-triphenylbenzene (1,2,3-TPhB) and 1,3,5-triphenylbenzene (1,3,5-TPhB) isomers was carried out by making use of the mini-bomb combustion calorimetry and Knudsen mass-loss effusion techniques. The mini-bomb combustion calorimetry technique was used to derive the standard (p o = 0.1 MPa) molar enthalpies of formation in the crystalline state from the measured standard molar energies of combustion for both isomers. The Knudsen mass-loss effusion technique was used to measure the dependence with the temperature of the vapour pressure of crystalline 1,2,3-TPhB, which allowed the derivation of the standard molar enthalpy of sublimation, by application of the Clausius-Clapeyron equation. The sublimation study of 1,3,5-TPhB had been performed previously. From the combination of data obtained by both techniques, the standard molar enthalpies of formation in the gaseous state, for both isomers, at T = 298.15 K, were calculated. The results indicate a higher stability of the 1,3,5-TPhB isomer relative to 1,2,3-TPhB, similarly to the terphenyls. Nevertheless, the 1,2,3-TPhB isomer is not as energetically destabilized as one might expect, supporting the existence of a π-π displacive stacking interaction between both pairs of outer phenyl rings. The volatility difference between the two isomers is ruled by the enthalpy of sublimation. The volatility of the 1,2,3-TPhB is two orders of magnitude higher than the 1,3,5-TPhB isomer, at T = 298.15 K.

Cerebral blood flow imaging by I-123 IMP and Tc-99m HM-PAO

Energy Technology Data Exchange (ETDEWEB)

Uno, Koichi; Yoshikawa, Kyosan; Minoshima, Satoshi; Imaseki, Keiko; Arimizu, Noboru; Yamaura, Akira; Uematsu, Sadao

1988-02-01

SPECT studies with either N-isopropyl-p-(I-123)iodo- amphetamine (I-123 IMP) or Tc-99m hexamethyl propylene amine oxime (Tc-99m HM-PAO) were cuncurrently performed in 12 patients with brain disorders, comprising cerebral infarction (7), cerebral aneurysm (one), intracranial hemorrhage (3), and subdural hematoma (one). Whereas I-123 IMP was taken up gradually into the brain, the uptake of Tc-99m-HM-PAO in the brain reached the peak immediately after the iv injection, with 90% or more remaining constant by 15 min postinjection. On early SPECT images, a high uptake of I-123 IMP was observed in the lung, and the uptake of Tc-99m HM-PAO was observed as well in the soft tissue of cervical region. In all patients except for one, decreased rCBF was observed in the lesions on both I-123 and Tc-99m SPECT scans. Both of the radiopharmaceuticals were analogous in that decreased blood flow corresponded to cerebral lesions. (Namekawa, K).

Thermodynamic properties of 1-ethyl-4-nitro-1,2,3-triazole

Energy Technology Data Exchange (ETDEWEB)

Blokhin, Andrey V., E-mail: blokhin@bsu.by; Kohut, Sviataslau V.; Kabo, Gennady J.; Stepurko, Elena N.; Paulechka, Yauheni U.; Voitkevich, Olga V.

2013-08-10

Graphical abstract: - Highlights: • Heat capacities and phase transition enthalpies for 1-ethyl-4-nitro-1,2,3-triazole were measured. • Enthalpy of formation for 1-ethyl-4-nitro-1,2,3-triazole was determined. • Vapor pressure and enthalpy of sublimation of 1-ethyl-4-nitro-1,2,3-triazole were found from Knudsen measurements. - Abstract: Temperature dependence of the heat capacity and the parameters of phase transitions of 1-ethyl-4-nitro-1,2,3-triazole (1ET) were studied between 5 and 370 K in a vacuum adiabatic calorimeter. Thermodynamic properties of the 1ET in the condensed state were obtained over the range of 0–370 K. Saturated vapor pressure for crystalline 1ET in the temperature ranges from 313 to 344 K and its enthalpy of sublimation were measured by the Knudsen effusion method. The standard enthalpy of formation for crystalline 1ET at 298.15 K was determined in a static bomb combustion calorimeter. From these data, the standard enthalpy of formation for gaseous 1ET was evaluated. The enthalpy of formation calculated using quantum chemical methods is in excellent agreement with the experimental value.

Thermodynamic properties of 1-ethyl-4-nitro-1,2,3-triazole

International Nuclear Information System (INIS)

Blokhin, Andrey V.; Kohut, Sviataslau V.; Kabo, Gennady J.; Stepurko, Elena N.; Paulechka, Yauheni U.; Voitkevich, Olga V.

2013-01-01

Graphical abstract: - Highlights: • Heat capacities and phase transition enthalpies for 1-ethyl-4-nitro-1,2,3-triazole were measured. • Enthalpy of formation for 1-ethyl-4-nitro-1,2,3-triazole was determined. • Vapor pressure and enthalpy of sublimation of 1-ethyl-4-nitro-1,2,3-triazole were found from Knudsen measurements. - Abstract: Temperature dependence of the heat capacity and the parameters of phase transitions of 1-ethyl-4-nitro-1,2,3-triazole (1ET) were studied between 5 and 370 K in a vacuum adiabatic calorimeter. Thermodynamic properties of the 1ET in the condensed state were obtained over the range of 0–370 K. Saturated vapor pressure for crystalline 1ET in the temperature ranges from 313 to 344 K and its enthalpy of sublimation were measured by the Knudsen effusion method. The standard enthalpy of formation for crystalline 1ET at 298.15 K was determined in a static bomb combustion calorimeter. From these data, the standard enthalpy of formation for gaseous 1ET was evaluated. The enthalpy of formation calculated using quantum chemical methods is in excellent agreement with the experimental value

Radioisotope exploration of transplanted kidneys using 123I-hippuran

International Nuclear Information System (INIS)

Champailler, A.; Juge, J.; Herrmann, T.; Berthoux, F.; Healy, J.C.

1983-01-01

Hippuran labelled with iodine 123 is now used for short- and long-terme monitoring of renal transplants. Sixty-one explorations were performed in 24 patients, using this new radiopharmaceutical agent. Repeated explorations, facilitated by the lower doses of radiations as compared with 131 I-hippuran, are particularly useful to diagnose thrombosis of the renal artery, early acute tubular lesions, acute and chronic rejection and impaired evacuation of the kidney. 123 I-hippuran is the first-choice method of exploration of transplanted kidneys and can be followed, if required, by explorations more aggressive for the patient and the kidney [fr

Multiband Observations of the Quasar PKS 2326–502 during Active and Quiescent Gamma-Ray States in 2010–2012

Energy Technology Data Exchange (ETDEWEB)

Dutka, Michael S. [The Catholic University of America, 620 Michigan Avenue, NE, Washington, DC 20064 (United States); Carpenter, Bryce D.; Gehrels, Neil [NASA Goddard Space Flight Center, Astrophysics Science Division, Code 661, Greenbelt, MD 20771 (United States); Ojha, Roopesh [UMBC/NASA Goddard Space Flight Center, Astrophysics Science Division, Code 661, Greenbelt, MD 20771 (United States); Finke, Justin D. [Naval Research Laboratory, Space Science Division, Code 7653, 4555 Overlook Avenue, SW, Washington, DC 20375 (United States); D’Ammando, Filippo [Università di Bologna Dipartimento di Fisica e Astronomia, INAF-IRA, Bologna (Italy); Kadler, Matthias [Lehrstuhl für Astronomie, Universität Würzburg, Emil -Fischer-Straße 31, D-97074 Würzburg (Germany); Edwards, Philip G. [CSIRO Astronomy and Space Science, P.O. Box 76, Epping NSW 1710 (Australia); Stevens, Jamie [CSIRO Astronomy and Space Science, 1828 Yarrie Lake Road, Narrabri NSW 2390 (Australia); Torresi, Eleonora; Grandi, Paola [Istituto Nazionale di Astrofisica, (National Institute of Astrophysics) INAF-IASFBO, via Gobetti 101, I-40129 Bologna (Italy); Nesci, Roberto [Istituto Nazionale di Astrofisica, (National Institute of Astrophysics) INAF-IAPS, via Fosso del Cavaliere 100, I-00133 Roma (Italy); Krauß, Felicia [GRAPPA and Anton Pannekoek Institute for Astronomy, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Müller, Cornelia [Department of Astrophysics/IMAPP, Radboud University Nijmegen, P.O. Box 9010, 6500 GL, Nijmegen (Netherlands); Wilms, Joern, E-mail: ditko86@gmail.com, E-mail: carpbr01@gmail.com [Remeis Observatory and ECAP, Sternwartstr. 7, D-96049 Bamberg (Germany)

2017-02-01

Quasi-simultaneous observations of the Flat Spectrum Radio Quasar PKS 2326−502 were carried out in the γ -ray, X-ray, UV, optical, near-infrared, and radio bands. Using these observations, we are able to characterize the spectral energy distribution (SED) of the source during two flaring and one quiescent γ -ray states. These data were used to constrain one-zone leptonic models of the SEDs of each flare and investigate the physical conditions giving rise to them. While modeling one flare required only changes in the electron spectrum compared to the quiescent state, modeling the other flare required changes in both the electron spectrum and the size of the emitting region. These results are consistent with an emerging pattern of two broad classes of flaring states seen in blazars. Type 1 flares are explained by changes solely in the electron distribution, whereas type 2 flares require a change in an additional parameter. This suggests that different flares, even in the same source, may result from different physical conditions or different regions in the jet.

7 CFR 1221.123 - Patents, copyrights, inventions, trademarks, information, publications, and product formulations.

Science.gov (United States)

2010-01-01

..., information, publications, and product formulations. 1221.123 Section 1221.123 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE SORGHUM PROMOTION, RESEARCH, AND INFORMATION ORDER Sorghum...

Radiation dosimetry of iodine-123 HEAT, an alpha-1 receptor imaging agent

International Nuclear Information System (INIS)

Thomas, K.D.; Greer, D.M.; Couch, M.W.; Williams, C.M.

1987-01-01

Biologic distribution data in the rat were obtained for the alpha-1 adrenoceptor imaging agent (+/-) 2-[beta-(iodo-4-hydroxyphenyl)ethylaminomethyl]tetralone (HEAT) labeled with [ 123 I]. The major excretory routes were through the liver (67%) and the kidney (33%). Internal radiation absorbed dose estimates to nine source organs, total body, the GI tract, gonads, and red bone marrow were calculated for the human using the physical decay data for [ 123 I]. The critical organ was found to be the lower large intestine, receiving 1.1 rad per mCi of [ 123 I]HEAT administered. The total-body dose was found to be 58 mrad per mCi

Clinical evaluation of 123I-MIBG for assessment of sympathetic nervous system in the heart

International Nuclear Information System (INIS)

Hirosawa, Koushitiro; Tanaka, Takeshi; Hisada, Kin-ichi; Bunko, Hisashi.

1991-01-01

Multi-center clinical trial of 123 I-metaiodobenzylguanidine ( 123 I-MIBG) was carried out to assess its utility as a scintigraphic imaging agent reflecting sympathetic neuronal function in cardiovascular field. Studies were performed on patients with heart diseases of three categories, myocardial infarction, angina pectoris and cardiomyopathy. Scintigraphic images, reflecting sympathetic neuronal function, were obtained with 123 I-MIBG from all of those categories of patients and the efficacy of the imaging was revealed in 781 (95.0%) out of 822 patients. In some patients abnormality was suggested in sympathetic neuronal function with 123 I-MIBG imaging, in spite of normal findings with myocardial perfusion scintigraphy by 201 TlCl. In all 981 patients studied with 123 I-MIBG, there have been no severe adverse reactions, except complaints of burning on injection site of the agent or nausea, ect. from 4 patients. We conclude that 123 I-MIBG imaging is one of the effective tools for diagnostic use reflecting topical sympathetic neuronal function in the heart, judging from its safety and efficacy. (author)

Distribution of N-isopropyl-p-(I-123)iodoamphetamine among the peripheral blood components

International Nuclear Information System (INIS)

Kumazaki, Satoshi; Oriuchi, Noboru; Tomiyoshi, Katsumi; Inoue, Tomio; Sasaki, Yasuhito.

1990-01-01

With the purpose to clarify dynamics of N-isopropyl-p-[I-123]iodoamphetamine (I-123 IMP) in the blood stream its binding to the peripheral blood components was determined by in vitro experiment. I-123 IMP was added to the peripheral venous blood obtained from healthy volunteers to be incubated for different length of time (0-30 min) at 37deg C. The blood was then separated into blood cells and plasma. From the latter platelet rich plasma were separated. Radioactivity in each blood component was counted in a well type scintillation counter respectively. To evaluate the affinity of I-123 IMP to red blood cell the component containing blood cells were washed repeatedly with salines. It was found that the fraction of radioactivity in the blood cell component was 68.0±6.3% (m±1 S.D.), which was higher than that in the plasma (32.0%±6.3%). The radioactivity in the platelet-rich plasma was only 1.7±1.1% of the total I-123 IMP activity. This percentage did not change by the incubation time. When Tc-99m DTPA was incubated with blood, radioactivity in the blood cell component was only 22.5%, which is further lowered by 32±2.1% after each washing to reach 6.8% after three times washing. In contrast the radioactivity of I-123 IMP in blood cell component remained as high as 31.1% after eight times washing. Almost constant fraction (8.20±0.57%) of radioactivity was freed into supernate by each washing. These findings suggest that a certain specific binding mechanism is involved in the binding of I-123 IMP to red blood cells. (author)

Development of Na/sup 123/I pharmaceutical from antimony target

Energy Technology Data Exchange (ETDEWEB)

Yongjian, L.; Qixun, S.; Dequn, S. (Shanghai Inst. of Nuclear Research, Academia Sinica, Shanghai (China))

A new method for the production of Na/sup 123/I is described. It is produced by the /sup 121/Sb(..cap alpha..,2n)/sup 123/I nuclear reaction and using a natural antimony target prepared by electroplating in a bath of antimony oxide and hydrofluoric acid. The target is irradiated with 32MeV ..cap alpha..-beams then transferred to a dry distillation apparatus and the iodide evolved and absorbed in NaOH. Quality control is by paper chromatography.

Altered insulin distribution and metabolism in type I diabetics assessed by [123I]insulin scanning

International Nuclear Information System (INIS)

Hachiya, H.L.; Treves, S.T.; Kahn, C.R.; Sodoyez, J.C.; Sodoyez-Goffaux, F.

1987-01-01

Scintigraphic scanning with [ 123 I]insulin provides a direct and quantitative assessment of insulin uptake and disappearance at specific organ sites. Using this technique, the biodistribution and metabolism of insulin were studied in type 1 diabetic patients and normal subjects. The major organ of [ 123 I]insulin uptake in both diabetic and normal subjects was the liver. After iv injection in normal subjects, the uptake of [ 123 I]insulin by the liver was rapid, with peak activity at 7 min. Activity declined rapidly thereafter, consistent with rapid insulin degradation and clearance. Rapid uptake of [ 123 I]insulin also occurred in the kidneys, although the uptake of insulin by the kidneys was about 80% of that by liver. In type 1 diabetic patients, uptake of [ 123 I]insulin in these organ sites was lower than that in normal subjects; peak insulin uptakes in liver and kidneys were 21% and 40% lower than those in normal subjects, respectively. The kinetics of insulin clearance from the liver was comparable in diabetic and normal subjects, whereas clearance from the kidneys was decreased in diabetics. The plasma clearance of [ 123 I]insulin was decreased in diabetic patients, as was insulin degradation, assessed by trichloroacetic acid precipitability. Thirty minutes after injection, 70.9 +/- 3.8% (+/- SEM) of [ 123 I]insulin in the plasma of diabetics was trichloroacetic acid precipitable vs. only 53.9 +/- 4.0% in normal subjects. A positive correlation was present between the organ uptake of [123I]insulin in the liver or kidneys and insulin degradation (r = 0.74; P less than 0.001)

Recent developments in 99mTc and 123I-radiopharmaceuticals for SPECT imaging

International Nuclear Information System (INIS)

Kulkarni, P.V.

1991-01-01

Availability of 123 I of high radionuclidic purity has encouraged the development of 123 I-based radiopharmaceuticals for the assessment of myocardial fatty acid metabolism, myocardial neuronal activity, and for receptor and antibody imaging. Advances in the chemistry of technetium have resulted in the development of novel agents for myocardial and cerebral perfusion and renal function studies. Monoclonal antibodies labeled with 99m Tc show promise for imaging neoplastic lesions, myocardial infarcts, and thrombus localization. Recent developments in 123 I and 99m Tc agents for myocardial and brain imaging studies are discussed. (author)

New syntheses of No-carrier-added 123I-labeled agents via organoborane chemistry

International Nuclear Information System (INIS)

Kabalka, G.W.

1985-01-01

No-carrier-added 123 I-labeled agents are readily prepared via the reaction of organoboranes with sodium iodide- 123 I in the presence of mild oxidizing agents. The reactions are rapid and regiospecific, and they produce excellent yields of the labeled products. The organoboranes are readily prepared from alkenes and alkynes via the hydroboration reaction. A wide variety of functional groups are tolerated by the hydroboration-iodination sequence. The sequence has been utilized to prepare 123 I-labeled steroids and fatty acids, as well as a number of labeled esters, and aromatic derivatives

Iodine-123 uptake in vertebral haemangiomas in a patient with papillary thyroid carcinoma

International Nuclear Information System (INIS)

Sameer Khan, S.; Dunn, J.; All-Nahhas, A.; Strickland, N.

2008-01-01

We present a case of a 58-year-old woman with papillary carcinoma of the thyroid and elevated thyroglobulin. Whole body 123 I scan with SPECT images demonstrated focal uptake in the thoracic spine, reported as bone metastases. Subsequent 18 F DG PET and 99m Tc HDP bone were normal. MRI and CT scans confirmed the presence of vertebral haemangiomas corresponding to the uptake seen on the 123 I scan. False-positive uptake of 123 I in benign vertebral haemangiomas should be considered in the differential diagnosis of focal vertebral uptake. (authors)

14 CFR 1264.123 - Protective order.

Science.gov (United States)

2010-01-01

... PENALTIES ACT OF 1986 § 1264.123 Protective order. (a) A party or a prospective witness or deponent may file a motion for a protective order with respect to discovery sought by an opposing party or with... the following: (1) That the discovery not be had; (2) That the discovery may be had only on specified...

THE NATURE OF A GALAXY ALONG THE SIGHT LINE TO PKS 0454+039

Energy Technology Data Exchange (ETDEWEB)

Takamiya, Marianne [Physics and Astronomy Department, University of Hawaii Hilo, Hilo, HI 96720 (United States); Chun, Mark [Institute for Astronomy, University of Hawaii Manoa, HI 96822 (United States); Kulkarni, Varsha P.; Gharanfoli, Soheila, E-mail: takamiya@hawaii.edu [Department of Physics and Astronomy, University of South Carolina, SC 29208 (United States)

2012-10-01

We report on the properties of a faint blue galaxy (G1) along the line of sight to the QSO PKS 0454+039 from spectroscopic and imaging data. We measured emission lines of H{alpha}, [S II] {lambda}{lambda}6716, 6732, and [N II] {lambda}6584 in the spectrum of G1 obtained with the Gemini/GMOS instrument. The spectroscopic redshift of G1 is z = 0.0715 {+-} 0.0002. From the extinction-corrected H{alpha} flux, we determine a modest star formation rate of SFR = 0.07 M{sub Sun} yr{sup -1} and a specific SFR of log (sSFR) -8.4. Using three different abundance indicators, we determine a nebular abundance 12 + log (O/H) ranging from 7.6 to 8.2. Based on the velocity dispersion inferred from the emission line widths and the observed surface brightness profile, we estimate the virial mass of G1 to be M{sub vir} {approx} 6.7 Multiplication-Sign 10{sup 9} M{sub Sun} with an effective radius of 2.0 kpc. We estimate the stellar mass of G1 using spectral energy distribution fitting to be M{sub *} Almost-Equal-To 1.2 Multiplication-Sign 10{sup 7} M{sub Sun} and an r'-luminosity of L{sub r'} = 1.5x10{sup 8} L{sub Sun }. Overall, G1 is a faint, low-mass, low-metallicity Im/H II galaxy. We also report on the line flux limits of another source (G3) which is the most likely candidate for the absorber system at z = 0.8596. From the spectrum of the QSO itself, we report a previously undetected Mg II {lambda}{lambda}2796, 2803 absorption line system at z = 1.245.

Remuneração em opções de ações: o SFAS 123 revisado Share option awards: SFAS 123 revised

Directory of Open Access Journals (Sweden)

Fernando Caio Galdi

2006-08-01

Full Text Available Diferentes mecanismos de remuneração têm sido desenvolvidos com o intuito de estimular os empregados a agir com foco na maximização do valor da firma. Uma das maneiras utilizadas pelas empresas na busca desse objetivo é a remuneração vinculada à entrega de ações ou opções de ações da empresa para os empregados (chamada genericamente de remuneração baseada em ações em troca de seus serviços. Contudo, a utilização desse instrumento acarreta algumas questões controversas para a Contabilidade. Esse tipo de remuneração deve ser reconhecido como despesa? Opções de compra lançadas pela empresa para a remuneração de seus funcionários representam um passivo ou um item do patrimônio líquido? Por qual valor deve ser mensurado esse tipo de remuneração? E qual o período que deve ser considerado para a contabilização? No intuito de regulamentar o assunto, o FASB emitiu o SFAS 123 revisado. Este trabalho aborda os temas relacionados com a remuneração baseada em ações, concentrando-se na remuneração com opções de ações, e objetiva expor e analisar o arcabouço conceitual do SFAS 123 revisado. Para isso apresenta a evolução histórica da controversa normatização do tema, discorre sobre os principais conceitos emanados do SFAS 123 revisado e aborda a argumentação utilizada pelo FASB para o embasamento teórico da norma.Different kinds of awards have been developed to stimulate employers to focus on the maximization of the fi rm value. To reach this target, entities use share-based payment in exchange for the employee services they receive. However, the utilization of these instruments results in controversial questions for Accounting. Should equity awards be recognized as expenses? Is a share option award (issued to pay for employee services a liability or an equity instrument? What method should be used to measure the value of this instrument? What period of time should be considered to account for this kind

Clinical results with beta-methyl-p-(123I)iodophenylpentadecanoic acid, single-photon emission computed tomography in cardiac disease.

Science.gov (United States)

Nishimura, T; Uehara, T; Shimonagata, T; Nagata, S; Haze, K

1994-01-01

This study was undertaken to evaluate the relationships, between myocardial perfusion and metabolism. Simultaneous beta-methyl-p(123I)iodophenylpentadecanoic acid (123I-BMIPP) and thallium 201 myocardial single-photon emission computed tomography (SPECT) were performed in 25 patients with myocardial infarction (group A) and 16 patients with hypertrophic cardiomyopathy (group B). The severity scores of 123I-BMIPP and 201Tl myocardial SPECT images were evaluated semiquantitatively by segmental analysis. In Group A, dissociations between thallium- and 123I-BMIPP-imaged defects were frequently observed in patients with successful reperfusion compared with those with no reperfusion and those with reinfarction. In four patients with successful reperfusion, repeated 123I-BMIPP and 201Tl myocardial SPECT showed gradual improvement of the 123I-BMIPP severity score compared with the thallium severity score. In group B, dissociations between thallium- and 123I-BMIPP-imaged defects were also demonstrated in hypertrophic myocardium. In addition, nonhypertrophic myocardium also had decreased 123I-BMIPP uptake. In groups A and B, 123I-BMIPP severity scores correlated well with left ventricular function compared with thallium severity scores. These findings indicate that 123I-BMIPP is a suitable agent for the assessment of functional integrity, because left ventricular wall motion is energy dependent and 123I-BMIPP may reflect an aspect of myocardial energy production. This agent may be useful for the early detection and patient management of various heart diseases as an alternative to positron emission tomographic study.

A comparison among 123I-IMP SPECT, EEG and MRI in patients with temporal lobe epilepsy

International Nuclear Information System (INIS)

Tatsu, Yoshimitsu; Nishigaki, Hiroshi; Adachi, Itaru

1994-01-01

N-isopropyl-p-[ 123 I]iodoamphetamine ( 123 I-IMP) single photon emission computed tomography (SPECT), electroencephalography (EEG), and magnetic resonance imaging (MRI) were performed in 19 patients with temporal lobe epilepsy during interictal stage. MRI demonstrated abnormal signal in mesial temporal lobe (hippocampus) in 10 of 19 patients and 123 I-IMP SPECT showed a hypoperfusion area in 15 of 19 patients. When compared with EEG and MRI data, disagreement of the affected area was observed in 3 cases. In comparison of EEG and 123 I-IMP SPECT data, disagreement of the affected area was observed in 6 cases. Although there was no disagreement in comparison of MRI and 123 I-IMP SPECT. We made a reprojection data parallel to the hippocampus in 123 I-IMP SPECT. These data demonstrated obviously a hypoperfusion area around the hippocampus. In cases within one month from seizure attack, wide hypoperfusion area was showed on 123 I-IMP SPECT in comparison of abnormal signal area on MRI. It could be considered that a reprojection data parallel to the hippocampus was useful to know extent of hypoperfusion area in temporal lobe epilepsy. (author)

Synthesis of N-isopropyl p-[123I]iodoamphetamine via organoborane chemistry

International Nuclear Information System (INIS)

Kabalka, G.W.; Varma, R.S.; Gai, Y.

1990-01-01

Iodine-123 labeled amphetamines have proven to be excellent cerebral perfusion tracers. The radioiodination of aromatic amines is generally achieved via high temperature substitution reactions which are prone to side reactions. The authors report that N-isopropyl p-[ 123 I]iodoamphetamine, and other iodophenylamines, are readily synthesized from the corresponding air stable, boronic acids. The reaction is based on the no-carrier-added radioiodination sequence developed in their laboratory

Indocyanine green labeled with 123I for dynamic studies of the hepato-biliary system

International Nuclear Information System (INIS)

Lambrecht, R.M.; Ansari, A.N.; Wolf, A.P.; Atkins, H.L.

1975-01-01

This report summarizes the results to develop an iodine-123 labeled agent for dynamic studies of the hepato-biliary system. Iodine-123 is an ideal nuclide for radiopharmaceuticals, because of its short half-life (T/sub 1 / 2 / = 13.3 hr); its decay with a high abundance (83%) of 159 keV photons; and the reduced patient radiation exposure (a factor of 100 less than iodine-131). Indocyanine green, a tricarbanocyanine dye, was introduced by Heseltine and co-workers in 1956, has several characteristics which suggested that iodine-123 labeled ICG might be potentially useful for hepatic functional evaluation. The plasma clearance and biliary excretion kinetics of 123 I-ICG (in dogs) will be compared to 131 I-rose bengal and bromosulphalein labeled with iodine-125

Identification of a polyketide synthase required for alternariol (AOH and alternariol-9-methyl ether (AME formation in Alternaria alternata.

Directory of Open Access Journals (Sweden)

Debjani Saha

Full Text Available Alternaria alternata produces more than 60 secondary metabolites, among which alternariol (AOH and alternariol-9-methyl ether (AME are important mycotoxins. Whereas the toxicology of these two polyketide-based compounds has been studied, nothing is known about the genetics of their biosynthesis. One of the postulated core enzymes in the biosynthesis of AOH and AME is polyketide synthase (PKS. In a draft genome sequence of A. alternata we identified 10 putative PKS-encoding genes. The timing of the expression of two PKS genes, pksJ and pksH, correlated with the production of AOH and AME. The PksJ and PksH proteins are predicted to be 2222 and 2821 amino acids in length, respectively. They are both iterative type I reducing polyketide synthases. PksJ harbors a peroxisomal targeting sequence at the C-terminus, suggesting that the biosynthesis occurs at least partly in these organelles. In the vicinity of pksJ we found a transcriptional regulator, altR, involved in pksJ induction and a putative methyl transferase, possibly responsible for AME formation. Downregulation of pksJ and altR caused a large decrease of alternariol formation, suggesting that PksJ is the polyketide synthase required for the postulated Claisen condensations during the biosynthesis. No other enzymes appeared to be required. PksH downregulation affected pksJ expression and thus caused an indirect effect on AOH production.

N-isopropyl I-123 p-iodoamphetamine (IMP) brain SPECT in Alzheimer's disease

Energy Technology Data Exchange (ETDEWEB)

Momose, Toshimitsu; Nishikawa, Junichi; Kosaka, Noboru; Ohtake, Tohru; Watanabe, Toshiaki; Yoshikawa, Kohki; Iio, Masahiro [Tokyo Univ. (Japan). Faculty of Medicine

1989-09-01

Eighteen patients with Alzheimer's disease (AD), 5 patients with Pick disease (PD), 6 patients with other types of degenerative dementia (O) and 12 age-matched normal control subjects (N) were studied using N-isopropyl p-(I-123)iodoamphetamine (I-123 IMP) with SPECT. Regional to cerebellar activity (R/CE) ratio and frontal to parietal (F/R) activity ratio were evaluated in each case. I-123 IMP-SPECT revealed focal abnormality in all cases in AD, PD, O group, while XCT and/or MRI were normal or showed cerebral atrophy without focal abnormal density or intensity. In AD group, R/CE ratio in all the regions except for bilateral Rolandic area and left primary visual cortex were significantly lower (p<0.05 or p<0.01) than that in N group, and F/P ratio were significantly higher (p<0.01) than that in P and O group. In conclusion, I-123 IMP-SPECT is useful to detect focal perfusion abnormality in dementia and may be of value in differentiating Alzheimer's disease from dementia of non-Alzheimer type. (author).

N-isopropyl I-123 p-iodoamphetamine (IMP) brain SPECT in Alzheimer's disease

International Nuclear Information System (INIS)

Momose, Toshimitsu; Nishikawa, Junichi; Kosaka, Noboru; Ohtake, Tohru; Watanabe, Toshiaki; Yoshikawa, Kohki; Iio, Masahiro

1989-01-01

Eighteen patients with Alzheimer's disease (AD), 5 patients with Pick disease (PD), 6 patients with other types of degenerative dementia (O) and 12 age-matched normal control subjects (N) were studied using N-isopropyl p-[I-123]iodoamphetamine (I-123 IMP) with SPECT. Regional to cerebellar activity (R/CE) ratio and frontal to parietal (F/R) activity ratio were evaluated in each case. I-123 IMP-SPECT revealed focal abnormality in all cases in AD, PD, O group, while XCT and/or MRI were normal or showed cerebral atrophy without focal abnormal density or intensity. In AD group, R/CE ratio in all the regions except for bilateral Rolandic area and left primary visual cortex were significantly lower (p<0.05 or p<0.01) than that in N group, and F/P ratio were significantly higher (p<0.01) than that in P and O group. In conclusion, I-123 IMP-SPECT is useful to detect focal perfusion abnormality in dementia and may be of value in differentiating Alzheimer's disease from dementia of non-Alzheimer type. (author)

47 CFR 69.123 - Density pricing zones for special access and switched transport.

Science.gov (United States)

2010-10-01

... switched transport. 69.123 Section 69.123 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED... for special access and switched transport. (a)(1) Incumbent local exchange carriers not subject to... at least 15 percent of that carrier's special access and transport revenues within that study area...

Our experience in radiolabelling and quality control of [123I]meta-iodobenzylguanidine

International Nuclear Information System (INIS)

Najdovski, L.; O'Brien, J.C.; Collier, T.L.; Izard, M.E.

1996-01-01

The possibility and practicability of manufacturing commercial quantities of[ 123 I]meta-iodobenzylguanidine ([ 123 I]-mIBG), following the method described by van Doremalen and Janssen. This method uses Cu (II) catalysed halogen exchange reaction. Process development was required to compensate for different sodium content of the radionuclide solutions and higher activity required for commercial scale production of [ 123 I]-mIBG. It was possible to produce commercial quantities with an overall reaction yield of 55 %, acceptable radiochemical purity, radioactivity concentration 200 ± 10 MBq/2 mL, and specific activity 121 GBq mmol -1 at calibration time. A remote controlled production module was developed for routine production. 7 refs., 1 tab., 4 figs

Quantification of GABAA receptors in the rat brain with [123I]Iomazenil SPECT from factor analysis-denoised images

International Nuclear Information System (INIS)

Tsartsalis, Stergios; Moulin-Sallanon, Marcelle; Dumas, Noé; Tournier, Benjamin B.; Ghezzi, Catherine; Charnay, Yves; Ginovart, Nathalie; Millet, Philippe

2014-01-01

Purpose: In vivo imaging of GABA A receptors is essential for the comprehension of psychiatric disorders in which the GABAergic system is implicated. Small animal SPECT provides a modality for in vivo imaging of the GABAergic system in rodents using [ 123 I]Iomazenil, an antagonist of the GABA A receptor. The goal of this work is to describe and evaluate different quantitative reference tissue methods that enable reliable binding potential (BP) estimations in the rat brain to be obtained. Methods: Five male Sprague–Dawley rats were used for [ 123 I]Iomazenil brain SPECT scans. Binding parameters were obtained with a one-tissue compartment model (1TC), a constrained two-tissue compartment model (2TC c ), the two-step Simplified Reference Tissue Model (SRTM2), Logan graphical analysis and analysis of delayed-activity images. In addition, we employed factor analysis (FA) to deal with noise in data. Results: BP ND obtained with SRTM2, Logan graphical analysis and delayed-activity analysis was highly correlated with BP F values obtained with 2TC c (r = 0.954 and 0.945 respectively, p c and SRTM2 in raw and FA-denoised images (r = 0.961 and 0.909 respectively, p ND values from raw images while scans of only 70 min are sufficient from FA-denoised images. These images are also associated with significantly lower standard errors of 2TC c and SRTM2 BP values. Conclusion: Reference tissue methods such as SRTM2 and Logan graphical analysis can provide equally reliable BP ND values from rat brain [ 123 I]Iomazenil SPECT. Acquisitions, however, can be much less time-consuming either with analysis of delayed activity obtained from a 20-minute scan 50 min after tracer injection or with FA-denoising of images

Synthesis of the 123I- and 125I-labeled cholinergic nerve marker (-)-5-iodobenzovesamicol

International Nuclear Information System (INIS)

Van Dort, M.E.; Jung, Y.-W.; Gildersleeve, D.L.; Hagen, C.A.; Kuhl, D.E.; Wieland, D.M.

1993-01-01

The highly toxic curaremimetic and cholinergic neuron marker (-)-5-iodobenzovesamicol (IBVM) has been labeled with iodine-125 and iodine-123. [ 125 I]IBVM, suitable for animal distribution and ex vivo autoradiographic studies, was synthesized by solid-state exchanger; isolated yields were 65-89% with specific activities in the range of 130-200 Ci/mmol. The synthesis of no-carrier-added (-)-5-[ 125 I]IBVM from the corresponding chiral (-)-5-(tri-n-butyltin) derivative using Na 125 I was evaluated using the oxidants H 2 O 2 , peracetic acid and chloramine-T. Both peracetic acid and chloramine-T gave good yields (70-95%). However, when Na 123 I was utilized, acceptable yields of [ 123 I]IBVM were obtained only with chloramine-T. Distribution analyses of [ 125 I]IBVM and [ 123 I]IBVM in mice 4 h following intravenous administration show essentially equivalent concentrations of the two tracers in the four brain regions sampled. The exceptionally high specific activity of [ 123 I]IBVM has made possible the evaluation of this radiotracer in humans. (Author)

β-Casein(94-123)-derived peptides differently modulate production of mucins in intestinal goblet cells.

Science.gov (United States)

Plaisancié, Pascale; Boutrou, Rachel; Estienne, Monique; Henry, Gwénaële; Jardin, Julien; Paquet, Armelle; Léonil, Joëlle

2015-02-01

We recently reported the identification of a peptide from yoghurts with promising potential for intestinal health: the sequence (94-123) of bovine β-casein. This peptide, composed of 30 amino acid residues, maintains intestinal homoeostasis through production of the secreted mucin MUC2 and of the transmembrane-associated mucin MUC4. Our study aimed to search for the minimal sequence responsible for the biological activity of β-CN(94-123) by using several strategies based on (i) known bioactive peptides encrypted in β-CN(94-123), (ii) in silico prediction of peptides reactivity and (iii) digestion of β-CN(94-123) by enzymes of intestinal brush border membranes. The revealed sequences were tested in vitro on human intestinal mucus-producing HT29-MTX cells. We demonstrated that β-CN(108-113) (an ACE-inhibitory peptide) and β-CN(114-119) (an opioid peptide named neocasomorphin-6) up-regulated MUC4 expression whereas levels of the secreted mucins MUC2 and MUC5AC remained unchanged. The digestion of β-CN(94-123) by intestinal enzymes showed that the peptides β-CN(94-108) and β-CN(117-123) were present throughout 1·5 to 3 h of digestion, respectively. These two peptides raised MUC5AC expression while β-CN(117-123) also induced a decrease in the level of MUC2 mRNA and protein. In addition, this inhibitory effect was reproduced in airway epithelial cells. In conclusion, β-CN(94-123) is a multifunctional molecule but only the sequence of 30 amino acids has a stimulating effect on the production of MUC2, a crucial factor of intestinal protection.

Sup(123)I excretion in breast milk - additional data

Energy Technology Data Exchange (ETDEWEB)

Lawes, S.C. (Queen' s Medical Centre, Nottingham (United Kingdom))

1992-07-01

A woman with a suspected sublingual thyroid was referred for thyroid imaging with {sup 123}I-sodium iodide. On attending it was ascertained that she was currently breastfeeding her 3-month-old baby. Reference to the available literature showed little information regarding the excretion of {sup 123}I-sodium iodide in human breast milk apart from one single case. It was felt therefore that this would be an ideal opportunity to collect some useful data. Originally the presence of impurities in the radiopharmaceutical administered had been discounted as being of little significance. However, after consideration, a review of the contribution of any impurity was undertaken. (author).

29 CFR 825.123 - Unable to perform the functions of the position.

Science.gov (United States)

2010-07-01

... position within the meaning of the Americans with Disabilities Act (ADA), as amended, 42 U.S.C. 12101 et... 29 Labor 3 2010-07-01 2010-07-01 false Unable to perform the functions of the position. 825.123... Act § 825.123 Unable to perform the functions of the position. (a) Definition. An employee is “unable...

CuO-Nanoparticles Catalyzed Synthesis of 1,4-Disubstituted-1,2,3 ...

Indian Academy of Sciences (India)

John Paul Raj

2018-04-13

Apr 13, 2018 ... has been developed for the synthesis of 1,2,3-triazoles. A library of 1 ... Kuang et al., described Cu-catalyzed synthesis of 1H-. 1,2,3-triazoles from 1 ..... Tornøe C W, Christensen C and Meldal M 2002 Peptido- triazoles on solid ... 2015 Copper-catalyzed [3+2] cycloaddition/oxidation reactions between ...

Preparation of [123I]- and [125I]epidepride: a dopamine D-2 receptor antagonist radioligand

International Nuclear Information System (INIS)

Clanton, J.A.; Schmidt, D.E.; Ansari, M.S.; Manning, R.G.; Kessler, R.M.; Paulis, T. de; Vanderbilt Univ., Nashville, TN; Baldwin, R.M.

1991-01-01

(S)-(-)-N-[(1-ethyl-2-pyrrolidinyl)methyl]-5-[ 123 I] iodo-2,3-dimethoxybenzamide (TDP 517) (proposed generic name, [ 123 I]epidepride) is the iodine-123 substituted analogue of isoremoxipride (FLB 457), both of which are very potent dopamine D-2 antagonists (epidepride K D 0.024 nM). [ 123 I] Epidepride was radioiodinated in 60-70% radiochemical yields in 35 min from the corresponding 5-(tributyltin) derivative using Na 123 I with a specific radioactivity of 3000 Ci/mmol, and oxidized in situ with chloramine-T. The aryltin precursor was prepared from non-labelled epidepride by palladium-catalyzed stannylation using bis(tri-n-butyltin) in triethylamine. Alternatively, using no carrier-added Na 125 I as the radioisotope, [ 125 I] epidepride at 2000 Ci/mmol specific radioactivity was prepared in 86% radiochemical yield and 99% radiochemical purity after purification by reverse phase HPLC in ethanolic phosphate buffer. (author)

The production of iodine-123 on the Harwell variable energy cyclotron

International Nuclear Information System (INIS)

Cuninghame, J.G.; Hill, J.I.S.; Nichols, A.L.; Taylor, N.K.

1978-01-01

123 I has often been called the isotope of choice for dynamic body function studies in nuclear medicine. There has therefore, been a keen interest in the possibility of regular supply of high purity 123 I produced by the Harwell Variable Energy Cyclotron (VEC) and Synchrocyclotron (SC). This report describes a three year research and development programme on the VEC which has resulted in a method for the safe and reliable large scale production of 123 I by irradiation of di-iodomethane with 58 MeV protons. The quality of the product, and the medical trials which have been carried out with it, are also discussed. The processing and handling of the hundreds of millicuries produced during a run presents serious handling problems. These have been solved and the methods and equipment developed are described. (author)

SPECT and 123I-Iodolisuride (123-I-ILIS) in extra-pyramidal syndromes. The use of different models of γ-cameras

International Nuclear Information System (INIS)

Ribeiro, M.J.; Jannuario, C.; Santos, A.C.; Cunha, L.; Pedroso de Lima, J.J.; Prunier-Levilion, C.; Autret, A.; Guilloteau, D.; Besnard, J.C.; Baulieu, J.L.; Chassat, F.; Bekhechi, D.; Marchand, J.; Mauclaire, L.; Catela, L.

1999-01-01

The aim of this work was to evaluate 123 I-ILIS as a radioligand of dopamine receptors in patients with extra-pyramidal diseases by using different cameras in two different centers. 45 patients were included and divided in 2 groups: group I (n=28): idiopathic Parkinson disease, group II (n=17): other extra-pyramidal syndrome. 123 I-ILIS, 1.7 to 2.8 MBq/kg, was injected after informed consent. Imaging was performed with a single head camera, a dual head camera, a triple head camera and a brain dedicated annular detector. The pattern of the transverse slices containing the basal ganglia was classified according to 3 types: type 1: visible basal ganglia and invisible cortex, type 2: invisible basal ganglia and visible cortex, type 3: visible basal ganglia and cortex. Striatal/frontal cortex ratio (S/FC) was calculated from standardized, geometrical ROI's. No patient showed any undesirable effect. All SPECT images were interpretable. In group 1, 45/45 scintigraphic pattern were type 1 or 3, in group II 18/23 scintigraphic patterns were type 2 or 3. S/FC was significantly lower in group II than in group I patients. We conclude that 123 I-ILIS SPECT can be performed with any conventional γ-camera. It provides functional informations about the striatal dopaminergic synapse in patients with extra-pyramidal degenerative disease, and could be useful in the differential diagnosis between Parkinson disease and other extra-pyramidal syndromes. (author)

Lifetimes in 121,123Cs and the question of core stiffness

International Nuclear Information System (INIS)

Droste, Ch.; Morek, T.; Rohozinski, S.G.

1992-01-01

Lifetimes of low-lying states in 121,123 Cs and 120,122 Xe are measured using the recoil-distance Doppler-shift method. The investigated nuclei were produced by the 107 Ag + 18 O and 109 Ag + 18 O reactions. The negative-parity states in 121,123 Cs are described in the framework of the core-quasiparticle coupling model with γ-soft (the extended Wilets-Jean model) and rigid (the Davydov-Filippov model) cores. (Author)

Synthesis, estrogen receptor binding, and tissue distribution of a new iodovinylestradiol derivative (17α,20E)-21-[123I]iodo-11β-nitrato-19-norpregna-1,3,5(10),20-tetraene-3,17 -diol (E-[123I]NIVE)

International Nuclear Information System (INIS)

Rijks, Leonie J.M.; Bos, Jan C. van den; Doremalen, Peter A.P.M. van; Boer, Gerard J.; Bruin, Kora de; Doornbos, Tamme; Vekemans, Jozef A.J.M.; Posthumus, Maarten A.; Janssen, Anton G.M.; Royen, Eric A. van

1998-01-01

We have synthesized and evaluated E-11β-nitrato-17α-iodovinylestradiol (E-NIVE; E-3c) and its 123 I-labelled form, as a new potential radioligand for imaging of estrogen receptor (ER)-positive human breast tumors. E-[ 123 I]NIVE was prepared by stereospecific iododestannylation of the E-tri-n-butylstannylvinyl precursor (E-2c), obtained from reaction of 11β-nitrato-estrone (8) with E-tributylstannylvinyllithium. In competitive binding studies, E-NIVE proved to have high binding affinity for both the rat and the human ER (K i 280-730 pM), without significant binding to human sex hormone binding globulin. Distribution studies in normal and mammary tumor-bearing rats showed specific ER-mediated uptake of E-[ 123 I]NIVE in the estrogen target tissues, i.e., uterus, ovaries, pituitary, and hypothalamus, but not in the mammary tumors. Selective retention in these target tissues, including tumor tissue, resulted in significant increases over time for the target tissue-to-muscle uptake ratios, but not for the target tissue-to-fat uptake ratios. The tumor-to-fat uptake ratio even appeared constantly below 1. In the primary estrogen target tissues, E-[ 123 I]NIVE displayed high specific ER-mediated uptake and retention, which resulted in moderate target-to-nontarget tissue uptake ratios. In contrast, in tumor tissue, E-[ 123 I]NIVE uptake appeared to be rather low and not ER-specific. As a consequence, E-[ 123 I]NIVE appears to be a less favorable radioligand for ER imaging in breast cancer than the previously studied stereoisomers of 11β-methoxy-17α-[ 123 I]iodovinylestradiol (E- and Z-[ 123 I]MIVE; [ 123 I]E- and [ 123 I]Z-3b).

Effects of cross talk on dual energy SPECT imaging between [sup 123]I-BMIPP and [sup 201]Tl

Energy Technology Data Exchange (ETDEWEB)

Morita, Masato; Narita, Hitoshi; Yamamoto, Juro; Fukutake, Naoshige; Ohyanagi, Mitsumasa; Iwasaki, Tadaaki; Fukuchi, Minoru (Hyogo College of Medicine, Nishinomiya (Japan))

1994-01-01

The study was undertaken to determine how much cross talk influences the visual assessment of dual energy single photon emission computed tomographic (SPECT) images with iodine 123 beta-methyl-p-iodophenylpentadecanoic acid (I-123 BMIPP) and thallium-201 in 15 patients with acute myocardial infarction. After single SPECT with I-123 BMIPP was undertaken, simultaneous dual SPECT with I-123 BMIPP and Tl-201 were undertaken in all patients. Three patients also underwent single SPECT with Tl-201. I-123 BMIPP and Tl-201 uptake was graded in four-score for the comparison between single and dual SPECT images. There was good correlation between dual energy SPECT and both single I-123 BMIPP SPECT (pS=0.97) and single Tl-201 SPECT (pS=0.59). Uptake scores were increased on dual energy SPECT, compared with single I-123 SPECT (8 out of 132 segments) and single Tl-201 SPECT (12 out of 36 segments). Overall, there was a comparatively well correlation between single SEPCT with either I-123 BMIPP or Tl-201 and dual energy SPECT images. However, one tracer uptake sometimes increased in the other tracer defect areas. This was noticeable when I-123 BMIPP exerted an effect on Tl-201. (N.K.).

Synthesis of carbon-14 analogue of 1,5 diaryl-5-[14C]-1,2,3-triazoles

International Nuclear Information System (INIS)

Matloubi, Hojatollah; Shafiee, Abbas; Saemian, Nader; Shirvani, Gholamhossein; Daha, Fariba Johari

2004-01-01

Two 1,2,3-triazole anticonvulsants, 1-(4-methylsulfone-phenyl)-5-(4-methyl-phenyl)-1,2,3-triazole and 1-(4-methylsulfone-phenyl)-5-phenyl-1,2,3-triazole, both labeled with carbon-14 in the 5-position were prepared from para-tolunitrile-[cyano- 14 C] and benzonitrile-[cyano- 14 C], respectively

123I-5-I-R91150, a new single-photon emission tomography ligand for 5-HT2A receptors: influence of age and gender in healthy subjects

International Nuclear Information System (INIS)

Baeken, C.; D'haenen, H.; Flamen, P.; Bossuyt, A.; Mertens, J.; Terriere, D.; Chavatte, K.; Boumon, R.

1998-01-01

5-HT 2A receptors have been implicated in the pathophysiology of mood disorders and in the therapeutic effect of the so-called atypical antipsychotics. Recently, a new radioiodinated ligand with high affinity and selectivity for serotonin 5-HT 2A receptors, 123 iodinated 4-amino-N-1-[3-(4-fluorophenoxy)propyl-4-methyl-4-piperidinyl] 5-iodo-2-methoxybenzamide ( 123 I-5-I-R91150), has been developed and has been shown to be suitable for single-photon emission tomography (SPET) imaging. In this study the influence of age and gender on the ligand binding was investigated in normal volunteers. One hundred and fifty MBq of 123 I-5-I-R91150 was administered to 26 normal volunteers (13 females and 13 males) with an age range of 23-60 years. SPET imaging was performed with a triple-headed gamma camera. For semi-quantitative analysis, ratios of ligand binding in different regions of interest to the binding in the cerebellum were calculated. Mean ratios of 1.7 were obtained. No gender difference was demonstrated. 5-HT 2A binding was shown to decline with age. Over an age range of 40 years a reduction in ligand binding of 42%±7% was found. These results are in agreement with in vitro and positron emission tomography findings of a decline in 5-HT 2A receptor binding with age. The findings confirm the suitability of 123 I-5-I-R91150 for SPET imaging of 5-HT 2A receptors, and highlight the necessity for age-matched controls in clinical studies. (orig.)

False Positive Radioiodinated Metaiodobenzylguanidine (123I-MIBG Uptake in Undifferentiated Adrenal Malignant Tumor

Directory of Open Access Journals (Sweden)

Hee Soo Jung

2015-01-01

Full Text Available 123I-Metaiodobenzylguanidine (123I-MIBG scintigraphy is a widely used functional imaging tool with a high degree of sensitivity and specificity in diagnosis of pheochromocytoma. However, rare cases of false positive reactions have been reported. A 67-year-old male patient was admitted with epigastric pain. Abdominal computed tomography (CT revealed a heterogeneous left adrenal mass 6 cm in diameter; following hormone testing, 123I-MIBG scintigraphy was performed to determine the presence of pheochromocytoma, which confirmed eccentric uptake by a large left adrenal gland mass. Chest CT and PET-CT confirmed metastatic lymphadenopathy; therefore, endobronchial ultrasound transbronchial needle aspiration was performed. Metastatic carcinoma of unknown origin was suspected from a lymph node biopsy, and surgical resection was performed for definitive diagnosis and correction of excess hormonal secretion. A final diagnosis of undifferentiated adrenal malignant tumor was rendered, instead of histologically malignant pheochromocytoma, despite the uptake of 123I-MIBG demonstrated by scintigraphy.

Ketamine displaces the novel NMDA receptor SPET probe [123I]CNS-1261 in humans in vivo

International Nuclear Information System (INIS)

Stone, James M.; Erlandsson, Kjell; Arstad, Erik; Bressan, Rodrigo A.; Squassante, Lisa; Teneggi, Vincenza; Ell, Peter J.; Pilowsky, Lyn S.

2006-01-01

[ 123 I]CNS-1261 [N-(1-naphthyl)-N'-(3-iodophenyl)-N-methylguanidine] is a high-affinity SPET ligand with selectivity for the intrachannel PCP/ketamine/MK-801 site of the N-methyl-D-aspartate (NMDA) receptor. This study evaluated the effects of ketamine (a specific competitor for the intrachannel PCP/ketamine/MK-801 site) on [ 123 I]CNS-1261 binding to NMDA receptors in vivo. Ten healthy volunteers underwent 2 bolus-plus-infusion [ 123 I]CNS-1261 scans, one during placebo and the other during a ketamine challenge. Ketamine administration led to a significant decrease in [ 123 I]CNS-1261 V T in most of the brain regions examined (P 123 I]CNS-1261 appears to be a specific ligand in vivo for the intrachannel PCP/ketamine/MK-801 NMDA binding site

Production of no-carrier-added {sup 123}I via heavy-ion activation of natural antimony oxide

Energy Technology Data Exchange (ETDEWEB)

Maji, S. [The Univ. of Burdwan (India). Dept. of Chemistry; Lahiri, S. [Saha Institute of Nuclear Physics, Kolkata (India). Chemical Sciences Div.

2007-07-01

Activation of natural Sb{sub 2}O{sub 3} with 48 MeV {sup 7}Li{sup 3+} beam results in the formation of no-carrier-added {sup 123}I in the matrix along with the radionuclides {sup 123,125}Xe and {sup 122}Sb. The {sup 123}I yield amounts to about 400 kBq/{mu}Ah and the radionuclidic impurity of {sup 124}I to {proportional_to}1.2% of {sup 123}I. Attempts to separate no-carrier-added iodine from bulk antimony target involved liquid-liquid extraction with TOA and HDEHP as well as precipitation of Sb{sub 2}S{sub 3} with thioacetamide. The precipitation technique was found to be the most effective for quantitative separation of {sup 123}I from the bulk antimony oxide target. (orig.)

Clinical application of iodine 123 with special consideration of radionuclide purity, measuring accuracy and radiation dose

International Nuclear Information System (INIS)

Hermann, H.J.; Ammon, J.; Winkel, K. zum; Haubold, U.

1975-01-01

Iodine 123 is a nearly 'ideal' radionuclide for thyroid imaging. The production of Iodine 123 requires cyclotrons or accelerators. The production of multicurie amounts of Iodine 123 has been suggested through the use of high-energy accelerators (> 60 MeV). Most of the methods for the production of Iodine 123 using a compact cyclotron result in contamination with f.e. Iodine 124 which reduces the spatial resolution of imaging procedures and increases the radiation dose to the patient. The radiation dose has been calculated for three methods of production. The various contamination with Iodine 124, Iodine 125 and Iodine 126 result in comparable radiation dose of Iodine 131, provided that the time between production and application is more than four half-live-times of Iodine 123. (orig.) [de

Iodogen-mediated radiolabeling of Bevacizumab with I-123 for clinical applications

International Nuclear Information System (INIS)

Lemps, R. de; Desruet, M.; Bacot, S.; Ahmadi, M.; Ghezzi, C.; Desruet, M.; Fagret, D.; Berger, F.

2014-01-01

Bevacizumab is a monoclonal antibody, directed against vascular endothelial growth factor (VEGF), and is currently used in various types of cancers (breast, lung, colorectal). In order to administer to humans glioblastomas, we developed its iodine 123 radiolabeling for in vitro and in vivo studies subsequent. The aim of the study is to choose the best radioiodination conditions based on feasibility in a hospital radiopharmacy: Quick one step method under mild condition, reproducible, using materials for pharmaceutical use and in a closed-system. Method Bevacizumab was radiolabeled with "1"2"3I using Iodogen, the most widely used oxidants in direct labelling techniques for tyrosyl residues-containing compounds. We have been explored two crucial parameters for clinical transfer: the amount of oxidant required (50μg and 100μg) and the choice of the purification column (size exclusion column or anion exchange resin), respectively. Quality control was performed before and after purification of each condition in order to evaluate the radiochemical purity (RCP) and purification efficiency. The stability of the radiolabeled molecule is evaluated over time and also when the solution is diluted with unlabeled bevacizumab. Moreover, the in vitro stability of "1"2"3I-bevacizumab was determined in presence of human blood at 15, 30, 60 and 120 min. Labeling yield before purification was 96.5% for the first condition (50μg Iodogen) and 95.5% for the second one (100μg Iodogen). The radiochemical purity was 99.5% after purification on a size exclusion column and 99% after purification on anion exchange resin. The purification yield with size exclusion column is 75%, compared with 81% of the anionic exchange resin. The stability in the labeling medium of "1"2"3I-bevacizumab at 3, 6, 24 and 30 h after labeling showed a RCP at 100%, 93%, 99.8% and 99.8% for condition 1 so that it was found to be 99.2%, 100%, 99.3%, 99.5% for condition 2, respectively. In vitro incubation with

Application of 123I-labelled long-chained fatty acids for the study of myocardial metabolism

International Nuclear Information System (INIS)

Freundlieb, C.; Hoeck, A.; Vyska, F.; Feinendegen, L.E.; Machulla, H.J.; Stoecklin, G.

1978-01-01

Radioiodine-labelled fatty acids are useful tracers for myocardial imaging. The present study extends myocardial scintigraphy with ω-123-I-heptadecanoic acid to measuring myocardial metabolism. 4 normal individuals and 6 patients with cardiac disease received i.v. 1-2 mCi ω-123-I-heptadecanoic acid. Immediately fast serial scintigrams of the myocardium were taken for 30 minutes. Disappearance of the tracer, and appearance of anorganic 123-I, was measured in the peripheral blood. The myocardial images were of high quality later than 5 minutes after injection. By correcting for anorganic 123-I in the peripheral blood and the interstitium, the turnover of tracer in the myocardial cells could be measured. Activity was lost from the myocardium with a half time between 14 and 32 minutes. Within regions of old myocardials infarctions the half time of tracer loss was prolonged. The data clearly indicate the feasibility of using ω-123-I-heptadecanoic acid for measuring myocardial metabolism. (author)

Acute administration of haloperidol does not influence 123I-FP-CIT binding to the dopamine transporter

NARCIS (Netherlands)

Booij, Jan; van Loon, Guus; de Bruin, Kora; Voorn, Pieter

2014-01-01

A recent (123)I-FP-CIT ((123)-I-N-ω-fluoropropyl-2β-carbomethoxy-3β-(4-iodophenyl)nortropane) SPECT study on rats suggested that a single 1 mg/kg dose of the antipsychotic haloperidol induces enough dopamine release to compete with (123)I-FP-CIT for binding to the dopamine transporter. Taking into

Faraday rotation at low frequencies: magnetoionic material of the large FRII radio galaxy PKS J0636-2036

Science.gov (United States)

O'Sullivan, S. P.; Lenc, E.; Anderson, C. S.; Gaensler, B. M.; Murphy, T.

2018-04-01

We present a low-frequency, broad-band polarization study of the FRII radio galaxy PKS J0636-2036 (z = 0.0551), using the Murchison Widefield Array (MWA) from 70 to 230 MHz. The northern and southern hotspots (separated by ˜14.5 arcmin on the sky) are resolved by the MWA (3.3 arcmin resolution) and both are detected in linear polarization across the full frequency range. A combination of Faraday rotation measure (RM) synthesis and broad-band polarization model fitting is used to constrain the Faraday depolarization properties of the source. For the integrated southern hotspot emission, two-RM-component models are strongly favoured over a single RM component, and the best-fitting model requires Faraday dispersions of approximately 0.7 and 1.2 rad m-2 (with a mean RM of ˜50 rad m-2). High-resolution imaging at 5 arcsec with the Australia Telescope Compact Array shows significant sub-structure in the southern hotspot and highlights some of the limitations in the polarization modelling of the MWA data. Based on the observed depolarization, combined with extrapolations of gas density scaling relations for group environments, we estimate magnetic field strengths in the intergalactic medium between ˜0.04 and 0.5 μG. We also comment on future prospects of detecting more polarized sources at low frequencies.

Clinical evaluation of Parkinson's disease using 123I-IMP SPECT

International Nuclear Information System (INIS)

Hayashi, Hiroko; Odano, Ikuo; Nishihara, Mamiko; Higuchi, Shouichi; Sakai, Kunio; Ishikawa, Atsushi.

1989-01-01

N-isopropyl-p[ 123 I]iodoamphetamine ( 123 I-IMP) SPECT and regional cerebral blood flow (rCBF) studies were performed in 20 patients with Parkinson's disease (PD) and 8 normal subjects. RCBF was measured by the arterial blood sampling method which used the microsphere model. We analized seven factors which might be related to the rCBF in PD, i.e., age, stage, duration of the disease, cerebral atrophy, severity of dementia, laterality of symptoms and motor disability score (MDS; the degree of akinesia, rigidity, tremor, gait disturbance, freezing and pulsion sign). Compared with normal subjects, global CBF (supratentorial mean rCBF) was reduced by 21.8% in PD. In particular, rCBF in the basal ganglia and that of frontal cortex were reduced by 25.3% and 24.8%, respectively. Distribution patterns of rCBF in PD were almost as same as those in normals except for cerebellum. The reduction of both rCBFs in the basal ganglia and parietal cortex significantly correlated with MDS (p 123 I-IMP SPECT study is a useful method for clinical evaluation of PD. (author)

A rapid and efficient preparation of [{sup 123}I]radiopharmaceuticals using a small HPLC Rocket[reg] column

Energy Technology Data Exchange (ETDEWEB)

Katsifis, Andrew [Radiopharmaceuticals Division R and D, Australian Nuclear Science and Technology, Organisation, Menai, NSW 2234, Sydney (Australia)]. E-mail: akx@ansto.gov.au; Papazian, Vahan [Radiopharmaceuticals Division R and D, Australian Nuclear Science and Technology, Organisation, Menai, NSW 2234, Sydney (Australia); Jackson, Timothy [Radiopharmaceuticals Division R and D, Australian Nuclear Science and Technology, Organisation, Menai, NSW 2234, Sydney (Australia); Loc' h, Christian [Radiopharmaceuticals Division R and D, Australian Nuclear Science and Technology, Organisation, Menai, NSW 2234, Sydney (Australia)

2006-01-01

A simplified method for the rapid and efficient preparation of [{sup 123}I]radiopharmaceuticals is described. Three radiopharmaceuticals, [{sup 123}I]{beta}-CIT, [{sup 123}I]MIBG and [{sup 123}I]clioquinol, were synthesised and purified as model compounds. The radiotracers were labelled with iodine-123 using electrophilic oxidative conditions and purified by a compact semi-preparative reverse phase column (C-18, 3 {mu}m, 7x53 mm, Alltima Rocket[reg, Alltech] using aqueous-ethanol as HPLC solvents that were directly used for radiopharmaceutical formulation. The radiochemical purity of the radioiodinated tracers as assessed by analytical HPLC was higher than 99% with specific activity higher than 3 GBq/nmol. The total preparation time of a radiotracer ranged from 40 to 60 min and, starting from 3.7 GBq of iodine-123, more than 2.5 GBq of formulated radiopharmaceuticals were available for clinical investigations.

Evaluation of myocardial distribution of iodine-123 labeled metaiodobenzylguanidine (123I-MIBG) in normal subjects

International Nuclear Information System (INIS)

Tsuchimochi, Shinsaku; Tamaki, Nagara; Shirakawa, Seishi; Fujita, Toru; Yonekura, Yoshiharu; Konishi, Junji; Nohara, Ryuji; Sasayama, Shigetake; Nishioka, Kenya

1994-01-01

The normal pattern of the myocardial sympathetic innervation was studied in 15 subjects using gamma camera scintigraphy with iodine-123 labeled metaiodobenzylguanidine ( 123 I-MIBG). Seven younger subjects (mean age 24.6±3.6) and eight older patients (mean age 60.9±8.4) with normal cardiac function were studied. Planar imaging was obtained at 15 minutes and 3 hours, and SPECT was also performed 3 hours after injection of 111 MBq (3 mCi) of MIBG. The younger subjects showed higher the heart to mediastinum count ratio (2.91±0.25 vs. 2.67±0.34; p<0.05) and higher inferior to anterior count ratio (1.19±0.15 vs. 0.97±0.13; p<0.05) on the late scan. The bull's-eye polar map also differences in counts in the mid-inferior (p<0.005), basal-inferior (p<0.005) and mid-lateral sectors (p<0.01). But there was no significant difference in MIBG washout rate from myocardium between two groups. These data suggest that there is a difference of the cardiac sympathetic innervation, with older subjects having fewer sympathetic nerve terminals, especially in inferior than younger subjects. We conclude that the age difference in sympathetic nerve function should be considered in the interpretation of MIBG scan. (author)

Evaluation of newborns with brain disease using 123I-IMP SPECT

International Nuclear Information System (INIS)

Oshima, Motoo; Yasukochi, Hiroshi; Suzuki, Chizuko; Sasaki, Junko; Kitoh, Osamu.

1993-01-01

Eleven newborns with suspected cerebral disease were evaluated using 123 I-IMP SPECT. In a normal subject, high uptake was shown in the sensorimotor cortex, thalamus, midbrain-brainstem, and cerebellar vermis. Decreased perfusion was also noted in the frontal lobe. In hypoxic ischemic encephalopathy (HIE), diffuse decreased uptake which showed no redistribution in the white matter was seen in two patients. These two patients had a poor prognosis. In one of the other 4 patients with HIE, persistent defect in parasagittal area was recognized and the patient also had a poor prognosis. In one of two patients with tuberous sclerosis, 123 I-IMP SPECT showed high uptake in the area of increased density shown in CT. Thus, 123 I-IMP SPECT of newborn has characteristic findings different from the adult. This tracer also might have a prognostic value of clinical improvement following HIE. (author)

Dopamine transporter imaging with [{sup 123}I]FP-CIT SPECT: potential effects of drugs

Energy Technology Data Exchange (ETDEWEB)

Booij, Jan [University of Amsterdam, Department of Nuclear Medicine, Academic Medical Center, Amsterdam (Netherlands); Kemp, Paul [Southampton University Hospitals Trust, Department of Nuclear Medicine, Southampton (United Kingdom)

2008-02-15

[{sup 123}I]N-{omega}-fluoropropyl-2{beta}-carbomethoxy-3{beta}-{l_brace}4-iodophenyl{r_brace}nortropane ([{sup 123}I]FP-CIT) single photon emission computed tomography (SPECT) is a frequently and routinely used technique to detect or exclude dopaminergic degeneration by imaging the dopamine transporter (DAT) in parkinsonian and demented patients. This technique is also used in scientific studies in humans, as well as in preclinical studies to assess the availability of DAT binding in the striatum. In routine clinical studies, but also in scientific studies, patients are frequently on medication and sometimes even use drugs of abuse. Moreover, in preclinical studies, animals will be anesthetized. Prescribed drugs, drugs of abuse, and anesthetics may influence the visual interpretation and/or quantification of [{sup 123}I]FP-CIT SPECT scans. Here, we discuss the basic principle of how drugs and anesthetics might influence the visual interpretation and/or quantification of [{sup 123}I]FP-CIT SPECT scans. We also review drugs which are likely to have a significant influence on the visual interpretation and/or quantification of [{sup 123}I]FP-CIT SPECT scans. Additionally, we discuss the evidence as to whether frequently prescribed drugs in parkinsonian and demented patients may have an influence on the visual interpretation and/or quantification of [{sup 123}I]FP-CIT SPECT scans. Finally, we discuss our recommendations as to which drugs should be ideally withdrawn before performing a [{sup 123}I]FP-CIT SPECT scan for routine clinical purposes. The decision to withdraw any medication must always be made by the specialist in charge of the patient's care and taking into account the pros and cons of doing so. (orig.)

Mesoporous mixed metal oxides derived from P123-templated Mg-Al layered double hydroxides

International Nuclear Information System (INIS)

Wang Jun; Zhou Jideng; Li Zhanshuang; He Yang; Lin Shuangshuang; Liu Qi; Zhang Milin; Jiang Zhaohua

2010-01-01

We report the preparation of mesoporous mixed metal oxides (MMOs) through a soft template method. Different amounts of P123 were used as structure directing agent to synthesize P123-templated Mg-Al layered double hydroxides (LDHs). After calcination of as-synthesized LDHs at 500 o C, the ordered mesopores were obtained by removal of P123. The mesoporous Mg-Al MMOs fabricated by using 2 wt% P123 exhibited a high specific surface area of 108.1 m 2 /g, and wide distribution of pore size (2-18 nm). An investigation of the 'memory effect' of the mesoporous MMOs revealed that they were successfully reconstructed to ibuprofen intercalated LDHs having different gallery heights, which indicated different intercalation capacities. Due to their mesoporosity these unique MMOs have particular potential as drug or catalyst carriers. - Graphical abstract: Ordered mesoporous Mg-Al MMOs can be obtained through the calcination of P123-templated Mg-Al-CO 3 LDHs. The pore diameter is 2.2 nm. At the presence of ibuprofen, the Mg-Al MMOs can recover to Mg-Al-IBU LDHs, based on its 'remember effect'. Display Omitted

34 CFR 303.123 - Prohibition against commingling.

Science.gov (United States)

2010-07-01

... assurance in this section is satisfied by the use of an accounting system that includes an “audit trail” of... TODDLERS WITH DISABILITIES State Application for a Grant Statement of Assurances § 303.123 Prohibition against commingling. The statement must include an assurance satisfactory to the Secretary that funds made...

7 CFR 906.123 - Fruit for processing.

Science.gov (United States)

2010-01-01

... LOWER RIO GRANDE VALLEY IN TEXAS Rules and Regulations § 906.123 Fruit for processing. (a) No person... limited to, the following information: (1) Name and address of applicant; (2) Location of plant or plants... issued thereunder (7 CFR part 46) when buying Texas oranges and grapefruit for processing; (6) A...

Substituted 4-hydroxy-1,2,3-triazoles

DEFF Research Database (Denmark)

Pippione, Agnese C.; Dosio, Franco; Ducime, Alex

2015-01-01

the distal (S)-glutamic acid carboxyl group using the 4-hydroxy-1,2,3-triazole moiety is applied, to obtain two promising glutamate analogs. In the second example, a scaffold hopping approach is applied, replacing the phenolic moiety present in MDG-1-33A, a potent inhibitor of Onchocerca volvulus chitinase...

Effects of anesthetic agents on cellular {sup 123}I-MIBG transport and in vivo {sup 123}I-MIBG biodistribution

Energy Technology Data Exchange (ETDEWEB)

Ko, Bong-Ho; Paik, Jin-Young; Jung, Kyung-Ho; Bae, Jun-Sang; Lee, Eun Jung; Choe, Yearn Seong; Kim, Byung-Tae; Lee, Kyung-Han [Sungkyunkwan University School of Medicine, Department of Nuclear Medicine, Samsung Medical Center, Seoul (Korea)

2008-03-15

Small animal imaging with meta-iodobenzylguanidine (MIBG) allows characterization of animal models, optimization of tumor treatment strategies, and monitoring of gene expression. Anesthetic agents, however, can affect norepinephrine (NE) transport and systemic sympathetic activity. We thus elucidated the effects of anesthetic agents on MIBG transport and biodistribution. SK-N-SH neuroblastoma and PC-12 pheochromocytoma cells were measured for {sup 123}I-MIBG uptake after treatment with ketamine (Ke), xylazine (Xy), Ke/Xy, or pentobarbital (Pb). NE transporters were assessed by Western blots. Normal ICR mice and PC-12 tumor-bearing mice were injected with {sup 123}I-MIBG 10 min after anesthesia with Ke/Xy, Ke, Xy, or Pb. Plasma NE levels and MIBG biodistribution were assessed. Cellular {sup 123}I-MIBG uptake was dose-dependently inhibited by Ke and Xy but not by Pb. Treatment for 2 h with 300 {mu}M Ke, Xy, and Ke/Xy decreased uptake to 46.0 {+-} 1.6, 24.8 {+-} 1.5, and 18.3 {+-} 1.6% of controls. This effect was completely reversed by fresh media, and there was no change in NE transporter levels. In contrast, mice anesthetized with Ke/Xy showed no decrease of MIBG uptake in target organs. Instead, uptakes and organ-to-blood ratios were increased in the heart, lung, liver, and adrenals. Plasma NE was notably reduced in the animals with corresponding decreases in blood MIBG, which partly contributed to the increase in target organ uptake. In spite of their inhibitory effect at the transporter level, Ke/Xy anesthesia is a satisfactory method for MIBG imaging that allows favorable target tissue uptake and contrast by reducing circulating NE and MIBG. (orig.)

Correlative single photon emission computed tomography imaging of [123I]altropane binding in the rat model of Parkinson's

International Nuclear Information System (INIS)

Gleave, Jacqueline A.; Farncombe, Troy H.; Saab, Chantal; Doering, Laurie C.

2011-01-01

Introduction: This study used the dopamine transporter (DAT) probe, [ 123 I]-2β-carbomethoxy-3β-(4-fluorophenyl)-N-(3-iodo-E-allyl)nortropane ([ 123 I]altropane), to assess the DAT levels in the 6-hydroxydopamine rat model of Parkinson's disease. We sought to assess if the right to left [ 123 I]altropane striatal ratios correlated with dopamine content in the striatum and substantia nigra and with behavioural outcomes. Methods: [ 123 I]altropane images taken pre- and postlesion were acquired before and after the transplantation of neural stem/progenitor cells. The images obtained using [ 123 I]altropane and single photon emission computed tomography (SPECT) were compared with specific behavioural tests and the dopamine content assessed by high-performance liquid chromatography. Results: [ 123 I]altropane binding correlated with the content of dopamine in the striatum; however, [ 123 I]altropane binding did not correlate with the dopamine content in the substantia nigra. There was a significant correlation of altropane ratios with the cylinder test and the postural instability test, but not with amphetamine rotations. The low coefficient of determination (r 2 ) for these correlations indicated that [ 123 I]altropane SPECT was not a good predictor of behavioural outcomes. Conclusion: Our data reveal that [ 123 I]altropane predicts the integrity of the striatal dopamine nerve terminals, but does not predict the integrity of the nigrostriatal system. [ 123 I]altropane could be a useful marker to measure dopamine content in cell replacement therapies; however, it would not be able to evaluate outcomes for neuroprotective strategies.

Tumor scintigraphy using 123I-labelled estradiol in breast cancer - receptor scintigraphy

International Nuclear Information System (INIS)

Scheidhauer, K.; Mueller, S.; Smolarz, K.; Braeutigam, P.; Briele, B.

1991-01-01

16-α- 123 I-Iodestradiol-17β ( 123 I-E 2 ) as a receptor-specific radiopharmacon was used for scintigraphic tumor detection in 62 patients suspected of breast cancer. The studies were performed as a multicenter trial to validate the method and to overcome methodical problems. A fast tracer elimination from the blood pool into the liver was seen, followed by biliary excretion allowing early imaging of the thorax due to low background activity but resulting in difficult imaging conditions of the abdomen. In 42 patients (30 carcinomas, 12 benign lesions) are overall sensitivity was 66%. Some patients with breast cancer showed focal or diffuse uptake in the area of primary lymph drainage without any clinical correlation. There was only one false-positive result in a receptor-negative primary carcinoma. The sensitivity of 123 I-E 2 in the detection of primary breast cancer or metastases and recurrences is low compared to mammography and other methods. Differentiation of malignant and benign tissue is difficult as both may have a positive ER status, in. Nevertheless, 123 I-E 2 scintigraphy is an in vivo imaging technique for the detection of breast cancer depending on the ER status and provides information about tumor localisation. It may become a specific method for the non-invasive diagnosis of the ER status and may be helpful in follow-up studies. As a receptor-specific agent 123 I-E 2 may give answers to questions of tumor heterogeneity and changes of the ER status during therapy. (orig./MG) [de

Pool Boiling Enhancement of R-123 Using Perforated Plates

Energy Technology Data Exchange (ETDEWEB)

Kim, Nae-Hyun [Incheon Nat’l Univ., Incheon(Korea, Republic of)

2016-05-15

In this study, we investigate the pool boiling enhancement caused by perforated plates on top of a smooth surface. We conduct tests using R-123 at atmospheric pressure. It was shown that perforated plates significantly enhanced the pool boiling of the smooth surface. The reason may be attributed to the increased bubble contact area between the plates. The results showed that the enhancement ratio was dependent on the heat flux. At high heat flux, the enhancement ratio increased as the porosity increased. However, at low heat flux, the enhancement ratio decreased as the porosity increased. For the present investigation, the optimum configuration had a pore diameter of 2.0 mm, pore pitch of 2.5 mm×5.0 mm or 5.0 mm×5.0 mm, and a gap width of 0.5 mm, which yielded heat-transfer coefficients that are close to those of GEWA-T. The optimum porosity for R-123 was significantly larger than that of water or ethanol. The reason for this may be the large liquid-to-vapor density ratio along with the small latent heat of vaporization of R-123. The perforated plates yielded smaller boiling hysteresis compared with that of the smooth surface.

Synthesis of 123I-labelled analogues of imidazobenzodiazepine receptor ligands

International Nuclear Information System (INIS)

Katsifis, A.G.; Mattner, F.; McPhee, M.E.; Ridley, D.D.

1999-01-01

Reaction of bromo- or iodo-substituted isatoic anhydrides with N-methylglycine, L-proline or D-proline afforded bromo- or iodo-substituted 1,4-benzodiazepinediones which on condensation with ethyl or t-butyl isocyanoacetates gave ethyl or t-butyl bromo- or iodo-imidazobenzodiazepine carboxylates. These aryl halides were converted into the corresponding tributylstannanes with bis(tributyltin) in the presence of (triphenylphosphine)palladium(0), and the stannanes were treated with sodium ( 123 I)iodide in the presence of chloramine-T to give the required 123 I-labelled analogues of the imidazobenzodiazepine receptor ligands flumazenil and bretazenil. Copyright (1999) CSIRO Australia

The detection of ovarian cancer using 123I monoclonal antibody

International Nuclear Information System (INIS)

Granowska, M.; Britton, K.E.; Shepherd, J.

1984-01-01

The technique of the production of monoclonal antibodies is described. Antibodies show reactivity with epithelial surfaces of cancer of breast, colon and ovary. The iodogen reaction is used for labelling monoclonal antibodies with 123 I. Description of labelling technique and quality control. After intravenous injection of 74 MBq 123 I-labelled monoclonal antibody (0.5 mg) static camera images of the abdomen were recorded at 10 min, 4 and 22 hours in anterior and posterior position. 20 out of 22 patients with ovarian cancer with and without metastases were correctly diagnosed and confirmed at surgery. (author)

SPET imaging of central muscarinic acetylcholine receptors with iodine-123 labelled E-IQNP and Z-IQNP

Energy Technology Data Exchange (ETDEWEB)

Nobuhara, K.; Farde, L.; Halldin, C.; Karlsson, P.; Swahn, C.G.; Olsson, H.; Sedvall, G. [Dept. of Clinical Neuroscience, Psychiatry Section, Karolinska Hospital, Stockholm (Sweden); Bergstroem, K.A. [Dept. of Clinical Physiology, Kuopio University Hospital, Kuopio (Finland); Larsson, S.A.; Schnell, P.-O. [Dept. of Radiation Physics, Karolinska Hospital, Stockholm (Sweden); McPherson, D.W. [Oak Ridge National Laboratory (ORNL), Nuclear Medicine Group, TN (United States); Savonen, A.; Hiltunen, J. [MAP Medical Technologies Oy, Tikkakoski (Finland)

2001-01-01

1-Azabicyclo[2.2.2]oct-3-yl {alpha}-hydroxy-{alpha}-(1-iodo-1-propen-3-yl)-{alpha}-phenylacetate (IQNP) is a muscarinic acetylcholine receptor (mAChR) antagonist and the racemic ligand contains eight stereoisomers. In a single-photon emission tomography (SPET) study in monkeys we recently confirmed that [{sup 123}I]E-(R,R)-IQNP ([{sup 123}I]E-IQNP) is a radioligand with modest selectivity for the M{sub 1} and M{sub 4} subtypes, whereas [{sup 123}I]Z-(R,R)-IQNP ([{sup 123}I]Z-IQNP) is non-subtype selective. In the present SPET study, E- and Z-IQNP were examined in human subjects. SPET examination was performed on three male subjects after i.v. injection of [{sup 123}I]E-IQNP and in another three after i.v. injection of [{sup 123}I]Z-IQNP. The binding potential (BP) for [{sup 123}I]E-IQNP was calculated using several quantitative approaches with the cerebellum as a reference region. High-performance liquid chromatography was used to measure radioligand metabolism in plasma. Following [{sup 123}I]E-IQNP, the radioactivity was high in the neocortex and striatum, intermediate in the thalamus and low in the pons and cerebellum, which is consistent with the rank order for the regional density of M{sub 1} and M{sub 4} subtypes in vitro. For all regions, peak equilibrium was identified within the 48-h data acquisition. The simplified reference tissue approach using SPET data from 0 to 48 h was the most reliable in this limited series of subjects. Following injection of [{sup 123}I]Z-IQNP, radioactivity was high in the neocortex and striatum, intermediate in the thalamus and pons and low in the cerebellum, which is in agreement with the density of M{sub 1}, M{sub 2} and M{sub 4} subtypes as measured in vitro. Quantitative analyses provided indirect support for specific M{sub 2} binding of Z-IQNP in the cerebellum. The high selectivity of [{sup 123}I]E-IQNP for M{sub 1} and M{sub 4} receptors allowed the use of cerebellum as a reference region devoid of specific binding, and

Simultaneous 99mTC and 123I Dual-Isotope Brain Striatal Phantom Single Photon Emission Computed Tomography: Validation of 99mTC-Trodat-1 and 123I-IBZM Simultaneous Dopamine System Brain Imaging

OpenAIRE

Pan-Fu Kao; Shiaw-Pyng Wey; An-Shoei Yang

2009-01-01

[2[[2-[[[3-(4-chlorophenyl)-8-methyl-8-azabicyclo[3,2,1]-oct-2-yl]-methyl](2-mercaptoethyl)amino]ethyl]amino]ethanethiolato(3-)-N2,N2′,S2,S2]oxo-[1R-exo-exo)])-[99mTc]-technetium (99mTc-TRODAT-1) and 123I-iodobenzamide (123I-IBZM) are radiotracers for brain dopamine preand postsynaptic neuron imaging. The purpose of this study was to evaluate imaging parameters and crossed energy interference using simultaneous single photon emission computed tomography (SPECT) 99mTc and 123I data acquisition...

Biosynthetic potential for polyketides in Talaromyces atroroseus

DEFF Research Database (Denmark)

Rasmussen, Kasper Bøwig; Mortensen, Uffe Hasbro; Thrane, Ulf

11, and deletion of PKS11 results in the loss of Monascus pigment production. T. atroroseus PKS11 is delivering a precursor for both the mitorubrins and the Monascus pigments. Based on this finding we propose hypothetical models for the evolution of azaphilone pigment PKS clusters in Talaromyces......Talaromyces atroroseus is an efficient producer of red Monascus pigments. We genome sequenced Talaromyces atroroseus IBT11181 and found it to lack the Monascus pigment PKS with the rest of the Monascus pigment cluster intact. The PKS closest related to the Monascus pigment PKS is the mitorubrin PKS...

PKS’ DEMOCRATIC EXPERIENCES IN RECRUITING MEMBERS AND LEADERS

Directory of Open Access Journals (Sweden)

Ahmad Ali Nurdin

2011-08-01

Full Text Available This paper focuses on the views of democracy and the implementation of democratic rules in real politics by the Islamic political party that has a democracy platform in Indonesia, Partai Keadilan Sejahtera (PKS. I examine PKS views on the relationship between Islam and democracy and its manner of recruiting members and leaders to show that this Islamic political party is not a threat to democracy at all. PKS believes that democracy goes to the roots of Islam and the Indonesian context in which they exist; and that it is a good political tool for an Islamic party like PKS to achieve its political goals. Taking the process of recruitment of members and leaders of PKS as examples, the paper also shows that the commitment of PKS to strengthening democracy in Indonesia could be seen in their process of recruiting leaders. PKS has practiced democratic rules in their internal party activities, particularly in the way they used to recruit their members who would be nominated as parliamentary members and how they choose their own leaders. However, it is necessary to note that in terms of member recruitment and expanding the cadres of the party, the PKS seems to have a special strategy; that is, encouraging their cadres to have big families. [Artikel mengulas pandangan Partai Keadilan Sejahtera (PKS mengenai demokrasi dan implementasi nilai-nilai demokrasi dalam kehidupan politik. Dalam artikel ini, relasi Islam dan demokrasi serta metode PKS dalam merekrut anggota dan pemimpin partai akan dibahas. PKS sama sekali bukanlah ancaman bagi demokrasi. PKS percaya bahwa prinsip demokrasidapat ditemukan dalam Islam dan konteks Indonesia. Bagi PKS, demokrasi membuka ruang kesempatan bagi partai politik Islam untuk mencapai tujuan politiknya. Selain itu, artikel ini juga mengulas proses rekrutmen anggota dan pemimpin partai. Rekrutmen petinggi PKS memperlihatkan komitmen PKS terhadap penguatan demokrasi di Indonesia. PKS sudah mempraktekkan prinsip demokrasi dalam

Effects of the APC materials on c-axis correlated pinning effects in a-axis oriented Y123/2D APC multilayer films

International Nuclear Information System (INIS)

Takamura, M.; Mukaida, M.; Horii, S.; Ichinose, A.; Kita, R.; Namba, M.; Awaji, S.; Watanabe, K.; Matsumoto, K.; Yoshida, Y.; Teranishi, R.; Yamada, K.; Mori, N.

2009-01-01

For a-axis oriented and c-axis in-plane aligned YBa 2 Cu 3 O 7-δ /artificial pinning center (Y123/APC) alternately-layered thin films, effects of the APC materials on the multilayer structures are discussed. Pr123, (Y 1-x Pr x )123 and Gd 2 CuO 4 (Gd214) were used as APCs. The multilayer structure was observed for Y123/Pr123 films and Y123/Gd214 films. However, some grains are also grown in the Y123/Gd214 film. For the Y123/Pr123 multilayer film, each Pr123 layer act as two-dimensional APCs (2D APCs) in the magnetic field angular dependences of the critical current density. The growth mechanism of the multilayer structure in the Y123/2D APC films is discussed by a transmission electron microscopy and an atomic force microscope. It is found that two conditions are needed to obtain the c-axis correlated pinning effects by 2D APC in the a-axis oriented and c-axis in-plane aligned Y123/APC multilayer films: the same structure as Y123; Y-free APC materials.

Quantitative estimation of 123I-MIBG scintigraphy in neuroblastoma. Usefulness of the total body retention rate

International Nuclear Information System (INIS)

Okuyama, Chio; Ushijima, Yo; Sugihara, Hiroki; Nishimura, Tunehiko

2000-01-01

A new method of easily and simply quantifying 123 I-MIBG accumulation as a criterion for curative effect of chemotherapy in infants with neuroblastoma was developed. This method uses the data from two images: an early image (at 5-7.5 hr) and a delayed image (at 25-32 hr). Twenty infants with untreated neuroblastoma which showed clear accumulation of 123 I-MIBG at the primary site were examined. The differences between the accumulation counts on the early image and the delayed image showed that washout of 123 I-MIBG in the neuroblastomas was delayed in tumor regions. This finding indicated that the total body 123 I-MIBG retention rate reflects the total volume of the neuroblastoma. The 123 I-MIBG retention rate was significantly higher in patients with advanced stage neuroblastoma with systemic metastases, and there was a good correlation between the retention rate and tumor markers (VMA and HVA values in urine). The response to chemotherapy paralleled the change in markers. These results suggested that the total body 123 I-MIBG retention rate is useful as a criterion for curative effect in advanced neuroblastoma. (K.H.)

Evaluation of the monoamine uptake site ligand [123I]methyl 3β-(4-iodophenyl)-tropane-2β-carboxylate ([123I]β-CIT) in non-human primates: pharmacokinetics, biodistribution and SPECT brain imaging coregistered with MRI

International Nuclear Information System (INIS)

Baldwin, R.M.; Zea-Ponce, Y.; Zoghbi, S.S.

1993-01-01

The in vivo properties of a new radioiodinated probe of the dopamine and serotonin transporter, [ 123 I]methyl 3β-(4-iodophenyl)tropane-2β-carboxylate ([ 123 I]β-CIT) were evaluated in baboons and vervet monkeys. The labeled product was prepared in 65.2 ± 2.8% yield (mean ± SEM; n = 8) by reaction of the tributylstannyl precursor with [ 123 I]NaI in the presence of peracetic acid followed by high pressure liquid chromatography (HPLC) purification to give a product with radiochemical purity of 97.5 ± 0.5% and specific activity of 500-1200 Ci/mmol. [ 123 I]β-CIT promises to be a useful marker for SPECT study of the monoamine uptake system in primate brain. (author)

123-I ioflupane (Datscan® presynaptic nigrostriatal imaging in patients with movement disorders

Directory of Open Access Journals (Sweden)

Angel Soriano Castrejón

2005-10-01

Full Text Available 123-I Ioflupane (Datscan® presynaptic imaging has been shown to have a significant utility in the assessment of patients with movement disorders 123-I Ioflupane SPECT is able to distinguish between Parkinson’s disease (PD and other forms of parkinsonism without degeneration of the nigrostriatal pathway, including a common movement disorder such as essential tremor, and to assess disease progression in PD and other neurodegenerative disorders involving the substantia nigra.A imagem pré-sináptica através de 123-I Ioflupane (Datscan® tem mostrado um papel significante na avaliação de pacientes com distúrbios do movimento. 123-I Ioflupane SPECT é capaz de distinguir entre Mal de Parkinson (MP e outras formas de parkinsonismo sem degenerações da via nigroestriatal incluindo um distúrbio comum de movimento parecido com o tremor essencial e para medir a evolução da doença no Mal de Parkinson e outros distúrbios neurodegenerativos envolvendo a substantia nigra.

[sup 123]I-IBZM SPECT: Reconstruction methodology and results in Parkinsonism and dystonia

Energy Technology Data Exchange (ETDEWEB)

Berding, G [Abt. fuer Nuklearmedizin und Spezielle Biophysik, Medizinische Hochschule Hannover (Germany); Gratz, K F [Abt. fuer Nuklearmedizin und Spezielle Biophysik, Medizinische Hochschule Hannover (Germany); Kolbe, H [Neurologische Klinik mit Klinischer Neurophysiologie, Medizinische Hochschule Hannover (Germany); Meyer, G J [Abt. fuer Nuklearmedizin und Spezielle Biophysik, Medizinische Hochschule Hannover (Germany); Dengler, R [Neurologische Klinik mit Klinischer Neurophysiologie, Medizinische Hochschule Hannover (Germany); Knoop, B O [Abt. fuer Nuklearmesstechnik und Strahlenschutz, Medizinische Hochschule Hannover (Germany); Hundeshagen, H [Abt. fuer Nuklearmedizin und Spezielle Biophysik, Medizinische Hochschule Hannover (Germany)

1994-10-01

In 58 patients with Parkinsonism or dystonia striatal dopamine D[sub 2] receptors were investigated using [sup 123]I-iodobenzamide ([sup 123]I-IBZM) single-photon emission computed tomography (SPECT). The influence of SPECT reconstruction methodology on semiquantification and the clinical value of [sup 123]I-IBZM SPECT were evaluated. Delineation of the striatal uptake and striatum/frontal cortex (ST/FC) ratios were improved by the use of compensation procedures for scatter and attenuation as well as the choice of an adequate filter. Satisfactory results were achieved using a Metz prefilter with a comparatively high order number (i.e. high cut-off and low suppression of higher frequencies via roll-off). Regarding clinical diagnoses it was not possible to differentiate between advanced idiopathic Parkinson's disease (IP) and Parkinsonism of other aetiology (OP) on the basis of [sup 123]I-IBZM SPECT. But patients with IP and favourable response to L-Dopa showed significantly higher ST/FC ratios than those with fluctuating response. In patients with dystonia ST/FC ratios were significantly higher compared to patients with IP or OP. (orig.)

Practical benefit of [123I[FP-CIT SPET in the demonstration of the dopaminergic deficit in Parkinson's disease

International Nuclear Information System (INIS)

Booij, J.; Tissingh, G.; Winogrodzka, A.; Boer, G.J.; Wolters, E.C.; Royen, E.A. van

1997-01-01

Loss of striatal dopamine (DA) transporters in Parkinson's disease (PD) has been accurately assessed in vivo by single-photon emission tomography (SPET) studies using [ 123 I[β-CIT. However, these studies have also shown that adequate imaging of the striatal DA transporter content can be performed only 20-30 h following the injection of [ 123 I[β-CIT, which is not convenient for routine out-patient evaluations. Recently, a new ligand, N-ω-fluoropropyl-2β-carbomethoxy-3β-(4-iodophenyl)tropane (FP-CIT), became available for in vivo imaging of the DA transporter. The faster kinetics of [ 123 I[FP-CIT have been shown to allow adequate acquisition as early as 3 h following injection. In the present study, loss of striatal DA transporters in five non-medicated PD patients was assessed on two consecutive SPET scans, one with [ 123 I[β-CIT (24 h following injection) and one with [ 123 I[FP-CIT (3 h following injection). The ratios of specific to non-specific [ 123 I[FP-CIT uptake in the caudate nucleus and putamen were consistently 2.5-fold lower than those of [ 123 I[β-CIT. However, when the uptake ratio of both ligands in these brain regions of patients was expressed as a percentage of the uptake ratio found in healthy controls, both the decrease and the variation of the data were similar. It is concluded on the basis of these findings that [ 123 I[FP-CIT seems as good as [ 123 I[β-CIT for the assessment of the dopaminergic deficit in PD. The faster kinetics of [ 123 I[FP-CIT are a clear advantage. (orig.). With 3 figs

Assessment of myocardial metabolism with iodine-123 heptadecanoic acid: effect of decreased fatty acid oxidation on deiodination

International Nuclear Information System (INIS)

Luethy, P.C.; Chatelain, P.; Papageorgiou, I.; Schubiger, A.; Lerch, R.A.

1988-01-01

Terminally radioiodinated fatty acid analogs are of potential use for the noninvasive delineation of regional alterations of fatty acid metabolism by gamma imaging. Since radioactivity from extracted iodine-123 heptadecanoic acid [( 123I]HDA) is released from the myocardium in form of free radioiodide (123I-) the present study was performed to determine whether deiodination of [123I]HDA is related to free fatty acid metabolism. Myocardial production of free radioiodide was measured in rat hearts in vitro and in vivo both under control conditions and after inhibition of fatty acid oxidation. In isolated rat hearts perfused at constant flow with a medium containing [123I]HDA, release of 123I- was markedly reduced during cardioplegia and pharmacologic inhibition of mitochondrial fatty acid transfer with POCA by 67% (p less than 0.005) and 72% (p less than 0.005), respectively. In fasted rats in vivo, 1 min after i.v. injection of [123I]HDA, 51 +/- 5% of myocardial radioactivity was recovered in the aqueous phase, containing free iodide, of myocardial lipid extracts. Aqueous activity was significantly decreased in fed (20 +/- 2%; p less than 0.002) and POCA pretreated (30 +/- 3.7%; p less than 0.05) animals exhibiting reduced oxidation of [14C]palmitate. Thus, deiodination of [123I]HDA was consistently reduced during inhibition of fatty acid oxidation in vitro and in vivo. The results apply to the interpretation of myocardial clearance curves of terminally radioiodinated fatty acid analogs

123-I ioflupane (Datscan) presynaptic nigrostriatal imaging in patients with movement disorders

International Nuclear Information System (INIS)

Soriano Castrejon, Angel; Garcia Vicente, Ana Maria; Cortes Romera, Montserrat; Rodado Marina, Sonia; Poblete Garcia, Victor Manuel; Ruiz Solis, Sebastian Ruiz; Talavera Rubio, Maria del Prado; Vaamonde Cano, Julia

2005-01-01

123-I Ioflupane (Datscan) presynaptic imaging has been shown to have a significant utility in the assessment of patients with movement disorders 123 I Ioflupane SPECT is able to distinguish between Parkinson's disease (PD) and other forms of parkinsonism without degeneration of the nigrostriatal pathway, including a common movement disorder such as essential tremor, and to assess disease progression in PD and other neuro degenerative disorders involving the substantia nigra. (author)

Synthesis, estrogen receptor binding, and tissue distribution of a new iodovinylestradiol derivative (17{alpha},20E)-21-[{sup 123}I]iodo-11{beta}-nitrato-19-norpregna-1,3,5(10),20-te= traene-3,17 -diol (E-[{sup 123}I]NIVE)

Energy Technology Data Exchange (ETDEWEB)

Rijks, Leonie J.M.; Bos, Jan C. van den; Doremalen, Peter A.P.M. van; Boer, Gerard J.; Bruin, Kora de; Doornbos, Tamme; Vekemans, Jozef A.J.M.; Posthumus, Maarten A.; Janssen, Anton G.M.; Royen, Eric A. van

1998-05-01

We have synthesized and evaluated E-11{beta}-nitrato-17{alpha}-iodovinylestradiol (E-NIVE; E-3c) and its {sup 123}I-labelled form, as a new potential radioligand for imaging of estrogen receptor (ER)-positive human breast tumors. E-[{sup 123}I]NIVE was prepared by stereospecific iododestannylation of the E-tri-n-butylstannylvinyl precursor (E-2c), obtained from reaction of 11{beta}-nitrato-estrone (8) with E-tributylstannylvinyllithium. In competitive binding studies, E-NIVE proved to have high binding affinity for both the rat and the human ER (K{sub i} 280-730 pM), without significant binding to human sex hormone binding globulin. Distribution studies in normal and mammary tumor-bearing rats showed specific ER-mediated uptake of E-[{sup 123}I]NIVE in the estrogen target tissues, i.e., uterus, ovaries, pituitary, and hypothalamus, but not in the mammary tumors. Selective retention in these target tissues, including tumor tissue, resulted in significant increases over time for the target tissue-to-muscle uptake ratios, but not for the target tissue-to-fat uptake ratios. The tumor-to-fat uptake ratio even appeared constantly below 1. In the primary estrogen target tissues, E-[{sup 123}I]NIVE displayed high specific ER-mediated uptake and retention, which resulted in moderate target-to-nontarget tissue uptake ratios. In contrast, in tumor tissue, E-[{sup 123}I]NIVE uptake appeared to be rather low and not ER-specific. As a consequence, E-[{sup 123}I]NIVE appears to be a less favorable radioligand for ER imaging in breast cancer than the previously studied stereoisomers of 11{beta}-methoxy-17{alpha}-[{sup 123}I]iodovinylestradiol (E- and Z-[{sup 123}I]MIVE; [{sup 123}I]E- and [{sup 123}I]Z-3b)

Dicty_cDB: VSD608 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available T09822 |T09822.1 0405m3 gmbPfHB3.1, G. Roman Reddy Plasmodium falciparum genomic ...clone 0405m, DNA sequence. 50 4e-07 2 T09823 |T09823.1 0405m7 gmbPfHB3.1, G. Roman Reddy Plasmodium falcipar

Hippuran-123 I: labelling and quality control

International Nuclear Information System (INIS)

Barboza, M.F. de; Colturato, M.T.; Herrerias, R.; Muramoto, E.

1992-01-01

The o-iodo hippuric acid labelling with radioiodine is a radiopharmaceutical used with more frequently for evaluation the kidney function. Several reactive kits for labelling with 123 I are prepared. Controls of radiochemical purity and biological distribution are made. The reactive kit of hippuran is kept at 4 C during 2 years. (C.G.C.)

19 CFR 123.22 - In-transit manifest.

Science.gov (United States)

2010-04-01

... CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.22 In-transit... cars or other overland carriers transiting Mexico a manifest on Customs Form 7512-B or 7533-C shall be... enter and reenter Canada in a continuing movement en route to a final destination in the United States...

Synthesis of 1-(4-methylsulfone-phenyl)-5-(4-fluoro-phenyl)-5-[14C]-1,2,3- triazole and 1-(4-sulfonamide-phenyl)-5-(4-fluoro-phenyl)-5-[14C]-1,2,3- triazole as novel carbon-14 anticonvulsant

International Nuclear Information System (INIS)

Saemian, N.; Shirvani, G.; Matloubi, H.

2006-01-01

Two 1,2,3-triazole anticonvulsants, 1-(4-methylsulfone-phenyl)-5-(4-fluoro-phenyl)-5-[ 14 C]-1,2,3-triazole and 1-(4-sulfonamide-phenyl)-5-(4- fluoro-phenyl)-5-[ 14 C]-1,2,3-triazole, both labeled with carbon-14 in the 5-position were prepared from para-fluoro-benzonitrile-[cyano- 14 C]. (author)

Reduced 123I-BMIPP uptake implies decreased myocardial flow reserve in patients with chronic stable angina.

Science.gov (United States)

Kageyama, Hiroyuki; Morita, Koichi; Katoh, Chietsugu; Tsukamoto, Takahiro; Noriyasu, Kazuyuki; Mabuchi, Megumi; Naya, Masanao; Kawai, Yuko; Tamaki, Nagara

2006-01-01

Long-chain fatty acid (LCFA) is the main energy source for normal myocardium at rest, but in ischemic myocardium, the main energy substrate shifts from LCFA to glucose. 123I-BMIPP is a radiolabeled LCFA analog. In chronic stable angina without previous infarction, we suppose that reduced 123I-BMIPP uptake is related to the substrate shift in myocardium with decreased myocardial flow reserve (MFR). The purpose of this study was to relate 123I-BMIPP uptake to rest myocardial blood flow (MBF), hyperemic MBF, and MFR assessed with 15O-water positron emission tomography (PET). We enrolled 21 patients with chronic stable angina without previous infarction, all of whom underwent 123I-BMIPP single-photon emission computed tomography (SPECT) and 15O-water PET. The left ventricle was divided into 13 segments. In each segment, rest MBF and hyperemic MBF were measured by PET. 123I-BMIPP uptake was evaluated as follows: score 0=normal, 1=slightly decreased uptake, 2=moderately decreased uptake, 3=severely decreased uptake, and 4=complete defect. 123I-BMIPP uptake was compared with rest MBF, hyperemic MBF, and MFR. The numbers of segments with 123I-BMIPP scores 0, 1, 2, 3, and 4 were 178, 40, 25, 24, and 0, respectively. The rest MBFs for scores 0, 1, 2, and 3 were 0.93+/-0.25, 0.86+/-0.21, 0.97+/-0.30, and 0.99+/-0.37 ml/min/g, respectively. The hyperemic MBFs for scores 0, 1, 2, and 3 were 2.76+/-1.29, 1.84+/-0.74, 1.37+/-0.39, and 1.08+/-0.40 ml/min/g, respectively. The MFRs for scores 0, 1, 2, and 3 were 3.01+/-1.38, 2.20+/-0.95, 1.44+/-0.22, and 1.10+/-0.26, respectively. As 123I-BMIPP uptake declined, hyperemic MBF and MFR decreased. In chronic stable angina without previous infarction, reduced 123I-BMIPP uptake implies decreased MFR.

Reduced 123I-BMIPP uptake implies decreased myocardial flow reserve in patients with chronic stable angina

International Nuclear Information System (INIS)

Kageyama, Hiroyuki; Morita, Koichi; Katoh, Chietsugu; Mabuchi, Megumi; Tamaki, Nagara; Tsukamoto, Takahiro; Noriyasu, Kazuyuki; Naya, Masanao; Kawai, Yuko

2006-01-01

Long-chain fatty acid (LCFA) is the main energy source for normal myocardium at rest, but in ischemic myocardium, the main energy substrate shifts from LCFA to glucose. 123 I-BMIPP is a radiolabeled LCFA analog. In chronic stable angina without previous infarction, we suppose that reduced 123 I-BMIPP uptake is related to the substrate shift in myocardium with decreased myocardial flow reserve (MFR). The purpose of this study was to relate 123 I-BMIPP uptake to rest myocardial blood flow (MBF), hyperemic MBF, and MFR assessed with 15 O-water positron emission tomography (PET). We enrolled 21 patients with chronic stable angina without previous infarction, all of whom underwent 123 I-BMIPP single-photon emission computed tomography (SPECT) and 15 O-water PET. The left ventricle was divided into 13 segments. In each segment, rest MBF and hyperemic MBF were measured by PET. 123 I-BMIPP uptake was evaluated as follows: score 0=normal, 1=slightly decreased uptake, 2=moderately decreased uptake, 3=severely decreased uptake, and 4=complete defect. 123 I-BMIPP uptake was compared with rest MBF, hyperemic MBF, and MFR. The numbers of segments with 123 I-BMIPP scores 0, 1, 2, 3, and 4 were 178, 40, 25, 24, and 0, respectively. The rest MBFs for scores 0, 1, 2, and 3 were 0.93±0.25, 0.86±0.21, 0.97±0.30, and 0.99±0.37 ml/min/g, respectively. The hyperemic MBFs for scores 0, 1, 2, and 3 were 2.76±1.29, 1.84±0.74, 1.37±0.39, and 1.08±0.40 ml/min/g, respectively. The MFRs for scores 0, 1, 2, and 3 were 3.01±1.38, 2.20±0.95, 1.44±0.22, and 1.10±0.26, respectively. As 123 I-BMIPP uptake declined, hyperemic MBF and MFR decreased. In chronic stable angina without previous infarction, reduced 123 I-BMIPP uptake implies decreased MFR. (orig.)

A study on regional cerebral blood flow measurement by N-isopropyl-p-[I-123]iodoamphetamine

International Nuclear Information System (INIS)

Seki, Hiroyasu

1986-01-01

In vivo characteristics of N-isopropyl-p-[I-123]iodoamphetamine (I-123 IMP) as a potential agent for imaging regional cerebral blood flow (rCBF) were fundamentally studied, and the clinical value of gamma camera rotating SPECT with I-123 IMP was assessed. Brain autoradiography in rats revealed that brain uptake of I-123 IMP is comparable to that described for C-14 iodoantipyrin. In a healthy volunteer, brain uptake was 8.5 % of injected dose at 1.5 hr. Significant uptake of I-123 IMP was observed in the lungs and liver, but not observed in the eyeball or pancreas. Radiation absorbed doses per mCi of I-123 IMP were 0.142 in the brain, 0.178 in the lungs, 0.130 in the liver, 0.038 in the ovaries, 0.027 in the testes, and 0.042 in the total body. A rotating gamma camera for SPECT gave the same linear response to radioactivity as a ring detector, although the latter had better sensitivity and resolution than the former. An increased rCBF was observed with physiological stimulation including left hand movement, reading, and listening, providing three-dimensional mapping of regional cerebral function for kinesthesia. Fifty-three measurements of rCBF were clinically acquired in 42 patients with cerebrovascular disorder. Mean rCBF ranged from 11 to 40 ml/100 g/min. SPECT with I-123 IMP had a significantly high ability to detect ischemic lesions compared with X-ray CT (83 % vs. 41 %). These results indicate the potential benefits of this modality in evaluating cerebral pathophysiology, treatment efficacy, and surgical indications. (Namekawa, K.)

/sup 123/I production at the Milan AVF cyclotron

Energy Technology Data Exchange (ETDEWEB)

Acerbi, E; Birattari, C; Castiglioni, M; Resmini, F [Milan Univ. (Italy). Istituto di Fisica

1976-01-01

A program is described to make available quantities of at least 20 mCi of /sup 123/I per irradiation, on a weekly routine basis to medical users at the Clinical Physiology Laboratory of Pisa. Contaminants such as /sup 124/I should be kept below 3%. The isotope, or compounds of it, like iodo-antipyrine and ortho-iodohippuric acid, were to be used as scanning agents for pancreas, kidneys, thyroid and for the detection of the aqueous content in the pulmonary region. The production of /sup 123/I from enriched /sup 124/Te is described. Preliminary experiments on a distillation separation of iodine from the Te target have been performed and the method seems promising in comparison to the time-consuming chemical separation technique.

Reproducibility of [123I]PE2I binding to dopamine transporters with SPECT

DEFF Research Database (Denmark)

Ziebell, Morten; Thomsen, Gerda; Knudsen, Gitte M

2007-01-01

The iodinated cocaine derivative [(123)I]PE2I is a new selective ligand for in vivo studies of the dopamine transporter (DAT) with SPECT. Recently, a bolus/infusion (B/I) protocol for [(123)I]PE2I measurements of DAT density was established [Pinborg LH et al. J Nucl Med 2005;46:1119-271]. The aims...

13 CFR 123.19 - May I request an increase in the amount of an economic injury loan?

Science.gov (United States)

2010-01-01

... amount of an economic injury loan? 123.19 Section 123.19 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION DISASTER LOAN PROGRAM Overview § 123.19 May I request an increase in the amount of an economic... increase is essential for your business to continue and is based on events occurring after SBA approved...

The lignin pyrolysis composition and pyrolysis products of palm kernel shell, wheat straw, and pine sawdust

International Nuclear Information System (INIS)

Chang, Guozhang; Huang, Yanqin; Xie, Jianjun; Yang, Huikai; Liu, Huacai; Yin, Xiuli; Wu, Chuangzhi

2016-01-01

Highlights: • The primarily pyrolysis composition of PKS lignin was p-hydroxyphenyl unit. • Higher phenol yield and lower gas energy yield were obtained from PKS pyrolysis. • PKS produced more bio-oil and biochar than WS and PS from pyrolysis at 650–850 °C. • PKS-char had poorer gasification reactivity due to higher ordering carbon degree. - Abstract: The lignin monomer composition of palm kernel shell (PKS) was characterized using pyrolysis-gas chromatography/mass spectrometry (Py-GC/MS), and the characteristics and distributions of products obtained from PKS pyrolysis were investigated using Py-GC/MS, GC, and a specially designed pyrolysis apparatus. The gasification reactivity of PKS biochar was also characterized using thermogravimetry (TG) and Raman spectroscopy. All the results were compared with those obtained from wheat straw (WS) and pine sawdust (PS). The results showed that PKS lignin is primarily composed of p-hydroxyphenyl structural units, while WS and PS lignins are mainly made up of guaiacyl units. Both the mass and energy yields of non-condensable gases from PKS pyrolysis were lower than those obtained from WS and PS pyrolysis at 650–850 °C, owing to the lower volatile content (75.21%) and lack of methoxy groups in PKS. Compared with WS and PS, higher bio-oil productivity was observed during PKS pyrolysis. Phenols were the main component of PKS bio-oil from pyrolysis at 500 °C, and the phenol content of PKS bio-oil (13.49%) was higher than in WS bio-oil (1.62%) and PS bio-oil (0.55%). A higher yield of biochar (on an ash-free basis) was also obtained from PKS pyrolysis. Because of its greater relative degree of ordered carbon, PKS biochar exhibited lower in situ reactivity during CO_2 or H_2O gasification than WS and PS biochars. A longer residence time and addition of steam were found to be beneficial during PKS biochar gasification.

7 CFR 1703.123 - Nonapproved purposes for grants.

Science.gov (United States)

2010-01-01

..., DEPARTMENT OF AGRICULTURE RURAL DEVELOPMENT Distance Learning and Telemedicine Grant Program § 1703.123..., wages, or employee benefits to medical or educational personnel; (4) To pay for the salaries or... the applicant. (6) To duplicate facilities providing distance learning or telemedicine services in...

30 CFR 229.123 - Standards for audit activities.

Science.gov (United States)

2010-07-01

... 229.123 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE... required, including a knowledge of accounting, auditing, agency regulations, and industry operations. (ii... statement of standards. (iii) The auditor's report should contain a statement of positive assurance on those...

Determining the breast-feeding interruption schedule after administration of {sup 123}I-iodide

Energy Technology Data Exchange (ETDEWEB)

Morita, Seiichiro; Umezaki, Noriyoshi; Ishibashi, Masatoshi; Kawamura, Seiji; Hayabuchi, Naofumi [Kurume Univ., Fukuoka (Japan). Hospital; Inada, Chizuko

1998-10-01

Radioactivity after administration of {sup 123}I-sodium iodide was measured in breast milk samples obtained from a patient with postpartum thyroiditis. The breast milk was collected over 93 h during the infant`s regular feeding times. The radioactivity in the breast milk was calculated with a {sup 123}I capsule of the same lot number as the standard source. {sup 123}I was excreted exponentially with an effective half-life of 5.5 h; 2.5% of the total radioactivity administered was excreted in the breast milk over the 93 h, 95% of which was excreted within the first 24 h, and 98.2% within 36 h. The first milk sample collected at 7 h after administration of the radiopharmaceutical contained 48.5% of the total radioactivity excreted. We estimated the potential absorption of radioactivity to an infant`s thyroid in uninterrupted breast-feeding to be 30.3 mGy. With a 24-hour interruption, the absorbed radioactivity would be 1.25 mGy; with a 36-hour interruption, it would be 0.24 mGy. According to our calculations, breast feeding should be curtailed for 36 h to reduce the infant`s exposure to {sup 123}I radioactivity. By using a correction factor based on maximum radioactivity from another {sup 123}I capsule of the same lot, we were able to ascertain the appropriate protocol for our patient and establish a measurement method that can be applied in similar clinical situations. (author)

Human pancreas scintigraphy using iodine-123-labeled HIPDM and SPECT

International Nuclear Information System (INIS)

Yamamoto, K.; Shibata, T.; Saji, H.; Kubo, S.; Aoki, E.; Fujita, T.; Yonekura, Y.; Konishi, J.; Yokoyama, A.

1990-01-01

The pancreatic affinity of iodine-123-labeled HIPDM (N,N,N'-trimethyl-N'-(2-hydroxy-3-methyl-5-iodobenzyl)-1,3-propane diamine) ([ 123 I]HIPDM) was studied in 18 cases (5 normal volunteers, 7 cases with pancreas cancer, and 6 with chronic pancreatitis). In the normal cases, the pancreas was visualized in the planar images as early as 3 hr, and again at 20 hr postinjection. Single-photon emission computed tomography (SPECT) performed following 3-hr planar scintigraphy, provided excellent pancreas images without an overlap of activity in the liver or spleen. The mean pancreas-to-liver (P/L) ratio was 1.26 +/- 0.22 in normal controls. With the exception of one case of massive calcification in the pancreas, the entire pancreas could be observed in the cases with chronic pancreatitis, but the P/L ratio was 0.74 +/- 0.15, significantly lower than that of normal cases. Defective areas of the distal portion of the pancreas were clearly seen in those with cancer of the pancreas. The results of our study indicate that [ 123 I] HIPDM may have clinical potential as a human pancreas imaging agent

Synthesis of carbon-14 analogue of 1,5 diaryl-5-[{sup 14}C]-1,2,3-triazoles

Energy Technology Data Exchange (ETDEWEB)

Matloubi, Hojatollah E-mail: hmatloubi@aeoi.org.ir; Shafiee, Abbas; Saemian, Nader; Shirvani, Gholamhossein; Daha, Fariba Johari

2004-05-01

Two 1,2,3-triazole anticonvulsants, 1-(4-methylsulfone-phenyl)-5-(4-methyl-phenyl)-1,2,3-triazole and 1-(4-methylsulfone-phenyl)-5-phenyl-1,2,3-triazole, both labeled with carbon-14 in the 5-position were prepared from para-tolunitrile-[cyano-{sup 14}C] and benzonitrile-[cyano-{sup 14}C], respectively.

Assessment of endogenous dopamine release by methylphenidate challenge using iodine-123 iodobenzamide single-photon emission tomography

International Nuclear Information System (INIS)

Booij, J.; Korn, P.; Linszen, D.H.; Royen, E.A. van

1997-01-01

This double-blind, placebo-controlled study assessed pharmacologically induced endogenous dopamine (DA) release in healthy male volunteers (n=12). Changes in endogenous DA release after injection of the psychostimulant drug methylphenidate were evaluated by single-photon emission tomography (SPET) and constant infusion of iodine-123 iodobenzamide ([ 123 I[IBZM), a D 2 receptor radioligand that is sensitive to endogenous DA release. Methylphenidate induced displacement of striatal [ 123 I[IBZM binding, resulting in a significantly decrease in the specific to non-specific [ 123 I[IBZM uptake ratio (average: 8.6%) in comparison with placebo (average: -1.9%). Moreover, injection of methylphenidate induced significant behavioural responses on the following items: excitement, anxiety, tension, and mannerisms and posturing. The results of this study demonstrate the feasibility of using constant infusion of [ 123 I[IBZM and SPET imaging to measure endogenous DA release after methylphenidate challenge and to investigate neurochemical aspects of behaviour. (orig.). With 2 figs., 1 tab

Prediction of effect of {beta}-blocker therapy in patients with dilated cardiomyopathy by using {sup 123}I-BMIPP, {sup 123}I-MIBG scintigraphy

Energy Technology Data Exchange (ETDEWEB)

Inoue, Aritomo; Yamazaki, Junichi; Nanjou, Shuji; Togane, Yuko; Amano, Hideo [Toho Univ., Tokyo (Japan). School of Medicine

2001-03-01

We investigated prediction of the efficacy of {beta}-blocker therapy in patients with dilated cardiomyopathy (DCM) by using myocardial scintigraphy with {sup 123}I-BMIPP (BMIPP) and {sup 123}I-MIBG (MIBG). Thirty-seven patients with DCM were examined by myocardial scintigraphy with BMIPP and MIBG before {beta}-blocker therapy. Patients were classified into two groups, based on whether they improved >10% of the left ventricular ejection fraction (LVEF) (improved group, n=21) or not (unimproved group, n=16). The extent and severity score of BMIPP for the improved group was significantly lower (p<0.001) than that for unimproved group. It has been suggested that BMIPP is useful in evaluating the prediction of efficacy of {beta}-blocker therapy in patients with DCM. (author)

45 CFR 46.123 - Early termination of research support: Evaluation of applications and proposals.

Science.gov (United States)

2010-10-01

... of applications and proposals. 46.123 Section 46.123 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROTECTION OF HUMAN SUBJECTS Basic HHS Policy for Protection of Human... rights and welfare of human subjects (whether or not the research was subject to federal regulation). ...

Clinical evaluation of renal scintigram with 123I-OIH and sup(99m)Tc-DTPA in renal transplantation

International Nuclear Information System (INIS)

Ishibashi, Akira; Fujino, Awato; Ikeda, Shigeru; Ishii, Katsumi; Nakazawa, Keiji

1983-01-01

We have carried out 85 renal scintigrams on the 29 renal transplants last 6 months. Clinical usefulness of 123 I-IIH (ortho-iodohippurate) specially prepared compared with that of sup(99m)Tc-DTPA. The parameters of the vascular phase, perfusion index (PI) and (mean) transit time (TT), for the 123 I-OIH and sup(99m)Tc-DTPA renal scintigrams, were almost identical. Therefore it might be thought that renal circulation of 123 I-OIH is similar to that of sup(99m)Tc-DTPA. Moreover 123 I-OIH can afford us specific information on the exretory phase. The complicated renal transplants are well differentiated from normal functioning ones by B/K ratio of 123 I-OIH. B/K ratio is one of the parameters for the excretory phase. 123 I-OIH could be a useful agent for the clinical evaluation after renal transplantation. (author)

Iodine-123 metaiodobenzylguanidine imaging of the heart in idiopathic congestive cardiomyopathy and cardiac transplants

International Nuclear Information System (INIS)

Glowniak, J.V.; Turner, F.E.; Gray, L.L.; Palac, R.T.; Lagunas-Solar, M.C.; Woodward, W.R.

1989-01-01

Iodine-123 metaiodobenzylguanidine ([ 123 I]MIBG) is a norepinephrine analog which can be used to image the sympathetic innervation of the heart. In this study, cardiac imaging with [ 123 I]MIBG was performed in patients with idiopathic congestive cardiomyopathy and compared to normal controls. Initial uptake, half-time of tracer within the heart, and heart to lung ratios were all significantly reduced in patients compared to normals. Uptake in lungs, liver, salivary glands, and spleen was similar in controls and patients with cardiomyopathy indicating that decreased MIBG uptake was not a generalized abnormality in these patients. Iodine-123 MIBG imaging was also performed in cardiac transplant patients to determine cardiac nonneuronal uptake. Uptake in transplants was less than 10% of normals in the first 2 hr and nearly undetectable after 16 hr. The decreased uptake of MIBG suggests cardiac sympathetic nerve dysfunction while the rapid washout of MIBG from the heart suggests increased cardiac sympathetic nerve activity in idiopathic congestive cardiomyopathy

Cerebral dynamics of N-isopropyl-(123I)p-iodoamphetamine

International Nuclear Information System (INIS)

Creutzig, H.; Schober, O.; Gielow, P.; Friedrich, R.; Becker, H.; Dietz, H.; Hundeshagen, H.

1986-01-01

Temporal changes in the distribution of N-isopropyl-(123I)p-iodoamphetamine (IMP) within the brain are measured with serial tomographic imaging. In the cerebellum there is a decrease in activity of 42% from the early [15-45 min postinjection (p.i.)] to the late (210-240 min p.i.) scan, while in the cortex the decrease is 18%, and in the basal ganglia there is no decrease within this time. In brain tumors there was no IMP uptake in the early as well as in the late scans, regardless of tumor type, perfusion rate, or blood-brain barrier dysfunction. In 11 of 43 patients with a cerebral infarction a real increase of 123I activity (mean +21%) was seen in the late images. This ''filling in'' phenomena might be useful in selecting patients for bypass surgery. In these patients the diaschisis cerebelli, seen in the early scans, disappeared in the late images. The regional distribution of IMP changes with time; spatial ratios might be blurred by temporal changes. High-flow areas such as visio-auditory centers can be delineated clearly after stimulation in fast early scans; in these areas the pharmacokinetics of 123I are different from other cortex regions. To get the full information from the IMP brain uptake, both spatial and temporal variation must be measured

SPECT quantification of 123I - and - CIT in Parkinsonism

International Nuclear Information System (INIS)

Larcos, G.; Shaffi, M.; Hutton, B.F.; Hatton, R.; Kyme, A.; Fung, V.S.C.; Morris, J.G.L.

2002-01-01

Full text: Evaluation of presynaptic dopaminergic function using 2B-carboxymethoxy-3B-(4-[ 123 I] iodophenyl) tropane ( 123 I-and-CIT) SPECT has employed subjective or semi-quantitative methods. Our hypothesis is that disease classification in Parkinsonism may be improved by partial volume correction and co-registration with MRI. We studied seven patients (pts) with IPD (four men, three women, mean age=54.5+/-10.9 yrs; Hoehn and Yahr stage range 1-3; Schwab and England scale range: 30-100 [mean=67.1+/-26.9]) and two controls with 123 I- - CIT using 110-150 MBq and a dual-head camera equipped with fan-beam collimation. SPECT was registered to MRI and then aligned to a reference template. Specific to non-specific dopaminergic binding (UR) was calculated for the putamen and caudate nucleus, as well as the fractional volume (FV; fraction of the Structure affected) and residual uptake ratio (RUR; count density in area/remnant apparently unaffected by disease). Parameters that were statistically significant were the putamen (p; but not caudate) UR, FV and RUR. We conclude that: (a) it is possible to distinguish dopaminergic activity within the putamen from caudate using MRI image co-registration and (b) parameters other than UR may discriminate IPD from normal subjects and other entities. Copyright (2002) The Australian and New Zealand Society of Nuclear Medicine Inc

7 CFR 4287.123 - Subordination of lien position.

Science.gov (United States)

2010-01-01

....123 Agriculture Regulations of the Department of Agriculture (Continued) RURAL BUSINESS-COOPERATIVE SERVICE AND RURAL UTILITIES SERVICE, DEPARTMENT OF AGRICULTURE SERVICING Servicing Business and Industry... must be requested in writing by the lender and concurred in by the Agency in writing in advance of the...

Iodine-123-iodobenzamide imaging, MRI and apomorphine testing in the evaluation of patients with Parkinsonism

International Nuclear Information System (INIS)

Van der Schaaf, A.A.; Stell, R.; Groom, G.N.; Lambrecht, R.; Najdovski, L.; Cardaci, G.; Davis, S.; Dikic, B.; Laing, B.; Mastaaglia, F.L.; O''Brein, J.

1998-01-01

Full text: Idiopathic Parkinson''s disease (IPD) is characterised by a loss of dopaminergic neurons in the substantia nigra. Other neurodegenerative disorders may mimic IPD, and the clinical distinction is important in patient management. Iodine-123-iodobenzamide (IBZM) has high specific binding to dopamine-2 (D2) receptors enabling SPECT studies of these receptors in the human brain. A significant reduction of D2 receptor binding of 123 I-lBZM has been shown in the basal ganglia of patients with Parkinsonian syndromes (PS) but normal uptake is seen in patients with IPD. Iodine-123-lBZM SPECT imaging has been proposed as a means of distinguishing between patients with IPD and PS and may be of value in predicting the long-term responsiveness to dopaminergic drugs. Magnetic resonance imaging has also been used to distinguish IPD from PS, and apomorphine testing is in use as a clinical means of predicting response to dopaminergic drugs. We plan to evaluate the sensitivity and specificity of 123 I-lBZM SPECT, MRI and apomorphine testing for categorisation of patients and the prediction of responsiveness to dopaminergic drugs. To date we have studied 17 patients. SPECT imaging of the brain was carried out two hours after the i.v. administration of 185 MBq of 123 I-lBZM and visual and semi-quantitative analysis, using ratios of uptake in basal ganglia to frontal cortex, occipital cortex and cerebellum have been carried out. Although the data are incomplete, preliminary results suggest that there is a poor correlation of 123 I-lBZM uptake with the provisional clinical diagnosis and with apomorphine testing, but that 123 I-lBZM uptake is a predictor of dopaminergic response

123I-Iodomethyl tyrosine radiochemical synthesis and quantification of residual impurities after SepPak purification

International Nuclear Information System (INIS)

Matte, G.; Abrams, D.; Kumar, P.; Mercer, J.

2002-01-01

[123-I]-Iodomethyl tyrosine, an analog of tyrosine, is used as a radiopharmaceutical to detect malignant tissue in vivo. Initial synthesis report removal of the starting material using HPLC reversed phase chromatography as well as a simple method using a C18-SepPak cartridge when an HPLC system is not available. Small amounts of residual starting material have not been reported to interfere with tumor uptake following biodistribution in vivo. However, in vitro tissue culture studies do require the final product to be free of un-reacted methyl tyrosine. Our goal was to quantify the amount of residual methyl tyrosine after C18-SepPak purification to confirm that 123 I methyl tyrosine purified in this manner would be suitable tissue culture studies. A preconditioned (rinsed with 2 ml Ethanol and 8 ml PBS) C18-SepPak cartridge is loaded with the 123 I-iodomethyl tyrosine reaction mixture and washed with 8 mL of PBS to remove the un-reacted methyl tyrosine and free 123 I-iodide. The cartridge is then eluted with a 20% alcohol/PBS mixture to recover the 123 I-iodomethyl tyrosine. Paper chromatography confirmed the removal of un-reacted 123 I-iodide. A parallel study with a methyl tyrosine standard was used to confirm the removal of the methyl tyrosine from the SepPak cartridge during the washing with 8 mL of PBS. Fractions were collected and UV absorbance was recorded. A standard curve was prepared using the UV absorbance of serial dilutions of methyl tyrosine. The detection limit was in the order of ng/mL. An elution profile of both 123 I methyl tyrosine and methyl tyrosine was obtained and shows that traces of methyl tyrosine can still be present after an 8 mL PBS wash

Ketamine displaces the novel NMDA receptor SPET probe [{sup 123}I]CNS-1261 in humans in vivo

Energy Technology Data Exchange (ETDEWEB)

Stone, James M. [Institute of Psychiatry, King' s College London, De Crespigny Park London, SE5 8AF (United Kingdom)]. E-mail: j.stone@iop.kcl.ac.uk; Erlandsson, Kjell [Institute of Nuclear Medicine, University College London, London, W1N 8AA (United Kingdom); Arstad, Erik [Institute of Psychiatry, King' s College London, De Crespigny Park London, SE5 8AF (United Kingdom); Bressan, Rodrigo A. [Institute of Psychiatry, King' s College London, De Crespigny Park London, SE5 8AF (United Kingdom); Squassante, Lisa [GlaxoSmithKline (GSK), Verona 37135 (Italy); Teneggi, Vincenza [GlaxoSmithKline (GSK), Verona 37135 (Italy); Ell, Peter J. [Institute of Nuclear Medicine, University College London, London, W1N 8AA (United Kingdom); Pilowsky, Lyn S. [Institute of Psychiatry, King' s College London, De Crespigny Park London, SE5 8AF (United Kingdom); Institute of Nuclear Medicine, University College London, London, W1N 8AA (United Kingdom)

2006-02-15

[{sup 123}I]CNS-1261 [N-(1-naphthyl)-N'-(3-iodophenyl)-N-methylguanidine] is a high-affinity SPET ligand with selectivity for the intrachannel PCP/ketamine/MK-801 site of the N-methyl-D-aspartate (NMDA) receptor. This study evaluated the effects of ketamine (a specific competitor for the intrachannel PCP/ketamine/MK-801 site) on [{sup 123}I]CNS-1261 binding to NMDA receptors in vivo. Ten healthy volunteers underwent 2 bolus-plus-infusion [{sup 123}I]CNS-1261 scans, one during placebo and the other during a ketamine challenge. Ketamine administration led to a significant decrease in [{sup 123}I]CNS-1261 V {sub T} in most of the brain regions examined (P<.05). [{sup 123}I]CNS-1261 appears to be a specific ligand in vivo for the intrachannel PCP/ketamine/MK-801 NMDA binding site.

Synthesis of iodine-123 labelled analogues of imidazenil and ethyl-imidazenil for studying benzodiazepine receptors using SPECT

International Nuclear Information System (INIS)

Katsifis, A.; Mattner, F.; Dikic, B.; Najdovski, L.; Kassiou, M.

1996-01-01

The [ 123 I]iodinated analogues of the benzodiazepine receptor partial agonist imidazenil and N-ethyl imidazenil have been synthesised for the study of the central benzodiazepine receptor using SPECT. [ 123 I]Iodomidazenil and [ 123 I]N-ethyliodoimidazenil were prepared by nucleophilic bromine-iodine exchange in acetic acid at 150 o . The products were purified by semi-preparative reverse-phase HPLC with average radiochemical yields of 80% in a total synthesis time of 80 minutes. The specific activity was determined to be greater than 2500 Ci/mmol. The radiochemical and chemical purity assessed by radio-TLC and HPLC were found to be 98%. Alternatively, iododestannylation reactions via the trimethyltin precursors with Na[ 123 I] in the presence of Chloramine-T or peracetic acid resulted in yields of only 20-25% with the bulk of activity being lost as volatile methyl [ 123 I]iodide. (author)

Production, purification, sequencing and activity spectra of mutacins D-123.1 and F-59.1.

Science.gov (United States)

Nicolas, Guillaume G; LaPointe, Gisèle; Lavoie, Marc C

2011-04-10

The increase in bacterial resistance to antibiotics impels the development of new anti-bacterial substances. Mutacins (bacteriocins) are small antibacterial peptides produced by Streptococcus mutans showing activity against bacterial pathogens. The objective of the study was to produce and characterise additional mutacins in order to find new useful antibacterial substances. Mutacin F-59.1 was produced in liquid media by S. mutans 59.1 while production of mutacin D-123.1 by S. mutans 123.1 was obtained in semi-solid media. Mutacins were purified by hydrophobic chromatography. The amino acid sequences of the mutacins were obtained by Edman degradation and their molecular mass was determined by mass spectrometry. Mutacin F-59.1 consists of 25 amino acids, containing the YGNGV consensus sequence of pediocin-like bacteriocins with a molecular mass calculated at 2719 Da. Mutacin D-123.1 has an identical molecular mass (2364 Da) with the same first 9 amino acids as mutacin I. Mutacins D-123.1 and F-59.1 have wide activity spectra inhibiting human and food-borne pathogens. The lantibiotic mutacin D-123.1 possesses a broader activity spectrum than mutacin F-59.1 against the bacterial strains tested. Mutacin F-59.1 is the first pediocin-like bacteriocin identified and characterised that is produced by Streptococcus mutans. Mutacin D-123.1 appears to be identical to mutacin I previously identified in different strains of S. mutans.

Production, purification, sequencing and activity spectra of mutacins D-123.1 and F-59.1

Directory of Open Access Journals (Sweden)

LaPointe Gisèle

2011-04-01

Full Text Available Abstract Background The increase in bacterial resistance to antibiotics impels the development of new anti-bacterial substances. Mutacins (bacteriocins are small antibacterial peptides produced by Streptococcus mutans showing activity against bacterial pathogens. The objective of the study was to produce and characterise additional mutacins in order to find new useful antibacterial substances. Results Mutacin F-59.1 was produced in liquid media by S. mutans 59.1 while production of mutacin D-123.1 by S. mutans 123.1 was obtained in semi-solid media. Mutacins were purified by hydrophobic chromatography. The amino acid sequences of the mutacins were obtained by Edman degradation and their molecular mass was determined by mass spectrometry. Mutacin F-59.1 consists of 25 amino acids, containing the YGNGV consensus sequence of pediocin-like bacteriocins with a molecular mass calculated at 2719 Da. Mutacin D-123.1 has an identical molecular mass (2364 Da with the same first 9 amino acids as mutacin I. Mutacins D-123.1 and F-59.1 have wide activity spectra inhibiting human and food-borne pathogens. The lantibiotic mutacin D-123.1 possesses a broader activity spectrum than mutacin F-59.1 against the bacterial strains tested. Conclusion Mutacin F-59.1 is the first pediocin-like bacteriocin identified and characterised that is produced by Streptococcus mutans. Mutacin D-123.1 appears to be identical to mutacin I previously identified in different strains of S. mutans.

SPECT imaging with the serotonin transporter radiotracer [123I]p ZIENT in nonhuman primate brain

International Nuclear Information System (INIS)

Cosgrove, Kelly P.; Staley, Julie K.; Baldwin, Ronald M.; Bois, Frederic; Plisson, Christophe; Al-Tikriti, Mohammed S.; Seibyl, John P.; Goodman, Mark M.; Tamagnan, Gilles D.

2010-01-01

Introduction: Serotonin dysfunction has been linked to a variety of psychiatric diseases; however, an adequate SPECT radioligand to probe the serotonin transporter system has not been successfully developed. The purpose of this study was to characterize and determine the in vivo selectivity of iodine-123-labeled 2β-carbomethoxy-3β-(4'-((Z)-2-iodoethenyl)phenyl)nortropane, [ 123 I]p ZIENT, in nonhuman primate brain. Methods: Two ovariohysterectomized female baboons participated in nine studies (one bolus and eight bolus to constant infusion at a ratio of 9.0 h) to evaluate [ 123 I]p ZIENT. To evaluate the selectivity of [ 123 I]p ZIENT, the serotonin transporter blockers fenfluramine (1.5, 2.5 mg/kg) and citalopram (5 mg/kg), the dopamine transporter blocker methylphenidate (0.5 mg/kg) and the norepinephrine transporter blocker nisoxetine (1 mg/kg) were given at 8 h post-radiotracer injection. Results: In the bolus to constant infusion studies, equilibrium was established by 4-8 h. [ 123 I]p ZIENT was 93% and 90% protein bound in the two baboons and there was no detection of lipophilic radiolabeled metabolites entering the brain. In the high-density serotonin transporter regions (diencephalon and brainstem), fenfluramine and citalopram resulted in 35-71% and 129-151% displacement, respectively, whereas methylphenidate and nisoxetine did not produce significant changes ( 123 I]p ZIENT is a favorable compound for in vivo SPECT imaging of serotonin transporters with negligible binding to norepinephrine and dopamine transporters.

Synthesis, radiolabeling and baboon SPECT imaging of 2β-carbomethoxy-3β-(3'-[123I]iodophenyl)tropane ([123I]YP256) as a serotonin transporter radiotracer

International Nuclear Information System (INIS)

Bois, Frederic; Baldwin, Ronald M.; Amici, Louis; Al-Tikriti, Mohammed S.; Kula, Nora; Baldessarini, Ross; Innis, Robert B.; Staley, Julie K.; Tamagnan, Gilles D.

2008-01-01

To develop a potential SPECT probe to evaluate the integrity of the serotoninergic system (5-HTT) whose dysfunction is linked to several disease conditions such as Parkinson's disease, Alzheimer's disease and depression, we report the synthesis, radiolabeling and in vivo baboon imaging of 2β-carbomethoxy-3β-(3'-[ 123 I]iodophenyl) tropane (YP256, ). The radiolabeling was performed by iododestannylation using sodium [ 123 I]iodide and peracetic acid. Although the ligand displayed high selectivity for 5-HTT over dopamine transporter in vitro, SPECT imaging in baboons did not reveal selective 5-HTT accumulation in brain in vivo

Simultaneous acquisition of (99m)Tc- and (123)I-labeled radiotracers using a preclinical SPECT scanner with CZT detectors.

Science.gov (United States)

Kobayashi, Masato; Matsunari, Ichiro; Nishi, Kodai; Mizutani, Asuka; Miyazaki, Yoshiharu; Ogai, Kazuhiro; Sugama, Jyunko; Shiba, Kazuhiro; Kawai, Keiichi; Kinuya, Seigo

2016-05-01

Simultaneous acquisition of (99m)Tc and (123)I was evaluated using a preclinical SPECT scanner with cadmium zinc telluride (CZT)-based detectors. 10-ml cylindrical syringes contained about 37 MBq (99m)Tc-tetrofosmin ((99m)Tc-TF) or 37 MBq (123)I-15-(p-iodophenyl)-3R,S-methyl pentadecanoic acid ((123)I-BMIPP) were used to assess the relationship between these SPECT radioactive counts and radioactivity. Two 10-ml syringes contained 100 or 300 MBq (99m)Tc-TF and 100 MBq (123)I-BMIPP to assess the influence of (99m)Tc upscatter and (123)I downscatter, respectively. A rat-sized cylindrical phantom also contained both 100 or 300 MBq (99m)Tc-TF and 100 MBq (123)I-BMIPP. The two 10-ml syringes and phantom were scanned using a pinhole collimator for rats. Myocardial infarction model rats were examined using 300 MBq (99m)Tc-TF and 100 MBq (123)I-BMIPP. Two 1-ml syringes contained 105 MBq (99m)Tc-labeled hexamethylpropyleneamine oxime ((99m)Tc-HMPAO) and 35 MBq (123)I-labeled N-ω-fluoropropyl-2β-carbomethoxy-3β-(4-iodophenyl) nortropane ((123)I-FP-CIT). The two 1-ml syringes were scanned using a pinhole collimator for mice. Normal mice were examined using 105 MBq (99m)Tc-HMPAO and 35 MBq (123)I-FP-CIT. The relationship between SPECT radioactive counts and radioactivity was excellent. Downscatter contamination of (123)I-BMIPP exhibited fewer radioactive counts for 300 MBq (99m)Tc-TF without scatter correction (SC) in 125-150 keV. There was no upscatter contamination of (99m)Tc-TF in 150-175 keV. In the rat-sized phantom, the radioactive count ratio decreased to 4.0 % for 300 MBq (99m)Tc-TF without SC in 125-150 keV. In the rats, myocardial images and radioactive counts of (99m)Tc-TF with the dual tracer were identical to those of the (99m)Tc-TF single injection. Downscatter contamination of (123)I-FP-CIT was 4.2 % without SC in 125-150 keV. In the first injection of (99m)Tc-HMPAO and second injection of (123)I-FP-CIT, brain images and radioactive counts

Stress-strain behavior under static loading in Gd123 high-temperature superconductors at 77 K

Science.gov (United States)

Fujimoto, Hiroyuki; Murakami, Akira; Teshima, Hidekazu; Morita, Mitsuru

2013-10-01

Mechanical properties of melt-growth GdBa2Cu3Ox (Gd123) superconducting samples with 10 wt.% Ag2O and 0.5 wt.% Pt were evaluated at 77 K through flexural tests for specimens cut from the samples in order to estimate the mechanical properties of the Gd123 material without metal substrates, buffer layers or stabilization layers. We discuss the mechanical properties; the Young's modulus and flexural strength with stress-strain behavior at 77 K. The results show that the flexural strength and fracture strain of Gd123 at 77 K are approximately 100 MPa and 0.1%, respectively, and that the origin of the fracture is defects such as pores, impurities and non-superconducting compounds. We also show that the Young's modulus of Gd123 is estimated to be 160-165 GPa.

Demonstration and quantitation of pharmacological inhibition of pulmonary uptake of N-isopropyl-123I-p-Iodoamphetamine by propanolol

International Nuclear Information System (INIS)

Akber, S.F.

1989-01-01

The first-pass pulmonary extraction values of N-Isopropyl- 123 I-p-Iodoamphetamine ( 123 I-IMP) in pretreated dogs decreases from 90 to 62% as the amount of propranolol increases from 0 to 20 mg. The first-pass pulmonary extraction values of 123 I-IMP in dogs with a simultaneous bolus injection of propranolol decreases from 90 to 62% as the amount of propranolol increases from 0 to 10 mg. The pulmonary extraction of 123 I-IMP with a simultaneous bolus injection of ketamine and 123 I-IMP decreases from 90 to 64% as the ketamine dose increases from 0 to 100 mg. These results suggest that the pulmonary uptake of 123 I-IMP may be at least partially mediated by receptors. They also indicate that endothelial metabolic cell function may be a useful index of early lung pathology. Furthermore, studies of the degree of lung uptake may be a sensitive index of pathologic states in which alterations of amine binding sites have occurred. (orig.) [de

22 CFR 123.16 - Exemptions of general applicability.

Science.gov (United States)

2010-04-01

... United States, by accredited U.S. institutions of higher learning of articles fabricated only for... FOR THE EXPORT OF DEFENSE ARTICLES § 123.16 Exemptions of general applicability. (a) The following exemptions apply to exports of unclassified defense articles for which no approval is needed from the...

29 CFR 500.123 - Property damage insurance required.

Science.gov (United States)

2010-07-01

... MIGRANT AND SEASONAL AGRICULTURAL WORKER PROTECTION Motor Vehicle Safety and Insurance for Transportation of Migrant and Seasonal Agricultural Workers, Housing Safety and Health for Migrant Workers Insurance § 500.123 Property damage insurance required. (a) When a person who is an employer of a migrant or...

Fracture toughness of Dy123 low porosity bulks at liquid nitrogen temperature

International Nuclear Information System (INIS)

Murakami, A.; Otaka, K.; Miura, T.; Iwamoto, A.

2011-01-01

Fracture toughness values were measured for Dy123 bulks. Fracture toughness was improved by reducing porosity. Fracture toughness values at 77 K were higher than those at room temperature. Fracture toughness was also improved by Ag addition. In order to evaluate the fracture toughness of DyBa 2 Cu 3 O x (Dy123) low porosity bulks, bending tests of V-notched specimens cut from the bulks were carried out. Fracture toughness evaluations of a conventional Dy123 bulk which had pores were also carried out and effects of elimination of pores on the fracture toughness were investigated. Fracture toughness values at 77 K of the low porosity bulks were higher than those of the porous bulk. These fracture toughness values at 77 K were higher than the values at room temperature. Fracture toughness of the low porosity bulk was improved by Ag addition.

Clinical usefulness of {sup 123}I-BMIPP myocardial SPECT in collagen disease

Energy Technology Data Exchange (ETDEWEB)

Ito, Kazuki; Zen, Kan [Asahi Univ., Gifu (Japan). Murakami Memorial Hospital; Sugihara, Hiroki (and others)

2000-07-01

This study was designed to evaluate the clinical usefulness of {sup 123}I-BMIPP myocardial SPECT for detecting cardiac involvement in patients with collagen disease. We studied 12 patients with systemic lupus erythematosus (SLE), 8 with progressive systemic sclerosis (PSS), 6 with polymyositis/dermatomyositis (PM/DM) and 3 with allergic granulomatosis and angiitis (AGA). A 111 MBq of {sup 123}I-BMIPP was intravenously injected at rest, and SPECT images were obtained at 15 min after the injection. Seven of 12 SLE, 6 of 8 PSS, 3 of 6 PM/DM and all 3 AGA patients showed an abnormal tracer uptake. The left ventricular ejection fraction was inversely correlated with a BMIPP abnormality. The regional wall motion abnormality was reduced in regions with reduced tracer uptake. These findings suggest that {sup 123}I-BMIPP imaging could be useful for assessment of cardiac involvement in patients with collagen disease. (author)

Evaluation of newborns with brain disease using [sup 123]I-IMP SPECT

Energy Technology Data Exchange (ETDEWEB)

Oshima, Motoo; Yasukochi, Hiroshi (Teikyo Univ., Tokyo (Japan). Faculty of Medicine); Suzuki, Chizuko; Sasaki, Junko; Kitoh, Osamu

1993-07-01

Eleven newborns with suspected cerebral disease were evaluated using [sup 123]I-IMP SPECT. In a normal subject, high uptake was shown in the sensorimotor cortex, thalamus, midbrain-brainstem, and cerebellar vermis. Decreased perfusion was also noted in the frontal lobe. In hypoxic ischemic encephalopathy (HIE), diffuse decreased uptake which showed no redistribution in the white matter was seen in two patients. These two patients had a poor prognosis. In one of the other 4 patients with HIE, persistent defect in parasagittal area was recognized and the patient also had a poor prognosis. In one of two patients with tuberous sclerosis, [sup 123]I-IMP SPECT showed high uptake in the area of increased density shown in CT. Thus, [sup 123]I-IMP SPECT of newborn has characteristic findings different from the adult. This tracer also might have a prognostic value of clinical improvement following HIE. (author).

Production of iodine-123 radiobiological specimen on 25 MeV electron beam

International Nuclear Information System (INIS)

Oganesyan, Yu.Ts.; Starodub, G.Ya.; Buklanov, G.V.; Korotkin, Yu.S.; Belov, A.G.

1988-01-01

The technique is described and experimental results are presented for production of radioactive specimen-iodine-123 for medical biological investigations. It is shown that in ten hour irradiation of 124 Xe enriched target of 10 g weight by the 25 MeV electron beam at MT-25 microtron short lived 123 I with activity of about 200 mCl can be accumulated. The procedure was developed for extraction of radioactive atoms and preparing the solution that permits to obtain during 1-1.5 h after the end of irradiation the specimen which satisfies all pharmacopeia requirements. It follows from the results that using small-size electron accelerators with the beam energy up to 25 MeV permits to organize economical and large-scale production of high quality radioactive specimen of 123 I for servicing a large region of this country. 14 refs.; 4 figs.; 1 tab

I-123-labelled heptadecanoic acid as myocardial imaging agent: comparison with thallium-201 and first-pass nuclear ventriculography

International Nuclear Information System (INIS)

Abdullah, A.Z.; Hawkins, L.A.; Britton, K.E.; Elliott, A.T.; Stephens, J.D.

1981-01-01

Results of the use of 123 I-iodoheptadecanoic acid (HA) as a myocardial imaging agent in eight patients and six normals are presented. It was shown that 123 I-HA gave comparable results to the widely used radiopharmaceutical 201 Tl. However the advantages of using 123 I-HA are that the 159 KeV energy is better suited to the conventional gamma camera, it gives a lower radiation dose to the patient and has a lower cost per study. 123 I-HA also has an important advantage in its potential for studying regional myocardial metabolic activity; in one patient, a defect due to ischaemia was seen at rest with 123 I-HA but required stress to make it evident with 201 Tl imaging. (U.K.)

Novel 1H-1,2,3-, 2H-1,2,3-, 1H-1,2,4- and 4H-1,2,4-triazole derivatives: a patent review (2008 - 2011).

Science.gov (United States)

Ferreira, Vitor F; da Rocha, David R; da Silva, Fernando C; Ferreira, Patrícia G; Boechat, Núbia A; Magalhães, Jorge L

2013-03-01

The triazoles represent a class of five-membered heterocyclic compounds of great importance for the preparation of new drugs with diverse biological activities because they may present several structural variations with the same numbers of carbon and nitrogen atoms. Due to the success of various triazoles that entered the pharmaceutical market and are still being used in medicines, many companies and research groups have shown interest in developing new methods of synthesis and biological evaluation of potential uses for these compounds. In this review, the authors explored aspects of patents for the 1H-1,2,3-, 2H-1,2,3-, 1H-1,2,4- and 4H-1,2,4-triazole families, including prototypes being considered in clinical studies between 2008 and 2011. The triazoles have been studied for over a century as an important class of heterocyclic compounds and still attract considerable attention due to their broad range of biological activities. More recently, there has been considerable interest in the development of novel triazoles with anti-inflammatory, antiplatelet, antimicrobial, antimycobacterial, antitumoral and antiviral properties and activity against several neglected diseases. This review emphasizes recent perspective and advances in the therapeutically active 1H-1,2,3-, 2H-1,2,3-, 1H-1,2,4- and 4H-1,2,4-triazole derivative patents between 2008 and 2011, covering the development of new chemical entities and new pharmaceuticals. Many studies have focused on these compounds as target structures and evaluated them in several biological targets. The preparation of 1H-1,2,3-, 2H-1,2,3-, 1H-1,2,4- and 4H-1,2,4-triazole derivatives brings to light several issues. There is a need to find new, more efficient preparations for these triazoles that take into consideration current issues in green chemistry, energy saving and sustainability. New diseases are discovered and new viruses and bacteria continue to challenge mankind, so it is imperative to find new prototypes for these

Iodine-123 metaiodobenzylguanidine in the assessment of late cardiac effects from cancer therapy

International Nuclear Information System (INIS)

Valdes Olmos, R.A.; Bokkel Huinink, W.W. ten; Dewit, L.G.H.; Hoefnagel, C.A.; Liem, I.H.; Tinteren, H. van

1996-01-01

Recognition of adverse late cardiac effects from cancer therapy may enable identification of patients with risk of cardiotoxicity upon cancer retreatment. In this study the feasibility of using iodine-123 metaiodobenzylguanidine ( 123 I-MIBG) heart scintigraphy to detect abnormalities of the myocardial adrenergic neurone function in the late period after cancer therapy was evaluated in relation to the left ventricle ejection fraction (LVEF) in 18 cancer patients: 11 had undergone thoracic irradiation involving the heart, in five cases in combination with anthracycline therapy, 11-228 months (median 60 months) before radionuclide tests, while seven had not received previous anthracycline and/or radiotherapy (controls). The 123 I-MIBG cardiac uptake, expressed as a heart-to-mediastinum ratio on planar images after 4 h, ranged from 1.21 to 1.76 (median 1.56) in cancer therapy patients, which was significantly decreased (P=0.0006) in comparison with controls (range 1.81-2.06, median 1.9). The myocardial 123 I-MIBG washout, calculated from planar images after 15 min and 4 h, and LVEF also showed significant differences, but with some overlap in individual cases. In cancer therapy patients, cardiac abnormalities seen on planar images and additional single-photon emission tomographic images varied from focal defects to diffusely reduced myocardial uptake. It is concluded that 123 I-MIBG heart scintigraphy, which is able to identify cardiac adrenergic neurone abnormalities in the follow-up period after cancer therapy, may help to identify relapsed patients who are at increased risk of developing cardiotoxicity during retreatment with cardiotoxic therapy modalities. (orig.). With 4 figs., 2 tabs

13 CFR 123.11 - Does SBA require collateral for any of its disaster loans?

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Does SBA require collateral for any of its disaster loans? 123.11 Section 123.11 Business Credit and Assistance SMALL BUSINESS...? Generally, SBA will not require that you pledge collateral to secure a disaster home loan or a physical...

Neuroimaging of post-traumatic higher brain dysfunction using 123I-Iomazenil (IMZ) SPECT

International Nuclear Information System (INIS)

Nakagawara, Jyoji; Kamiyama, Kenji; Takahashi, Masaaki; Nakamura, Hirohiko

2010-01-01

In patients with mild traumatic brain injury (MTBI), higher brain dysfunctions which consist of cognitive impairments such as memory, attention, performance and social behavioral disturbances could be rarely apparent. However, higher brain dysfunctions should be identified by neuropsychological tests and supported by a social welfare for handicapped patients. Acknowledgement of higher brain dysfunctions after MTBI without obvious brain damages on morphological neuroimagings could be a social issue under controversy. An imaging of cortical neuron damages in patients with higher brain dysfunctions after MTBI was studied by functional neuroimaging using 123 I-Iomazenil (IMZ) single photon emission computed tomography (SPECT). Statistical imaging analyses using 3 dimensional stereotactic surface projections (3D-SSP) for 123 I-IMZ SPECT and 123 I-IMP SPECT as cerebral blood flow (CBF) studies were performed in 11 patients with higher brain dysfunctions after MTBI. In all patients with higher brain dysfunctions defined by neuropsychological tests, cortical neuron damages were observed in bilateral medial frontal lobes, but reduction of CBF in bilateral medial frontal lobes were less obviously showed in 8 patients (apparent in 3 and little in 5). Group comparison of 3D-SSP of 123 I-IMZ SPECT between 11 patients and 18 normal controls demonstrated significant selective loss of cortical neuron in bilateral medial frontal gyrus (MFG). Extent of abnormal pixels on each cortical gyrus using stereotactic extraction estimation (SEE) for 3D-SSP of 123 I-IMZ SPECT confirmed that 8 patients had abnormal pixel extent >10% in bilateral MFG and 5 patients had abnormal pixel extent >10% in bilateral anterior cingulate gyrus. In patients with MTBI, higher brain dysfunctions seems to correlate with selective loss of cortical neuron within bilateral MFG which could be caused by Wallerian degeneration as secondary phenomena after diffuse axonal injury within corpus callosum. Statistical

Assessment of myocardial fatty acid metabolism in patients with angina pectoris and diabetes mellitus using 123I-BMIPP myocardial scintigraphy

International Nuclear Information System (INIS)

Ito, Kazuki; Tanabe, Takuji; Yuba, Tatsuya; Doue, Tomoki; Adachi, Yoshihiko; Katoh, Shuuji; Sugihara, Hiroki; Azuma, Akihiro; Nakagawa, Masao

2001-01-01

We studied the effect of myocardial ischemia and diabetes mellitus (DM) on the myocardial fatty acid metabolism using 123 I-BMIPP myocardial scintigraphy. We performed 123 I-BMIPP myocardial scintigraphy in 50 patients with myocardial ischemia and without DM (AP), in 30 patients with myocardial ischemia and DM (AP+DM), 12 patients with DM and without myocardial ischemia (DM), and in 10 normal subjects (N). Myocardial uptake rate of 123 I-BMIPP was obtained using the time activity curve. Myocardial washout rate of 123 I-BMIPP was calculated using the polar images of early and delayed SPECT images. Myocardial uptake rate of 123 I-BMIPP (%) were AP: 4.9±0.6, AP+DM: 5.5±0.5, DM 5.7±0.5 and N: 5.0±0.4. 123 I-BMIPP myocardial uptake rate was increased in AP+DM and DM. 123 I-BMIPP myocardial washout rate (%) were AP: 30.2±4.3, AP+DM: 24.5±3.9, DM: 16.1±2.8 and N: 19.4±3.2. 123 I-BMIPP myocardial washout rate was increased in AP and AP+DM. 123 I-BMIPP myocardial washout rate was increased particularly in patients with multi-vessels disease. 123 I-BMIPP myocardial washout rate was decreased in DM. The present study suggested that diabetes mellitus increased myocardial fatty acid uptake and decreased myocardial fatty acid washout, and that myocardial ischemia increased myocardial fatty acid washout. (author)

14 CFR 417.123 - Computing systems and software.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Computing systems and software. 417.123... systems and software. (a) A launch operator must document a system safety process that identifies the... systems and software. (b) A launch operator must identify all safety-critical functions associated with...

Diagnostic performance of I-123-labeled serum amyloid P component scintigraphy in patients with amyloidosis

NARCIS (Netherlands)

Hazenberg, BPC; van Rijswijk, MH; Piers, DA; Lub-de Hooge, MN; Vellenga, E; Haagsma, EB; Hawkins, PN; Jager, PL

Purpose: To assess the diagnostic accuracy and additional information provided by I-123-labeled serum amyloid P component ( SAP) scintigraphy in patients with systemic and localized amyloidosis. Subjects and Methods: I-123-labeled human SAP was injected intravenously into 20 controls and 189

Reduced {sup 123}I-BMIPP uptake implies decreased myocardial flow reserve in patients with chronic stable angina

Energy Technology Data Exchange (ETDEWEB)

Kageyama, Hiroyuki; Morita, Koichi; Katoh, Chietsugu; Mabuchi, Megumi; Tamaki, Nagara [Hokkaido University Graduate School of Medicine, Department of Nuclear Medicine, Sapporo (Japan); Tsukamoto, Takahiro; Noriyasu, Kazuyuki; Naya, Masanao [Hokkaido University, Department of Cardiovascular Medicine, Sapporo (Japan); Hokkaido University Graduate School of Medicine, Department of Nuclear Medicine, Sapporo (Japan); Kawai, Yuko [Hokko Memorial Hospital, Department of Cardiovascular Medicine, Sapporo (Japan)

2006-01-01

Long-chain fatty acid (LCFA) is the main energy source for normal myocardium at rest, but in ischemic myocardium, the main energy substrate shifts from LCFA to glucose. {sup 123}I-BMIPP is a radiolabeled LCFA analog. In chronic stable angina without previous infarction, we suppose that reduced {sup 123}I-BMIPP uptake is related to the substrate shift in myocardium with decreased myocardial flow reserve (MFR). The purpose of this study was to relate {sup 123}I-BMIPP uptake to rest myocardial blood flow (MBF), hyperemic MBF, and MFR assessed with {sup 15}O-water positron emission tomography (PET). We enrolled 21 patients with chronic stable angina without previous infarction, all of whom underwent {sup 123}I-BMIPP single-photon emission computed tomography (SPECT) and {sup 15}O-water PET. The left ventricle was divided into 13 segments. In each segment, rest MBF and hyperemic MBF were measured by PET. {sup 123}I-BMIPP uptake was evaluated as follows: score 0=normal, 1=slightly decreased uptake, 2=moderately decreased uptake, 3=severely decreased uptake, and 4=complete defect. {sup 123}I-BMIPP uptake was compared with rest MBF, hyperemic MBF, and MFR. The numbers of segments with {sup 123}I-BMIPP scores 0, 1, 2, 3, and 4 were 178, 40, 25, 24, and 0, respectively. The rest MBFs for scores 0, 1, 2, and 3 were 0.93{+-}0.25, 0.86{+-}0.21, 0.97{+-}0.30, and 0.99{+-}0.37 ml/min/g, respectively. The hyperemic MBFs for scores 0, 1, 2, and 3 were 2.76{+-}1.29, 1.84{+-}0.74, 1.37{+-}0.39, and 1.08{+-}0.40 ml/min/g, respectively. The MFRs for scores 0, 1, 2, and 3 were 3.01{+-}1.38, 2.20{+-}0.95, 1.44{+-}0.22, and 1.10{+-}0.26, respectively. As {sup 123}I-BMIPP uptake declined, hyperemic MBF and MFR decreased. In chronic stable angina without previous infarction, reduced {sup 123}I-BMIPP uptake implies decreased MFR. (orig.)

Iodobell in vivo kits for labelling with 123I or 131I

International Nuclear Information System (INIS)

Koernyei, J.; Horvath, M.; Pszota, A.; Lakatos, M.; Szirtes, L.

1988-01-01

Iodobell in vivo kits provide an easy and fast method for 'on the spot' radioiodination with 123 I (or 131 I). Until now three kits have been developed in the Institute of Isotopes Budapest, the heptadecanoic acid, the hippurate and the MIBG kits. From these, the heptadecanoic acid kit is being tested in humans in Hungary, the other two are under the registration procedure. The Iodobell in vivo kits may contribute to the application of 123 I radioisotope in Hungary. (orig.)

12 CFR 221.123 - Combined credit for exercising employee stock options and paying income taxes incurred as a...

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Combined credit for exercising employee stock options and paying income taxes incurred as a result of such exercise. 221.123 Section 221.123 Banks and... (REGULATION U) Interpretations § 221.123 Combined credit for exercising employee stock options and paying...

The usefulness of brain SPECT with 123-I-IAMP and HIPDM

International Nuclear Information System (INIS)

Raynaud, C.; Rancurel, G.; Kieffer, E.; Soussaline, F.; Ricard, S.; Askienazy, S.; Moretti, J.L.; Bourdoiseau, M.; Rapin, J.

1983-10-01

I-123-isopropyl amphetamine (IAMP) and I-123 trimethyl propane diamine (HIPDM) are the first two brain indicators labelled with a gamma emitter. The brain activity curve reaches a value of 5% of the injected dose after 30 minutes and tomographic images of the brain can be obtained. Hypofixation is observed in brain lesions such as tumors or infarcts. At present, applications of brain tomography using IAMP or HIPDM are limited to focal epilepsy and Alzheimer disease. However, results obtained in cerebrovascular patients are encouraging and could become the most important applications of these two substances

Are 1,4- and 1,5-disubstituted 1,2,3-triazoles good pharmacophoric groups?

Science.gov (United States)

Massarotti, Alberto; Aprile, Silvio; Mercalli, Valentina; Del Grosso, Erika; Grosa, Giorgio; Sorba, Giovanni; Tron, Gian Cesare

2014-11-01

Over the last decade, 1,2,3-triazoles have received increasing attention in medicinal chemistry thanks to the discovery of the highly useful and widely applicable 1,3-dipolar cycloaddition reaction between azides and alkynes (click chemistry) catalyzed by copper salts and ruthenium complexes. After a decade of medicinal chemistry research on 1,2,3-triazoles, we feel that the time is ripe to demonstrate the real ability of this heterocycle to participate in important and pivotal binding interactions with biological targets while maintaining a good pharmacokinetic profile. In this study, we retrieved and analyzed X-ray crystal structures of complexes between 1,2,3-triazoles and either proteins or DNA to understand the pharmacophoric role of the triazole. Furthermore, the metabolic stability, the capacity to inhibit cytochromes, and the contribution of 1,2,3-triazoles to the overall aqueous solubility of compounds containing them have been analyzed. This information should furnish fresh insight for medicinal chemists in the design of novel bioactive molecules that contain the triazole nucleus. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Synthesis, biological distribution and radiation dosimetry of Te-123m analogues of hexadecenoic acid

International Nuclear Information System (INIS)

Basmadjian, G.P.; Ice, R.D.; Mills, S.L.

1982-01-01

The synthesis and biological distribution of four Te-123m analogues of hexadecenoic acid in rats, rabbits and dogs were described for use as possible myocardial imaging agents. The heart-to-blood ratios ranged from 0.13 for 3-telluranonadecenoic acid in rats at 5 mins to 6.25 for 18-methyl-17-tellura-9-nonadecenoic acid in dogs at 24 hrs. The biological half-life of the Te-123m labelled fatty acids ranged from 26 to 583 hrs in the hearts of the test animals. These Te-123m fatty acids were retained in the heart longer than radioiodinated fatty acids and have acceptable absorbed doses to the various target organs. (U.K.)

Iodine 123-antipyrine. A diffusible tracer for brain exploration

International Nuclear Information System (INIS)

Dantonel-Mathieu, Evelyne.

1978-09-01

Iodine 123-labelled iodoantipyrine is a liposoluble diffusible tracer which crosses the blood-brain barrier intact. Its build-up in brain tissue is proportional to the regional blood flow. Its behavior was studied in undervascularised brain lesions and in cases where research with traditional radioactive tracers (99mTc and its different vectors for example) has proved limited. Because of the great diffusibility of iodoantipyrine a brain parenchyma image is obtained within minutes after its injection, and this by the use of a non-invasive technique and under good gamma-camera exploration conditions. 81 brain explorations including 11 standards have been carried out on subjects averaging 51,2 years old; these examinations took place in three nuclear medicine centres. The 123 I iodoantipyrine used in each nuclear medicine centre is supplied by the CEA. Iodoantipyrine is labelled with a good yield (>98%) checked by chromatography by means of a CEA kit. After intraveinous injection of 4 to 6 mCi iodine-123 iodoantipyrine, a dynamic study (from 0 to 60 seconds) of the tracer passage in the brain tissue may be followed by static images taken in the next minutes according to a standard procedure. The table of results shows the major interest of this tracer for the exploration of vascular accidents with ischemic lesions, especially in the early phase of the accident. The lesion appears as a hypoactive zone and this lack of perfusion lasts for some minutes after the injection [fr

Molecular characterization of two alkylresorcylic acid synthases from Sordariomycetes fungi

DEFF Research Database (Denmark)

Ramakrishnan, Dhivya; Tiwari, Manish Kumar; Manoharan, Gomathi

2018-01-01

Two putative type III polyketide synthase genes (PKS) were identified from Sordariomycetes fungi. These two type III PKS genes from Sordaria macrospora (SmPKS) and Chaetomium thermophilum (CtPKS), shared 59.8% sequence identity. Both, full-length and truncated versions of type III PKSs were...

Fused 1,2,3-Dithiazoles: Convenient Synthesis, Structural Characterization, and Electrochemical Properties

Directory of Open Access Journals (Sweden)

Lidia S. Konstantinova

2016-05-01

Full Text Available A new general protocol for synthesis of fused 1,2,3-dithiazoles by the reaction of cyclic oximes with S2Cl2 and pyridine in acetonitrile has been developed. The target 1,2,3-dithiazoles fused with various carbocycles, such as indene, naphthalenone, cyclohexadienone, cyclopentadiene, and benzoannulene, were selectively obtained in low to high yields. In most cases, the hetero ring-closure was accompanied by chlorination of the carbocyclic moieties. With naphthalenone derivatives, a novel dithiazole rearrangement (15→13 featuring unexpected movement of the dithiazole ring from α- to β-position, with respect to keto group, was discovered. Molecular structure of 4-chloro-5H-naphtho[1,2-d][1,2,3]dithiazol-5-one 13 was confirmed by single-crystal X-ray diffraction. Electrochemical properties of 13 were studied by cyclic voltammetry and a complex behavior was observed, most likely including hydrodechlorination at a low potential.

Kinetic modelling of [123I]CNS 1261--a potential SPET tracer for the NMDA receptor

International Nuclear Information System (INIS)

Erlandsson, Kjell; Bressan, Rodrigo A.; Mulligan, Rachel S.; Gunn, Roger N; Cunningham, Vincent J.; Owens, Jonathan; Wyper, David; Ell, Peter J.; Pilowsky, Lyn S.

2003-01-01

N-(1-napthyl)-N'-(3-[ 123 I]-iodophenyl)-N-methylguanidine ([ 123 I]CNS 1261) is a novel SPET ligand developed for imaging the NMDA receptor intra-channel MK 801/PCP/ketamine site. Data was acquired in 7 healthy volunteers after bolus injection of [ 123 I]CNS 1261. Kinetic modeling showed reversible tracer binding. Arterial and venous time-activity curves overlapped after 90 min. The rank order of binding was: Thalamus > striatum > cortical regions > white matter. This distribution concurs with [ 11 C]-ketamine and [ 18 F]-memantine PET studies . These data provide a methodological basis for further direct in vivo challenge studies