WorldWideScience

Sample records for pira creciendo silvestre

  1. FAUNA SILVESTRE

    Directory of Open Access Journals (Sweden)

    Luis Fernando Osorio, Director 5 Simp. For.

    2012-10-01

    Full Text Available Comité científico del simposio Director Luis Fernando Osorio Vélez, Ph.D. Universidad Nacional de Colombia, sede Medellín. Colombia. Fauna silvestre Brian C. Bock, Ph.D. Universidad de Antioquia. Colombia. Jaime Polanía Vorenberg, Ph.D. Universidad Nacional de Colombia. Colombia. Joan Gastón Zamora Abrego, Ph.D. Universidad Nacional de Colombia. Colombia. Néstor Javier Mancera Rodríguez, Ph.D. Universidad Nacional de Colombia. Colombia. Sergio Solari, Ph.D. Universidad de Antioquia. Colombia.

  2. Activities on PIRA Researches and its Applications in Korea

    International Nuclear Information System (INIS)

    Yoo, Kunjoong; Chae, Sungki; Choi, Youngsang; Roh, Myungsub

    1986-01-01

    Since 1979, activities on the developments of PIRA methodologies and procedures, and its application as well as the safety goal establishment have increased because of the important benefits which may be derived from the uses of PIRA. PIRA is used in many areas including safety evaluation, preparation of basis of standards, siting of nuclear facilities, operator training, energy technology comparison, design, safety improvement(backfitting), operating procedure changes, test and maintenance procedure development, safety goal establishment, and plant availability improvement. Especially, vendor countries are utilizing PIRA methods for parts of the safety demonstration for proposed power plants. In this connection, Korea began to take a interest in PIRA in 1979. Since then, basic methodologies and computer codes of PIRA have been introduced, modified, and applied to Korea nuclear power plants

  3. Aceite de frutos de Persea schiedeana en sobremaduración y cosechados de árboles en estado silvestre

    OpenAIRE

    Campos-Hernández, N; Cruz-Castillo, JG; Hernández-Montes, A; Rubio-Hernández, D

    2011-01-01

    En frutos sobremaduros de Persea schiedeana Nees colectados en árboles creciendo en estado silvestre se estudiaron las características químicas y sensoriales del aceite. La extracción de aceite con isopropanol y hexano tuvo un rendimiento de 12% aceite/pulpa (v/p). El aceite de P. schiedeana fue comparado con aceites comerciales de oliva y aguacate. El aceite de P. schiedeana tuvo menor número de insaturaciones y más ácidos grasos de cadena larga que los aceite de oliva y de aguacate. Los índ...

  4. Amendoins silvestres para uso ornamental.

    Directory of Open Access Journals (Sweden)

    Renato Ferraz de Arruda Veiga

    2003-06-01

    Full Text Available Algumas espécies silvestres de amendoim (Arachis spp. gênero Arachis L. (Fabaceae, vêm sendo utilizadas como forração em jardins no Brasil, porém todas com pouca variabilidade já que a distribuição do germoplasma é feita sempre pelos mesmos acessos4. Por outro lado, inúmeras coletas têm sido realizadas, particularmente pela Embrapa Recursos Genéticos e Biotecnologia (Cenargen, disponibilizando acessos até então inacessíveis à pesquisa científica. Em virtude dessa nova disponibilidade e igualmente de híbridos resultantes de pesquisas do Cenargen, organizou-se este trabalho. Foram objeto desta pesquisa cinco espécies: A. glabrata Benth., A. helodes Mart. ex Krapov.& Rigoni, A. pintoi‘Krapov.& W.C.Gregory, A. repens Handro e A. kempff-mercadoi Krapov.,W.C.Gregory & C.E.Simpson, e seis híbridos originados dos paternais: A. appressipila Krapov.&W.C.Gregory, A. paraguariensis Chodat & Hassl., A. pintoi, A. repens e A. vallsi Krapov.& W.C.Gregoryi. O experimento foi desenvolvido no período dos anos agrícolas de 1998 a 2000, na Fazenda Santa Elisa do Instituto Agronômico (IAC, em Campinas (SP, anotando-se o número de flores por planta, a velocidade de desenvolvimento, a capacidade de cobertura do solo, aspectos ornamentais como exuberância das flores e folíolos, coloração e, ainda, sanidade e vigor dos acessos. Os híbridos apresentaram um bom comportamento, porém com ciclo anual, ao passo que os acessos de Arachis kempffmercadoi, A.helodes, A. repens e A. glabrata mostraram-se mais recomendáveis para o uso em jardins por serem perenes. Todos os acessos ficam mais bonitos no verão em razão do período de floração e graças ao verde de sua massa foliar.

  5. Sexagem cirúrgica em aves silvestres

    Directory of Open Access Journals (Sweden)

    Raso T.F.

    2004-01-01

    Full Text Available Relata-se a utilização da laparoscopia na sexagem de 349 aves silvestres nacionais e exóticas, pertencentes a 61 espécies, de 11 famílias e seis ordens. Foram sexadas aves com idades entre quatro meses e 42 anos e peso corpóreo entre 55g e 3,4kg. Com essa técnica foi possível visualizar as gônadas, avaliar seu estágio de desenvolvimento e observar os órgãos adjacentes. A técnica cirúrgica utilizando endoscópio rígido para sexagem de aves silvestres foi considerada rápida e segura. Nenhum óbito foi verificado durante ou em conseqüência do procedimento cirúrgico.

  6. Bromeliaceae from Pico Piraí, Guaratuba Municipality (Parana, Brazil Bromeliaceae Juss. do Pico Piraí, município de Guaratuba (Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    Rosemeri Morokawa

    2011-12-01

    Full Text Available The results of a Bromeliaceae Juss. floristic survey in the Piraí Mountain, Araraquara complex(Guaratuba Municipality, Paraná State are presented. Twenty six species included in nine genera and three subfamilies were registered. Bromelioideae presented the highest genera diversity and Tillandsioideae showed the highest species diversity, including twelve species belonging to the genus Vriesea (46%. It was the first register of Nidularium procerum Lindm., Tillandsia stricta Sol. ex Ker Gawl., Vriesea altodaserrae L. B. Sm., Vriesea erythrodactylon (E. Morren E. Morren ex Mez, Vrieseaflava And.Costa, H. Luther & Wand., Vriesea friburgensis Mez, Vriesea hoehneana L. B. Sm., Vriesea inflata (Wawra Wawra e Wittrockia superba Lindm. at the Guaratuba Municipality. Dyckia leptostachya Baker was collected for the first time at the coastal zone of Paraná State, being this record done after 40 years since its last register in the State. For each species, information on phenology, geographic distribution and vulnerability level are included. Apresentam-se resultados de levantamento florístico das espécies de Bromeliaceae Juss. no Pico Piraí, Complexo do Araraquara (Guaratuba, Paraná. Verificou-se a ocorrência de 26 espécies pertencentes a nove gêneros e três subfamílias. Bromelioideae englobou a maior diversidade de gêneros e Tillandsioideae registrou-se a maior diversidade de espécies, sendo 12 delas incluídas no gênero Vriesea (46%. As seguintes espécies foram registradas pela primeira vez no município de Guaratuba: Nidularium procerum Lindm., Tillandsia stricta Sol. ex Ker Gawl., Vriesea altodaserrae L. B. Sm., Vriesea erythrodactylon (E. Morren E. Morren ex Mez, Vriesea flava And. Costa, H. Luther & Wand.,Vriesea friburgensis Mez, Vriesea hoehneana L. B. Sm., Vriesea inflata (Wawra Wawra e Wittrockia superba Lindm.. Dyckia leptostachya Baker foi registrada pela primeira vez na zona litorânea paranaense e após 40 anos do último

  7. Ectoparasitos de animais silvestres no Maranhão

    Directory of Open Access Journals (Sweden)

    Mayra A P Figueiredo

    2010-11-01

    Full Text Available Objetivou-se identificar os ectoparasitos de animais silvestres recepcionados pelo Centro de Triagem de Animais Silvestres, São Luís, Maranhão. Os ectopararasitos identificados foram: piolhos Acidoproctus sp., Trinoton sp., Ciconiphilus sp, Austromenopon sp., Quadraceps sp., Saemundssonia sp. e Trichodectes canis; carrapato Amblyomma rotundatum e Rhipicephalus sanguineus; pulgas Ctenocephalides felis e larvas de Cochliomyia hominivorax. Os resultados apresentados documentam a infestação de mamíferos, répteis e aves silvestres por ectoparasitos.

  8. Ranino ua uai: Palabra de cosecha de frutas silvestres

    Directory of Open Access Journals (Sweden)

    Hipolito Candre

    2016-01-01

    Full Text Available Este texto, transcrito de una narración del anciano Hipólito Candre, hace un inventario de los frutos silvestres que se encuentran en el monte y cómo eran aprovechados por las antiguas generaciones. También hace referencia a la colecta de miel silvestre, a la pesca con barbasco y trampas y la colecta de ranas comestibles en trampas. En las notas se da la identificación biológica de las especies mencionadas y se agrega información sobre sus épocas de fructificación y otras informaciones recogidas en el campo.

  9. A new detection method for the K variant of butyrylcholinesterase based on PCR primer introduced restriction analysis (PCR-PIRA).

    Science.gov (United States)

    Shibuta, K; Abe, M; Suzuki, T

    1994-01-01

    The K variant of human butyrylcholinesterase is caused by a G/A transition in the butyrylcholinesterase gene, which neither creates nor destroys any restriction site. In an attempt to detect the K variant both simply and rapidly, we developed a two step method of "PCR primer introduced restriction analysis" (PCR-PIRA). The first step was used to introduce a new Fun4HI site into the normal allele for a screening test, while the second step was performed to create a new MaeIII site on the variant allele for a specific test. This method thus enabled us to distinguish clearly the K variant from the normal allele, and also showed that the frequency of the K variant allele is 0.164 in the Japanese population. Images PMID:7966197

  10. The Pseudomonas aeruginosa pirA gene encodes a second receptor for ferrienterobactin and synthetic catecholate analogues.

    Science.gov (United States)

    Ghysels, Bart; Ochsner, Urs; Möllman, Ute; Heinisch, Lothar; Vasil, Michael; Cornelis, Pierre; Matthijs, Sandra

    2005-05-15

    Actively secreted iron chelating agents termed siderophores play an important role in the virulence and rhizosphere competence of fluorescent pseudomonads, including Pseudomonas aeruginosa which secretes a high affinity siderophore, pyoverdine, and the low affinity siderophore, pyochelin. Uptake of the iron-siderophore complexes is an active process that requires specific outer membrane located receptors, which are dependent of the inner membrane-associated protein TonB and two other inner membrane proteins, ExbB and ExbC. P. aeruginosa is also capable of using a remarkable variety of heterologous siderophores as sources of iron, apparently by expressing their cognate receptors. Illustrative of this feature are the 32 (of which 28 putative) siderophore receptor genes observed in the P. aeruginosa PAO1 genome. However, except for a few (pyoverdine, pyochelin, enterobactin), the vast majority of P. aeruginosa siderophore receptor genes still remain to be characterized. Ten synthetic iron chelators of catecholate type stimulated growth of a pyoverdine/pyochelin deficient P. aeruginosa PAO1 mutant under condition of severe iron limitation. Null mutants of the 32 putative TonB-dependent siderophore receptor encoding genes engineered in the same genetic background were screened for obvious deficiencies in uptake of the synthetic siderophores, but none showed decreased growth stimulation in the presence of the different siderophores. However, a double knock-out mutant of ferrienterobactin receptor encoding gene pfeA (PA 2688) and pirA (PA0931) failed to be stimulated by 4 of the tested synthetic catecholate siderophores whose chemical structures resemble enterobactin. Ferric-enterobactin also failed to stimulate growth of the double pfeA-pirA mutant although, like its synthetic analogues, it stimulated growth of the corresponding single mutants. Hence, we confirmed that pirA represents a second P. aeruginosa ferric-enterobactin receptor. The example of these two

  11. Identificación de parásitos gastrointestinales en aves silvestres en cautiverio

    OpenAIRE

    García Corredor, Diego José; Sánchez Parada, Oscar Javier; Pulido Medellín, Martin Orlando; Andrade Becerra, Roy José

    2013-01-01

    Este trabajo identifica los parásitos gastrointestinales que presentaron las aves silvestres en cautiverio, en el municipio de Tibasosa (Boyacá, Colombia). Se tomaron 100 muestras de materia fecal de aves silvestres correspondientes a 11 familias (Psittacidae, Ramphastidae, Ophistocomidae, Cracidae, Anatidae, Icteridae, Alaudidae, Burhinidae, Phoenicopteridae, Anhimidae y Rallidae) y 16 especies (Ara ararauna, Ara macao, Amazona spp, Amazona ochrocephala, Ramphastos toco,...

  12. Structure and Function of the PiuA and PirA Siderophore-Drug Receptors from Pseudomonas aeruginosa and Acinetobacter baumannii.

    Science.gov (United States)

    Moynié, Lucile; Luscher, Alexandre; Rolo, Dora; Pletzer, Daniel; Tortajada, Antoni; Weingart, Helge; Braun, Yvonne; Page, Malcolm G P; Naismith, James H; Köhler, Thilo

    2017-04-01

    The outer membrane of Gram-negative bacteria presents an efficient barrier to the permeation of antimicrobial molecules. One strategy pursued to circumvent this obstacle is to hijack transport systems for essential nutrients, such as iron. BAL30072 and MC-1 are two monobactams conjugated to a dihydroxypyridone siderophore that are active against Pseudomonas aeruginosa and Acinetobacter baumannii Here, we investigated the mechanism of action of these molecules in A. baumannii We identified two novel TonB-dependent receptors, termed Ab -PiuA and Ab -PirA, that are required for the antimicrobial activity of both agents. Deletion of either piuA or pirA in A. baumannii resulted in 4- to 8-fold-decreased susceptibility, while their overexpression in the heterologous host P. aeruginosa increased susceptibility to the two siderophore-drug conjugates by 4- to 32-fold. The crystal structures of PiuA and PirA from A. baumannii and their orthologues from P. aeruginosa were determined. The structures revealed similar architectures; however, structural differences between PirA and PiuA point to potential differences between their cognate siderophore ligands. Spontaneous mutants, selected upon exposure to BAL30072, harbored frameshift mutations in either the ExbD3 or the TonB3 protein of A. baumannii , forming the cytoplasmic-membrane complex providing the energy for the siderophore translocation process. The results of this study provide insight for the rational design of novel siderophore-drug conjugates against problematic Gram-negative pathogens. Copyright © 2017 American Society for Microbiology.

  13. COMERCIO DE FAUNA SILVESTRE EN COLOMBIA WILDLIFE TRADE IN COLOMBIA

    Directory of Open Access Journals (Sweden)

    Néstor Javier Mancera Rodríguez

    2008-12-01

    Full Text Available Este trabajo ofrece un panorama sobre las actividades relacionadas con el comercio de bienes derivados de las especies de fauna silvestre en Colombia, abordando el tema desde el desarrollo que ha tenido su actividad productiva, el aprovechamiento extractivo, así como la dinámica de su comercio legal e ilegal en el país y el desarrollo y promoción de alternativas productivas sustentadas en su aprovechamiento. Se analizó la información secundaria de entidades como el Ministerio de Ambiente, Vivienda y Desarrollo Territorial, las Corporaciones Autónomas Regionales y Autoridades Ambientales Urbanas, el Instituto Colombiano de Desarrollo Rural-INCODER, las Autoridades Policiales, los Institutos de Investigación, el Departamento Administrativo Nacional de Estadística, la Dirección de Impuestos y Aduanas Nacionales-DIAN, el Ministerio de Comercio, Industria y Turismo, y PROEXPORT. entre otras. En Colombia, el comercio de especies de fauna silvestre está centrado principalmente en la extracción de ejemplares de forma ilegal, lo cual ha generado desequilibrios en las poblaciones naturales y ha repercutido en el deterioro de la dinámica de los ecosistemas. El comercio legal de fauna silvestre se basa en la producción de unas pocas especies entre las que se destacan la babilla (Caiman crocodilus, el chigüiro (Hydrochaeris hydrochaeris, cerca de 200 especies de peces ornamentales y en menor medida el lobo pollero (Tupinambis nigropunctatus, la iguana (Iguana iguana, la boa (Boa constrictor, escarabajos (Dynastes hercules y mariposas. En el país no se tiene información exacta sobre el número de incautaciones realizadas en los operativos de control al tráfico ilegal de fauna, y no existe un conocimiento de la dinámica de este comercio ilegal.This work offers a current view on the activities related to the trade of derived from the wildlife species in Colombia, approaching the topic from the development that has had its productive activity

  14. FLUJO DE GENES ENTRE FRIJOL COMÚN Y SILVESTRE EN COSTA RICA

    Directory of Open Access Journals (Sweden)

    N\\u00E9stor Chaves-Barrantes

    2009-01-01

    Full Text Available Con el objetivo de analizar el flujo de genes entre frijol común silvestre y cultivado, se determinó el porcentaje de alogamia en condiciones naturales de crecimie nto del frijol silvestre y en estación experimental. En el 2004 se evaluó el cruzamie nto natural entre frijol silvestre mexicano G23511A (Phaseolus vulgaris L. y la línea blanca PAN 68, en la Estación Experimental Fabio Baudrit de la Universidad de Costa Ri ca en Alajuela. Para ello se sembraron dos parcelas experimentales; cada una constó de dos bloques de PAN 68 de 10 surcos (15 m de largo y espacia dos 0,6 m. Entre los bloques y en el borde superior de los mismos, se sembraron tres surcos de frijol silvestre como donantes de polen. Se numeraron las hileras y las plantas de cada una en los bloques de frijol blanco. En Quircot de Ca rtago (área donde crece en forma natural P. vulgaris silvestre, en el 2005 y 2006, se sembraron plantas de frijol comercia l (Vainica de Palo a lo largo de seis sitios junto a las poblaciones de frijol silvestre. En ambas localidades la floración de silvestres y comerciales fue coincidente. Se cosechó toda la semilla de los ensayos y se germinó en bandejas, determinando el porcentaje de alogamia por medio del color morado del hip ocotilo, indicativo de aquellas plántulas cruzadas. En Alajuela el porcentaje de cruza varió entre 0,007 y 0,028 %; mie ntras que en Quircot, entre 0 y 0,199 %.

  15. Guía para restricción física de fauna silvestre

    OpenAIRE

    Torres-Chaparro, María Yanneth; Quintero-Sánchez, Vladimir

    2016-01-01

    Esta guía presenta los protocolos y actividades que deben realizarse durante la manipulación de fauna silvestre en los Centros de Atención y Valoración (CAV). Como bien es sabido, el tráfico de fauna silvestre es una actividad ilícita que trae consigo unos problemas profundos de pérdida de biodiversidad. Dentro de las estrategias de control de tráfico de fauna se realizan actividades de control y monitoreo, presentándose situaciones en las cuales un gran número de animales son rescatados, dec...

  16. PRESENCIA DEL VIRUS DE INFLUENZA AVIAR EN AVES SILVESTRES DE LOS HUMEDALES DE PUERTO VIEJO, LIMA

    OpenAIRE

    Segovia H., Karen; Icochea D., Eliana; González V., Rosa; Ghersi, Bruno; González Z., Armando

    2013-01-01

    El objetivo del estudio fue determinar la presencia del virus de influenza aviar (IA) en aves silvestres presentes en los Humedales de Puerto Viejo, en el departamento de Lima. Novecientas muestras de heces frescas de 18 especies de aves silvestres fueron colectadas desde abril de 2008 hasta febrero de 2009. Dichas muestras se analizaron mediante aislamiento viral en huevos embrionados de pollo SPF. Se logró aislar siete cepas de virus de IA de baja patogenicidad del subtipo H12N5 (seis cepas...

  17. Estimativas de parâmetros populacionais e demográficos de Ozotoceros bezoarticus (Artiodactyla, Cervidae) em Piraí do Sul, Paraná, sul do Brasil Estimates of population and demographic parameters of Ozotoceros bezoarticus (Artiodactyla, Cervidae) in Piraí do Sul, Paraná, southern Brazil

    OpenAIRE

    Fernanda G. Braga; Yoshiko S. Kuniyoshi

    2010-01-01

    Este estudo foi realizado em duas propriedades particulares, situadas no município de Piraí do Sul, sul do Brasil. Foram realizadas 16 fases de campo mensais, com três dias de duração, no período compreendido entre fevereiro de 2001 e maio de 2002, com o objetivo de obter informações sobre a biologia do veado-campeiro (Ozotoceros bezoarticus Linnaeus, 1758) e identificar os principais fatores de impacto sobre o mesmo. Foram computadas 1.065 observações, estimando-se 71,45 indivíduos na popula...

  18. IMPACTOS DE LAS CARRETERAS SOBRE LA FAUNA SILVESTRE Y SUS PRINCIPALES MEDIDAS DE MANEJO

    Directory of Open Access Journals (Sweden)

    María del Pilar Arroyave

    Full Text Available El objetivo de este artículo es presentar el impacto de los proyectos viales sobre la fauna silvestre y evaluar las medidas de manejo de estos efectos. Se revisó y analizó la información de diversos estudios realizados en el mundo, al igual que algunos estudios de impacto ambiental de carreteras que se han desarrollado en Antioquia. Se encontró que los principales impactos son el atropellamiento, el aislamiento de poblaciones y el cambio en los patrones reproductivos de la fauna; esto trae como consecuencia la disminución de las poblaciones de especies de fauna silvestre. También se plantean las estrategias comúnmente implementadas para el manejo de los impactos.

  19. [Reseñas Bibliográficas] Atlas de la flora vascular silvestre de Burgos

    Directory of Open Access Journals (Sweden)

    Iñaki Aizpuru

    2005-01-01

    Full Text Available Es una reseña bibliográfica de la obra, Atlas de la flora vascular silvestre de Burgos / Alejandre Sáenz, J.M. García-López, L. Marín Padellano, G. Mateo Sanz, E. Miguélez del coso, C. Molina Martín, G. Montamarta Prieto, S. Patino Sánchez, M.A. Pinto Cebrián 6 J. Valencia Janices.

  20. Feasibility and impact of Creciendo Sanos, a clinic-based pilot intervention to prevent obesity among preschool children in Mexico City.

    Science.gov (United States)

    Martínez-Andrade, Gloria Oliva; Cespedes, Elizabeth M; Rifas-Shiman, Sheryl L; Romero-Quechol, Guillermina; González-Unzaga, Marco Aurelio; Benítez-Trejo, María Amalia; Flores-Huerta, Samuel; Horan, Chrissy; Haines, Jess; Taveras, Elsie M; Pérez-Cuevas, Ricardo; Gillman, Matthew W

    2014-03-20

    Mexico has the highest adult overweight and obesity prevalence in the Americas; 23.8% of children obese. Creciendo Sanos was a pilot intervention to prevent obesity among preschoolers in Instituto Mexicano del Seguro Social (IMSS) clinics. We randomized 4 IMSS primary care clinics to either 6 weekly educational sessions promoting healthful nutrition and physical activity or usual care. We recruited 306 parent-child pairs: 168 intervention, 138 usual care. Children were 2-5 years old with WHO body mass index (BMI) z-score 0-3. We measured children's height and weight and parents reported children's diet and physical activity at baseline and 3 and 6-month follow-up. We analyzed behavioral and BMI outcomes with generalized mixed models incorporating multiple imputation for missing values. 93 (55%) intervention and 96 (70%) usual care families completed 3 and 6-month follow-up. At 3 months, intervention v. usual care children increased vegetables by 6.3 servings/week (95% CI, 1.8, 10.8). In stratified analyses, intervention participants with high program adherence (5-6 sessions) decreased snacks and screen time and increased vegetables v. usual care. No further effects on behavioral outcomes or BMI were observed. Transportation time and expenses were barriers to adherence. 90% of parents who completed the post-intervention survey were satisfied with the program. Although satisfaction was high among participants, barriers to participation and retention included transportation cost and time. In intention to treat analyses, we found intervention effects on vegetable intake, but not other behaviors or BMI. ClinicalTrials.gov NCT01539070.Comisión Nacional de Investigación Científica del IMSS: 2009-785-120.

  1. Evaluación del riesgo de las carreteras nacionales para la fauna silvestre y el uso de ciencia ciudadana como herramienta para el monitoreo de fauna silvestre atropellada en Costa Rica

    OpenAIRE

    Gutiérrez Sanabria, Diego R.

    2017-01-01

    Evalua el riesgo de las carreteras nacionales para la fauna silvestre y el uso de ciencia ciudadana como herramienta para el monitoreo de fauna silvestre atropellada en Costa Rica. A partir de ahí se desarrolló y evaluó el uso de una aplicación informática en una plataforma web ya existente, para ser usado por cualquier smartphone, lo cual, representa una propuesta innovadora y por último, se usaron datos provenientes de esta aplicación, con una de las especies que más registros de atropellos...

  2. ESTUDIO EPIDEMIOLÓGICO DEL CONEJO SILVESTRE Sylvilagus brasiliensis EN EL PARQUE NACIONAL NATURAL LOS NEVADOS

    OpenAIRE

    Insuasty Osorio, Julián Alejandro; Ramírez Benavides, Ginés Fernando; Mejía Morales, Luis Miguel

    2008-01-01

    Este estudio epidemiológico se realizó con el objeto de identificar los agentes etiológicos responsables de las afecciones presentes en las poblaciones de conejo silvestre Sylvilagus brasiliensis, en la zona amortiguadora del Parque Nacional Natural Los Nevados. Con un enfoque en Medicina de la Conservación, bajo el concepto "Triada Ecológica de la Enfermedad" y por medio del análisis multivariado "Análisis Factorial de Correspondencias Múltiples" con el programa "SPAD-WIN"; se determinó y an...

  3. DIAGNÓSTICO JURÍDICO SOBRE EL DECOMISO Y MANEJO POSTDECOMISO DE FAUNA SILVESTRE EN EL DEPARTAMENTO DEL CHOCÓ

    OpenAIRE

    Lisneider Hinestroza Cuesta; Marisela Mena Valencia; Kelly Johana Palacios Sánchez

    2011-01-01

    En este artículo se presenta un estudio de carácter descriptivo sobre los decomisos y el manejo postdecomiso de fauna silvestre en el departamento del Chocó utilizado como corredor para el tráfico y comercialización ilegal; se analizan, a partir del marco jurídico colombiano, la definición de fauna silvestre, decomiso y sus consecuencias jurídicas. Entre el 2005 y marzo del 2011 se realizaron en el Chocó 904 decomisos: 316 aves, 321 reptiles y 264 de mamíferos, 1 anfibio, 1 arácnido y 1 pez. ...

  4. Plasticidad fenotípica de poblaciones de chile silvestre (Capsicum annuum var. glabriusculum) en respuesta a disponibilidad de luz

    OpenAIRE

    Hernández-Verdugo, Sergio; González-Sánchez, Ramón A.; Porras, Flor; Parra-Terraza, Saúl; Valdez-Ortiz, Angel; Pacheco-Olvera, Antonio; López-España, Ricardo Guillermo

    2015-01-01

    La plasticidad fenotípica permite a las plantas lidiar con ambientes heterogéneos. Capsicum annuum silvestre es un valioso recurso genético que habita en sitios que difieren en la disponibilidad de luz. Evaluamos la variación genética entre poblaciones, la plasticidad fenotípica y su variación en respuesta a tres niveles de luz (alto, 100%; medio, 50%; y bajo, 25% de luz solar) de cinco poblaciones de Capsicum annuum silvestre del noroeste de México. Las características medidas fueron: altura...

  5. Genotyping of friesian horses to detect a hydrocephalus-associated c.1423C>T mutation in B3GALNT2 using PCR-RFLP and PCR-PIRA methods: Frequency in stallion horses in México.

    Science.gov (United States)

    Ayala-Valdovinos, Miguel Angel; Galindo-García, Jorge; Sánchez-Chiprés, David; Duifhuis-Rivera, Theodor

    2017-04-01

    Hydrocephalus in Friesian horses is an autosomal recessive hereditary disease that can result in an abortion, a stillbirth, or euthanization of a newborn foal. Here, the hydrocephalus-associated c.1423C > T mutation in B3GALNT2 gene was detected with PCR-RFLP and PCR-PIRA methods for horse genotyping. A preliminary genotyping survey was performed on 83 randomly selected Friesian stallion horses to determine the current allele frequency in Mexico. The frequency of the mutant T allele was 9.6%. Copyright © 2016 Elsevier Ltd. All rights reserved.

  6. Estimativas de parâmetros populacionais e demográficos de Ozotoceros bezoarticus (Artiodactyla, Cervidae) em Piraí do Sul, Paraná, sul do Brasil

    OpenAIRE

    Braga,Fernanda G.; Kuniyoshi,Yoshiko S.

    2010-01-01

    Este estudo foi realizado em duas propriedades particulares, situadas no município de Piraí do Sul, sul do Brasil. Foram realizadas 16 fases de campo mensais, com três dias de duração, no período compreendido entre fevereiro de 2001 e maio de 2002, com o objetivo de obter informações sobre a biologia do veado-campeiro (Ozotoceros bezoarticus Linnaeus, 1758) e identificar os principais fatores de impacto sobre o mesmo. Foram computadas 1.065 observações, estimando-se 71,45 indivíduos na popula...

  7. A tutela da fauna silvestre como efetivação do direito fundamental ao meio ambiente

    Directory of Open Access Journals (Sweden)

    Emerson Bortolozi

    2018-03-01

    Full Text Available Esta pesquisa tem por objeto a análise da efetivação do direito fundamental ao meio ambiente sob a ótica da tutela à fauna silvestre, com base na Constituição Federal e em normas infraconstitucionais. Como se sabe, a Constituição de 1988 é um marco importantíssimo na evolução da defesa jurídica do meio ambiente, tendo desencadeado o surgimento de uma ampla legislação voltada à defesa de valores ambientais e, particularmente, da fauna silvestre. A partir da ótica constitucional e da legislação de proteção à fauna silvestre, como a Lei que cria Política Nacional do Meio Ambiente, a Lei que cria o Sistema Nacional de Unidades de Conservação – SNUC, a Lei de Uso Científico de Animais, a Lei de Rodeios e, em especial, a Lei de Proteção à Fauna, que foi recepcionada pela Constituição, é que se compõe o arsenal de ferramentas jurídicas que realizam a efetivação do direito fundamental ao meio ambiente animal. Por meio desse exame, identifica-se que a tutela da fauna silvestre acaba significando forma de efetivação do direito fundamental ao Meio Ambiente

  8. Bravo, Silvestre!

    Science.gov (United States)

    Kline, Harriet

    1971-01-01

    Discussion of a successful Federally funded program designed to teach English to Mexican-Americans in Edinburg, Texas. The author credited this success to the multi-media approach of teaching languages. (AF)

  9. L1014F-kdr Mutation in Indian Anopheles subpictus (Diptera: Culicidae) Arising From Two Alternative Transversions in the Voltage-Gated Sodium Channel and a Single PIRA-PCR for Their Detection.

    Science.gov (United States)

    Singh, O P; Dykes, C L; Sharma, G; Das, M K

    2015-01-01

    Leucine-to-phenylalanine substitution at residue L1014 in the voltage-gated sodium channel, target site of action for dichlorodiphenyltrichloroethane (DDT) and pyrethroids, is the most common knockdown resistance (kdr) mutation reported in several insects conferring resistance against DDT and pyrethroids. Here, we report presence of two coexisting alternative transversions, A>T and A>C, on the third codon position of L1014 residue in malaria vector Anopheles subpictus Grassi (species A) from Jamshedpur (India), both leading to the same amino acid substitution of Leu-to-Phe with allelic frequencies of 19 and 67%, respectively. A single primer-introduced restriction analysis-polymerase chain reaction (PIRA-PCR) was devised for the identification of L1014F-kdr mutation in An. subpictus resulting from either type of point mutation. Genotyping of samples with PIRA-PCR revealed high frequency (82%) of L1014F-kdr mutation in the study area. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  10. Orientalismos peninsulares en el levante andaluz. Nombres y usos de algunas plantas silvestres

    Directory of Open Access Journals (Sweden)

    Torres Montes, Francisco

    2000-06-01

    Full Text Available The author describes sorne wild plants from the provinces of Almería, Granada and Jaén (Andalusia, Spain that have folk names from Eastern Iberia. For each plant he provides the scientific and folk name, the isoglottic line and the lexical arca. He also informs about the use of these plants in folk and household medecine, religious rites, animal husbandry, etc.En este estudio se presentan algunas plantas silvestres de Almería, Granada y Jaén cuyos nombres vulgares proceden del oriente peninsular. De cada planta se da, junto al nombre vulgar y científico, la isoglosa o límite de los orientalismos y sus correspondientes áreas léxicas. Al mismo tiempo se hace el estudio etnográfico de sus usos en la medicina popular o doméstica, ritos religiosos, ganadería, etc.

  11. Estimativas de parâmetros populacionais e demográficos de Ozotoceros bezoarticus (Artiodactyla, Cervidae em Piraí do Sul, Paraná, sul do Brasil Estimates of population and demographic parameters of Ozotoceros bezoarticus (Artiodactyla, Cervidae in Piraí do Sul, Paraná, southern Brazil

    Directory of Open Access Journals (Sweden)

    Fernanda G. Braga

    2010-06-01

    Full Text Available Este estudo foi realizado em duas propriedades particulares, situadas no município de Piraí do Sul, sul do Brasil. Foram realizadas 16 fases de campo mensais, com três dias de duração, no período compreendido entre fevereiro de 2001 e maio de 2002, com o objetivo de obter informações sobre a biologia do veado-campeiro (Ozotoceros bezoarticus Linnaeus, 1758 e identificar os principais fatores de impacto sobre o mesmo. Foram computadas 1.065 observações, estimando-se 71,45 indivíduos na população, sendo o tamanho médio dos grupos de 2,29 (DV ± 0,55, e a razão sexual de 0,83. Indivíduos isolados corresponderam a 40% das observações, sendo o maior grupo composto por 10 indivíduos. Registrou-se um pico de nascimentos entre setembro e novembro, embora esses tenham acontecido ao longo de todo o estudo. Foram registrados 34 óbitos, correspondendo a uma mortalidade de 47,6%, sendo as principais causas a predação por Puma concolor (Linnaeus, 1771, a caça e os atropelamentos. A população estudada encontra-se severamente ameaçada, e não sobreviverá por muito tempo a menos que políticas que garantam a sua conservação sejam adotadas. Estas políticas devem incluir o manejo adequado das áreas e o controle dos vetores de pressão.This study was conducted in two private properties in the municipality of Piraí do Sul (Paraná state, southern Brazil. Sixteen monthly visits were made each one lasting three days between February 2001 and May 2002. The study aimed at the observation of pampas deer biology (Ozotoceros bezoarticus Linnaeus, 1758, and the evaluation of main impacts to this population. We computed 1,065 observations of estimated 71.45 individuals. The average size of the groups was 2.29 (SD ± 0.55 animals, and the sexual ratio was 0.83. Isolated deer accounted for 40% of the observations, whereas the largest group comprised 10 individuals. It was recorded a peack period of births between September and November, although

  12. Febre amarela silvestre: reemergencia de transmissao no estado de Sao Paulo, Brasil, 2009

    Directory of Open Access Journals (Sweden)

    Melissa Mascheretti

    2013-10-01

    Full Text Available OBJETIVO Descrever a investigação do surto de febre amarela silvestre e as principais medidas de controle realizadas no estado de São Paulo. MÉTODOS Estudo descritivo do surto de febre amarela silvestre na região sudoeste do estado, entre fevereiro e abril de 2009. Foram avaliados casos suspeitos e confirmados em humanos e primatas não humanos. A investigação entomológica, em ambiente silvestre, envolveu captura em solo e copa de árvore para identificação das espécies e detecção de infecção natural. Foram realizadas ações de controle de Aedes aegypti em áreas urbanas. A vacinação foi direcionada para residentes dos municípios com confirmação de circulação viral e nos municípios contíguos, conforme recomendação nacional. RESULTADOS Foram confirmados 28 casos humanos (letalidade 39,3% em áreas rurais de Sarutaiá, Piraju, Tejupá, Avaré e Buri. Foram notificadas 56 mortes de primatas não humanos, 91,4% do gênero Alouatta sp . A epizootia foi confirmada laboratorialmente em dois primatas não humanos, sendo um em Buri e outro em Itapetininga. Foram coletados 1.782 mosquitos, entre eles Haemagogus leucocelaenus , Hg. janthinomys/capricornii , Sabethes chloropterus , Sa. purpureus e Sa. undosus . O vírus da febre amarela foi isolado de um lote de Hg. leucocelaenus procedente de Buri. A vacinação foi realizada em 49 municípios, com 1.018.705 doses aplicadas e o registro de nove eventos adversos graves pós-vacinação. CONCLUSÕES Os casos humanos ocorreram entre fevereiro e abril de 2009 em áreas sem registro de circulação do vírus da febre amarela há mais de 60 anos. A região encontrava-se fora da área com recomendação de vacinação, com alto percentual da população suscetível. A adoção oportuna de medidas de controle permitiu a interrupção da transmissão humana em um mês, assim como a confirmação da circulação viral em humanos, primatas não humanos e mosquitos. Os isolamentos

  13. Frutos tropicais silvestres e polpas de frutas congeladas: atividade antioxidante, polifenóis e antocianinas

    Directory of Open Access Journals (Sweden)

    Kuskoski Eugenia Marta

    2006-01-01

    Full Text Available Os sucos de frutas tropicais conquistam cada vez mais o mercado consumidor, sendo o Brasil um dos principais produtores. Existe grande diversidade de produtos derivados de frutos e constante inserção de novos produtos no mercado de consumo, os quais, na maioria das vezes, ainda não foram devidamente pesquisados com respeito às suas propriedades e atividades benéficas à saúde. Neste trabalho, objetiva-se determinar algumas propriedades de frutos tropicais silvestres in natura e polpas de frutos comercializados congelados. Para determinar a atividade antioxidante, utilizou-se o método do radical 2,2-difeniL-1-picrilhidrazilo (DPPH.; para determinar os polifenóis totais, o método de Folin-Ciocalteu e, para as antocianinas, o método da diferença de pH. As polpas de frutas analisadas foram de amora, uva, açaí, goiaba, morango, acerola, abacaxi, manga, graviola, cupuaçu e maracujá; e os frutos silvestres, jambolão e baguaçu. Representada em TEAC (atividade antioxidante equivalente a Trolox, a atividade antioxidante global das polpas oscila entre mínimos e máximos 0,5 e 53,2mimol g-1, enquanto que, representada em VCEAC (atividade antioxidante equivalente a vitamina C, entre mínimos e máximos de 64,8 e 1198,9mg100g-1. Para os extratos de polpa dos frutos in natura, a atividade antioxidante oscila entre 13,3 e 111,2mimol g-1 (TEAC e entre 42,8 e 2533,1mg 100g-1 (VCEAC. Em ordem decrescente de capacidade antioxidante, encontra-se: acerola> manga> morango> uva> açaí> goiaba> amora> graviola> maracujá> cupuaçu> abacaxi. Os frutos de baguaçu apresentam maior atividade antioxidante que os de jambolão.

  14. Parasitos de aves e mamíferos silvestres em cativeiro no estado de Pernambuco

    Directory of Open Access Journals (Sweden)

    Pauline Marie de Souza Santos

    2015-09-01

    Full Text Available Resumo: Os animais silvestres são hospedeiros de uma grande variedade de parasitos que podem interferir em sua conservação ex situ. O objetivo deste estudo foi identificar os parasitos gastrointestinais (PGI e ectoparasitos dos animais do Centro de Triagem de Animais Silvestres (CETAS do Instituto Brasileiro de Meio Ambiente e Recursos Naturais Renováveis (IBAMA de Recife, Pernambuco, além de determinar os aspectos do manejo em cativeiro que possam estar relacionados com os parasitos identificados. Foram coletados ectoparasitos e amostras fecais de 223 aves e mamíferos, as quais foram processadas pelos métodos: microscopia direta, flutuação e sedimentação. Helmintos e/ou protozoários foram detectados em 91 (40,8% amostras fecais, sendo 64 (70,3% de aves e 27 (29,7% de mamíferos. Ovos de Capillaria sp., Ascaridida, Spirurida e oocistos de Eimeria sp. foram detectados nas amostras fecais das aves, enquanto ovos de Trichuris trichiura, Strongyloides sp., Toxocara canis, Ancylostoma sp., Strongylida e oocistos de Coccídios foram encontrados nas amostras fecais de mamíferos. Os ectoparasitos identificados em aves foram Colpocephalum turbinatum, Kurodaia (Kurodaia fulvofasciata, Halipeurus sp., Naubates sp., Saemundssonia sp., Austromenopon sp., Paragoniocotes sp., Brueelia sp., Myrsidea sp. and Pseudolynchia sp., enquanto em mamíferos os ectoparasitos identificados foram Rhipicephalus sanguineus, Amblyomma varium, A. calcaratum, A. nodosum, Ornithodoros talaje e Ctenocephalides felis felis. A. calcaratum e O. talaje são registrados pela primeira vez em Pernambuco e T. tetradactyla é apresentado como novo hospedeiro de O. talaje. Nenhum dos animais estudados apresentou sinais clínicos em decorrência da infecção/infestação parasitária. Parasitos com potencial zoonótico como T. trichiura, Strongyloides sp., T. canis e Ancylostoma sp. foram identificados em primatas não humanos e carnívoros. Precárias condições estruturais

  15. Caracterización morfológica de accesiones silvestres de guayaba

    Directory of Open Access Journals (Sweden)

    Liliana Jiménez Lozano

    2009-04-01

    Full Text Available Se realizó la caracterización morfológica de 22 accesiones silvestres de guayaba Psidium guajava L. 14 colectadas en el municipio de Restrepo (Valle del Cauca, seis en Armenia (Quindío y dos en Pereira (Risaralda. Se utilizaron 12 descriptores cuantitativos y 10 cualitativos de tallo, hojas y frutos; el análisis de agrupamiento se hizo mediante el coeficiente de Dice-Nei-Li y el promedio aritmético no ponderado (UPGMA. La mayor variabilidad se halló en los descriptores peso de la pulpa (CV = 55.92%, peso (CV = 45.23%, y acidez del fruto (CV = 44.75%. El análisis de agrupamientos con base en caracteres cuantitativos permitió establecer cuatro grupos: las accesiones del grupo A (Armenia, presentaron valores promedio de los descriptores de la calidad del fruto (grados Brix, acidez del fruto y relación grados Brix/acidez y valores altos de contenido de pulpa. La mayoría de accesiones del grupo C (Restrepo tuvieron altos valores de calidad del fruto y bajo contenido de pulpa. El grupo B, constituido por accesiones de Armenia y Pereira, se diferenció por valores bajos en los descriptores de rendimiento del fruto (peso del fruto, de la pulpa y diámetro de la cavidad seminal. Las accesiones del grupo D (Restrepo mostraron valores promedios en calidad y rendimiento del fruto. Los descriptores cuantitativos se reunieron en tres variables sintéticas para rendimiento y calidad del fruto que representaron 76.86% de la variabilidad total.

  16. Psychromicrobium silvestre gen. nov., sp. nov., an actinobacterium isolated from alpine forest soils.

    Science.gov (United States)

    Schumann, Peter; Zhang, De-Chao; França, Luís; Albuquerque, Luciana; da Costa, Milton S; Margesin, Rosa

    2017-03-01

    Two Gram-stain-variable, non-motile, catalase-positive and cytochrome c oxidase-negative bacteria, designated AK20-18 T and AM20-54, were isolated from forest soil samples collected in the Italian Alps. Growth occurred at a temperature range of 5-30 °C, at pH 6-9 and in the presence of 0-5 % (w/v) NaCl. The 16S rRNA gene sequence similarity between strains AK20-18 T and AM20-54 was 100 %. Phylogenetic analysis based on 16S rRNA gene sequence showed that strain AK20-18 T had highest 16S rRNA gene sequence similarity with the type strain of Arthrobacter psychrochitiniphilus (96.9 %). The cell-wall peptidoglycan structure of strain AK20-18 T was of the type A3alpha l-Lys-l-Thr-l-Ala2 (A11.27). The whole-cell sugars were galactose, ribose and lesser amounts of mannose. The major respiratory quinone of the two strains was menaquinone 9(H2) [MK-9(H2)], whereas MK-10(H2) was a minor component. The polar lipids were diphosphatidylglycerol, phosphatidylglycerol, phosphatidylinositol and unknown glycolipids. The major cellular fatty acids were anteiso-C15 : 0, iso-C15 : 0, iso-C16 : 0 and anteiso-C17 : 0. The genomic DNA G+C content was 59.9 mol%. Combined data of phylogenetic, phenotypic and chemotaxonomic analyses demonstrated that strains AK20-18 T and AM20-54 represent a novel genus and species, for which the name Psychromicrobium silvestre gen. nov., sp. nov. is proposed. The type strain of Psychromicrobium silvestregen. nov., sp. nov. is AK20-18 T (=DSM 102047 T =LMG 29369 T ).

  17. Augusto Boal en la educación social: del teatro del oprimido al psicodrama silvestre

    Directory of Open Access Journals (Sweden)

    Manuel F. Vieites García

    2015-02-01

    Full Text Available La obra de Augusto Boal Teatro del Oprimido se suele situar entre las aportaciones más transcendentales del teatro del siglo XX, en tanto sus dictados teóricos y sus propuestas metodológicas y prácticas han calado en ámbitos de la educación social y teatral relacionados con el desarrollo de la democracia cultural. Pasados cuarenta años desde sus primeras experiencias, en este trabajo se propone una genealogía del teatro del oprimido a partir de una lectura crítica de sus textos fundacionales y de alguna experiencia considerada paradigmática en su desarrollo, para mostrar su naturaleza, aportes, fortalezas y debilidades. Igualmente se muestra el tránsito entre una dimensión más educativa y teatral y otra más centrada en la terapia y el desarrollo personal, para concluir que las técnicas y recursos empleados en teatro del oprimido, que proceden de fuentes muy diversas, siguen teniendo potencialidades indudables en propuestas de intervención social, cultural y educativa propias de la pedagogía teatral y la pedagogía social.Cómo referenciar este artículoVieites García, M. F. (2015. Augusto Boal en la educación social: del teatro del oprimido al psicodrama silvestre. Foro de Educación, 13(18, pp. 161-179. doi: http://dx.doi.org/10.14516/fde.2015.013.018.009 

  18. Aspectos ecológicos y distribución de Tropaeolum tuberosum ssp. silvestre (Tropaeolaceae en Argentina

    Directory of Open Access Journals (Sweden)

    Eva Bulacio

    2012-06-01

    Full Text Available Tropaeolum tuberosum Ruiz et Pav. ssp. silvestre Sparre es una hierba rizomatosa trepadora que en Argentina fue encontrada en las Sierras de Calilegua (Jujuy y en áreas montanas de Catamarca, aunque de esta última localidad sólo se conoce un único e incompleto ejemplar. Habita quebradas húmedas, entre los 2.100 y 2.650 m s.n.m., en el límite superior del bosque montano. El tallo es grácil de hasta 3 m de largo y la porción subterránea está constituida por rizomas alargados y de hasta 1 cm de diámetro. Estas son las principales diferencias con la ssp. tuberosum, en la cual el tallo es más corto, erguido y desarrolla tubérculos bien definidos.Ecological features and distribution of Tropaeolum tuberosum ssp. silvestre (Tropaeolaceae in Argentina. Tropaeolum tuberosum Ruiz et Pav. ssp. silvestre Sparre is a rhizomatous climbing herb that in Argentina was found in the Sierras of Calilegua (Jujuy and Catamarca mountains, yet of this last locality only is known an one and incomplete specimen. It inhabits humid gorges, between 2100-2650 masl, in the upper limit of the montane forest. The slender stem reaches 3 meters in lenght and the underground portion shows elongated rhizomes up to 1 cm in diameter. These are the main differences with the ssp. tuberosum, in which the stem is shorter, erect and develop well-defned tubers.

  19. Diagnóstico da fauna silvestre em empresas florestais brasileiras Diagnosis of wild fauna in brazilian forest companies

    Directory of Open Access Journals (Sweden)

    Giovanna Debortoli Medeiros

    2009-02-01

    Full Text Available Com o objetivo de conhecer a situação atual da fauna silvestre em empresas florestais brasileiras, foram pesquisadas 42 razões sociais, entre Associadas e Co-Participantes da Sociedade de Investigações Florestais (SIF, as quais possuem plantios florestais próprios. As informações foram obtidas com base em questionário enviado às referidas empresas, via correio eletrônico, sendo as respostas obtidas também por esse mecanismo. Entre os vários resultados, destaca-se o fato de que 90,9% das empresas associadas já realizaram levantamentos qualitativos da fauna silvestre. No entanto, de modo geral há notória carência de infra-estrutura nas empresas pesquisadas para atender a trabalhos específicos de manejo e conservação da fauna silvestre.Forty-two companies, associates and co-participants of the Forest Investigation Society (SIF and owners of private forest plantations, were assessed to determine the current situation of wild fauna in Brazilian forest companies. Information was obtained through a questionnaire sent to and received from the companies by e-mail. One of the several results obtained was that 90.9% of the associate companies had already carried out qualitative surveys on wild fauna stands.. On the other hand, in general, there is a total lack of infrastructure in the surveyed companies, to specifically assist in the management and conservation of wild fauna.

  20. Contribución a la patología de los carnívoros silvestres.

    OpenAIRE

    Sobrino Menchero, Raquel

    2008-01-01

    España cuenta con una rica comunidad de carnívoros silvestres terrestres. Esta tesis parte de las siguientes hipótesis: (1) los carnívoros terrestres, por su ubicación en la cúspide de la pirámide trófica, pueden ser buenos indicadores de la presencia y frecuencia de enfermedades que afectan a distintos taxones animales. (2) la diversidad paisajística de la Península Ibérica, que se asocia con diferentes comunidades de carnívoros terrestres, podría determinar diferencias en la distribución y ...

  1. Diagnóstico jurídico sobre el decomiso y manejo postdecomiso de fauna silvestre en el departamento del Chocó

    OpenAIRE

    Hinestroza Cuesta, Lisneider; Mena Valencia, Marisela; Palacios Sánchez, Kelly Johana; 2011-12-31

    2011-01-01

    En este artículo se presenta un estudio de carácter descriptivo sobre los decomisos y el manejo postdecomiso de fauna silvestre en el departamento del Chocó utilizado como corredor para el tráfico y comercialización ilegal; se analizan, a partir del marco jurídico colombiano, la definición de fauna silvestre, decomiso y sus consecuencias jurídicas. Entre el 2005 y marzo del 2011 se realizaron en el Chocó 904 decomisos: 316 aves, 321 reptiles y 264 de mamíferos, 1 anfibio, 1 arácnido y 1 pez. ...

  2. DIAGNÓSTICO JURÍDICO SOBRE EL DECOMISO Y MANEJO POSTDECOMISO DE FAUNA SILVESTRE EN EL DEPARTAMENTO DEL CHOCÓ

    Directory of Open Access Journals (Sweden)

    Lisneider Hinestroza Cuesta

    2011-12-01

    Full Text Available En este artículo se presenta un estudio de carácter descriptivo sobre los decomisos y el manejo postdecomiso de fauna silvestre en el departamento del Chocó utilizado como corredor para el tráfico y comercialización ilegal; se analizan, a partir del marco jurídico colombiano, la definición de fauna silvestre, decomiso y sus consecuencias jurídicas. Entre el 2005 y marzo del 2011 se realizaron en el Chocó 904 decomisos: 316 aves, 321 reptiles y 264 de mamíferos, 1 anfibio, 1 arácnido y 1 pez. La tendencia ha sido el aumento. La principal opción de disposición de fauna decomisada es la Liberación. Se han impuesto solamente sanciones de tipo administrativo sin reporte en el Registro Único de Infractores Ambientales y no se ha adelantado ninguna investigación de tipo penal

  3. Usos potenciales de germoplasma animal masculino con fines de preservación de fauna silvestre

    Directory of Open Access Journals (Sweden)

    Francisco Cabrera

    2017-11-01

    Full Text Available El germoplasma animal comprende células o tejidos que pueden generar nuevos individuos. Su preservación y uso puede instrumentarse en la reproducción de animales en peligro de extinción. El germoplasma animal, además de los gametos, incluye células diploides como las células madre, potencialmente capaces de dividirse indefinidamente. Las células madre espermatogoniales (CMEs generan los espermatozoides en el testículo (espermatogénesis. Las CME ofrecen múltiples opciones biotecnológicas. A diferencia de las células madre ovogoniales (hembras, numerosas CME pueden ser obtenidas durante el periodo postnatal prepuberal pre-meiosico. Estas células pueden ser aisladas, amplificadas in vitro y criopreservadas, para así crear líneas celulares. Las CME pueden inducirse a diferenciar in vivo e in vitro. Las metodologías in vivo, están basadas en el transplante de CMEs del testículo de un animal donador al testículo de otro receptor sin espermatogenesis, técnicas ya establecidas en animales de laboratorio con potencial para utilizarse en animales domésticos y silvestres. Estos últimos, podrían donar CMEs y animales de especies filogenéticamente relacionadas no amenazadas serían receptores para producir espermatozoides de la especie amenazada. Existen técnicas de transplante de material testicular preservado de diversos animales al tejido subcutáneo de ratones, donde se desarrolla la espermatogénesis completa. La espermatogénesis in vitro está disponible en ratones. Independientemente de la metodología utilizada, los espermatozoides obtenidos de CME pueden utilizarse en técnicas de reproducción asistida para generar embriones y/o nuevos individuos a fin de repoblar ecosistemas en desequilibrio o aumentar las tasas de mejoramiento genético en sistemas de producción animal.

  4. Riesgo de transmisión de la enfermedad de Chagas por intrusión de triatominos y mamíferos silvestres en Bucaramanga, Santander, Colombia

    Directory of Open Access Journals (Sweden)

    Marlene Reyes

    2017-01-01

    Conclusiones. El hallazgo de especies de triatominos intrusivas y de mamíferos con T. cruzi en el domicilio y el peridomicilio, así como en los bosques periurbanos, demuestra el riesgo de infección en las poblaciones que habitan en viviendas urbanas adyacentes a los ecótopos donde se mantiene el ciclo silvestre.

  5. O silêncio de Deus em Morangos Silvestres e O Sétimo Selo de Ingmar Bergman

    OpenAIRE

    Sinay, Isadora Goldberg

    2014-01-01

    A presente dissertação de mestrado é composta da análise de dois longa-metragens de ficção, Morangos Silvestres e O Sétimo Selo, de Ingmar Bergman . A análise busca mapear nas duas obras a temática do silêncio de Deus, aspecto relevante na obra do cineasta em questão. Ingmar Bergman é um dos maiores nomes da arte contemporânea e seus filmes articulam filosofia e religião, tornando-os de interesse fundamental para as ciências da religião como manifestação de reflexões essenci...

  6. Clínica de animais exóticos e silvestres: patologias nutricionais em psitacídeos

    OpenAIRE

    Pereira, Stéphanie Dorothée Melen Palha Ramos

    2014-01-01

    O presente trabalho visa relatar a casuística observada durante o estágio curricular em clínica de animais exóticos e silvestres, no Centro Veterinário de Exóticos do Porto e no Parc Zoologique d’Amnéville. Esta será exposta em frequências absolutas e relativas que estarão representadas em gráficos e tabelas para que a interpretação das atividades desenvolvidas seja clara. De seguida, estará contemplada uma revisão bibliográfica subordinada a uma das emergências mais frequentemente assisti...

  7. Are camouflaged seeds less attacked by wild birds? Sementes camufladas são menos atacadas por aves silvestres?

    Directory of Open Access Journals (Sweden)

    Alexandre de Almeida

    2010-04-01

    Full Text Available Wheat, corn and rice crops in Brazil use seeds treated with systemic insecticide/nematicide carbofuran, mixed to rhodamine B red dye. Carbofuran is toxic and rhodamine B is attractive to wild birds that eat up these seeds, resulting in notable mortality during planting. A field experiment was performed in southeast Brazil to evaluate if camouflaged seeds would be less consumed by wild birds in comparison to commercial seeds with red-colored rhodamine B and aposematic blue seeds. Camouflaged seeds were less removed than seeds with rhodamine B and natural colors. The camouflaging was more effective in the presence of irregularities and litter. There was no removal of blue-colored seeds. As legislation requires treated seeds to receive a different color to avoid accidents with humans, camouflaging may be used as replacement of rhodamine B to reduce mortality rates of wild birds.Plantações de trigo milho e arroz no Brasil utilizam sementes tratadas com o inseticida e nematicida sistêmico carbofuran, associado ao corante vermelho rodamina B. O carbofuran é tóxico e a rodamina B é atrativa às aves silvestres, as quais consomem estas sementes, resultando em notável mortalidade durante o plantio. Um experimento realizado em campo agrícola no sudeste do Brasil mostrou que sementes camufladas foram menos removidas por aves silvestres do que sementes com rodamina B. A camuflagem foi potencializada em presença de irregularidades e serrapilheira no solo. Não houve remoção de sementes de cor azul, mas a formulação granular de cor azul tem causado mortalidade de aves nos USA e Canadá. Como sementes tratadas com agrotóxicos devem, de acordo com a legislação, receber coloração diferenciada para evitar acidentes com humanos, a camuflagem pode ser utilizada, substituindo a rodamina B.

  8. Ácidos grasos y parámetros de calidad del aceite de semilla de uva silvestre (Vitis spp.

    Directory of Open Access Journals (Sweden)

    O. Franco-Mora

    2015-01-01

    Full Text Available México es centro de origen de varias especies de Vitis. La gran mayoría de ellas no son empleadas en la agricultura e industrias derivadas. Como parte de la exploración de su potencial agroindustrial se identificó y cuantificó a los ácidos grasos del aceite de semilla de vid silvestre (Vitis spp. de frutos de Temascaltepec, México y de la accesión E-201, cultivada en Zumpahuacán, México. El contenido promedio de aceite en la semilla fue de 16,7%, encontrando ácido linoleico (71,5%, oleico (17,2%, palmítico (6,6% y esteárico (4,3%. En el aceite obtenido en vides de Temascaltepec se determinó índice de yodo (57,9 g/100 g, índice de saponificación (170,7 mg/g e índice de peroxidos (30 mEq/kg, valores relacionados posiblemente al contenido de ácidos grasos insaturados. Sin embargo, ese mismo grado de insaturación no concordó con el punto de humeo observado (211 °C, lo cual posiblemente está relacionado con el contenido de ácidos palmítico y esteárico. El aceite de semilla de vid silvestre cumple parcialmente con los estándares establecidos para el aceite de semilla de V. vinifera, lo cual implica su potencial culinario, agroindustrial y cosmetológico.

  9. Ecología de la fauna silvestre de la sierra nevada y la Sierra del Ajusco

    Directory of Open Access Journals (Sweden)

    D. Granados Sánchez

    2004-01-01

    Full Text Available Se presenta un estudio sobre la fauna silvestre de la Sierra del Ajusco y la Sierra Nevada, localizadas dentro de la Faja Volcánica Transmexicana (FVT, en la porción oriental del límite meridional de la Cuenca de México. La enorme riqueza biológica de esta zona que rodea la zona metropolitana de la ciudad de México, uno de los mayores complejos urbanos del mundo, ha sobrevivido durante décadas al impacto de la urbanización de las áreas forestales, explotación de recursos naturales, contaminación, cacería, incendios y pastoreo. A pesar de esto, se desconocen muchos de los factores que regulan la dinámica de los ecosistemas en esta región. Con relación a la fauna silvestre la carencia de información es mucho más evidente, aspectos elementales como la diversidad de especies, las interacciones ecológicas, la función de los organismos en el ecosistema, las condiciones de estrés a que están sometidos, han sido poco explorados. En esta investigación se recurrió a observaciones de campo y a la consulta de diferentes fuentes bibliográficas para estimar la riqueza de especies de mamíferos, aves, reptiles y anfibios; las relaciones ecológicas entre los mismos y las consecuencias de la modificación de su hábitat producto de las actividades humanas.

  10. Estudio preliminar de especies de micobacterias en primates colombianos no humanos en cautiverio en dos centros de rescate de fauna silvestre de Bogotá

    Directory of Open Access Journals (Sweden)

    Karol Bibiana Barragán Fonseca

    2005-01-01

    Mycobacterium africanum, siendo el primer reporte de estas micobacterias para primates del Nuevo Mundo. La prevalencia para MNT fue de 7,2% perteneciendo a las especies Mycobacterium phlei, M. terrae, M. vaccae, M. flavescens, M. flavescens y M. zsulgaii, algunas de estas, patógenos oportunistas. No existe una diferencia a nivel descriptivo en cuanto a la edad, al sexo y al tipo de entrega de los individuos infectados con MNT y micobacterias tuberculosas con respecto a los individuos que no las presentaron. Los primates del Nuevo Mundo pueden ser portadores sanos de micobacterias tuberculosas lo que representa un riesgo para la salud humana, y con ciertas especies de micobacterias, podría ser un riesgo para las poblaciones de primates silvestres en caso de que estos primates sean liberados en el medio silvestre. Este estudio es relevante para el país, ya que integra conceptos médicos tanto epidemiológicos como microbiológicos, con aspectos relacionados con la conservación de la fauna silvestre.

  11. Tráfico y tenencia ilegal de fauna silvestre en el departamento de Boyacá

    Directory of Open Access Journals (Sweden)

    Alejandro Cabrejo Bello

    2010-10-01

    Full Text Available Con el fin de establecer cuáles son los principales grupos taxonómicos, suparticipación y las ciudades con mayores índices de tráfico y tenencia ilegal de vida silvestre en el departamento de Boyacá, jurisdicción de la Corporación Autónoma Regional de Boyacá- Corpoboyacá, se tomaron reportes de la base de datos de dicha entidad entre los años 2004 y 2008. Se hallaron registros de 398 individuos decomisados por parte de la autoridad ambiental y otros por entregas voluntarias. El grupo con mayor incidencia fue el de las aves con 58%,seguido por los reptiles con 26% y en tercer lugar los mamíferos con el 16% de los registros. Se observó que las tres principales ciudades del departamento (Tunja, Duitama y Sogamoso reportan las frecuencias más elevadas de incautaciones. Puerto Boyacá, también registra un número elevado de decomisos. Dentro de los tres grupos mencionados, las especies más afectadas correspondena los órdenes Psitaciformes, Primates y Testudínata, por lo cual merecen principal atención. Se recomienda además, implementar planes de conservación y emprender actividades de educación ambiental encaminadas a la utilización sostenible de la fauna en general.

  12. LA VIDA SILVESTRE MANEJADA COMO RECURSOS DE USO COMÚN: ESTUDIO DE CASO EN MÉXICO

    Directory of Open Access Journals (Sweden)

    Alejandra Juárez Mondragón

    2015-12-01

    Full Text Available Desde 1997, el ejido Ajuchitlán Santiopan implementó reglas de aprovechamiento del venado cola blanca (Odocoileus virginianus mexicanus. Paralelamente registró una Unidad de Manejo para la Conservación de la Vida Silvestre (UMA, pretendiendo una caza sustentable. Esto implicó un co-manejo entre regulación local y federal. En México existe insuficiente conocimiento de estos procesos y de las repercusiones que generan en los ejidos. El objetivo del estudio fue comprender (desde la percepción de los pobladores la relación entre la creación de la institución local y el establecimiento de la UMA, utilizando la perspectiva teórica de recursos de uso común (RUC. Se realizaron entrevistas, listados libres, observación participante y consulta documental. De los entrevistados, el 46 % consideró que algunas leyes federales afectan tradiciones, y mencionaron que el 20 % dejó de respetar reglas ejidales. Sin embargo, 78 % reconoció importante mantener la UMA, porque: genera empleos temporales, incrementó la abundancia de venados y suscitó la reintroducción natural de especies ya extintas en el ejido. El 100 % coincidió en que la UMA es el factor principal de conservación de especies silvestres. Para continuar con este proceso es esencial replantear colectivamente objetivos de aprovechamiento y estrategias de vigilancia, ante las condiciones actuales.   White-tailed deer (Odocoileus virginianus mexicanus use regulations were implemented by the ejido Ajuchitlán Santiopan, since 1997. In parallel, the ejidatarios registered a Management Unit for the Conservation of Wildlife (UMA, seeking its sustainable hunting. This involved a co-management between local and federal regulation. The knowledge on these types of processes is sparse in Mexico, and of the impact that they generate in the ejidos. The aim of this study was to understand (from the perception of the inhabitants the relationship

  13. Estudio de la resistencia a Bemisia tabaci (Gennadius (Hemiptera: Aleyrodidae en germoplasma cultivado y silvestre de tomate (Solanum lycopersicum L.

    Directory of Open Access Journals (Sweden)

    Yeimy García Valencia

    2013-12-01

    Full Text Available En la Universidad Nacional de Colombia sede Palmira, en condiciones de campo y casa de malla, se evaluaron por preferencia para oviposición y número de ninfas de mosca blanca (Bemisia tabaci (Gennadius varias accesiones silvestres y poblaciones segregantes de tomate resistentes al pasador del fruto, Neoleucinodes elegantalis (Guenée. Se utilizó un diseño de bloques completos al azar con cuatro repeticiones, donde se evaluaron como variables el número de huevos y de ninfas del insecto por hoja. En cada observación se incluyeron tres hojas del tercio superior, medio e inferior del tallo de la planta. Las poblaciones de mosca blanca fueron muy bajas en los dos primeros ciclos de cultivo (en campo debido, probablemente, a las altas precipitaciones. Estas condiciones no permitieron una selección de materiales resistentes o susceptibles a este insecto. En el tercer ciclo de cultivo, bajo condiciones de casa de malla, no se encontraron diferencias significativas entre los retrocruzamientos respecto al testigo susceptible para la variable preferencia por oviposición. El genotipo 4212P4 presentó el menor número de ninfas, mostrando que tiene posiblemente un mecanismo que le confiere menor atracción para B. tabaci. Se encontró que los genotipos menos preferidos para oviposición y con menor número de ninfas fueron PI 134417, PI 134418 y PI 126449 (Solanum habrochaites var. Glabratum S. Knapp y D. M Spooneer.

  14. Sistemas de transmisión del conocimiento etnobotánico de plantas silvestres comestibles en Turbo, Antioquia, Colombia.

    Directory of Open Access Journals (Sweden)

    Ramón Antonio Mosquera Mena

    2015-03-01

    Full Text Available Los diferentes estudios etnobotánicos y etnoecológicos, muestran no solo la gran riqueza de recursos naturales que muchas comunidades han aprovechado de manera sostenible en el tiempo, si no también, la preocupación por la falta de sistematización del conocimiento debido a diferentes situaciones que lo dificultan. Esta investigación tiene como propósito mostrar los diferentes sistemas de transmisión del conocimiento que los habitantes del municipio de Turbo, Antioquia, Colombia, han utilizado para que las generaciones presentes y futuras reconozcan las plantas silvestres comestibles, lo cual es útil para tomar decisiones frente a la necesidad de sistematización del conocimiento de la biodiversidad local. Se utiliza una metodología que comprende las etapas de diseño de la encuesta etnobotánica, la aplicación de la misma teniendo en cuenta el tamaño de la población lo que arroja un total de 360 encuestas aplicadas en los 18 corregimientos del municipio, agrupados en cuatro sectores fisiográficos: Serranía, Litoral, Abanico Aluvial y Planicie Inundable. Los resultados muestran las formas de transmisión de conocimiento en cada uno de los corregimientos que componen la geografía del territorio, evidenciando que continúan primando sistemas de transmisión oral con muy baja sistematización y con un desinterés de la población joven por reconocer dichos recursos orientados a la preservación como fuentede alimento.

  15. Fauna silvestre asociada a ganado vacuno doble propósito en sistema de silvopastoreo, Pinto, Magdalena, Colombia

    Directory of Open Access Journals (Sweden)

    Jaime De La Ossa V.

    2011-12-01

    Full Text Available Objetivo. Evaluar la biodiversidad faunística asociada a ganadería vacuna de doble propósito en dos potreros estructurados con Botriochloa pertusa (colosoana como herbácea dominante, uno de ellos plantado con Crescentia cujete (Bignoniaceae como fuente de alimento adicional y otro con escaso y disperso arbolado. Materiales y métodos. El área de estudio está ubicada en el municipio de Pinto, Magdalena. Cada potrero evaluado fue de 10 ha, se mantuvo en cada uno un lote de quince vacas (½ Cebú, ¼ Pardo y ¼ Costeño con Cuernos, la separación entre las áreas muestreadas fue de 500m. Los registros de fauna se condujeron mediante punto fijo de conteo, en diez sitios de avistamiento, durante 20 días continuos, con cubrimiento visual amplio. Al ganado vacuno adulto presente en las dos áreas de trabajo se le realizó un pesaje individual al inicio del trabajo y al final del mismo, con el fin de determinar posibles diferencias entre ellos. Resultados. Estadísticamente el número de individuos y el número de especies presentaron diferencias significativas, siendo mayor la diversidad biológica para el potrero que poseía la plantación de C. cujete, mientras que el peso corporal de las vacas sometidas a pastoreo en las dos áreas no presentó diferencias significativas. Conclusiones. Se demuestra la importancia de este modelo pecuario como promotor de la conservación faunística local al convertirse enrefugio de variadas especies silvestres, al tiempo que mantiene la productividad existente sin alterar el ambiente sustancialmente.

  16. Biossegurança no manejo de animais silvestres em áreas de confinamento no Estado do Piauí

    Directory of Open Access Journals (Sweden)

    Felipe José Costa Viana

    2016-02-01

    Full Text Available A biossegurança em áreas de confinamento de animais silvestres é questão fundamental para a saúde pública, sobretudo em locais onde os animais são considerados protagonistas da atração, como em parques zoológicos. Estes locais, apesar de toda segurança envolvida na contenção e manejo dos animais, ainda podem ser considerados como ponto de transmissão de zoonoses. Objetivou-se avaliar o grau de insalubridade dos funcionários e o uso de equipamentos de proteção contra patógenos de caráter zoonótico em áreas de confinamento de animais silvestres. O estudo foi realizado através da análise dos dados obtidos por meio de questionário aplicado aos trabalhadores de áreas de confinamento de animais silvestres, cujo enfoque era sobre a rotina de trabalho, manejo dos animais, histórico de saúde e o conhecimento acerca de doenças zoonóticas. As informações coletadas revelaram que, em parte, a administração do local proporciona aos funcionários uma segurança básica, fornecendo EPIs e cursos de atualização no manejo dos animais. Entretanto, a vestimenta utilizada pelos funcionários é lavada em suas próprias residências. Ainda há pontos a serem corrigidos na biossegurança nestes parques, como a construção de vestiários e uniformes próprios, com a lavagem do mesmo em um setor de lavanderia no próprio local.

  17. Prácticas culinarias y (reconocimiento de la diversidad local de verduras silvestres en el Colectivo Mujeres y Maíz de Teopisca, Chiapas, México

    Directory of Open Access Journals (Sweden)

    Celina Guadalupe Solís Becerra

    2014-07-01

    Full Text Available Se analizan los saberes y acciones relacionados con la diversidad local de verduras silvestres, reconocida por las integrantes del Colectivo Mujeres y Maíz de Teopisca, Chiapas, México, a partir de sus prácticas culinarias. Se documentaron trece especies de verduras silvestres mayormente presentes en traspatios y 33 recetas culinarias con incorporación de tales especies. Se destaca la importancia de las verduras silvestres, la gastronomía local, el trabajo cotidiano y la vida campesina, con los cuales se enriquece la relación que las mujeres del colectivo y sus familias tienen con la biodiversidad local a través de su cultura alimentaria.

  18. Técnica de Necropsia, Interpretación de Hallazgos Macroscópicos y Toma de Muestras en Mamíferos Silvestres

    OpenAIRE

    Jahnier Caicedo; J C Ospina; J Avila

    2012-01-01

    La correcta realización de necropsias y toma de muestras en los animales silvestres de los diferentes sistemas de conservación del país es una herramienta de alta importancia en el manejo epidemiológico de muchas enfermedades. La falta de entrenamiento en las técnicas de necropsia de estos animales dificulta la elaboración de propuestas diagnósticas y de control que repercutan en los problemas sanitarios; por lo cual, se presenta una guía de técnica de necropsia general para mamíferos silvest...

  19. Priorización de enfermedades virales zoonóticas en la interfaz de cerdos silvestres, cerdos domésticos y seres humanos

    Directory of Open Access Journals (Sweden)

    Diana Benavides-Arias

    2016-08-01

    Conclusión. Los métodos semicuantitativos de priorización son una fuente de información para la toma de decisiones, pero su utilización es poco frecuente en los países en desarrollo por la falta de datos de vigilancia en salud pública. El control de las enfermedades que afectan tanto a los seres humanos como a los animales silvestres, requiere el desarrollo de estrategias que reduzcan la transmisión de patógenos de estos a los animales domésticos y a los seres humanos.

  20. Estudio preliminar de especies de micobacterias en primates colombianos no humanos en cautiverio en dos centros de rescate de fauna silvestre de Bogotá

    OpenAIRE

    Karol Bibiana Barragán Fonseca; Claudia I. Brieva Rico; Martha I. Guerrero

    2005-01-01

    Se determinó la presencia de diferentes especies de micobacterias en 83 primates colombianos en cautiverio en dos centros de rescate de fauna silvestre de Bogotá. Se evaluaron 166 muestras de sangre y lavado gástrico mediante amplificación por PCR-spoligotyping para micobacterias del complejo tuberculosis y Hsp65-PRA para micobacterias no  tuberculosas (MNT). Se obtuvo una prevalencia del 2,4% para micobacterias del complejo Mycobacterium tuberculosis, encontrando un Saimiri sciureus infec...

  1. Estudio preliminar de especies de micobacterias en primates colombianos no humanos en cautiverio en dos centros de rescate de fauna silvestre de Bogotá

    OpenAIRE

    Barragán Fonseca Karol Bibiana; Guerrero Martha I.; Brieva Rico Claudia I.

    2005-01-01

    Se determinó la presencia de diferentes especies de micobacterias en 83 primates colombianos en cautiverio en dos centros de rescate de fauna silvestre de Bogotá. Se evaluaron 166 muestras de sangre y lavado gástrico mediante amplificación por PCR-spoligotyping para micobacterias del
    complejo tuberculosis y Hsp65-PRA para micobacterias no  tuberculosas (MNT). Se obtuvo una prevalencia del 2,4% para micobacterias del complejo Mycobacterium tuberculosis, encontrando un Saimiri sciure...

  2. Composição química e valor nutricional de cogumelos silvestres comestíveis do nordeste de Portugal

    OpenAIRE

    Barros, Lillian; Baptista, Paula; Correia, Daniela M.; Casal, Susana; Oliveira, M.B.P.P.; Ferreira, Isabel C.F.R.

    2007-01-01

    Neste trabalho, determinou-se a composição química e o valor nutricional de cinco espécies de cogumelos silvestres comestíveis (Agaricus arvensis, Lactarius deliciosus, Leucopaxillus giganteus, Sarcodon imbricatus, Tricholoma portentosum) vulgarmente consumidos na região de Trás-os-Montes, Nordeste de Portugal. A avaliação da composição química incluíu determinação de humidade, gordura total, proteína total, cinzas, hidratos de carbono e do valor nutricional. O perfil de macron...

  3. Ecletismo e retórica na filosofia brasileira: de Silvestre Pinheiro Ferreira (1769-1846) ao frei Francisco do Monte Alverne (1784-1858)

    OpenAIRE

    Duran, Maria Renata da Cruz

    2015-01-01

    Resumo Este artigo trata da filosofia eclética de Victor Cousin conforme seus repetidores brasileiros do início do século XIX: Silvestre Pinheiro Pereira e frei Francisco do Monte Alverne. O objetivo principal é estudar as relações entre o ecletismo e a retórica em prol da justificação dos limites, da dispersão e da superficialidade do debate filosófico local. Revisando as obras de Antônio Paim, Laerte Ramos de Carvalho e Maria Beatriz Nizza da Silva, destacou-se, especialmente, alguns pressu...

  4. Eclecticism and Rhetoric in the Brazilian philosophy: from Silvestre Pinheiro Ferreira (1769-1846) to Fray Francisco do Monte Alverne (1784-1858)

    OpenAIRE

    Duran, Maria Renata da Cruz; Universidade Estadual de Londrina

    2015-01-01

    Este artigo trata da filosofia eclética de Victor Cousin conforme seus repetidores brasileiros do início do século XIX: Silvestre Pinheiro Pereira e frei Francisco do Monte Alverne. O objetivo principal é estudar as relações entre o ecletismo e a retórica em prol da justificação dos limites, da dispersão e da superficialidade do debate filosófico local. Revisando as obras de Antônio Paim, Laerte Ramos de Carvalho e Maria Beatriz Nizza da Silva, destacou-se, especialmente, alguns pressupostos ...

  5. La investigación en torno a la concepción de vida silvestre: Una aproximación al estado del arte en el contexto educativo.Pág 51-87

    Directory of Open Access Journals (Sweden)

    Luis Juan Rubiano O.

    2011-07-01

    Full Text Available Se hace una revisión sobre el origen de la concepción de vida silvestre, rastreando su significado desde el siglo XIV hasta el presente. Aunque existen en Inglaterra referencias muy antiguas sobre la concepción de vida silvestre, es en Estados Unidos donde nace y evoluciona dicho término. Al comparar las concepciones de la vida silvestre en los Estados Unidos respecto a los países latinoamericanos, se evidencia la enorme importancia cultural, educativa, política y social dada a tales concepciones en el continente norteamericano en contraste con Latinoamérica, particularmente Colombia, en donde no se dan tales manifestaciones. Igualmente, la historia de la educación e investigación en educación sobre la vida silvestre en los Estados Unidos revela una notoria inserción de esta temática tanto en los textos divulgativos (educación no formal como en la literatura científica y en los currículos de educación básica y universitaria. En dicho país es posible conjeturar un cambio evolutivo en la concepción de vida silvestre que, de acuerdo con nuestra investigación, se inicia a finales del siglo XIX con un significado de fauna de caza deportiva y culmina, hacia la década de 1970 con la inclusión de todos los reinos de la naturaleza así como su hábitat e interrelaciones. En nuestro país, y en general para Suramérica, es muy escasa la literatura especializada sobre vida silvestre, no existiendo facultades o carreras con dicha temática a pesar de la enorme biodiversidad de este continente. Algunas de las razones aducidas por el autor, que explican esta situación, son la influencia de la visión taxonómica de la naturaleza, privilegiada en Colombia por la Expedición Botánica, y la dificultad para incorporar la educación ambiental en el contexto académico universitario. Se concluye igualmente la escasa investigación en vida silvestre y el potencial que existe para desarrollarla en el campo de las ciencias naturales y sociales

  6. PARÁMETROS HEMATOLÓGICOS EN POLLUELOS DE PSITÁCIDOS EN CAUTIVERIO DE ORIGEN SILVESTRE

    Directory of Open Access Journals (Sweden)

    J. A. Herrera

    2013-01-01

    Full Text Available El objetivo de este estudio fue describir los parámetros hematológicos en 69 polluelos en cautiverio de origen silvestre, clínicamente sanos, menores de tres meses de edad, en cuatro especies de psitácidos: Pionus senilis (n = 18, Amazona albifrons (n = 15, Amazona autumnalis (n = 25 y Amazona oratrix (n = 11, procedentes de la región central de México. Para determinar dichos parámetros, de cada ejemplar se obtuvieron 500 μl de sangre por punción de la vena braquial. En las cuatro especies citadas, el porcentaje del hematocrito fue de 56,4 ± 3,36; 51 ± 6,52; 47,6 ± 6,47 y 53,8 ± 9,26; el VCM en fl fue de 184,6 ± 13,4; 142,0 ± 25,4; 106,3 ± 11,7 y 162,3 ± 71,9; la cuenta eritrocítica fue de 4,7 ± 2,1 x10 6 /μl; 6,1 ± 8,2 x10 6 /μl; 6,9 ± 1,2 x10 6 /μl y 5,4 ± 1,1 x10 6 /μl; y la cuenta leucocitaria de 3,06 ± 0,15 x10 3 /μl; 3,62 ± 0,24 x10 3 /μl; 4,48 ± 0,36 x10 3 /μl y 3,56 ± 0,71 x10 3 /μl respectivamente para P. senilis , A. albifrons , A. autumnalis y A. oratrix . Se constató tendencia a la heterofilia en A. albifrons y A. oratrix , lo cual puede ser de gran utilidad para un diagnóstico cada vez más preciso en la clínica de aves en cautiverio.

  7. Natural infection by endoparasites among free-living wild animals Infecção natural por endoparasitas em animais silvestres de vida-livre

    Directory of Open Access Journals (Sweden)

    Luciane Holsback

    Full Text Available The objective of this study was to investigate the frequency of occurrence and variety of intestinal parasites among free-living wild animals. Fecal samples from wild mammals and birds at rehabilitation centers in the states of Mato Grosso do Sul and São Paulo were analyzed by sedimentation and flotation-centrifugation methods. Parasite eggs, oocysts, cysts and/or trophozoites were found in 71% of the samples. Cryptosporidium sp. oocysts were detected in fecal samples from oncillas (Leopardus tigrinus and scaly-headed parrots (Pionus maximiliani. Giardia cysts were identified in the feces of a gray brocket (Mazama gouazoubira. Among the most common parasites found, there were eggs from Toxocara cati, Toxascaris leonina and Ancylostoma tubaeforme, and from Cestoda. Several Enterobius sp. eggs were found in the feces of red howler monkeys (Alouatta seniculus. It can be concluded from this study that despite the small number of samples, the diversity of parasites found was noteworthy. Additional information about parasite endofauna in wild animals is needed, since their presence might suggest that there could be proximity to and interactions with domestic animals and/or humans. In addition, further studies on parasites from free-living wild animals are of prime importance for understanding the intensity of anthropic changes in wild environments.O objetivo deste trabalho foi pesquisar a frequência de ocorrência e a variedade de parasitas intestinais de animais silvestres de vida livre. Amostras de fezes de mamíferos e aves silvestres de centros de reabilitação dos Estados do Mato Grosso do Sul e São Paulo, foram analisadas pelos métodos de sedimentação e de centrífugo-flutuação. Foram encontrados ovos, oocistos, cistos e/ou trofozoítos de parasitas em 71% das amostras. Oocistos de Cryptosporidium sp. foram detectados em amostras de fezes de gato-do-mato-pequeno (Leopardus tigrinus e maritacas (Pionus maximiliani. Cistos de Giardia

  8. Detección por reacción en cadena de la polimerasa de transcriptasa inversa del virus de la fiebre amarilla en monos silvestres: una herramienta sensible para la vigilancia epidemiológica

    Directory of Open Access Journals (Sweden)

    Jairo A. Méndez

    2007-09-01

    Conclusión. El hallazgo del virus de la fiebre amarilla en monos silvestres representa una evidencia de su actividad enzoótica en nuestro territorio, que incrementa el riesgo de transmisión a humanos y de urbanización por procesos de migración de la población.

  9. New records of Histoplasma capsulatum from wild animals in the Brazilian Amazon Novos registros de Histoplasma capsulatum em animais silvestres na Amazônia brasileira

    Directory of Open Access Journals (Sweden)

    Roberto Daibes Naiff

    1996-08-01

    Full Text Available Twenty-eight isolates of Histoplasma capsulation were obtained from eight species of forest mammals from the States of Amazonas, Pará and Rondônia in the Amazon Region of Brazil. Primary isolates were obtained by inoculating triturated liver and spleen tissue intradermally and intraperito-neally in hamsters. Mycological diagnosis in hamsters presenting lesions was confirmed by histopathology and culture on Sabouraud dextrose-agar. Infected hamsters developed signs of disease within two to nine months; all had disseminated visceral lesions and most also had skin lesions at the sites of inoculation. None of the hamsters inoculated with skin macerates of the original hosts developed histoplasmosis, and histopathological examination of the viscera of the wild hosts failed to reveal H. capsulation. Prevalence of infection was considerably higher in females than in males both for the opossum Didelphis marsupialis and for total wild animals (479 examined. It is proposed that canopy-dwelling mammals may acquire the infection from conidia borne on convective currents in hollow trees with openings at ground-level.Vinte e oito amostras de Histoplasma capsulatum foram obtidas de oito espécies de mamíferos silvestres nos Estados do Amazonas, Pará e Rondônia. Os isolamentos foram feitos mediante inoculação de amostras trituradas de fígado e baço em hamsters por via intradérmica e intraperitoneal. O diagnóstico micológico nos hamsters que apresentaram lesões foi confirmado por histopatologia e cultivo em meio dextrose-agar de Sabouraud. Os hamsters infectados desenvolveram sinais de doença após dois a nove meses; todos apresentaram lesões disseminadas nas vísceras e a maioria apresentou também lesões cutâneas nos locais da inoculação. Nenhum dos hamsters inoculados com material de pele dos hospedeiros originais desenvolveu histoplasmose, e H. capsulatum não foi detectado nos exames histopatológicos dos animais silvestres. A preval

  10. Caracterización morfológica de accesiones silvestres de guayaba Morphologic characterization of wild accesions of guava

    Directory of Open Access Journals (Sweden)

    Liliana Jiménez Lozano

    2009-04-01

    Full Text Available Se realizó la caracterización morfológica de 22 accesiones silvestres de guayaba Psidium guajava L. 14 colectadas en el municipio de Restrepo (Valle del Cauca, seis en Armenia (Quindío y dos en Pereira (Risaralda. Se utilizaron 12 descriptores cuantitativos y 10 cualitativos de tallo, hojas y frutos; el análisis de agrupamiento se hizo mediante el coeficiente de Dice-Nei-Li y el promedio aritmético no ponderado (UPGMA. La mayor variabilidad se halló en los descriptores peso de la pulpa (CV = 55.92%, peso (CV = 45.23%, y acidez del fruto (CV = 44.75%. El análisis de agrupamientos con base en caracteres cuantitativos permitió establecer cuatro grupos: las accesiones del grupo A (Armenia, presentaron valores promedio de los descriptores de la calidad del fruto (grados Brix, acidez del fruto y relación grados Brix/acidez y valores altos de contenido de pulpa. La mayoría de accesiones del grupo C (Restrepo tuvieron altos valores de calidad del fruto y bajo contenido de pulpa. El grupo B, constituido por accesiones de Armenia y Pereira, se diferenció por valores bajos en los descriptores de rendimiento del fruto (peso del fruto, de la pulpa y diámetro de la cavidad seminal. Las accesiones del grupo D (Restrepo mostraron valores promedios en calidad y rendimiento del fruto. Los descriptores cuantitativos se reunieron en tres variables sintéticas para rendimiento y calidad del fruto que representaron 76.86% de la variabilidad total.Quantitative and qualitative morphologic characterization of 22 wild accessions of guava Psidium guajava L. collected in Restrepo (Valle del Cauca, Armenia (Quindío and Pereira (Risaralda was done. Twelve (12 quantitative and ten (10 qualitative descriptors of stem, leaves and fruits were used. The Dice- Nei Li coefficient and the UPGMA was used for the cluster analysis. Dendrograms and principal components analysis were used. The highest variability was associated with fruit descriptors, pulp weight (CV = 55

  11. Reproducción de cochinilla silvestre Dactylopius opuntiae (Homóptera: Dactylopiidae Reproduction of wild cochineal Dactylopius opuntiae (Homoptera: Dactylopiidae

    Directory of Open Access Journals (Sweden)

    Arnoldo Flores-Hernández

    2006-06-01

    Full Text Available Por sus características, la cochinilla silvestre ofrece perspectivas de aprovechamiento como fuente de carmín y para el mejoramiento genético de la grana fina. Por lo anterior, se estableció una multiplicación y crianza de cochinilla silvestre, proveniente de la zona árida del norte de México para caracterizarla, utilizando como hospedero a Opuntia megacantha Salm Dyck. Los resultados indican que la especie silvestre pertenece al género-especie Dactylopius opuntia. Se determinó la presencia de partenogénesis en hembras. La duración de los estadios biológicos depende del sexo del insecto; el adulto hembra permaneció durante 38.4 días y 4.2 días para machos, los primeros estadios ninfales fueron similares en duración (18.1-19.8 días. El ciclo biológico de las hembras fue de 77 días mientras que el de los machos fue de 43 días. Para las hembras se estimó un periodo de preoviposición de 18.8 días, manteniéndose en oviposición durante 21 días con un promedio de 131 insectos por hembra. La proporción sexual hembras: machos fue 1:1. El tipo de reproducción fue predominantemente sexual, aunque hubo hembras partenogénicas. Este es el primer reporte de Dactylopius opuntiae como cochinilla silvestre asociada a la zona árida del noreste de México, específicamente en el Bolsón de Mapimí, Durango, México.Wild cochineal has characteristics that offer advantage as a source of carmine and for fine cochineal improvement. To characterize wild cochineal, we initiated a breeding effort raising wild cochineal from the arid zone of the north oh Mexico, using as a host organism Opuntia megacantha Salm dick. The results indicate that the wild specie is Dactylopius opuntiae. The presence of parthenogenesis in females was determined. The duration of ontogenetic stages depends on the sex of the insect. The adult female lasted 38.4 days and 4.2 days for males, the first stage nymphs were similar in duration (18-19.8 days. The complete

  12. Epidemiologia da Leptospirose em animais silvestres na Fundação Parque Zoológico de São Paulo

    Directory of Open Access Journals (Sweden)

    Sandra Helena Ramiro Corrêa

    2004-06-01

    Full Text Available A Leptospirose é uma doença bacteriana de caráter zoonótico que afeta os animais domésticos, silvestres e o homem. Levantamentos sorológicos têm demonstrado o envolvimento de diferentes espécies sinantrópicas e silvestres na epidemiologia da doença. Com o objetivo de conhecer melhor a epidemiologia da Leptospirose dentro da Fundação Parque Zoológico de São Paulo, foi realizado um estudo sorológico nos animais silvestres mantidos em cativeiro, no período de 1996 a 1999. Foram colhidas amostras de sangue de 302 animais atendidos na rotina da Divisão de Veterinária, das quais 59 apresentaram resultado positivo (19.5% para a prova de Soroaglutinação Microscópica. Os sorovares mais prováveis para o conjunto total de resultados foram : copenhageni (15/59=25.4%, pomona (13/59=22% e castellonis (10/59=16.9%. Entre os animais silvestres examinados os sorovares mais prováveis foram : Família Callithrichidae : castellonis (3/3=100%, Família cebidae : copenhageni : (13/21=65%, grippotyphosa (2/21=9.5% e castellonis (1/21=44.7%. Família felidae : pomona (12/17=70.5%, icterohaemorrhagiae (2/17=11.7% e grippotyphosa (1/17=5.8%, Família canidae : castellonis (2/4=50%, cynopteri (1/4=25% e mini (1/4=25%, Família cervidae : mini (1/1=100%, Família bovidae : copenhageni (2/3=66.6%, pomona (1/3=33.3%, Família dasyproctidae : castellonis (2/3=66.6%, Família macropodidae: sentot (1/1=100%, família giraffidae : castellonis (1/1=100%. Animais de vida livre como ratos (Rattus norvegicus e gambás (Didelphis marsupialis também foram submetidos a prova de soroaglutinação necroscópica e cultura bacteriológica. Foram encontrados testes positivos para o sorovar icterohaemorrhagiae em 42,8% dos ratos e 40% dos gambás estudados. As freqüências de positivos quando analisadas do ponto de vista da localização espacial dos recintos destes animais, permitiram a verificação da existência de áreas críticas para exposição à leptospira

  13. Caracterización fitoquímica y bromatológica de Dichapetalum spruceanum vell.affinis planta silvestre de la Orinoquia Colombiana y sus potencialidades de uso

    OpenAIRE

    Cortés-Castillo, Caroll E.; Quiñones-Méndez, Luz M; Hernández C, Catalina

    2010-01-01

    Dichapetalum spruceanum vell.affinis (DICHAPETALACEAE), es una especie espontánea del departamento del Casanare en la Orinoquia Colombiana, la cual ha sido poco estudiada y considerada una maleza para los cultivos que se desarrollan en esa zona; dentro del marco del proyecto Caracterización fitoquímica y bromatológica de Dichapetalum spruceanum, planta silvestre subexplotada de la Orinoquia Colombiana, financiado por el Instituto de Investigaciones de la Orinoquia Colombiana (IIOC), se desarr...

  14. Antioxidant Capacity, Anthocyanins, and Total Phenols of Wild and Cultivated Berries in Chile Capacidad Antioxidante, Antocianinas y Fenoles Totales de Berries Silvestres y Cultivados en Chile

    Directory of Open Access Journals (Sweden)

    Jaime Guerrero C

    2010-12-01

    ón fue determinar la capacidad antioxidante (AC, antocianinas totales (TA y el contenido de fenoles totales (TP, de berries silvestres y cultivados en diferentes localidades de la Región de La Araucanía y Región de Los Ríos (Chile. Para evaluar estos parámetros se utilizó el método de radicales libres 2,2-difenil-2- picrilhidrazilo (DPPH, pH diferencial y Folin-Ciocalteu, respectivamente. Los porcentajes de decoloración del DPPH estuvieron comprendidos entre 67,8% para zarzaparrilla roja y 95,3% para rosa mosqueta. El maqui presentó un contenido de AT significativamente mayor (2240,2 y 1445,3 mg L-1 cianidina 3-glucósido que el resto de los berries, el promedio de AT fue de 335,5 mg L-1. En cuanto al contenido FT los mayores niveles se obtuvieron en los dos cultivares de saskatoon (773,9 y 1001,9 mg L-1 ácido gálico y en rosa mosqueta silvestre (1457,0 y 1140,4 mg L-1 de ácido gálico. En este estudio se concluye que existen diferencias significativas en la capacidad antioxidante de frutos silvestres y cultivados en Chile, observándose una fuerte correlación entre el CA y el contenido de FT.

  15. DISPONIBILIDAD DE RAÍCES ADVENTICIAS DE TRES ESPECIES SILVESTRES COSECHADAS PARA LA ELABORACIÓN DE ARTESANÍAS EN SANTA ELENA, ANTIOQUIA (COLOMBIA

    Directory of Open Access Journals (Sweden)

    ANA MARÍA BENAVIDES

    2015-01-01

    Full Text Available En los Andes colombianos, un gran número de artesanías se fabrican a partir de raíces adventicias de plantas nativas que crecen de forma silvestre. Sin embargo, la deforestación y las prácticas no sustentables han diezmado la disponibilidad de plantas silvestres productoras de fibra. En este estudio evaluamos la disponibilidad de fibras de tres especies en Santa Elena (Antioquia, Colombia: Asplundia sarmentosa, Philodendron aff. sagittifolium y Clusia multiflora. Después de una búsqueda exhaustiva en la zona de estudio ubicamos menos de 30 individuos adultos de cada especie. Para cada planta se midieron las variables asociadas al tamaño de la planta y se registró el número y la longitud de raíces maduras e inmaduras. Se pesaron fragmentos de raíces para estimar la biomasa. El crecimiento de raíces de cada planta fue monitoreado mensualmente durante siete meses. La disponibilidad actual de fibra (raíces maduras es de ca. 3 352 m (Asplundia 1 481 m, Clusia de 952 m, Philodendron 918 m, con esta cantidad de material se pueden elaborar entre 419 a 838 canastos. De acuerdo a la tasa de crecimiento mensual, una nueva raíz podría alcanzar un tamaño para ser cosechado entre el mes 38 y 71. Plantas más grandes tienen mayor cantidad de raíces maduras, sin embargo, la tasa de crecimiento no está asociada al tamaño de la planta. Nuestros resultados proveen evidencia de que las plantas en Santa Elena presentan una relación (tamaño de la planta, número de raíces maduras que es similar a plantas que se encuentran en zonas no intervenidas, no obstante, la cosecha de fibras en Santa Elena no es una actividad sostenible debido al bajo número de individuos susceptibles de ser cosechados, la lenta tasa de crecimiento de raíces y la alta demanda de fibras. Es necesario implementar estrategias como el enriquecimiento del bosque con estas tres especies para garantizar una actividad sustentable para recolectores y artesanos en Santa Elena y

  16. Prevalência da infecção pelo Toxoplasma gondii em animais domésticos, silvestres e grupamentos humanos da Amazônia

    Directory of Open Access Journals (Sweden)

    José João Ferraroni

    1980-01-01

    Full Text Available Através de Reação de Hemaglutinação Indireta para toxoplasmose foram examinadas amostras de sangue de dez diferentes espécies de animais domésticos e silvestres, de um grupamento humano da cidade de Manaus-Amazonas e de um grupamento humano indígena de área distante, no território de Roraima. Em 108 animais domésticos, o exame sorológico foi reagente em 90,6% dos gatos (Felis catus, 68,4% dos cães (Canis familiaris, 60,0% dos bovinos (Bos sp, 41,2% dos galináceos (Gallus sp e 40,0% dos palmípedes (Cairina sp. Nos 104 animais silvestres foram reagentes 75,0% dos felídeos (Felis sp, 63,6% dos marsupiais (Didelphis marsupialis e Marmosa sp, 63,3% dos primatas (Saimiri sp e 61,1% dos roedores (Proechimys. Entre os dois grupos humanos a prevalência foi de 70,6% nos 51 habitantes da área de Manaus, 64,8% nos 37 silvícolas de Roraima. Os autores discutem os resultados obtidos, assim como os diversos aspectos envolvidos na epidemiologia da toxoplasmose e chamam a atenção para a existência de mecanismos de transmissão ainda não esclarecidos, enfatizando a necessidade de maiores estudos dessa zoonose.Serological examination for Toxoplasma gondii in human blood samples and in blood samples from ten different species of animals obtained in Manaus, State of Amazonas-Brazil, are compared with results obtained from similar examinations of blood from humans living in other areas of the Amazon basin. The domestic cat (Felis catus showed the highest levels of antibody for Toxoplasma gondii, whereas the domestic chicken (Gallus domesticus and duck (Cairina sp the lowest. The other animals showed similar intermediate levels of antibody to this protozoa. The authors discuss the results and several aspects of the involvement in epidemiology of toxoplasmosis and call attention to some transmission mechanisms not yet elucidated.

  17. Etnobotánica del "coro" (Nicotiana paa, Solanaceae: Un tabaco silvestre poco conocido del extremo sur de Sudamérica

    Directory of Open Access Journals (Sweden)

    Gustavo F. Scarpa

    2011-07-01

    Full Text Available El "coro" es un tabaco silvestre de Argentina y Chile cuyas raíces son empleadas como fumatorio y mascatorio desde tiempos inmemoriales por grupos indígenas. Si bien existen noticias sobre su empleo desde la época colonial, en la actualidad no hay consenso sobre su identidad botánica a la par que sus modalidades de obtención, procesado y consumo han sido escasamente descriptas. Se efectuaron campañas etnobotánicas al sudoeste de la provincia del Chaco donde se colectaron ejemplares que responden a dicho nombre vernáculo en compañía de indígenas y se analizaron fuentes bibliográficas históricas disponibles. Se comprobó in situ que los mocovíes actualmente fuman sus raíces mezcladas con tabaco tanto en contextos ceremoniales como extra-ceremoniales. Como resultado del análisis bibliográfico se infiere que también lo emplearon en el pasado de manera homóloga indígenas vilelas, qom (tobas; wichi y abipones. Se descarta la correspondencia del "coro" con especies de Trichocline por la inexistencia de registros etnobotánicos al respecto. Se confirma que este fumatorio corresponde a Nicotiana paa Mart. rov. y se presentan y discuten nuevos datos sobre su obtención, procesamiento y consumo.

  18. Efecto del fotoperiodo y la temperatura sobre la composición bioquímica en reproductores silvestres de cabrilla sardinera, Mycteroperca rosacea (Streets, 1877

    Directory of Open Access Journals (Sweden)

    José Antonio Estrada-Godínez

    2014-03-01

    Full Text Available Se estimó el factor de condición (K, el índice gonadosomático (IGS, hepatosomático (IHS y de grasa visceral (IGV, así como la composición bioquímica en diferentes tejidos de reproductores silvestres de cabrilla sardinera, Mycteroperca rosacea, para evaluarlos a lo largo de un ciclo reproductivo y ver la relación que presentan los cambios con respecto a la temperatura del agua y fotoperiodo de la zona de muestreo. Se capturaron 187 reproductores, 146 hembras y 41 machos en el golfo de California, México. Se observaron diferencias significativas (P < 0,005 en los IGS, IHS e IGV; en el caso de K no se encontraron diferencias. También, se observaron variaciones significativas (P < 0,05 en la mayoría de los parámetros bioquímicos, encontrándose los valores más altos durante la etapa de desove, mientras que los más bajos durante la etapa de reposo. Todos los índices estimados y los parámetros bioquímicos determinados, se correlacionaron significativamente (P < 0,05 con el fotoperiodo, mientras que solo se encontraron correlaciones significativas (P < 0,05 entre el IGS e IGV con respecto a la temperatura del agua.

  19. Desenterrado os mortos: A reconstrução do passado político brasileiro na obra de Edney Silvestre

    Directory of Open Access Journals (Sweden)

    Gabriela Antunes

    2014-07-01

    Full Text Available Este artigo tem como objetivo analisar a trilogia de estreia de Edney Silvestre, composta por Se eu fechar os olhos agora (2009, A felicidade é fácil (2011, e Vidas provisórias (2013. Pretende-se fazer um breve balanço da contribuição do autor para a reabertura de um debate sobre o recente passado histórico-político brasileiro, e, relacionando os fatos abordados no romance com temas contemporâneos, ressaltar a relevância e a atualidade desse debate. Para isso, os textos serão analisados cronologicamente, o que visa mostrar o desenvolvimento do tratamento do sujeito histórico no conjunto de obras do autor.   This paper aims to analyse Edney Silvestre’s trilogy composed by If I close my eyes now (2009, Happiness is easy (2011, and Temporary lives (2013, as well as to review the author’s contribution in reopening a debate on Brazilian’s recent historical and political past. By pointing out the relationship between the facts mentioned in thenovels and contemporary Brazil, it aims to stress the importance and up-to-dateness of this discussion. In order to achieve these goals, the novels will be analysed chronologically, which also intends to reveal the development of the way the author deals with Brazilian history throughout his oeuvre.

  20. Híbridos somáticos obtenidos por fusión de protoplastos entre Solanum tuberosum L. subsp. tuberosum y la especie silvestre Solanum circaeifolium Bitter

    Directory of Open Access Journals (Sweden)

    Rosa Espejo

    2013-03-01

    Full Text Available Con la finalidad de obtener híbridos somáticos interespecíficos, se fusionaron protoplastos de la especie tetraploide Solanum tuberosum y de la especie silvestre diploide Solanum circaeifolium utilizando polietilenglicol. Los productos de fusión fueron cultivados en el medio V-KM suplementado con albúmina de suero bovino. Las primeras divisiones celulares ocurrieron a los 3 a 4 días de cultivo. Después de la formación de colonias se observó una rápida proliferación de callos, a partir de los cuales se regeneraron 19 plantas. El análisis molecular usando RAPD, confirmó que los regenerantes presentaban segmentos de ADN de ambos parentales, sugiriendo su posible naturaleza de híbridos somáticos. Las observaciones del número de cromosomas indicaron que todos los híbridos fueron aneuploides. En condiciones de invernadero, los regenerantes derivados de la fusión de protoplastos, mostraron características morfológicas intermedias entre las líneas parentales. Este estudio muestra la producción de híbridos somáticos de papa con el método de fusión presentado.

  1. Ecología trófica del jabalí europeo (Sus scrofa silvestre en Chile Trophic ecology of the wild boar (Sus scrofa in Chile

    Directory of Open Access Journals (Sweden)

    ÓSCAR SKEWES

    2007-09-01

    Full Text Available Documentamos la dieta del jabalí silvestre en el centro-sur de Chile basados en el examen de 20 estómagos colectados en los faldeos de volcán Mocho-Choshuenco (39°54' S, 72°02' O y en el Parque Nacional Vicente Pérez Rosales (41°03' S, 71°54' O. La dieta está representada por animales, vegetales y hongos. Entre los vegetales y hongos son consumidas tanto las partes epígeas como hipógeas, lo mismo que frutos y semillas. Hongos y rizomas de Gunnera tinctoria constituyen ítemes vegetales cuantitativamente importantes en la alimentación. El jabalí forrajea en general en ambiente boscoso, pero las especies vegetales más frecuentes en la dieta se encuentran en espacios abiertos o fuera del bosque. El ambiente dominado por Chusquea spp. constituye un importante sitio de alimentación. Los roedores de la familia Muridae dominan entre los animales determinados en la dieta del jabalí. Esta situación, sin embargo, parece obedecer a la ocurrencia de una ratada producto de la semillación masiva de Chusquea spp. durante la época de muestreo. Las aves de la familia Rhinocryptidae e invertebrados (en especial larvas del coleóptero Chiasognathus grantii constituyen parte frecuente de los ítemes animales de la dieta del jabalí. En comparación a estudios en otras partes del mundo, el jabalí silvestre en Chile consume hongos en porcentaje de ocurrencia similar (65 % a su dieta en Estados Unidos de América pero bastante más alta que su dieta en Europa (5-32 %. En relación al volumen del componente animal, el jabalí en Chile consume más (16,1 % que en Estados Unidos de América (6 % y que en Europa (7-13 %We document the diet of wild boar in south-central Chile based on analysis of 20 stomachs collected on the outskirts of Mocho-Choshuenco volcano (39°54' S, 72°02' W and of Vicente Pérez Rosales National Park (41°03' S, 71°54' W. The diet incorporates animals, plants and fungi. Among the latter two, both epigeal and hypogeal parts

  2. Crecimiento y mortalidad de la concha nácar Pteria sterna en bancos silvestres de Baja California Sur, México

    Directory of Open Access Journals (Sweden)

    Humberto Wright-López

    2009-09-01

    Full Text Available La concha nácar Pteria sterna sustenta los perlicultivos en México, y es la base de producción de perlas en el continente Americano. Está bajo protección especial desde 1994, y solo puede capturarse semilla natural para cultivo e investigación. Determinamos su crecimiento y mortalidad en bancos silvestres, registrando la altura de ostras de Santa Rosalía, Mulegé y Bahía de Loreto (1997-99. La longitud máxima estimada fue 130.35 mm (124.22-136.48 mm, P>0.95. Las frecuencias de longitudes se ordenaron en un "año virtual" (Guanco 1991. Los parámetros de crecimiento de von Bertalanffy estimados con el programa ELEFAN I fueron: L∞= 156.02 mm, k=0.48año-1, t0=-0.216 años, C= 0.43 y WP = 0.73; el índice de desempeño de crecimiento fue Φ’ = 4.068. La mortalidad total fue de Z = 3.34 año -1por longitud convertida a curva de captura. La regresión del peso total y la altura tuvo la expresión W = 0.000756 * L(i2.7075 (r²=0.90, n=233. Mostramos la diferencia entre los parámetros de crecimiento en condiciones de repoblamiento experimental y aquellos de individuos silvestres de P. sterna. El valor de mortalidad total es comparable a aquellos de Pinctada fucata en el mar Rojo o P. radiata en el mar Mediterráneo.Growht and mortality of the mollusk Pteria sterna in wild banks of Southern Baja California, Mexico. The Gulf of California nacre shell Pteria sterna is an important marine resource in Mexico, and the main species for "half" and round pearl production in the American continent. Wild spat can only be extracted legally for research or culture activities. This study calculates growth and mortality parameters for wild stocks in the eastern coast of Southern Baja California. Height’s data (353 dorso-ventral measurements were taken from 1997 to 1999 at Santa Rosalía, Mulegé and Loreto Bay coast. The maximum length was estimated at 130.35 mm (124.22-136.48 mm, p>0.95. The length frequency data were set in a "virtual year

  3. Observações sobre calazar em Jacobina, Bahia. VI - Investigações sobre reservatórios silvestres e comensais

    Directory of Open Access Journals (Sweden)

    I. A. Sherlock

    1988-03-01

    Full Text Available Durante os anos de 1982 a 1986, a investigação sobre mamíferos comensais e silvestres, da periferia da cidade de Jacobina, Bahia, mostrou, ao lado do escasso número de exemplares, uma reduzida variedade específica dessa fauna. Capturou-se apenas 11 espécies, entre as quais, predominou o Didelphis albiventris, que abrangeu 44% dos 213 espécimens capturados. Entre os 193 com exames já concluídos, 84 eram exemplares de D. albiventris e 2 estavam infectados pela Leishmania donovani senso lato, 1 por L. mexicana amazonensis, 1 por L. braziliensis, subespécie e 3 por Trypanosoma cruzi Também foram observadas formas suspeitas de serem amastigotas de leishmanics, nos esfregaços de órgãos de 3 exemplares de Dasyprocta aguti, 1 Cercomys cunicularius - e 1 Oryzomys eliurus. 0 restante dos exemplares, inclusive 14 de Lycalopex vetulus, estava negativo para flagelados. Apesar de reforçado por outros indicadores epidemiológicos, como a predominância específica, a freqüência domiciliar, a atratividade para a vetora Lutzomyia longipalpis, e a concomitância com casos humanos nos mesmos locais, o índice de 2,3% de infecção natural do Didelphis albiventris, não autoriza a conclusão definitiva de ser o marsupial o mais importante reservatório natural da leishmaniose visceral em Jacobina.

  4. Pasado y presente del uso de plantas silvestres con órganos subterráneos de almacenamiento comestibles en la Patagonia

    Directory of Open Access Journals (Sweden)

    Juan J. Ochoa

    2011-07-01

    Full Text Available El presente trabajo es la primara aproximación acerca del papel de las plantas con órganos de almacenamiento subterráneos comestibles (POAS en la Patagonia, desde una perspectiva temporal y espacial, al integrar datos etnohistóricos y etnográficos actuales ligados al uso de las POAS. El 75 % de las 54 fuentes analizadas mencionan el uso de POAS en la alimentación humana de la Patagonia. Las POAS silvestres comestibles registradas ascienden a 51 especies, siendo mayor el conjunto de POAS con raíces comestibles. La estepa y zonas ecotonales resultaron las de mayor riqueza de POAS, probablemente vinculado a adaptaciones ecológicas de éstas a la aridez en el primer caso, como a la alta diversidad relativa que presentan los ecotonos, en el segundo. El registro etnohistórico mostró discontinuidades marcadas, siendo pocas las especies presentes por más de un siglo, destacándose la continuidad documental de A. tuberosa desde el siglo XVIII al presente, así como la incorporación reciente de especies exóticas. Las fuentes etnohistóricas revisadas y su contraste con datos etnobotánicos recientes de campo sugieren dinamismo en los patrones de utilización, que a lo largo del tiempo han llevado al abandono del uso de las POAS en la práctica alimentaria de la Patagonia. Las singularidades encontradas respecto a lo temporal y espacial pueden vincularse tanto a los conocimientos locales y específicos desarrollados a lo largo del tiempo por los habitantes de la Patagonia, como también a las circunstancias sociopolíticas y académicas de cada una de las fuentes analizadas.

  5. Prevalencia y distribución de los principales agentes etiológicos que afectan los langostinos silvestres en Tumbes, Perú

    Directory of Open Access Journals (Sweden)

    Rubén Alfaro Aguilera

    2011-05-01

    Full Text Available Se determinó la prevalencia y distribución de diferentes agentes patógenos en langostinos silvestres, en la zona de esteros de la Región Tumbes - Perú, entre marzo y diciembre de 2009. Los canales de marea considerados en este estudio fueron: Boca del Río Tumbes, El Alcalde, Jelí, El Bendito, Envidia, Soledad y Algarrobo. Se colectó un total de 1926 langostinos entre juveniles y pre-adultos de las especies Litopenaeus vannamei, L. stylirostris y Farfantepenaeus californiensis. Utilizando la técnica de la PCR, se detectó la presencia de los patógenos NHPB (0,62%, IHHNV (0,31%, BP (1,61% y WSV (2,75%; no se encontró infección por TSV. Las tres especies en estudio fueron positivas a WSV y BP, presentándose la mayor prevalencia de infección por WSV (2,98% en la especie L. stylirostris y por BP (2,66% en L. vannamei. La NHPB fue detectada en las especies L. vannamei y L. stylirostris con 0,77% y 0,43% de prevalencia respectivamente. Se obtuvo una prevalencia de 0,52% para IHHNV en L. vannamei. Las más altas prevalencias de las infecciones por WSV, BP, NHPB e IHHNV se registraron en los canales de marea El Alcalde (10,79%, Algarrobo (4,51%, Envidia (2,26% y Jelí (5,05%. Los datos señalan la presencia constante de diversos patógenos virales y bacterianos en diferentes especies de peneidos y su amplia distribución a lo largo del litoral tumbesino, lo que constituye un riesgo potencial para el desarrollo de la acuicultura en la región, y podría afectar las poblaciones naturales de langostinos.

  6. Epidemiología molecular de la rabia urbana en Colombia, 1994-2004. La rabia en ecosistemas silvestres como amenaza para la población humana

    Directory of Open Access Journals (Sweden)

    Jorge Boshell

    2004-03-01

    Full Text Available

    En Colombia la rabia ocurre en dos ciclos epidemiológicos principales: la rabia urbana con el perro como principal reservorio y transmisor principalmente a humanos, y la rabia silvestre con especies animales de la vida silvestre como los quirópteros y zorros entre otros, como reservorios y transmisores principalmente a especies ganaderas y eventualmente a humanos que se convierten en víctimas accidentales. Durante los últimos años la rabia silvestre en Colombia ha cobrado mayor relevancia como problema de salud pública que la rabia urbana, a juzgar por el número de víctimas humanas. Con el fin de perfeccionar el diagnóstico y la tipificación del virus de la rabia en Colombia, el Laboratorio Nacional de Referencia del Instituto Nacional de Salud estandarizó técnicas para amplificar y secuenciar un fragmento de ADN complementario (cADN a una fracción de 902 nucleótidos seleccionados del ARN del virus, con el fin de adelantar estudios de epidemiología molecular. La fracción mencionada contiene secuencias que codifican para los aminoácidos 447-525 de la glicoproteína y 1-35 de la proteína L. Además contiene la región intergénica no codificante conocida como Pseudogen Psi.

    Las técnicas estandarizadas fueron las siguientes: a extracción de ARN total a partir de cerebro de ratón infectado. b amplificación molecular por transcripción reversa y reacción en cadena de la polimerasa. c secuenciación del fragmento amplificado.

    Mediante estas técnicas de epidemiología molecular viral se determinó que durante 1994-2004, la rabia urbana se concentró en tres regiones geográficas definidas, con epizootias en el antiplano cundiboyacense, departamento de Arauca y la región Caribe. Las dos primeras se controlaron

  7. PROECHIMYS SEMISPINOSUS (RATÓN DE ESPINAS: UNA ESPECIE DE FAUNA SILVESTRE CON POTENCIAL PROMISORIO PARA COMUNIDADES NEGRAS DEL DEPARTAMENTO DEL CHOCÓ, PACÍFICO COLOMBIANO

    Directory of Open Access Journals (Sweden)

    Asprilla-Perea Jeferson

    2012-12-01

    Full Text Available Se valoró el potencial de Proechimys semispinosus (ratón de espinas como especiepromisoria para el departamento del Chocó, según su uso tradicional en comunidadesnegras y a través de ensayos de laboratorio como aporte nutricional de su carne. Laalimentación es el principal uso que los pobladores de estas comunidades le dana la especie, y la trampa de cajón es la técnica de cacería que más se utiliza parasu captura. El sabor de la carne de este roedor goza de buena aceptación por partede sus consumidores, y no se han asociado enfermedades humanas a la ingesta dela misma. A nivel socioeconomico, aunque es una importante fuente de proteinapara las comunidades, su carne no se comercializa con frecuencia. Los ensayosde laboratorio mostraron que su carne posee características bromatológicas (20%proteínas, 78% humedad, 0.40% grasas, 0.97% Cenizas y 3.34 Kcal/100 g similaresa carnes domésticas de origen porcino, vacuno y aviar, así como también a otrassilvestres como la guagua (Cuniculus paca y el cuy (Cavia porcellus. Por lotanto, P. semispinosus es una especie de fauna silvestre con potencial promisoriopara comunidades negras en el departamento del Chocó, ya que es ampliamenteutilizado como alimento en localidades rurales de la región (que es la mayor partedel territorio y su carne cuenta con un importante valor nutricional

  8. Informe sobre la fiebre amarilla silvestre en la región del Meta, desde julio 1934 hasta diciembre de 1936

    Directory of Open Access Journals (Sweden)

    Jorge Boshell Manrique

    1938-02-01

    Full Text Available En agosto de 1934 el Padre Francisco Savary, misionero de la Compañía Montfort, da la voz de alarma acerca de unos casos de fiebres que se han presentado en unas veredas del vecindario de Restrepo y cuyo cuadro clínico corresponde al descrito en el capítulo de fiebre amarilla de su Manual de Misionero. Se practica una primera investigación encontrando, en efecto, manifestaciones mórbidas que sugieren fiebre amarilla. El brote presenta una característica extraña que confunde a primera vista la investigación, en un momento en que la noción de la fiebre silvestre, o sea sin Aedes aegypti, no está aún generalizada. No se encuentra tal zancudo en la región. A consecuencia de un informe de la Dirección Nacional de Higiene, el Dr. E. R. Rickard, médico de la Fundación Rockefeller, baja a Villavicencio y me deja instrucciones precisas, con elementos de investigación. En esta época el autor era Director Intendencial de Higiene. Se toman 30 muestras de sangre distribuídas entre personas convalecientes de ataques de la enfermedad, entre personas que moraban en las casas en que habían ocurrido casos y entre compañeros de trabajo de personas atacadas. De las muestras sometidas a la prueba de inmunidad para fiebre amarilla, 20 resultaron positivas, 2 inconclusivas y 8 negativas. Estos resultados traen por consecuencia el establecimiento de una comisión de investigación epidemiológica en la región de Restrepo.

  9. Diversidad y aspectos biológicos de abejas silvestres de un ambiente urbano y otro natural de la región central de Santa Fe, Argentina

    Directory of Open Access Journals (Sweden)

    Milagros DALMAZZO

    2010-01-01

    Full Text Available El objetivo del presente trabajo fue relevar el elenco de abejas silvestres en la región central de Santa Fe y comparar la diversidad de especies y aspectos biológicos en dos ambientes de una misma región. Las abejas fueron colectadas en el estrato herbáceo de la Reserva Universitaria “Escuela Granja” de la localidad Esperanza, y en la zona urbana de la localidad Susana, ambas ubicadas dentro de la Provincia Fitogeográfica del Espinal. La colecta se realizó en octubre, noviembre y diciembre de 2004 y en enero, febrero y marzo de 2005, registrando las especies vegetales sobre las que se capturaron. Se colectaron 277 ejemplares en total, de los cuales se identificaron 62 especies (27 géneros en 5 familias. Las curvas de rarefacción indican una tasa de acumulación de especies mayor para la Reserva Ecológica, los índices de diversidad de Shannon son 3,25 para la Reserva Ecológica y 2,64 para la Zona Urbana. Para la comparación de las comunidades en ambos sitios, las abejas fueron clasificadas en tres categorías según la especialización en el uso del recurso floral, sustrato de nidificación y comportamiento social. Se observó una asociación entre los grupos especialistas y de nidificación en el suelo con el ambiente natural, y por otro lado, las especies generalistas y de nidificación en cavidades con el ambiente urbano. No se identificaron diferencias, en cuanto al tipo de comportamiento social de las especies, entre ambos sitios.

  10. Determinación de anticuerpos contra patógenos virales y bacterianos seleccionados en la población de cerdos silvestres (Sus scrofa de la Reserva Natural Bahía Samborombón, Argentina

    Directory of Open Access Journals (Sweden)

    B. Carpinetti

    2017-06-01

    Full Text Available Los cerdos silvestres (Sus scrofa descienden de cruzamientos entre cerdos domésticos liberados durante la colonización con jabalíes salvajes euroasiáticos, liberados con propósitos cinegéticos. Son invasivos y su coexistencia con especies domésticas implica riesgos sanitarios. Argentina es considerada libre de fiebre aftosa (FA, peste porcina clásica (PPC y africana (PPA y síndrome reproductivo y respiratorio porcino (PRRS. La enfermedad de Aujeszky (EA y la leptospirosis son endémicas en ciertas áreas del país. El objetivo fue evaluar la presencia de ciertas enfermedades zoonóticas y/o de importancia para la producción animal y la conservación de la biodiversidad en cerdos silvestres de la Bahía de Samborombón. Se capturaron 118 animales. Se tomaron muestras de suero, tonsilas, músculo, intestino delgado, linfonódulos, entre otras. Se estudió la presencia de anticuerpos contra Brucella spp., coronavirus respiratorio porcino, virus de la estomatitis vesicular, de la FA, de la gastroenteritis transmisible porcina (TGEV, de la PPC, PPA, EA, PRRS y Leptospira spp. Se realizaron análisis bacteriológicos para Mycobacterium spp. Los resultados ratificaron la ausencia de las enfermedades exóticas e indicaron que 36 % de los animales presentó anticuerpos contra Leptospira interrogans serovar pomona y 62,5 % contra el virus de la EA. Estos resultados remarcan la importancia del monitoreo de la interfase productiva/silvestre en función de la salud pública, producción animal y conservación de la biodiversidad.

  11. Análisis de la dinámica de poblaciones silvestres de Chigüiros Hydrochaeris hydrochaeris (Linnaeus, 1766 como herramienta de manejo hacia el aprovechamiento sostenible y la conservación

    Directory of Open Access Journals (Sweden)

    Elizabeth Mesa González

    2006-01-01

    Full Text Available Se analizó el comportamiento de la dinámica de poblaciones silvestres de chigüiros bajo diferentes condiciones del hábitat y presiones antrópicas, y se formuló una herramienta técnica para apoyar la gestión de manejo que realiza la autoridad ambiental regional relacionada con el aprovechamiento sostenible y la conservación de la especie. Se generó un modelo de simulación determinístico que representa la dinámica de poblaciones silvestres de chigüiros, como resultado de procesos biológicos de natalidad y mortalidad, y del aprovechamiento extractivo anual de individuos en hatos de los municipios de Paz de Ariporo y Hato Corozal (Casanare, Colombia. Una interfase fue diseñada para facilitar el uso del modelo y construir escenarios para simular diferentes alternativas de manejo. El modelo fue usado para evaluar el efecto a largo plazo de la cosecha o extracción de individuos mediante la caza comercial, la cosecha selectiva de adultos por sexos, la presencia de adecuaciones y la variación del área de hábitat adecuado disponible sobre la tendencia de abundancia de tres poblaciones silvestres de chigüiros en la zona de estudio. Las simulaciones realizadas bajo los diferentes escenarios permitieron establecer las distintas respuestas de cada población a los cambios realizados en la tasa de cosecha y el área de hábitat y así recomendar acciones de manejo. Los escenarios evaluados destacan la importancia de hacer una extracción selectiva de adultos por sexos para realizar un aprovechamiento sostenible de la población y garantizarsu conservación. Así mismo, se destaca la importancia de mantener mayores áreas con hábitat adecuado.

  12. Evaluación de respuestas bioquímicas y anormalidades cito-genótóxicas en mejillón silvestre "mytilus galloprovincialis" como biomarcadores de contaminación ambiental

    OpenAIRE

    Fernández Galindo, Beatriz

    2012-01-01

    En esta Tesis Doctoral se ha estudiado una batería de biomarcadores en branquias y glándula digestiva de mejillón silvestre de la costa mediterránea y noratlántica española para detectar el impacto y efectos biológicos de los principales tipos de contaminantes químicos. Las aportaciones que recoge esta Tesis incluyen que los biomarcadores investigados presentan un comportamiento diferente en branquias y glándula digestiva, y que su respuesta integrada en ambos tejidos refleja los efectos biol...

  13. Determinación de anticuerpos contra patógenos virales y bacterianos seleccionados en la población de cerdos silvestres (Sus scrofa) de la Reserva Natural Bahía Samborombón, Argentina

    OpenAIRE

    B. Carpinetti; G. Castresana; P. Rojas; J. Grant; A. Marcos; M. Monterubbianesi; H. R. Sanguinetti; M. S. Serena; M. G. Echeverría; M. Garciarena; A. Aleksa

    2017-01-01

    Los cerdos silvestres (Sus scrofa) descienden de cruzamientos entre cerdos domésticos liberados durante la colonización con jabalíes salvajes euroasiáticos, liberados con propósitos cinegéticos. Son invasivos y su coexistencia con especies domésticas implica riesgos sanitarios. Argentina es considerada libre de fiebre aftosa (FA), peste porcina clásica (PPC) y africana (PPA) y síndrome reproductivo y respiratorio porcino (PRRS). La enfermedad de Aujeszky (EA) y la leptospirosis son endémic...

  14. Frecuencia de Varroa destructor, Nosema apis y Acarapis woodi en colonias manejadas y enjambres silvestres de abejas (Apis mellifera en Mérida, Yucatán, México

    Directory of Open Access Journals (Sweden)

    Jesús Froylán Martínez Puc

    2011-01-01

    Full Text Available Las enfermedades y parasitosis que afectan a las abejas melíferas causan importantes pérdidas económicas a la actividad apícola. Sin embargo, los daños provocados por dichas parasitosis se presentan de manera heterogénea en colonias manejadas y en enjambres silvestres. Con la finalidad de determinar la frecuencia y niveles de infestación de V. destructor, N. apis y A. woodi en abejas melíferas en Yucatán, se colectaron un total de 76 muestras de abejas melíferas, durante junio a septiembre de 2006, siendo 27 de colonias manejadas y 49 de enjambres silvestres. La frecuencia de V. destructor en colonias manejadas fue de 62.9 %, con un nivel de infestación de 1.70 ± 0.26 (ácaros/100 abejas, y en los enjambres silvestres fue de 55.1 %, con un nivel de infestación de 1.96 ± 0.44. No se observaron diferencias en la frecuencia (X2 = 0.44, gl = 1, P =0.51, y niveles de infestación (t=0.14, P=0.89. La frecuencia de N. apis en las colonias manejadas fue de 74.0 %, con una media de infestación de 1´480 x 103 ± 232 x 103 (esporas/ abeja, y en los enjambres silvestres de 53.0 %, con una media de infestación de 1´416 x 103 ± 264 x 103, no se observaron diferencias en la frecuencia (X2 = 3.22, gl = 1, P= 0.07 y niveles de infestación (t=0.18, P=0.86. No se detectó la presencia de A. woodi en las muestras analizadas. Los resultados demuestran un aumento en la frecuencia de N. apis en Yucatán.

  15. Identificación de escenarios de calidad de hábitat para fauna silvestre : caso de estudio| cuenca media y alta del río Otún (Risaralda)

    OpenAIRE

    García Gómez, Martha Patricia

    2009-01-01

    Este trabajo contiene eje clave de investigación las dinámicas espaciales de cambio en la calidad del hábitat para fauna silvestre, a partir de la transformación de coberturas dentro de las áreas protegidas (sistemas naturales) y los sistemas reproductivos. Se presenta la estructura de un modelo basado en la utilización de software SIG. Lógica difusa y Agentes Inteligentes a partir del cual se logra la simulación de escenarios de calidad de hábitat para la especie ?zorros? en la cuenca media ...

  16. Caracterización de sitios de percha del guajolote silvestre (Meleagris gallopavo mexicana) en Sierra Fría, Aguascalientes, México Roost sites characteristics of wild turkey (Meleagris gallopavo mexicana) in Sierra Fria, Aguascalientes, Mexico

    OpenAIRE

    Marcelo Márquez-Olivas; Edmundo García-Moya; Carlos González-Rebeles Islas; Humberto Vaquera-Huerta

    2007-01-01

    Entre octubre y noviembre del año 2001 y mayo de 2002 se localizaron 16 sitios de percha de guajolote silvestre (Meleagris gallopavo mexicana) en la Sierra Fría de Aguascalientes. El 87.5% de los sitios se encontraron en bosques de pino-encino (en rodales de pinos), en altitudes de 2500 a 2650 m. En la parte alta (2/3) de la cuesta se localizaron 8 de los sitios y 7 sobre laderas de exposición noreste, en una pendiente promedio de 38.9 ± 12.6%. El 62.5% de los sitios se usaron durante todo el...

  17. Micrometeorología de masas forestales de pino silvestre (Pinus sylvestris L.) y rebollo (Quercus pyrenaica Willd.) en la vertiente norte del Sistema Central (Montes de Valsaín, Segovia). Consecuencias selvícolas

    OpenAIRE

    Gómez Sanz, Valentín

    2011-01-01

    La Tesis trata sobre el estudio y evaluación de los patrones microescálicos de variabilidad, tanto espacial como temporal, que bajo diferentes cubiertas forestales de pino silvestre (Pinus sylvestris L.) y rebollo (Quercus pyrenaica Wild.), presentan las variables de estado de uso más frecuente en la caracterización de] sistema atmósfera-superficie terrestre. Se ha buscado con ello analizar cualitativa y cuantitativamente el efecto modificador que, sobre la respuesta micrometereológica bajo e...

  18. Utilización de especies silvestres diploides cultivadas de papa a fin de transferir resistencia a las heladas a la papa común cultivada (Solanum tuberosum l.

    Directory of Open Access Journals (Sweden)

    Estrada Ramos Nelsón

    1986-12-01

    Full Text Available Las heladas constituyen un factor limitante importante para la producción de papa en las altiplanicies y cordilleras andinas de Suramérlca. Por su efecto, se pierde cerca de 20% de la
    producción. Se ha informado de unas 30 especies silvestres de papa que poseen alta resistencia a las heladas. La utilización de especies de papa silvestres muy valiosas y con
    resistencia a las heladas es más eficiente y factible, si se cruzan inicialmente con clones de la especie dlplolde cultivada Sol.num phureJ. Juz. et Buk. Los híbridos F1, pueden resultar dlploides, trlploides o tetraploides, los cuales en su mayoria
    se pueden cruzar nuevamente con clones o cultivares tetraploides de S. tuberoaum L. Mediante este método se pueden transferir rápida y fácilmente la mayoria de genes que controlan la resistencia a las heladas e incorporarlos en la papa comunmente cultivada S. tuberoaum L.

  19. Mesocestoides sp. (Eucestoda, Mesocestoididae parasitizing four species of wild felines in Southern Brazil Mesocestoides sp. (Eucestoda, Mesocestoididae parasitando quatro espécies de felinos silvestres no Sul do Brasil

    Directory of Open Access Journals (Sweden)

    Moisés Gallas

    2011-06-01

    Full Text Available Leopardus colocolo, Leopardus geoffroyi, Leopardus tigrinus and Puma yagouaroundi are wild feline species endangered mainly due to habitat destruction and vehicle run overs. Seventeen felines hit on the roads were collected in Southern Brazil and examined for parasites. Cestodes were identified as Mesocestoides sp. The parasites were found in the small intestine of the hosts with a prevalence of 66.7% (L. colocolo and L. tigrinus, 60% (P. yagouaroundi and 50% (L. geoffroyi. Rodents and lizards were found in the stomach contents and they possibly were intermediate hosts of Mesocestoides sp. This is the first report of Mesocestoides sp. in wild felines in Brazil.As espécies Leopardus colocolo, Leopardus geoffroyi, Leopardus tigrinus e Puma yagouaroundi, são felídeos silvestres ameaçados de extinção, principalmente pela destruição do hábitat e morte em rodovias. Dezessete felídeos foram coletados atropelados no sul do Brasil e, analisados na pesquisa de parasitos. Cestóides encontrados foram identificados como Mesocestoides sp. Os parasitos foram encontrados no intestino delgado dos hospedeiros com prevalência de 66,7% (L. colocolo e L. tigrinus, 60% (P. yagouaroundi e 50% (L. geoffroyi. Roedores e lagartos foram encontrados no conteúdo estomacal, podendo ser os hospedeiros intermediários para Mesocestoides sp. Este é o primeiro registro de Mesocestoides sp. em felídeos silvestres no Brasil.

  20. Memoria espacial en monos capuchinos de Argentina: un estudio observacional en vida silvestre / Spatial memory in capuchin monkeys (Argentina:a wildlife observational study

    Directory of Open Access Journals (Sweden)

    María P. Tujague

    2016-03-01

    Full Text Available La memoria espacial se considera un factor selectivo en la evolución de la inteligencia. Los estudios en animales permiten pensar que los procesos cognitivos descriptos en humanos comparten características con los de otras especies. Se estudió el comportamiento espacial vinculado a la búsqueda del alimento de los monos capuchinos y su capacidad de retener información sobre la ubicación y estado del mismo. Durante los seguimientos de tres grupos de Cebus nigritus silvestres se aplicó un diseño observacional cualitativo que evaluó las cantidades de fruta madura e inmadura presentes en los árboles frutales consumidos por los monos en sus desplazamientos diarios. Las visitas a los árboles de frutos indicaron que los monos retienen información particular sobre la ubicación y condición de cada árbol. Los resultados obtenidos son fundamentales para la comprensión del funcionamiento de los mecanismos cognitivos no mediados por el lenguaje, lo cual permite ampliar los conocimientos de la base biológica del comportamiento espacial no humano. Palabras clave: Cebus=Sapajus nigritus; árboles frutales; velocidad de acercamiento; visita Spatial memory is considered a selective factor in the evolution of intelligence. Animal studies lead us to believe that cognitive processes described in humans may have much in common with those of other species. We studied the foraging spatial behavior of capuchin monkeys and their ability to retain information about food location and quality. We analyzed whether individuals were able to integrate stored information about food sites and changes in the ripening of the resource. A qualitative observational design was used to monitor three groups of wild Cebus nigritus in their daily movements, evaluating the amounts of ripe and unripe fruit present in the fruiting trees consumed by monkeys. Visits to fruiting trees showed that monkeys remember specific information on the location and condition of each tree

  1. Investigações sôbre o comportamento de formas adultas de mosquitos Silvestres no Estado de Sao Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Oswaldo Paulo Forattini

    1968-12-01

    Full Text Available Apresentaram-se os resultados das observações sobre o comportamento de formas adultas de Culicidae silvestres na área de Casa Grande, de zona de florestas primitivas situada na parte nordeste do Estado de São Paulo, Brasil. As investigações focalizaram os mosquitos de hábitos diurnos e crepusculares-noturnos, durante o período de 1963 a 1966. Foram obtidos dados concernentes à composição especifica, distribuição, ciclo anual da densidade, estratificação vertical na floresta e possíveis relações com o ambiente doméstico. A região estudada é considerada como bioma ou ecossistema do Anopheles (Kerteszia cruzii e, dessa maneira, êsse mosquito compareceu de maneira predominante nas observações, merecendo por isso especial atenção. As outras espécies distribuiram-se predominantemente entre os Sabethini, além de alguns Culicini. No que concerne à domesticidade, o Anopheles cruzii apresentou-se como apreciável freqüentador das casas, seguido pelo Aedes serratus. Além disso, aquele anofelino mostrou-se acentuadamente acrodendrófilo, parecendo ser dotado de alguma ornitofilia.This work reports observations on adult Culicidae activities for diurnal and crepuscular-nocturnal forest species occurring in the area of Casa Grande, located at the Northeast region of the State of São Paulo, Brazil. These investigations, were carried out during the 1963 to 1966 period. They recorded the specific composition, distribution, year cycle of abundance, vertical stratification in the forest, and the possible relationship of these forest mosquitoes to the housekold environment. Since these region is considered a biome of the Anopheles (Kerteszia cruzii particular attention was dedicated to this species, considered as an important malaria vector. Beside this, several Sabethini species proved to be considerably abundant and, along with some culicines as Aedes serratus, showed activities that may put these mosquitoes in relation with humans

  2. Fenología de la floración en tomate cultivado y especies silvestres relacionadas Flowering phenology in cultivated tomato and related wild species

    Directory of Open Access Journals (Sweden)

    Edwin Fernando Restrepo Salazar

    2008-06-01

    Full Text Available En un diseño experimental de bloques completos al azar se comparó la fenología de la floración de doce accesiones silvestres de Solanum sección Lycopersicum con la del tomate cultivado tipo “chonto”. Los tratamientos se repitieron tres veces. Se evaluó la aparición de las 12 primeras inflorescencias y el tipo de inflorescencia. Las fenologías de las accesiones de la variedad glabratum de S. habrochaites (PI 134417, PI134418 y PI126449, las accesiones LA1624, LA2092 de la variedad typicum de S. habrochaites y la accesión LA 444-1 de S. peruvianum coincidieron con la del tomate “chonto”. No se presentaron diferencias significativas en la variable días a inicio de floración entre las accesiones de la variedad glabratum y el tomate cultivado. Las accesiones de la variedad glabratum de S. habrochaites y el tomate cultivado presentaron inflorescencias simples; mientras que las accesiones de la variedad typicum de S. habrochaites y de la especie S. peruvianum presentaron inflorescencias bifurcadas.The flowering phenology of twelve wild accesions of Solanum section Lycopersicum were compared with those of the cultivated tomato type of “chonto” by using the randomized complete block design. The treatments were repeated three times. The appearance initiate of the first twelve inflorescences and kind of inflorescence were evaluated. The phenologies of the accesions of the glabratum variety from S. habrochaites (PI 134417, PI134418 y PI126449, LA1624 y LA2092 of the typicum variety from S. habrochaites and LA 444-1 from S. peruvianum coincided with those of the “chonto” tomato. There were no significant differences between the glabratum variety accessions and cultivated tomato in the starting days of flowering variable. The accesions of the glabratum variety from S. habrochaites and the cultivated tomato presented simple inflorescences; while the accesions of the typicum variety from S. habrochaites and S. peruvianum specie showed

  3. Comportamento reológico de méis de florada de silvestre Rheological behavior of honey from Serjania glabrata flowers

    Directory of Open Access Journals (Sweden)

    Alexandre J. de M. Queiroz

    2007-04-01

    Full Text Available Estudou-se o comportamento reológico de méis de Apis mellifera produzidos no estado do Piauí, no semi-árido brasileiro, elaborados com florada predominante de silvestre (Serjania glabrata. As amostras foram coletadas ao longo do ano 2000, a partir de coletas realizadas por apicultores, associações e cooperativas de apicultura da região abrangida pelos municípios de Picos, Itainópolis, Vera Mendes e Isaías Coelho. Após as coletas as amostras passaram pelos processos de centrifugação, filtragem e decantação. As medidas reológicas foram feitas nas temperaturas de 20 a 40 ºC utilizando-se um viscosímetro Brookfield, modelo RVT. As leituras de velocidade de rotação e torque foram transformadas em valores de taxa de deformação e tensão de cisalhamento. Os dados de taxa de deformação e tensão de cisalhamento foram ajustados pelas equações da Lei-da-Potência e de Herschel-Bulkley. As amostras apresentaram comportamento pseudoplástico. As equações se ajustaram adequadamente aos resultados experimentais de tensão de cisalhamento em função da taxa de deformação. O aumento de temperatura reduziu a viscosidade aparente em níveis próximos de 80%. Os valores de viscosidade aparente foram bem ajustados por uma equação do tipo Arrhenius.The rheological behavior of Apis mellifera honey produced in the State of Piauí, in the Brazilian semi-arid, obtained with predominance of Serjania glabrata flowers was studied. The samples were collected in the year 2000 by beekeepers and associations and cooperatives of beekeepers in the area covered by the municipal districts of Picos, Itainópolis, Vera Mendes and Isaías Coelho. The samples were centrifuged, filtered, decanted and the rheological measures at temperatures of 20 to 40 ºC using a Brookfield Viscometer RVT model were made. The readings of rotation speed and torque were transformed in shear rate and shear stress values. The data of shear rate and shear stress were fitted

  4. Da ictiologia ao etnoconhecimento: saberes populares, percepção ambiental e senso de conservação em comunidade ribeirinha do rio Piraí, Joinville, Estado de Santa Catarina - DOI: 10.4025/actascibiolsci.v26i3.1594 From ichthyology to ethnoknowledge: popular knowledge, environmental perceptions and sense of environmental conservation of river land inhabitants - DOI: 10.4025/actascibiolsci.v26i3.1594

    Directory of Open Access Journals (Sweden)

    Luciana Pinheiro

    2004-04-01

    Full Text Available Este trabalho tem por objetivo descrever os potenciais do conhecimento empírico ou prático relacionados à ictiofauna e, de um modo mais amplo, à percepção ambiental da população ribeirinha do rio Piraí, Município de Joinville, Santa Catarina, Brasil. Partindo de uma pesquisa prévia, que teve como resultado um inventário ictiológico preliminar desse rio, foram elaborados os procedimentos metodológicos relativos à dimensão qualitativa do estudo. Com base nos depoimentos dessa população ribeirinha, obtidos mediante entrevista semi-estruturada, organizaram-se as categorias de análise com vistas a uma proposta de tipologia etnográfica. Essa tipologia foi utilizada na análise dos depoimentos dos sujeitos da pesquisa, concluindo-se que o estudo ictiológico desenvolvido sob uma perspectiva de diálogo com o saber popular dos ribeirinhos pode ser muito profícuo, em face do senso de conservação ambiental atrelado à sustentabilidade de seu modo de vidaThe purpose of this paper is to describe the potential of empirical knowledge or practice related to fishes and, in more general terms, the environmental perceptions of the population living alongside the Piraí river, Joinville, Santa Catarina, Brazil. Its point of departure is initial research that resulted in a preliminary ichthyological inventory of the river, from which methodological procedures relative to the qualitative dimension of the study were developed. Based on the testimony of the river land inhabitants, obtained through semi-structured interviews, analytical categories providing an ethnographic typology were developed. This typology was then used in the analysis of the testimony of the study's informants, arriving at the conclusion that an ichthyological study based on dialogue with popular knowledge can be very valuable, given the local people's sense of environmental conservation as it is linked to their sustainable life style

  5. Ocorrência de linhagens humana e silvestre de Schistosoma mansoni, na pré-amazônia: I - estudo em moluscos Occurrence of wild and human strains of Schistosoma mansoni in lower Amazonia: I - study in moluscs

    Directory of Open Access Journals (Sweden)

    Othon de Carvalho Bastos

    1982-10-01

    Full Text Available Foram isoladas na região da Baixada Maranhense (Brasil, linhagens humana (H e silvestre(S de Schistosoma mansoni a partir de miracídios eclodidos de ovos encontrados em fezes de doentes humanos autóctones da Região e de fígados de roedores silvestres naturalmente infectados. Biomphalaria glabrata, descentes de caramujos coletados no campo, foram expostos, isoladamente, aos miracídios H e S, mantidos isolados em moluscário e observados durante 100 dias. Moluscos normais foram mantidos nas mesmas condições de ambiente em que foram submetidos os infectados e tomados como controle da experiência. Foram anotados os indices de infecção dos moluscos, as datas da eliminação de cercárias, quantidade de larvas eliminadas e mortalidade dos moluscos. Os dados sugeriram melhor adaptação do esquistossomo da linhagem H à B. glabrata. A linhagem S, por sua vez, foi três vezes mais virulenta do que a linhagem H. Estes dados foram comparados com os encontrados na literatura especializada e verificado diversidades nos comportamentos parasitológicos das linhagens em estudo, quando comparados com os encontrados nas linhagens H e S oriundas do Vale do Rio Paraíba do Sul, no Estado de São Paulo (Brasil.The wild (W and human (H strains of Schistosoma mansoni were isolated in the Lowland Region of the Maranhão State (Brazil. The snail progenies from Biomphalaria glabrata collected from that region were exposed to the W miracidia, obtained from livers of wild rodents, and H miracidia from eggs in human stools. A control gruop of normal snails was kept in the same conditions as the infected one. The date of the elimination of cercariae, the quantity of eliminated larvae, the infection index of the moluscs and the mortality rate of the snails were recorded. These data suggested better adaptation of the H strain to B. glabrata. The W strain presented three times more virulence to snails than the H strain. These results were compared with published

  6. Procedencia y uso de madera de pino silvestre y pino laricio en edificios históricos de Castilla y Andalucía

    Directory of Open Access Journals (Sweden)

    Rodríguez Trobajo, Eduardo

    2008-12-01

    Full Text Available The productive cycle of Scots pine (Pinus sylvestris L. and black pine (Pinus nigra Arn. within the medieval Castilian and Andalusian carpentry is here analysed. New criteria to identify both timbers and its dendrochronological date are shown as previous facts to determine their geographical origin. Historical names of these species and other names, such as alerce, with a vague allocation are also studied. Main historical areas of resource and river ways of Tajo and Guadalquivir used to transport the wood (black pine to interior cities (Sevilla, Toledo, Madrid … are thus identified. On the other hand, wood’s diversification and its selective use is analysed regarding its resistance value. Availability also determines that a sort of wood becomes fossil-guide (especie-guía, which is proposed as chronological indicator for several periods and constructive contexts. Some timber remains dating to the first millennium are studied in detail. They belong to the Mosque of Cordoba and four early medieval churches sited in the Duero valley (La Nave, Baños, Quintanilla and Barriosuso. The empiric dating and analysis of this material offer a post quem chronology for the building of these churches and new facts about the distribution of theses wood’s species in the north-western Iberian peninsula.Se realiza un recorrido a través del ciclo constructivo de las maderas de pino silvestre (Pinus sylvestris L. y pino laricio (Pinus nigra Arn. en el ámbito de la carpintería medieval de Castilla y Andalucía. Nuevos criterios para diferenciar las dos especies de madera y su datación dendrocronológica, son aportados como datos previos para determinar el origen geográfico del material. Son objeto de discusión los nombres históricos de estas especies y otras voces, como alerce, que tienen una imprecisa asignación. Se identifican así las principales áreas históricas de aprovechamiento y las vías fluviales del Tajo y Guadalquivir utilizadas para el

  7. Observações sobre calazar em Jacobina, Bahia. VI - Investigações sobre reservatórios silvestres e comensais

    Directory of Open Access Journals (Sweden)

    I. A. Sherlock

    1988-03-01

    Full Text Available Durante os anos de 1982 a 1986, a investigação sobre mamíferos comensais e silvestres, da periferia da cidade de Jacobina, Bahia, mostrou, ao lado do escasso número de exemplares, uma reduzida variedade específica dessa fauna. Capturou-se apenas 11 espécies, entre as quais, predominou o Didelphis albiventris, que abrangeu 44% dos 213 espécimens capturados. Entre os 193 com exames já concluídos, 84 eram exemplares de D. albiventris e 2 estavam infectados pela Leishmania donovani senso lato, 1 por L. mexicana amazonensis, 1 por L. braziliensis, subespécie e 3 por Trypanosoma cruzi Também foram observadas formas suspeitas de serem amastigotas de leishmanics, nos esfregaços de órgãos de 3 exemplares de Dasyprocta aguti, 1 Cercomys cunicularius - e 1 Oryzomys eliurus. 0 restante dos exemplares, inclusive 14 de Lycalopex vetulus, estava negativo para flagelados. Apesar de reforçado por outros indicadores epidemiológicos, como a predominância específica, a freqüência domiciliar, a atratividade para a vetora Lutzomyia longipalpis, e a concomitância com casos humanos nos mesmos locais, o índice de 2,3% de infecção natural do Didelphis albiventris, não autoriza a conclusão definitiva de ser o marsupial o mais importante reservatório natural da leishmaniose visceral em Jacobina.From 1982 to 1986, investigations on the natural infection with leishmanias of the sylvatic and commensal mammals were carried out around the city of Jacobina, Bahia, one of the oldest endemic foci of visceral leishmaniasis in Brazil. The species of Marsupialia Didelphis albiventris predominated, with the rate of 44%, over the total of 213 specimens belonging to only 11 different species of mammals collected there. Among the 84 specimens of D. albiventris examined, 2(2.3% were infected with Leishmania donovani sensu lato; 1 with L. mexicana amazonensis, 1 with L. braziliensis sub species, and 3 with Trypanosoma cruzi. Also, amastigote suspected bodies were

  8. Characterization of rust, early and late leaf spot resistance in wild and cultivated peanut germplasm Caracterização da resistência à ferrugem, mancha preta e mancha castanha em germoplasma silvestre e cultivado de amendoim

    Directory of Open Access Journals (Sweden)

    Alessandra Pereira Fávero

    2009-02-01

    Full Text Available Groundnut (Arachis hypogaea has an AB genome and is one of the most important oil crops in the world. The main constraints of crop management in Brazil are fungal diseases. Several species of the genus Arachis are resistant to pests and diseases. The objective of our experiments was to identify wild species belonging to the taxonomic section Arachis with either A or B (or " non-A" genomes that are resistant to early leaf spot (Cercospora arachidicola, late leaf spot (Cercosporidium personatum and rust (Puccinia arachidis. For the identification of genotypes resistant to fungal diseases, bioassays with detached leaves were done in laboratory conditions, with artificial inoculation, a controlled temperature of 25ºC and a photoperiod of 10 h light/14 h dark, for 20-42 days, depending on the fungi species. Most of the accessions of wild species were more resistant than accessions of A. hypogaea for one, two or all three fungi species studied. Arachis monticola, considered to be a possible tetraploid ancestor or a derivative of A. hypogaea, was also more susceptible to Cercosporidium personatum and Puccinia arachidis, as compared to most of the wild species. Therefore, wild germplasm accessions of both genome types are available to be used for the introgression of resistance genes against three fungal diseases of peanut.O amendoim (Arachis hypogaea possui genoma AB e é uma das mais importantes culturas oleaginosas em todo o mundo. Os principais problemas da cultura no Brasil são as doenças fúngicas. Várias espécies do gênero Arachis são resistentes a pragas e doenças. Este trabalho visou a identificar espécies silvestres pertencentes à seção Arachis associadas aos genomas A ou B (ou " não-A" do amendoim que são resistentes à mancha castanha (Cercospora arachidicola, mancha preta (Cercosporidium personatum e ferrugem (Puccinia arachidis. Para a identificação de genótipos resistentes a doenças fúngicas, bioensaios utilizando

  9. Epidemiologia da raiva: caracterização de vírus isolados de animais domésticos e silvestres do semi-árido paraibano da Região de Patos, Nordeste do Brasil

    OpenAIRE

    Albério Antonio de Barros Gomes

    2004-01-01

    No semi-árido paraibano há poucos relatos de ocorrência da raiva, há quem afirme que os caprinos, ovinos e asininos são resistentes à doença e a prática de vacinação é incomum. Este trabalho visou estudar a situação da raiva na região semi-árida de Patos-PB, estabelecendo o diagnóstico desta enfermidade em diferentes espécies de animais domésticos e silvestres. Foram capturados 12 exemplares de raposas (Dusicyon vetulus), por meio de armadilha; 192 morcegos insetívoros (Molossus molossus), ca...

  10. ¿Es la cobertura forestal conservada y restaurada por las zonas protegidas?: El caso de dos áreas silvestres protegidas en el Pacífico Central de Costa Rica

    Directory of Open Access Journals (Sweden)

    J Antonio Guzmán Q

    2015-09-01

    Full Text Available Resumen:Cambios en el uso del suelo son principalmente consecuencia de las acciones antropogénicas. La actual transformación agrícola y urbana en Costa Rica ha generado preguntas acerca de la efectividad de la conservación y restauración dentro de las áreas protegidas. En este documento nosotros analizamos los patrones de cambio del uso del suelo entre tres periodos: 1997, 2005 y 2010 en términos de magnitud, dirección y velocidad a través de mapas categóricos generados por la foto-interpretación para dos áreas silvestres protegidas y sus áreas aledañas: Parque Nacional La Cangreja (LCNP, el Refugio de Vida Silvestre Rancho Mastatal (RMWR y sus áreas aledañas (SA, esta última compuesta por área de un kilómetro de radio fuera de los límites de las áreas protegidas. La matriz que describe el paisaje dentro de las áreas protegidas es la cobertura natural, compuesta principalmente por la cobertura forestal y tacotales. Encontramos que la cobertura natural más abundante para ambas áreas protegidas fue cubierta forestal en todos los años estudiados. La estabilidad y las grandes áreas de la cubierta forestal en LCNP y RMWR para 2005 y 2010 reflejan que las políticas, las acciones de manejo y vigilancia tienen un impacto positivo en la conservación y restauración de los hábitats naturales en esta zona del Pacifico Central Costarricense. Sin embargo, la alta complejidad del paisaje de SA en 1997, 2005 y 2010 son una prueba de presión antropogénica sobre estas áreas protegidas y sugieren una ineficacia de los gobiernos locales para monitorear y disminuir los cambios de uso del suelo que podrían obstaculizar la gestión, conservación y restauración de especies dentro de las áreas protegidas.

  11. Trypanosomatidae de importancia en salud pública en animales silvestres y sinantrópicos en un area rural del municipio Tovar del estado Mérida, Venezuela.

    Directory of Open Access Journals (Sweden)

    Héctor de Lima

    2006-03-01

    Full Text Available Introducción. La enfermedad de Chagas y la leishmaniasis son patologías de gran importancia en salud pública debido a su alta frecuencia y amplia distribución en América Latina. El estudio de los animales reservorios es vital para una comprensión global de estas enfermedades. Objetivo. En el presente trabajo nos propusimos identificar parásitos de la familia Trypanosomatidae en animales silvestres con la finalidad de establecer posibles relaciones debidas a la coinfección. Materiales y métodos. En El Carrizal, un área rural del estado Mérida, Venezuela, entre julio de 1998 y febrero de 2000 se realizaron capturas sistemáticas de animales silvestres con la finalidad de poner en evidencia la presencia de parásitos pertenecientes a la familia Trypanosomatidae. Las capturas fueron realizadas con trampas caseras tipo Tomahawk, colocadas 15 noches por mes durante el periodo del estudio. A los animales capturados se les practicó punción cardiaca bajo anestesia para extracción de sangre con la cual se realizaron los siguientes estudios: examen en fresco, extendido para coloración con Giemsa y cultivo en agar-sangre. Se realizaron algunos xenodiagnósticos. Los aislamientos obtenidos por medio de cultivo se identificaron por medio de análisis de restricción e hibridación con sondas específicas. Resultados. Se capturaron y estudiaron 215 animales pertenecientes a tres especies: Rattus spp. (135, Sigmodon hispidus (73 y Didelphis marsupialis (7. Igualmente, se identificaron tres especies de Trypanosomatidae: Leishmania (V guyanensis, Trypanosoma cruzi y Trypanosoma lewisi. Mientras T. cruzi fue identificado en D. marsupialis (4/7, S. hispidus (1/73 y Rattus spp. (1/135, L.(V guyanensis y T. lewisi sólo se identificaron en Rattus spp. (1/ 135 y 12/135, respectivamente. Conclusión. El estudio de la coexistencia de estas diferentes especies de flagelados genéticamente relacionados nos parece de importancia por las interacciones inmunol

  12. Contribución de Graells a la posición de España en el primer convenio internacional para la protección de ciertas especies de la fauna silvestre (1902

    Directory of Open Access Journals (Sweden)

    Ferrero-García, J. J.

    2012-12-01

    Full Text Available The process followed by Spain to decide whether it should subscribe the International Convention for the Protection of Birds Useful to Agriculture, signed in 1902 is described. The fundamental role played by Mariano de la Paz Graells, one of the foremost Spanish naturalists of the 19th century, in the technical review and acceptance of the draft agreement, drawn up in 1895, is highlighted. Furthermore, a critical analysis of Graells’s position in relation to this so-called first international convention for the conservation of certain wildlife species, has been carried out.

    Se describe el proceso que siguió España para decidir si debía suscribir el Convenio Internacional para la Protección de las Aves Útiles a la Agricultura, firmado en 1902. Se pone de manifiesto el papel fundamental que tuvo Mariano de la Paz Graells, uno de los más importantes naturalistas españoles del siglo XIX, en el examen técnico y aceptación del proyecto de dicho convenio, redactado en 1895. Además, se ha realizado un análisis crítico de la postura de Graells en relación con la que puede calificarse como la primera convención internacional para la conservación de ciertas especies de la fauna silvestre.

  13. CARACTERIZAÇÃO MORFOLÓGICA DE ACESSOS DE GERMOPLASMA DE QUATRO ESPÉCIES BRASILEIRAS DE AMENDOIM-SILVESTRE MORPHOLOGICAL CHARACTERIZATION OF GERMPLASM ACESSIONS OF FOUR BRAZILIAN SPECIES OF WILD PEANUT

    Directory of Open Access Journals (Sweden)

    RENATO FERRAZ DE ARRUDA VEIGA

    2001-01-01

    Full Text Available Caracterizaram-se morfologicamente os acessos de germoplasma de espécies silvestres brasileiras de amendoim do gênero Arachis L., Sect. Arachis e analisaram-se a similaridade genética entre acessos da mesma espécie e entre as espécies. Realizou-se o experimento nos anos agrícolas de 1993 a 1996, no Núcleo Experimental de Campinas, do Instituto Agronômico (IAC. Avaliaram-se os acessos disponíveis no Banco Ativo de Germoplasma de Espécies Silvestres de Arachis, da Embrapa Recursos Genéticos e Biotecnologia (CENARGEN - Brasília, DF, das espécies A. palustris Krapov., W.C. Gregory & Valls, A. decora Krapov., W.C. Gregory & Valls, A. praecox Krapov., W.C. Gregory & Valls e A. stenosperma Krapov. & W.C. Gregory, efetuando-se anotações fenotípicas quantitativas e qualitativas, conforme lista de descritores morfológicos. Observou-se que os acessos de A. stenosperma são semelhantes, apesar da sua grande distância geográfica, e diferem das demais espécies, formando um grupo mais coeso. Caracteres como o diâmetro do eixo central e o comprimento dos frutos e das sementes serviram para distingui-la das demais espécies. Arachis decora apresentou alta variação entre acessos nos vários caracteres morfológicos estudados. A. palustris apresentou alta variação morfológica entre acessos, ainda que tenham sido analisados apenas dois, para altura da planta, largura da semente, dimensões do esporão, istmo, folíolo, raque e eixo central e quanto à presença e ausência de tricomas no folíolo. Arachis praecox, representada por um único acesso, aproximou-se mais de A. decora que das demais espécies.In this work, a morphological characterization of germplasm accessions of wild Brazilian species of peanut, section Arachis was accomplished. Also, an analysis of the genetic similarity among accessions and between species was evaluated. The experiment was undertaken from 1993 to 1996, at the Campinas Experimental Station of the Instituto

  14. Caracterización de sitios de percha del guajolote silvestre (Meleagris gallopavo mexicana en Sierra Fría, Aguascalientes, México Roost sites characteristics of wild turkey (Meleagris gallopavo mexicana in Sierra Fria, Aguascalientes, Mexico

    Directory of Open Access Journals (Sweden)

    Marcelo Márquez-Olivas

    2007-06-01

    Full Text Available Entre octubre y noviembre del año 2001 y mayo de 2002 se localizaron 16 sitios de percha de guajolote silvestre (Meleagris gallopavo mexicana en la Sierra Fría de Aguascalientes. El 87.5% de los sitios se encontraron en bosques de pino-encino (en rodales de pinos, en altitudes de 2500 a 2650 m. En la parte alta (2/3 de la cuesta se localizaron 8 de los sitios y 7 sobre laderas de exposición noreste, en una pendiente promedio de 38.9 ± 12.6%. El 62.5% de los sitios se usaron durante todo el periodo de estudio y el resto, de manera ocasional. La mayoría de los dormideros se encontraron cerca de comederos o cebaderos y de parcelas agrícolas. Se contabilizaron de 1 a 23 árboles de percha utilizados por sitio, distribuidos a una distancia promedio de 24.4 ± 17.8 metros. El 81.2% de los árboles (n=170 fueron pinos (Pinus teocote, P. durangensis, P. leiophylla y P. michoacana, 17.6% encinos (Quercus laurina, Q. grisea y Q. eduardii y 1.2% madroños (Arbutus arizonica. La altura promedio de los árboles fue de 16.6 ± 4.4 m y el diámetro 43.2 ± 11.5 cm. La preferencia del guajolote silvestre por utilizar pinos como dormideros en lugar de otras especies arbóreas, se debe posiblemente a que son árboles de mayor porte o a la conformación de su dosel; sin embargo, se ha observado que en lugares donde hay pocos pinos, los guajolotes utilizan para dormir otros árboles de características semejantes, como encinos, madroños o sicomoros.Sixteen roosting sites of Gould's wild turkey (Meleagris gallopavo mexicana were found between October and November of 2001 and May of 2002 in Sierra Fría, Aguascalientes. A large percentage (87.5% of the roost sites was located in oak-pine forest (in pine stands, at an elevation range of 2500 to 2650 meters. Eight roost sites were on the upper portion (2/3 of the ridge, and 7 at northeast exposures with an average slope of 38.9 ± 12.6%. Most (81.2% of the roost trees (n =170 were pines (Pinus teocote, P

  15. Variabilidade genética de acessos silvestres e comerciais de Passiflora edulis Sims. com base em marcadores RAPD Genetic variability of wild and commercial passion fruit (Passiflora edulis Sims. accessions using RAPD markers

    Directory of Open Access Journals (Sweden)

    Graciele Bellon

    2007-04-01

    Full Text Available No Cerrado brasileiro, há uma grande diversidade de cores, tamanhos e aromas de frutos em acessos silvestres de P. edulis. Estes acessos também são importantes fontes de resistência a doenças, podendo ser incorporados em programas de melhoramento genético do maracujazeiro azedo. Neste trabalho, objetivou-se estimar a variabilidade genética existente em acessos silvestres e comerciais de P. edulis utilizando-se de marcadores RAPD. O DNA genômico de cada acesso foi extraído e amplificado com treze iniciadores decâmeros (OPD-04, OPD-07, OPD-08, OPD-16, OPE-18, OPE-20, OPF-01, OPF-14, OPG-05, OPG-08, OPH-04, OPH-12 e OPH-16 para a obtenção dos marcadores RAPD. Os marcadores obtidos foram convertidos em uma matriz de dados binários, a partir da qual foram estimadas as distâncias genéticas entre os acessos e realizadas análises de agrupamento e de dispersão gráfica. Um total de 187 marcadores foi gerado, sendo que apenas 28 (14,97% deles foram monomórficos. As distâncias genéticas entre os 15 acessos de maracujazeiro variaram de 0,091 a 0,496. Os marcadores moleculares demonstraram a alta variabilidade genética dos acessos de P. edulis, sendo que os acessos de frutos amarelos apresentaram maior distanciamento em relação aos de frutos roxos. Menores distâncias genéticas foram verificadas entre os acessos de mesma origem geográfica.There are a great diversity of colors, sizes and aromas of fruits in wild accessions of P. edulis in Brazilian Savannah. These accessions are also important resistance sources against illness which can be incorpored in passionfruit breeding programs. In this work, the objetive was to evaluate the genetic variability in wild and commercial P. edulis accessions using RAPD markers. The genomic DNA of each accession was extracted and amplified using thirteen decamer primers (OPD-04, OPD-07, OPD-08, OPD-16, OPE-18, OPE-20, OPF-01, OPF-14, OPG-05, OPG-08, OPH-04, OPH-12 and OPH-16 to obtain RAPD markers

  16. Caracterización morfológica y evaluación de resistencia a Fusarium oxysporum en especies silvestres del género Solanum sección Lycopersicon

    Directory of Open Access Journals (Sweden)

    Maria Natalia Morales Palacio

    2014-01-01

    Título corto: Caracterización morfológica y evaluación de resistencia a Fusarium oxysporum Resumen:  Con el objetivo de evaluar la variación morfológica y la resistencia a Fusarium oxysporum en la colección del banco de germoplasma de la Universidad Nacional de Loja (UNL, 146 accesiones de cuatro especies silvestres fueron seleccionadas (Solanum pimpinellifolium, S. neorickii, S. habrochaites, S. lycopersicum var. cerasiforme; y, 20 accesiones de tomate cultivado (S. lycopersicum. Un total de 723 plántulas se transplantaron al campo y se evaluaron morfológicamente durante todo su ciclo biológico, con un descriptor que incluyó 20 caracteres cuantitativos y 25 cualitativos. Se estimó la variabilidad morfológica y se detectaron diferencias fenotípicas relacionadas con el fruto, características vegetativas de las plantas y los componentes del rendimiento. Las variables morfológicas mostraron que S. habrochaites es la especie más diferenciada con relación a las restantes. La podredumbre vascular causada por F. oxysporum es responsable de enormes pérdidas en la producción de tomate en el mundo; sin embargo, las especies silvestres que originaron las variedades cultivadas poseen genes de interés agronómico, utilizados por décadas para la generación de variedades resistentes. Por ello, entre 64 y 228 individuos por especie, se evaluaron por tres procedimientos de inoculación. Todas las especies fueron significativamente diferentes en los niveles de resistencia, tolerancia o susceptibilidad. S. neorickii fue más resistente y tolerante, seguida de S. pimpinellifolium y S. lycopersicum var. cerasiforme, mientras que todas las variedades cultivadas (S. lycopersicum fueron susceptibles. Tales circunstancias permitieron determinar sin lugar a dudas, que las plantas sobrevivientes y tolerantes poseen un genotipo particular que determina esa característica. Palabras clave:  Ecuador, tomate, tolerancia, susceptibilidad, inoculación. Abstract: In order

  17. Periodicidade e intensidade de oocistos do gênero Isospora Schneider, 1881 eliminados nas fezes de passeriformes oriundos do tráfico de animais silvestres e mantidos em quarentena.

    Directory of Open Access Journals (Sweden)

    Cleide Domingues Coelho

    2016-12-01

    Full Text Available Frequência diurna tem sido observada em espécies de parasitos intestinais, especialmente no gênero Isospora Schneider, 1881 em aves selvagens, que eliminam oocistos nas fezes mais frequentemente no final da tarde. Este estudo teve como objetivo avaliar a periodicidade e a eliminação de oocistos por pássaros mantidos no Centro de Triagem de Animais Silvestres, Seropédica, Rio de Janeiro, Brasil triagem. Amostras de uma defecação foram coletadas de 602 pássaros, no período da manhã entre 9 e 12h e à tarde entre 15 e 17h, de maio a novembro de 2010. As amostras foram diluídas em dicromato de potássio a 2,5% 1: 6 (v/v e incubou-se à temperatura ambiente durante sete dias. De cada amostra foi também determinada a OoPD (número de oocistos por defecação, onde observou –se que as amostras fecais coletadas na parte da manhã tiveram um número menor de amostras positivas (12/2% em comparação com àquelas coletadas no fim da tarde os quais apresentaram um maior número de amostras positivas (136/23%, da mesma forma, que os OoPDs de pássaros das famílias Cardinalidae, Emberizidae e Thraupidae também foram diferentes em intensidade. Ambos os resultados indicaram que a periodicidade e a intensidade de oocistos em passeriformes foram extremamente significativas (p<0,0001, quando eles foram determinados usando amostras coletadas no período da tarde.

  18. Preferencias en la anidación de tortugas carey (Eretmochelys imbricata y baulas (Dermochelys coriacea en el Refugio Nacional de Vida Silvestre Gandoca Manzanillo, Limón, Costa Rica

    Directory of Open Access Journals (Sweden)

    Lilliana Piedra-Castro

    2015-09-01

    Full Text Available El Caribe costarricense es importante como sitio de alimentación, copulación, anidación y desove de las tortugas marinas, por lo que el presente trabajo pretendió actualizar el patrón de anidación en las tortugas marinas Dermochelys coriacea y Eretmochelys imbricata en el sector Gandoca, del Refugio Nacional de Vida Silvestre Gandoca Manzanillo, Limón, Costa Rica, para proponer medidas de manejo. Se realizaron recorridos nocturnos entre las 8:00 p. m. y 4:00 a. m., la playa se dividió en cinco sectores, en estos se realizaron observaciones directas y de rastros, de las tortugas que elaboraron el nido, entre febrero y agosto del 2011 y 2012. Se registraron tres especies de tortugas marinas, Dermochelys coriacea, Eretmochelys imbricata y Chelonia mydas. La anidación de tortugas baula tuvo su punto máximo entre marzo y julio; por su parte, las carey, entre mayo y junio (2011, y junio hasta agosto en el 2012. Se observó preferencia en la posición de la playa utilizada para construir sus nidos; la baula utiliza principalmente la parte media, mientras que la carey utilizó mayormente la parte baja para anidar (t = 17.2525. Se observó que la baula utilizó frecuentemente el sector C; sin embargo, no se encontraron diferencias en el uso de los sectores. Se concluye que ambas especies tienen preferencias en la selección de la zona de playa en que anidan; la carey en la parte baja cerca de la línea de costa y la baula en la parte media. Además, las tortugas baula utilizan indistintamente los diferentes sectores de la playa estudiada.

  19. Identificação de roedores silvestres como hospedeiros do Angiostrongylus costaricensis no sul do Brasil Identification of wild rodents as hosts of Angiostrongylus costaricensis in the South of Brazil

    Directory of Open Access Journals (Sweden)

    Carlos Graeff-Teixeira

    1990-06-01

    Full Text Available Um número crescente de casos de angiostrongilíase abdominal tem sido detectado no sul do Brasil. O principal hospedeiro do Angiostrongylus costaricensis na América Central, o rato do algodão (Sigmodon hispidus, não ocorre na América do Sul, exceto no norte do Peru, Colômbia e Venezuela. Foram realizadas capturas na área endêmica do Rio Grande do Sul (RS, visando identificar hospedeiros para obtenção de vermes em laboratório e produção de antígeno. Pela primeira vez no Brasil foi constatada a infecção em roedores: Oryzomys nigripes e Oryzomys ratticeps. O. nigripes é um roedor silvestre de pequeno porte e parece ser o principal hospedeiro definitivo do A. costaricensis na região serrana do RS.Increasing number of human cases of abdominal angiostrongyliasis has been diagnosed in the south of Brazil. The main definitive host of Angiostrongylus costaricensis in Central America is the cotton rat (Sigmodon hispidus that does not occur in South America, except in the north of Colombia, Peru and Venezuela. Rodents were captured in the endemic area in Rio Grande do Sul (RS and definitive hosts were identified for the first time in Brazil: Oryzomys nigripes and Oryzomys ratticeps. O. nigripes is a small wild rodent and it appears to be the main definitive host of A. costaricensis in the highlands of RS, Brazil's southermost State.

  20. Evaluación y valorización económica de la fauna silvestre en el río Algodón, Amazonía peruana

    Directory of Open Access Journals (Sweden)

    Rolando Aquino

    2013-04-01

    Full Text Available El presente trabajo informa sobre los hábitats, abundancia cuantitativa y valorización económica de la fauna silvestre que habitan en la cuenca del río Algodón. El estudio está basado en la diferenciación de hábitats, entrevistas a cazadores y censos por transecto. En 7 de los 10 tipos de hábitats diferenciados fueron realizados censos, donde ocurrieron en total 327 avistamientos directos de mamíferos, aves y reptiles. Entre los mamíferos, el pecarí labiado (Tayassu pecari Link y el choro (Lagothrix lagotricha Humboldt fueron los más abundantes con 9,8 individuos/km2, equivalente a 323,4 kg/km2 de biomasa, y 18,4 individuos/km2 equivalente a 202,4 kg/km2 de biomasa, respectivamente. En aves, la mayor densidad correspondió a la pucacunga (Penelope jacquacu Spix con 5,4 individuos/km2, equivalente a 6,9 kg/km2 de biomasa. Sin considerar las especies nocturnas y algunas diurnas, en el área de estudio se estiman alrededor de 31891 animales de caza entre mamíferos y aves, cuyo valor económico fue estimado en US$ 349374. De ellos, 3479 individuos tienen el valor de comercial y pertenecen a cuatro especies de ungulados y uno de aves, el resto tienen el valor de subsistencia.

  1. Conducta alimenticia, supervivencia y crecimiento de juveniles silvestres de Graus nigra Philippi, 1887 en cautiverio (Perciformes: Kyphosidae Feeding behavior, survival, and growth of wild Graus nigra Philippi, 1887 juveniles in captivity (Perciformes: Kyphosidae

    Directory of Open Access Journals (Sweden)

    Héctor Flores

    2011-11-01

    Full Text Available Se colectaron juveniles silvestres de Graus nigra, que fueron aclimatados durante 30 días en estanques con flujo de agua abierto y a temperatura ambiente, siendo alimentados con alimento formulado. Los peces fueron separados en seis grupos que se mantuvieron en experimentación por 196 días. La supervivencia promedio fue de 80%. El crecimiento en longitud total mostró un incremento promedio del 93,3% para los juveniles grandes (grupos 4, 5 y 6 y 125% para los pequeños (grupos 1, 2 y 3. El crecimiento en peso total mostró un incremento promedio de 434% para los peces grandes (grupos 4, 5 y 6 y de 707% para los pequeños (grupos 1, 2 y 3. Se concluyó que G. nigra toleró el cautiverio y el manejo, con una supervivencia relativamente alta, lo que hace de ella una especie atractiva para la acuicultura chilena.Wild juveniles of Graus nigra were collected and acclimated for 30 days in ponds with open-water flow and ambient temperature; the specimens were given a formulated feed. Fish individuals were separated into six groups that were studied for 196 days. The average survival was 80%. The total length increased an average of 93.3% for large individuals (groups 4, 5, 6 and 125% for small ones (groups 1, 2, 3. The total weight showed an average increase of 434% for large fishes (groups 4, 5, 6 and 707% for small ones (groups 1, 2, 3. Graus nigra was found to tolerate captivity and handling, with a relatively high survival rate, making it an attractive species for aquaculture in Chile.

  2. Leishmania (Leishmania infantum chagasi em canídeos silvestres mantidos em cativeiro, no Estado de Mato Grosso Leishmania (Leishmania infantum chagasi in wild canids kept in captivity in the State of Mato Grosso

    Directory of Open Access Journals (Sweden)

    Nely Pinheiro Souza

    2010-06-01

    Full Text Available INTRODUÇÃO: Leishmaniose visceral é uma zoonose que acomete diversos mamíferos tendo os canídeos domésticos como principais reservatórios em ambiente urbano. A presente nota descreve a infecção de canídeos silvestres por Leishmania (Leishmania infantum chagasi mantidos em cativeiro no Estado de Mato Grosso, Brasil. MÉTODOS: De seis raposas (Cerdocyon thous e um cachorro vinagre (Spheotos venaticus, foram coletadas amostras de pele, medula óssea e linfonodo para detecção e caracterização de Leishmania sp pela técnica de PCR-RFLP. RESULTADOS: Todos as animais pesquisados apresentaram-se positivos para Leishmania (L. infantum chagasi. CONCLUSÕES: Destaca-se a importância de monitoramento adequado dos mesmos, além do maior controle desta enfermidade já que estes animais estão em ambientes de recreação pública.INTRODUCTION: Visceral leishmaniasis is a zoonosis that affects many mammals, and domestic canids are the main reservoirs in urban environments. This note describes infection by Leishmania (Leishmania infantum chagasi among wild canids kept in captivity in the State of Mato Grosso, Brazil. METHODS: Skin, bone marrow and lymph node samples were collected from six crab-eating foxes (Cerdocyon thous and one bush dog (Spheotos venaticus, in order to detect and characterize Leishmania using the PCR-RFLP technique. RESULTS: All the animals studied were positive for Leishmania (L. infantum chagasi. CONCLUSIONS: This study highlights the importance of adequate monitoring of these animals, as well as greater control of this disease, given that these animals are in a public recreation environment.

  3. Aspectos do ciclo silvestre do Trypanosoma cruzi em regiões de cerrado (Município de Formosa, Estado de Goiás Aspects of the sylvatic cycle of Trypanosoma cruzi in the region of cerrado (Formosa municipality, State of Goias

    Directory of Open Access Journals (Sweden)

    D. A. Mello

    1981-09-01

    Full Text Available Neste trabalho estão apresentados resultados de estudos sobre roedores, marsupiais e triatomíneos do norte do municipio de Formosa,Estado de Goiás, e sua importância no ciclo silvestre do T.cruzi. A região estudada esta localizada do ponto de vista geográfico, na "Provincia do Cerrado". Foram coletados 963 roedores, 11 marsupiais e 766 triatomíneos silvestres. O índice de infecção pelo T. cruzi entre os roedores foi de 0,1% e entre os marsupiais 36,3%, enquanto todos os triatomíneos estavam negativos. Face aos aspectos ecológicos estudados, discute-se o papel desempenhado por roedores e marsupiais na manutenção e circulação do T. cruzi em ambiente silvestre. Alguns aspectos epidemiológicos no ambiente doméstico foram também abordados.Studies were carried out on the role of rodents, marsupials and triatoma bugs in the wild cycle of Trypanosoma cruzi. The area studied, located in the county of formosa, State of Goiás, Brasil, belongs to the "Província do Cerrado". The following animals were collected and examined: 963 rodents, 11 marsupials and 766 wild triatomid bugs. The infection rates for T. cruzi were as follow: 36.3% for the marsupials, 0.1% for the rodents, while all the triatomids were negative. The role of the collected mammals in the maintenance and circulation of T. cruzi in the wild environment is discussed. In addition, some epidemiological aspects of the domestic environment were also studied.

  4. Characterization and cultivation of a wild mushroom species isolated in Brazil Caracterização e cultivo de uma espécie de cogumelo silvestre isolado no Brasil

    Directory of Open Access Journals (Sweden)

    Luzia Doretto Paccola-Meirelles

    2002-11-01

    Full Text Available Wild mushrooms were collected close to cattle manure in pasture areas in Tamarana (Paraná/Brazil, with the objective of finding and domesticating new non-exploited basidiomycetes. An edible basidiomycete of the Agaricales order was classified as belonging to the Macrolepiota bonaerensis species (=Lepiota procera, form bonaerensis (Speg. Rick or M. procera (Scop.:Fr Sing.. The mycelia was isolated and characterized for growth rate in different culture media. A vigorous growth was observed in PDA Medium (pH 5, ±25°C. The oat culture medium was the most appropriate for cultivation submersed. M. bonaerensis mycelia secretes lipase, cellulase and protease exoenzyme types. Cytological analyses confirmed the bi-nucleated condition of the mycelia, the presence of septa and clamp connections in the hypha. The fructification occurred in the substrate composed of sterilized humus + soil (1:9 plus casing layer with active carbon. Visando a busca e a domesticação de basidiomicetos ainda inexplorados, coletou-se cogumelos silvestres em regiões de pastagens e próximos a esterco de gado no município de Tamarana, PR. Um basidiomiceto comestível da ordem Agaricales foi classificado como pertencente à espécie Macrolepiota bonaerensis (=Lepiota procera, forma bonaerensis (Speg. Rick ou M. procera (Scop.:Fr. Sing.. O micélio foi isolado e caracterizado em relação à taxa de crescimento em diferentes meios de cultura. Observou-se um crescimento vigoroso em meio BDA (pH 5, ±25°C. O meio de aveia foi o mais adequado para cultivo submerso. O micélio de M. bonaerensis secreta enzimas dos tipos lipase, celulase e protease, e as análises citológicas confirmaram a condição binucleada do micélio, a presença de septos e de grampos de conexão nas hifas. A frutificação dos cogumelos ocorreu no substrato constituído de húmus + terra (1:9 esterilizados, acrescido de terra de cobertura e carvão ativado.

  5. Capítulo V: evaluación de especies silvestres de Lycopersicon sp. como fuente de resistencia al insecto plaga Scrobipalpula absoluta (Meyrick y su intento de transferencia a Lycopersicon esculentum Mill

    Directory of Open Access Journals (Sweden)

    Vallejo Cabrera Franco Alirio

    1994-12-01

    Full Text Available

    En condiciones de campo, se evaluaron 32 introducciones silvestres de Lycopersicon sp. y una de la especie cultivada, L. esculentum Mill, con el fin de determinar la resistencia a Scrobipalpula absoluta (Meyrick. Se utilizó el diseño experimental bloques completos al azar con 4 repeticiones. Como bordes se colocaron tres variedades comerciales susceptibles al insecto (Chonto "Mata Verde", Napoli Y Chonto "Santa Cruz Kada" con el fin de tener una fuente de infestación natural y permanente del cogollero dentro del experimento. Se evaluaron los caracteres número de cogollos afectados, número de hojas dañadas, número de ampollas e intensidad de daño. Todas las introducciones de L. hirsutum y L. peruvianum fueron altamente resistentes. Las introducciones 1406 y 1407 de L. pimpinellifolium también fueron altamente resistentes. La introducción 1759 de L. esculentum y L. esculentum var. ceraciforme fueron muy susceptibles. Las introducciones de L. pimpinellifolium y L. hirsutum no tuvieron dificultad para hibridarse con L. esculentum var. Tropic. El cruzamiento L. esculentum x L. peruvianum no presentó semilla híbrida y se requirió efectuar cultivo de embriones inmaduros, in vitro, utilizando el medio Murashige & Skoog pero sin lograrse resultados positivos.

    Thirty two (32 wild accessions of Lycopersicon sp. and one (1 cultivated accession of Lycopersicon esculentum Mill were evaluated to determinate the resistance to Scrobipalpula absoluta (Meyrick. The experiment was conducted with a complete random design and four repetitions. Three (3 susceptibles cultivated accessions of L. esculentum (Chonto "Mata Verde", Napoli and Chonto "Santa Cruz Kada" were sowed to have natural infestation of S. absoluta. Damage intensity, number of buds damaged, number of leaves demaged and number of "blister" in the leaves were evaluated, All evaluated accessions of L. peruvianum showed heigh resistence. 1406 and 1407 accessions of L. pimpinellifolium

  6. Microbiologia de swabs retais e otológicos em carnívoros silvestres do zoológico do Parque Estadual de Dois Irmãos, Pernambuco

    Directory of Open Access Journals (Sweden)

    Débora Costa Viegas de Lima

    2012-02-01

    Full Text Available O estudo epidemiológico de patógenos em populações selvagens no ambiente in situ e ex situ é fundamental para implementação de programas de prevenção, controle e monitoramento de enfermidades e para elaboração de políticas públicas de saúde pública e animal. O estudo foi realizado no zoológico do Parque Estadual de Dois Irmãos no período de janeiro a julho de 2011 onde foram coletados swabs anais e otológicos referentes a 29 carnívoros silvestres cativos do zoológico. Dos swabs otológicos analisados, 1/29 (3,4% foi positivo para Malassezia pachy dermatis no exame direto. No exame microbiológico dos swabs otológicos, observou-se maior freqüência para bactérias do gênero Bacillus 16/29 (55,2%, seguida de Sta phylococcus 15/29 (51,7%, Escherichia coli 7/29 (24,1%, Streptobacillus 1/29 (3,4%, Micrococcus 1/29 (3,4% e Klebsiella 1/29 (3,4%. Com relação ao exame presuntivo para o gênero Salmonella a partir das amostras de swab retal, observou-se positividade para seis raposas (Cerdocyon thous e um guaxinim (Procyon cancrivorus. O isolamento de Salmonella spp. em C. thous e em P. cancrivorus indica um risco à saúde pública, principalmente para os profissionais do zoológico que trabalham diretamente com esses animais. Essa pesquisa reforça a importância da criação de estratégias de vigilância epidemiológica voltadas para a prevenção, controle e monitoramento de potenciais reservatórios de agentes etiológicos de doenças infecciosas e parasitárias no ambiente dos zoológicos.

  7. ISOLATION AND IDENTIFICATION OF STRAINS OF Salmonella spp IN RED-FOOT-TORTOISES FROM WILDLIFE TRADE ISOLAMENTO E IDENTIFICAÇÃO DE CEPAS DE Salmonella spp DE JABUTIS-PIRANGA ORIUNDOS DO TRÁFICO DE ANIMAIS SILVESTRES

    Directory of Open Access Journals (Sweden)

    Oberdan Coutinho Nunes

    2010-04-01

    Full Text Available We investigated Salmonella sp. in red-foot tortoise (Chelonoides carbonaria because of the fact this particular reptile shows high frequency of illegal commerce, and also because this situation represents a serious risk for health. We collected feces of 89 turtles from the wildlife center “Chico Mendes” - IBAMA/SUPES-BA. Characteristic colonies of Salmonella sp. were isolated in 12.36% of the tortoises (11/89. Nine colonies were identificated at the Adolfo Lutz Institute, distributed into six different sorotypes: S. enterica salamae 47:b:-; S. enterica houtenae 21:g,z51; S. Panama; S. Poona; S. Javiana e S. Michigan. All of them, according to literature, without previous description of infection in C. carbonaria whatsoever. However, there are previous cases of infections and antibiotics resistance involving these sorotypes, confirming the risk represented by wildlife trade to public health concerning the children’s exposition to the source of infection as well as the dissemination of resistant sorotypes.

    KEY WORDS: Epidemiology, reptiles, zoonosis.

    Este trabalho objetivou investigar a ocorrência de Salmonella sp. em jabutis-piranga (Chelonoides carbonaria, dada sua elevada frequência no comércio ilegal e risco que representa para a saúde. Coletaram-se fezes de 89 jabutis mantidos no Centro de Triagem de Animais Silvestres Chico Mendes – IBAMA/SUPES-BA. Isolaram-se colônias características de Salmonella sp. em 12,36% dos jabutis (11/89. Destas, nove foram identificadas no Instituto Adolfo Lutz (São Paulo, distribuindo-se em seis diferentes sorovares: S. enterica salamae 47:b:-; S. enterica houtenae 21:g,z51; S. Panama; S. Poona; S. Javiana e S. Michigan, todas, segundo a literatura consultada, sem prévia descrição para C. carbonária. No entanto, estão presentes em relatos de infecções e em estudos sobre resistência a antibióticos, confirmando o risco representado pelo tráfico de animais para a sa

  8. Teste de ELISA indireto para diagnóstico sorológico de leishmaniose visceral em canídeos silvestres Indirect ELISA for the serological diagnosis of visceral leishmaniasis in wild canids

    Directory of Open Access Journals (Sweden)

    Paulo R.B. Ferreira

    2013-04-01

    Full Text Available Na América do Sul, alguns canídeos silvestres são considerados reservatórios naturais da Leishmania chagasi. A resposta imunológica desses animais à Leishmania é pouco conhecida, havendo a necessidade de métodos diagnósticos adequados para esse fim. No presente estudo, é descrita a padronização do ensaio imunoenzimático indireto (ELISA para o diagnóstico sorológico de leishmaniose visceral em canídeos silvestres brasileiros. Foram estudadas amostras de soro e plasma de 12 canídeos cativos: sete lobos-guará (Chrysocyon brachyurus, três raposinhas (Lycalopex vetulus e dois cachorros-do-mato (Cerdocyon thous. As amostras de um C. brachyurus e uma L. vetulus, cativos em área endêmica para LV, que apresentavam doença clínica e positividade em testes de Imunofluorescência Indireta e Reação em Cadeia de Polimerase, foram utilizadas como controles positivos. Foram comparados os conjugados anti-IgG de cão e proteína A, ambos ligados a peroxidase, cujos testes detectaram quatro (04/12 e três (03/12 C. brachyurus soropositivos para anticorpos anti-Leishmania sp., respectivamente. As médias das densidades ópticas (DOs das amostras negativas foram nitidamente mais baixas do que as médias das DOs dos positivos tanto no ELISA com anti-IgG de cão (4,8 vezes como com proteína A (15,5 vezes. Os soros de três C. brachyurus positivos no ELISA indireto foram avaliados por Western blotting e identificaram 22 bandas, sendo imunodominantes as de peso molecular de 19, 22, 24, 45 e 66 kDa. Os testes ELISA com a proteína A e o conjugado anti-IgG de cão apresentaram respectivamente concordância excelente (Kappa = 1; pIn South America, some wild canids are considered natural reservoirs of Leishmania chagasi. The immunological response of wild canids to Leishmania is not well understood, and the development of diagnostic methods is necessary for such purpose. In the present study, the standardization of an enzyme-linked immunosorbent

  9. Entomological investigation of a sylvatic yellow fever area in São Paulo State, Brazil Investigação entomológica em área de ocorrência de febre amarela silvestre no Estado de São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Vera L. F. de Camargo-Neves

    2005-08-01

    Full Text Available Following reports of two autochthonous cases of sylvatic yellow fever in the State of São Paulo, Brazil, in 2000, entomological surveys were conducted with the objective of verifying the occurrence of vector species in forest environments close to or associated with riparian areas located in the western and northwestern regions of the State. Culicidae were captured in 39 sites distributed in four regions. Haemagogus leucocelaenus and Aedes albopictus were the most abundant species and were captured in all the regions studied. H. leucocelaenus was the most abundant species in the municipalities of Santa Albertina and Ouroeste, where the two cases of sylvatic yellow fever had been reported. Mosquitoes from the janthinomys/capricornii group were only found at eight sites in the São José do Rio Preto region, while Sabethes chloropterus was found at one site in Ribeirão Preto. H. leucocelaenus showed its capacity to adapt to a secondary and degraded environment. Our results indicate a wide receptive area for yellow fever transmission in the State of São Paulo, with particular emphasis on the possibility of H. leucocelaenus being involved in the maintenance of this sylvatic focus of the disease.O registro de dois casos autóctones de febre amarela silvestre no Estado de São Paulo, Brasil, em 2000, desencadeou investigações entomológicas com o objetivo de verificar a ocorrência das espécies vetoras em ambientes florestais próximos ou associados às zonas ribeirinhas, situados nas regiões oeste e noroeste do Estado. As capturas foram realizadas em 39 localidades distribuídas por quatro regiões do Estado. Haemagogus leucocelaenus e Aedes albopictus foram as espécies mais abundantes e capturadas em todas as regiões. H. leucocelaenus foi a espécie mais abundante nos municípios de Santa Albertina e Ouroeste, onde os casos de febre amarela silvestre foram registrados. Mosquitos do grupo janthinomys/capricornii foram encontrados em oito

  10. The ecology of Triatoma sordida in natural environments in two different regions of the state of Minas Gerais, Brazil Ecologia do Triatoma sordida no ambiente silvestre de duas diferentes regiões do estado de Minas Gerais, Brasil

    Directory of Open Access Journals (Sweden)

    L. Diotaiuti

    1993-06-01

    Full Text Available A study was undertaken about T. sordida in the natural environment in two different regions of the state of Minas Gerais: Itapagipe (Triângulo, an area of cerrado modified by the formation of fields of pasture and agriculture, and Mato Verde (north an area of transition between caatinga and cerrado with profound deforestation in the last years due to the expansion of cotton cultivation. In both regions the principal ecotopes identified were hollow trees and the bark of live or dead trees, where the occurrence of a food source is not frequent. In this environment, the triatomines utilize various food sources; opposums appear to represent an important source of infection. In the north of Minas, a greater concentration of reservoirs and vectors was observed than in the Triángulo which could explain the higher level of infection of the triatomines in the north. Close attention to the process of domiciliation of T. sordida in the north of Minas is recommended where an extensive intervention by man in the natural environment has occurred and where a rise in the population of triatomines in the peridomestic environment has been observed in recent years.Foi realizado um estudo sobre o T. sordida em ambiente silvestre em duas diferentes regiões do estado de Minas Gerais: Itapagipe (Triângulo, área de cerrado modificado para formação de campos de pastagem e agricultura, e Mato Verde (norte uma área de transição entre a caatinga e o cerrado, profundamente desmatada nos últimos anos com a finalidade de expansão do cultivo de algodão. Em ambas as regiões, os principais ecotopos identificados corresponderam a buracos e cascas de árvores vivas ou mortas, onde a ocorrência de fontes de alimentação não é frequente. Neste ambiente, os triatomíneos utilizam-se de variadas fontes de alimentação; gambás parecem representar urna importante fonte de infecção. No norte de Minas, observou-se urna maior concentração de reservatórios e vetores

  11. Behavioral experiments in a wild passerine cause short-term reductions in parental provisioning and nestling mass Experimentos conductuales en un ave paserina silvestre causan reducciones de corto plazo en el cuidado parental y peso de pichones

    Directory of Open Access Journals (Sweden)

    WOUTER F.D VAN DONGEN

    2009-06-01

    Full Text Available Research on wild animals often involves the capture and temporary removal of individuals from their territory. Although the acute effects of such procedures are well understood in terms of stress hormone profiles, their effect on the behaviour of captured individuals after release is poorly known. Additionally, for socially-monogamous individuals captured whilst breeding, little is known regarding whether the remaining individual compensates for the temporary loss of its partner and whether offspring condition or survival ultimately decreases due to any reductions in parental provisioning. We investigated the influence of field-based experiments requiring temporary adult removal on adult provisioning behaviour and nestling mass in the thorn-tailed rayadito (Aphrastura spinicauda, a Chilean furnariid species with equal parental effort between sexes. During the absence of the removed individual, remaining individuals did not increase nestling provisioning rates while, upon their release, removed individuals did not return to nestling feeding for at least 38 minutes and typically much longer. This drastic reduction in combined parental provisioning negatively affected nestling mass, while average nestling mass increased during a control period, nestlings failed to gain weight during and subsequent to parental removal. Finally, our experiments did not affect fledging probability. Overall, our results indicate that the temporary removal of rayaditos from their territories can cause short-term reductions in parental provisioning and nestling weight, but is unlikely to lead to any long-term effects on nestling survival.Las investigaciones en animales silvestres frecuentemente requieren la captura y remoción de individuos de sus territorios. Si bien se conocen los efectos a nivel hormonal de tales métodos, sus efectos sobre la conducta de los individuos después de la liberación son escasamente conocidos. Además, para individuos de especies mon

  12. Comparison of Pollen Production and Quality Characteristics of Cultivated and Wild Almond Species Comparación de Producción y Características de Calidad del Polen de Especies de Almendro Cultivadas y Silvestres

    Directory of Open Access Journals (Sweden)

    Safder Bayazit

    2011-12-01

    breeding programs.Hay varias especies de almendros silvestres en Turquía incluidas Amygdalus orientalis (Mill., Amygdalus turcomanica (Lincz., Amygdalus fenzliana (Fritsch Lipsky, Amygdalus trichamygdalus (Hand.-Mazz. Woronow, Amygdalus arabica (Olivier, y Amygdalus webbii (Spach. Estas especies ofrecen un gran valor para mejoramiento del almendro; se estudió la viabilidad del polen, tasa de germinación, y producción de polen para siete genotipos de A. orientalis y siete genotipos de A. turcomanica cultivados en condiciones naturales en el sudeste de Anatolia (Gaziantep and §anhurfa provinces, Turkey. También se estudiaron cultivares de almendros (Prunus dulcis [Mill.] D.A. Webb obtenidos desde Pozanti Agricultural Experimental Station, Universidad de Cukurova. Las viabilidades de polen de los diversos genotipos se determinaron por las pruebas 2,3,5-trifeniltetrazolium cloruro (TTC y fluoresceína diacetato (FDA. Las tasas de germinación de polen se establecieron en condiciones de placas Petri (1% agar + 0, 10, 15, y 20% sucrosa mientras la producción de polen se estimó con métodos hemocitométricos. Las tasas de viabilidad de polen fueron cercanas entre ambos métodos para los genotipos de A. orientalis y A. turcomanica. Las tasas de germinación de polen fueron dependientes del contenido de sucrosa y del genotipo. Los cultivares mostraron tasas de germinación de polen similares en todas las concentraciones de sucrosa mientras el polen de los genotipos A. orientalis y A. turcomanica mostraron mayores tasas de germinación en 10% sucrosa. El número de anteras por flor fue mayor en los cultivares mientras el número de granos de polen fue menor en otras especies de almendro. Mientras el número de granos de polen por flor fue relativamente alto en genotipos de A. orientalis, la calidad del polen fue alta en las tres especies en investigación. Los resultados sugirieron que estas dos especies, A. orientalis y A. turcomanica, podrían ser usadas para futuros

  13. Parasites of domestic and wild canids in the region of Serra do Cipó National Park, Brazil Parasitos de canídeos domésticos e silvestres na região do Parque Nacional da Serra do Cipó - Brasil

    Directory of Open Access Journals (Sweden)

    Juliana Lúcia Costa Santos

    2012-09-01

    Full Text Available Over recent decades, diseases have been shown to be important causes of extinctions among wild species. Greater emphasis has been given to diseases transmitted by domestic animals, which have been increasing in numbers in natural areas, along with human populations. This study had the aim of investigating the presence of intestinal helminths in wild canids (maned wolf, Chrysocyon brachyurus, and crab-eating fox, Cerdocyon thous in the Serra do Cipó National Park (43-44º W and 19-20º S and endo and ectoparasites of domestic dogs in the Morro da Pedreira Environmental Protection Area (an area surrounding the National Park. The Serra do Cipó is located in the state of Minas Gerais, Brazil. Among the enteroparasites found in domestic and wild canids, the following taxons were identified: Ancylostomidae, Trichuridae, Toxocara sp., Spirocerca sp., Physaloptera sp., Strongyloides sp., Cestoda, Dipylidium caninum, Diphyllobothriidae, Hymenolepidae, Anoplocephalidae, Trematoda, Acanthocephala and Isospora sp. Domestic dogs were positive for leishmaniasis and Babesia canis in serological tests. Among the ectoparasites, Rhipicephalus sanguineus, Amblyomma cajennense and Ctenocephalides felis felis were observed in domestic dogs. Variations in the chaetotaxy of the meta-episternum and posterior tibia were observed in some specimens of C. felis felis.Nas últimas décadas, as doenças têm sido apontadas como importantes causas de extinção de espécies silvestres. Maior ênfase tem sido dada às doenças transmitidas por animais domésticos que crescem em número, bem como as populações humanas, em áreas naturais. O presente estudo objetivou verificar a presença de helmintos intestinais de canídeos silvestres (lobo-guará - Chrysocyon brachyurus e cachorro-do-mato - Cerdocyon thous do Parque Nacional da Serra do Cipó (43-44º W e 19-20º S e endo e ectoparasitos de cães domésticos da Área de Proteção Ambiental Morro da Pedreira (entorno do

  14. Ocorrência de Giardia, Cryptosporidium e microsporídios em animais silvestres em área de desmatamento no Estado de São Paulo, Brasil Occurrence of Giardia, Cryptosporidium and microsporidia in wild animals from a deforestation area in the state of São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Maria Anete Lallo

    2009-08-01

    Full Text Available A ocorrência de Giardia, Cryptosporidium e microsporídios foi investigada por meio da análise de 98 amostras fecais de animais silvestres capturados em uma área de desmatamento para a construção das barragens de Paraitinga e Biritiba, localizadas nos Municípios de Mogi das Cruzes, Salesópolis e Biritiba-Mirim, no Estado de São Paulo. As amostras foram obtidas de 46 roedores, 21 marsupiais, 16 sapos, nove morcegos, três primatas e três lagartos. As técnicas de centrífugo-flutuação com sulfato de zinco, de Kinyoun e a coloração de Gram-Chromotrope foram utilizadas, respectivamente, para a pesquisa de Giardia, de Cryptosporidium e de microsporídios. O total de animais parasitados por um dos protozoários investigados foi de 17,35% (17/98. Cistos de Giardia foram encontrados em amostras fecais de dois pequenos roedores da espécie Coendou villosus (ouriço-cacheiro. Os três animais positivos para Cryptosporidium foram roedores das espécies Akodon montensis, Thaptomys nigrita (ambos conhecidos como ratos do mato e Sciurus aestuans (serelepe ou caxinguelê. Esporos de microsporídios foram encontrados nas fezes de 12 animais, sendo seis roedores das espécies Oligoryzomys sp.(um, Akodon montensis (três e Coendou villosus (dois, três marsupiais pertencentes às espécies Didelphis aurita (dois e Marmosops incanus (um e três morcegos da espécie Diphylla ecaudata. Este é o primeiro relato de microsporidiose em animais silvestres no Brasil. A presente investigação enfatiza a importância de animais silvestres, particularmente pequenos mamíferos, como potenciais fontes de infecção desses protozoários para outras populações animais, incluindo o homem, em áreas de desmatamento.The occurrence of Giardia, Cryptosporidium and microsporidia was investigated in 98 faecal specimens from wildlife animals, captured in an area of deforestation for the construction of two water reservoirs (Paraitinga and Biritiba, located in the

  15. Flebotomíneos coletados em matas remanescentes e abrigos de animais silvestres de zoológico no perímetro urbano de Maringá, sul do Brasil. Estudo preliminar Phlebotomines collected in remaining florests and wild animal shelters in zoological garden in the urban area of Maringá, Paraná State, shoutern Brazil. Preliminary study

    Directory of Open Access Journals (Sweden)

    Ueslei Teodoro

    1998-12-01

    Full Text Available Um caso de leishmaniose tegumentar com provável infecção em uma das áreas de matas remanescentes no perímetro urbano de Maringá, Paraná, Brasil, o desconhecimento da fauna e do comportamento de flebotomíneos nestas matas despertaram o interesse desta investigação. Os flebotomíneos foram coletados com armadilhas de Falcão instaladas em matas remanescentes do Parque do Ingá, Bosque Dois e Horto Florestal, de junho a setembro de 1995, no período noturno. Nestas áreas coletaram-se 3.532 flebotomíneos, prevalecendo Lutzomyia (Nyssomyia whitmani (Antunes & Coutinho, 1939 com 3.395 (96,1% exemplares. No Parque do Ingá, onde as coletas também foram feitas em abrigos de animais silvestres, mantidos em zoológico, foram coletados 2.907 flebotomíneos, dos quais 1.723 nestes abrigos. Os resultados mostram melhor adaptação de Lutzomyia whitmani nas matas remanescentes no perímetro urbano de Maringá e sua freqüência nos abrigos dos animais silvestres mantidos em cativeiro.The present study was undertaken after the detection of one case of cutaneous leishmaniasis with presumed infection in one of the three remaining wooded areas in the urban area of the city of Maringá, Southern Brazil; also in view of the lack of knowledge about sand flies and their behavior. From June to September, 1995, sand flies were caught with Falcão traps during the night in the remaining wooded areas (Parque do Ingá, Bosque Dois and Horto Florestal. A total of 2,907 sand flies were caugth in Parque do Ingá; 1,723 of them were aught in forest traps and 1,184 in wild animal shelter traps at the zoo. The results show that Lutzomyia whitmani is better adapted to the three areas under study and that it frequently occurs in wild animal shelters within the urban perimeter of Maringá.

  16. Whitefly species (Hemiptera: Aleyrodidae on wild and cultivated plants in the horticultural region of Rosario, Santa Fe, Argentina Especies de moscas blancas (Hemiptera: Aleyrodidae sobre plantas silvestres y cultivadas en la región hortícola de Rosario, Santa Fe, Argentina

    Directory of Open Access Journals (Sweden)

    Gustavo G. Gonsebatt

    2012-06-01

    Full Text Available Whiteflies of economic importance are polyphagous, being able to develop on a large number of cultivated and spontaneous plants. We recorded the whitefly species on vegetable and flower crops and the wild plants associated, under greenhouse and field conditions, for two years. We observed two species: Trialeurodes vaporariorum (Westwood and the Bemisia tabaci complex (Gennadius. T vaporariorum was recorded on 24 plant species (11 families, 12 and 8 of which are new hosts in Argentina and in the world, respectively. The B. tabaci complex was recorded only on flower production systems, on 19 plant species (11 families, 14 and 7 of which are new hosts in Argentina and in the world, respectively. The crops Glycine max (L. and Chrysanthemum morifolium Ramat., the wild species Amaranthus blitum L., Amaranthus quitensis Kunth, Conyza bonariensis (L., Galinsoga parviflora Cav., Sonchus oleraceus L. and Wedelia glauca (Ortega O. Hoffm. ex Hicken were hosts of both species. The only parasitoid recorded was Eretmocerus californicus near corni Haldeman (Hymenoptera: Aphelinidae from T. vaporariorum. This study, which is the first systematic survey of host plants in the region, intends to provide a better knowledge of the range of whiteflies host plants in Argentina.Las moscas blancas de importancia económica son polífagas y capaces de desarrollarse sobre numerosas plantas cultivadas y espontáneas. Registramos las especies de moscas blancas sobre cultivos hortícolas y de flores, y sobre las plantas silvestres asociadas. Observamos dos especies: Trialeurodes vaporariorum (Westwood y el complejo Bemisia tabaci (Gennadius. T. vaporariorum fue registrada sobre 24 especies de plantas (11 familias, 12 y 8 de las cuales son hospedantes nuevos para Argentina y a nivel mundial, respectivamente. El complejo B. tabaci fue registrado solo en sistemas de producción de flores, sobre 19 especies de plantas (11 familias, 14 y 7 de las cuales son nuevos hospedantes para

  17. Absconding and migratory behaviors of feral Africanized honey bee (Apis mellifera L. colonies in NE Brazil = Comportamentos de abandono e migração de colônias silvestres da abelha melífera africanizada (Apis mellifera L. no nordeste do Brasil

    Directory of Open Access Journals (Sweden)

    Breno Magalhães Freitas

    2007-10-01

    Full Text Available We investigated the annual movements of feral Africanized honey bee (Apis mellifera L. colonies in the state of Ceará, Brazil, aiming to understand seasonal variations in their population. Arrival and absconding of Africanized honey bee (AHB colonies in the semiaridmunicipality of Canindé and the coastal humid city of Fortaleza (120 km apart were recorded weekly from January 1999 to December 2001, and the data compared to rainfall records in both areas. Results showed that AHB colonies only nest in the semiarid during the rainy season and abscond during the dry season, the opposite from observations taken in Fortaleza. Only 5% of colonies remained in the semiarid area for the entire year due to ant (Camponotus sp. attacks and shortage of nectar and water during the dry season, with most colonies migrating to coastal areas where the weather is milder and many plant species bloom at that time of year. Excessive rainfallprobably pushes AHB colonies back to the semiarid during the rainy season. We concluded that absconding and migration are strategies that allow AHB colonies to survive in the semiarid NE of Brazil, contrary to European honeybees, which have never succeeded in establishing wild colonies in the region.Os movimentos de colônias silvestres da abelha melífera africanizada (Apis mellifera L. no Estado do Ceará, Brasil, foram investigados com o objetivo de compreender variações anuais em sua população. A chegada e a partida de colônias de abelhas africanizadas (AHB,no município semi-árido de Canindé e na úmida cidade litorânea de Fortaleza (separadas por 120 km, foram monitoradas semanalmente, de janeiro de 1999 a dezembro de 2001, e comparados com os dados pluviométricos de chuvas em ambas as áreas. Os resultadosdemonstraram que as abelhas africanizadas somente nidificaram no semi-árido durante a estação chuvosa e o abandonaram na estação seca, ao contrário do observado em Fortaleza. Apenas 5% das col

  18. Impactos de atropelamentos de animais silvestres no trecho da rodovia SP-215 confrontante ao Parque Estadual de Porto Ferreira – Porto Ferreira, SP (Nota Científica. Impacts roadkills mortality of wild animals in the area of SP-215 highway alongside Porto Ferreira State Park – Porto Ferreira, SP (Scientific Note.

    Directory of Open Access Journals (Sweden)

    Sonia Aparecida de SOUZA

    2010-12-01

    Full Text Available No presente trabalho foi realizado o monitoramento dos atropelamentos de animais silvestres na rodovia SP–215 no trecho confrontante ao Parque Estadual de Porto Ferreira. Em seis anos foram registrados 72 indivíduos, sendo 17 espécies de mamíferos, 10 de aves, quatro de répteis, uma de anfíbio e três indivíduos não identificados. Dentre esses, lobo-guará Chrysocyon brachyurus, jaguatirica Leopardus pardalis e cuíca-lanosa Caluromys lanatus se encontram na lista das espécies ameaçadas de extinção do Estado de São Paulo. A partir do conhecimento das espécies atingidas, faz-se necessário o desenvolvimento de estudos e propostas de implantação de medidas mitigadoras à presença da rodovia SP–215 para a conservação da fauna.This paper presents the data collected through the monitoring of roadkills on SP–215 highway in the area alongside Porto Ferreira State Park. During six years, 72 roadkills were recorded, including 17 species of mammals, 10 of birds, five of reptiles, one of amphibians and three unidentified individuals. Among those species, maned wolf Chrysocyon brachyurus, ocelot Leopardus pardalis, and Western woolly opossum Caluromys lanatus are included in the threatened species list of the state of São Paulo. After finding out which species are affected, it is necessary to develop studies and proposals for implementing effective mitigation measures for the presence of SP–215 highway in the area in order to preserve the local fauna.

  19. Expansión y recambio foliar de gramíneas perennes C4 creciendo a temperaturas moderadamente bajas

    OpenAIRE

    Berone, Germán D.

    2016-01-01

    Understanding the mechanisms by which some C4 grasses grow more than others at moderately low temperatures (~12-20°C) is valuable to select materials to lengthen the growing season. In turn, the determination of leaf lifespan for each material to be used is relevant to optimize the balance between herbage production and herbage utilization. The objectives of this study were to analyze the growth capacity and the leaf lifespan in two native mat...

  20. Creciendo Sin Drogas: Guia de Prevencion para Padres (Growing Up Drug-Free: A Parent's Guide to Prevention).

    Science.gov (United States)

    Office of Elementary and Secondary Education (ED), Washington, DC. Safe and Drug Free Schools Program.

    This publication is part of the Department of Education's ongoing effort to provide information to emerging populations in their native language on how to create and maintain drug-free and safe schools across the nation. Throughout the publication are personal stories and artwork of elementary and secondary school students that promote the message…

  1. Mindfulness en Pediatría: el proyecto "Creciendo con atención y consciencia plena"

    OpenAIRE

    Ruiz Lázaro, P.J.; Rodríguez Gómez, T.; Martínez Prádanos, A.; Núñez Marín, E.

    2014-01-01

    Distintos estudios sugieren que la atención y consciencia plena mindfulness tiene, entre otros, el beneficio potencial de mejorar la atención de los niños y las habilidades sociales, la reducción de ansiedad ante los exámenes y la mejora en mantener la calma. Promovido desde el espacio grupal "De jóvenes a jóvenes" y fruto de la colaboración entre nuestro centro de salud y el colegio Emperador Fernando de Alcalá de Henares (Madrid), está en marcha, desde octubre de 2012, el proyecto "Creciend...

  2. Diseño de un proceso estratégico para la empresa New Care – Creciendo Saludable

    OpenAIRE

    Murillo Agudelo, Jessica Alexandra; Caballero Montaño, Luis Ferney

    2015-01-01

    En este trabajo de grado se elabora una breve presentación de propuestas, modelos y teorías de organizaciones saludables desde diferentes perspectivas, con el fin de lograr un análisis y aplicación de un modelo en una pequeña empresa del sector cosmetico para lograr la propuesta y formulacion estrategica de un modelo aplicable. En este ejercicio se logra un diagnóstico, evaluación y direccionamiento estrategico de la compañía para la elaboración de una propuesta que le permita a la compañía c...

  3. Phytochemical Evaluation of Wild and Cultivated Pepper (Capsicum annuum L. and C. pubescens Ruiz & Pav. from Oaxaca, Mexico Evaluación Fitoquímica en Chile (Capsicum annuum L. and C. pubescens Ruiz & Pav. Silvestre y Cultivado en Oaxaca, México

    Directory of Open Access Journals (Sweden)

    Araceli Minerva Vera-Guzmán

    2011-12-01

    Full Text Available Reports of the last decade show that some types of food and spices included in the human diet, such as pepper (Capsicum annuum L. can have a positive effect on human health. The Mexican pepper germplasm is poorly documented with regard to variety and the amount of phytochemical compounds that it contains. In the present study, the variation of phytochemical compounds was evaluated in nine fruit variants (morphotypes of wild and cultivated pepper grown in Oaxaca. ANOVA detected significant differences among pepper morphotypes and ripeness stages of fruits; vitamin C, total phenols, flavonoids, P-carotene, coordinated chromatic of color, and capsaicinoids. The highest values of vitamin C were found in 'Tabaquero', 'Guero' and 'Costeño' morphotypes (151.6 to 183.2 mg 100 g-1. With regard to total phenols and flavonoids, 'Piquín' and 'Solterito' had the highest levels. Coordinates of color a* and b*, and chroma presented a positive correlation with phenol and flavonoid contents. The evaluated morphotypes differed in capsaicin and dihydrocapsaicin; C. annuum had higher capsaicin content (4.9 to 142 /En la última década, se reportó que el consumo de ciertos alimentos y especias, como el chile (Capsicum annuum L., pueden tener un efecto positivo en la salud. Particularmente, los acervos genéticos mexicanos de chile están poco documentados en relación a la diversidad desde la perspectiva fitoquímica. En este trabajo se evaluó la variación de compuestos fitoquímicos en nueve morfotipos de chile silvestres y cultivados de Oaxaca. El ANDEVA detectó diferencias significativas entre morfotipos y estados de madurez en vitamina C, fenoles, flavonoides, P-caroteno, color, y capsaicinoides. Los valores más altos de vitamina C se determinaron en 'Tabaquero', 'Guero' y 'Costeño' (151.6 a 183.2 mg 100 g-1. En fenoles y flavonoides sobresalieron los tipos 'Piquin' y 'Solterito'. Las coordenadas cromáticas a* y b*, y los tonos (C* se correlacionaron

  4. Caracterización histológica e histoquímica de la médula ósea de la baba (Caiman crocodilus crocodilus en hábitat silvestre | Histological and histochemical characterization of bone marrow of spectacled caiman (Caiman crocodilus crocodilus in a wildlife

    Directory of Open Access Journals (Sweden)

    Eva Velásquez Bolívar

    2017-10-01

    Full Text Available Estudios en cocodrilos prometen una estrategia para desarrollar nuevos fármacos antimicrobianos y terapias inmunes en humanos. Se caracterizaron la histología e histoquímica de la médula ósea de la Baba Caiman crocodilus crocodilus en hábitat silvestre, en virtud de la importancia de esta como formadora de las series hematopoyéticas (serie roja, serie blanca y serie trombocítica. Se tomaron muestras de los huesos húmero y fémur para la descripción histológica de la médula ósea. Los cortes histológicos fueron teñidos con hematoxilina y eosina (H-E, tinción de Wilder y tinción tricrómica de Gomori. En la descripción morfológica de las series hematopoyéticas se empleó H-E y May-Grünwald-Giemsa; la histoquímica incluyó las tinciones ácido peryódico de Schiff (PAS y Sudán III. La médula ósea del húmero y fémur de la especie resultó ser un tejido conjuntivo hipercelular con irrigación abundante de vasos sanguíneos de pequeño calibre, con soporte de reticulina. El parénquima medular está constituido por las series hematopoyéticas; las células rojas maduran en islotes eritroblásticos. La granulopoyesis es un proceso ordenado y la serie linfoide madura en la médula ósea, siguiendo un proceso de diferenciación, en: linfoblastos, prolinfocitos y linfocitos maduros. Se evidenció un proceso denominado trombopoyesis, sin que se observaran megacarioblastos ni plaquetas. La tinción del PAS, identificó glucógeno con intensa positividad en el citoplasma de heterófilos en todos sus grados de maduración. Los eosinófilos mostraron una débil positividad, permitiendo la diferenciación de estos dos tipos celulares. La serie linfoide fue débilmente positiva a la tinción Sudán III, en todos sus grados de maduración.

  5. Peumus boldus (Monimiaceae, Magnoliopsida) una especie silvestre promisoria de Chile

    OpenAIRE

    San Martín Acebedo, José; Doll, Ursula

    1998-01-01

    Se organiza y sintetiza la información relacionada con la botánica, ecología y el contenido químico de extraíbles de hojas, corteza y madera de Peumus boldus (Monimiaceae, Magnoliopsida), árbol siempreverde, autóctono, endémico y termófilo de los bosques y matorrales esclerófilos naturales del área mediterránea de Chile. La popularidad y conocimiento de la especie tiene arraigo en la medicina popular empírica, dado el efecto farmacológico atribuible fundamentalmente, al alcaloide boldina, pre...

  6. La finalidad del presente artículo es establecer la fuerte vinculación que existe entre el conocimiento y los activos intangibles, siendo que estos son los grandes desconocidos en la valoración de las empresas y en el cálculo de las cuentas nacionales, en especial el PIB y la productividad. Fue el investigador Robert Solow, en 1956, uno de los primeros en señalar la importancia del conocimiento en el crecimiento económico, expresando que este es una función de capital, trabajo y conocimiento. Desde la década de 1990 viene creciendo la inquietud sobre la necesidad de analizar y medir los diferentes tipos de activos intangibles para incluirlos, con su justo valor, tanto en las cuentas nacionales como en los estados financieros de las empresas. Pero dichos activos tienen unas características muy especiales, las cuales hacen de su valoración monetaria una difícil tarea. Es impostergable profundizar su análisis y estudio para que no sigan siendo ignorados o minimizados en las prácticas cotidianas de las empresas y los mercados.

    Directory of Open Access Journals (Sweden)

    Leonidas Torres Citraro

    2014-12-01

    Full Text Available La finalidad del presente artículo es establecer la fuerte vinculación que existe entre el conocimiento y los activos intangibles, siendo que estos son los grandes desconocidos en la valoración de las empresas y en el cálculo de las cuentas nacionales, en especial el PIB y la productividad. Fue el investigador Robert Solow, en 1956, uno de los primeros en señalar la importancia del conocimiento en el crecimiento económico, expresando que este es una función de capital, trabajo y conocimiento. Desde la década de 1990 viene creciendo la inquietud sobre la necesidad de analizar y medir los diferentes tipos de activos intangibles para incluirlos, con su justo valor, tanto en las cuentas nacionales como en los estados financieros de las empresas. Pero dichos activos tienen unas características muy especiales, las cuales hacen de su valoración monetaria una difícil tarea. Es impostergable profundizar su análisis y estudio para que no sigan siendo ignorados o minimizados en las prácticas cotidianas de las empresas y los mercados.

  7. Distribución geográfica del riesgo de rabia de origen silvestre y evaluación de los factores asociados con su incidencia en Colombia, 1982-2010 Geographic distribution of wild rabies risk and evaluation of the factors associated with its incidence in Colombia, 1982-2010

    Directory of Open Access Journals (Sweden)

    Diana Marcela Brito-Hoyos

    2013-01-01

    Full Text Available OBJETIVO: Actualizar la información sobre la distribución geográfica de los focos de rabia transmitida por quirópteros en Colombia y evaluar las condiciones bióticas y abióticas asociadas con la incidencia de esta enfermedad en el país. MÉTODOS: Estudio observacional a partir de una base de datos construida con la información de los focos de rabia silvestre detectados entre 1982 y 2010 y la población bovina de cada municipio. Se clasificaron los municipios según el riesgo de transmisión de la enfermedad y se realizó una caracterización ambiental de 15 variables. Se elaboró un modelo de máxima entropía para predecir las zonas con condiciones apropiadas para la presencia del vector Desmodus rotundus infectado por el virus y evaluar la importancia de las variables empleadas. RESULTADOS: Se presentaron 2 330 focos en 359 (31,8% de los 1 128 municipios del país; 144 municipios se clasificaron como de alto riesgo. Montería, Valledupar, Riohacha, Aguachica, Unguía, Acandí, Río de Oro, Tibú, Sahagún y San Onofre concentraron las mayores tasas de incidencia. Los focos de rabia se presentaron a lo largo de todo el año, aunque en los meses secos (de enero a abril se observó una mayor frecuencia (correlación lineal [r] = 0,64. La temperatura y las precipitaciones son las variables que más robustez aportaron al modelo de predicción. CONCLUSIONES: Se recomienda aplicar medidas de control y prevención en los municipios con alto riesgo. Los mejores meses para realizar jornadas de vacunación son junio, noviembre y diciembre. En futuros análisis se deben incluir variables de interacción biótica para mejorar la capacidad predictiva del modelo.OBJECTIVE: To update the information on the geographic distribution of bat-transmitted rabies foci in Colombia and evaluate the biotic and abiotic conditions associated with the incidence of this disease in the country. METHODS: Observational study of a database containing information on the

  8. Molecular diversity among domestic guinea-pigs (Cavia porcellus and their close phylogenetic relationship with the Andean wild species Cavia tschudii Diversidad molecular entre cuyes domésticos (Cavia porcellus y su relación filogenética cercana con la especie silvestre andina Cavia tschudii

    Directory of Open Access Journals (Sweden)

    ÁNGEL E SPOTORNO

    2004-06-01

    Full Text Available To investigate the origin and diversity of domestic guinea-pigs Cavia porcellus (Linnaeus, 1758; Rodentia, Caviidae, we sequenced the mitochondrial cytochrome b gene of 12 domestic and 10 wild specimens from six species, including the two presumed as ancestral to the domestic one: Cavia tschudii and Cavia aperea. All maximum parsimony and maximum likelihood analyses grouped C. porcellus with C. tschudii (mean K2P distance = 3.2 %; best trees had 609 steps (CI = 0.796; Bremer support Index (SI = 28, and a _Ln = 4419.52, with 100 % and 97 % bootstrap support respectively. This clade, supported by three substitutions and 96 % bootstrap, is also obtained in the cladistic analysis of corresponding amino acids. When the C. aperea node was forced to join C. porcellus, these trees were consistently longer, less likely and robust, and with less defining characters than the optimal one. All C. porcellus sequences also clustered in a node defined by 15 substitutions. The sub-node containing animals from city markets, pet shops and laboratories was characterized by four substitutions (one non-silent, SI = 7, and 91 % bootstrap. Some South American C. porcellus, called "criollos" (creoles by local breeders, were more diverse. Probably, a particular clade from southern Peru and Chile may represent a pre-Columbian lineage. Mean K2P distance between C. tschudii and C. aperea was rather large, 7.7 %. Cavia appeared as a robust node (100 % bootstrap. These results indicate that C. tschudii is the species most closely related to C. porcellusPara investigar el origen y la divergencia de los cuyes domésticos Cavia porcellus (Linnaeus, 1758; Rodentia, Caviidae, secuenciamos el gen mitocondrial para citocromo b de 12 especímenes domésticos y 10 silvestres de seis especies, incluyendo las dos que se presumen como ancestro de la doméstica: C. tschudii y C. aperea. Todos los análisis de máxima parsimonia y máxima verosimilitud agruparon a C. porcellus con C

  9. Diversidad y aspectos biológicos de abejas silvestres de un ambiente urbano y otro natural de la región central de Santa Fe, Argentina Diversity and biological aspects of wild bees in an urban and a natural environment in the central region of Santa Fe, Argentina

    Directory of Open Access Journals (Sweden)

    Milagros Dalmazzo

    2010-06-01

    Full Text Available El objetivo del presente trabajo fue relevar el elenco de abejas silvestres en la región central de Santa Fe y comparar la diversidad de especies y aspectos biológicos en dos ambientes de una misma región. Las abejas fueron colectadas en el estrato herbáceo de la Reserva Universitaria "Escuela Granja" de la localidad Esperanza, y en la zona urbana de la localidad Susana, ambas ubicadas dentro de la Provincia Fitogeográfica del Espinal. La colecta se realizó en octubre, noviembre y diciembre de 2004 y en enero, febrero y marzo de 2005, registrando las especies vegetales sobre las que se capturaron. Se colectaron 277 ejemplares en total, de los cuales se identificaron 62 especies (27 géneros en 5 familias. Las curvas de rarefacción indican una tasa de acumulación de especies mayor para la Reserva Ecológica, los índices de diversidad de Shannon son 3,25 para la Reserva Ecológica y 2,64 para la Zona Urbana. Para la comparación de las comunidades en ambos sitios, las abejas fueron clasificadas en tres categorías según la especialización en el uso del recurso floral, sustrato de nidificación y comportamiento social. Se observó una asociación entre los grupos especialistas y de nidificación en el suelo con el ambiente natural, y por otro lado, las especies generalistas y de nidificación en cavidades con el ambiente urbano. No se identificaron diferencias, en cuanto a la sociabilidad de las especies, entre ambos sitios.The purpose of this contribution is to present a survey of wild bees in the central region of Santa Fe, and to compare the diversity and biological aspects of the bee communities at two different environments of the same region. Bees were surveyed at the ecological reserve Reserva Universitaria "Escuela Granja" in the locality of Esperanza, and at an urban area in the locality of Susana, both in the Espinal Phytogeographic Province. Bees were sampled from October to December 2004 and from January to March 2005

  10. Evaluación de poblaciones segregantes producidas a partir de cruzamientos entre tomate cultivado y la accesión silvestre PI134418 de Solanum habrochaites var. glabratum resistente al pasador del fruto. Evaluation of segregating populations from crosses between cultivated tomato and PI134418 wild accession of Solanum habrochaites var. glabratum with resistance to the fruit borer.

    Directory of Open Access Journals (Sweden)

    Edwin F. Restrepo S.

    2008-01-01

    Full Text Available Se realizó la evaluación de poblaciones segregantes producidas a partir de cruzamientos entre tomate S. lycopersicum L. cv. maravilla y la accesión silvestre PI134418 de S. habrochaites var. glabratum resistente al pasador del fruto N. elegantalis. Se encontró que hay dominancia de los alelos que disminuyen la expresión del caraacute;cter peso promedio de fruto. El método del retrocruzamiento resultó maacute;s eficiente que el de la autofecundación, para contrarrestar la dominancia de los alelos que codifican por el tamaño pequeño del fruto. Los tricomas y el número promedio de frutos por racimo no ejercieron ningún efecto sobre el ataque de los frutos por parte del pasador; mientras que el peso promedio de fruto sí tuvo efecto importante sobre dicho ataque, de tal manera que el insecto tiende a producir mayor daño a medida que se incrementa el peso promedio de fruto. Las poblaciones RC1 y RC2 se comportaron como las típicas segregantes para los caracteres evaluados y exhibieron amplia variabilidad en los mismos. El método del retrocruzamiento fue efectivo para romper la asociación negativa entre el peso promedio de fruto y la resistencia al insecto. El peso promedio de algunos de los frutos en los recombinantes RC2 fluctuó entre 45.1 y 68.6 g y mostraron resistencia al pasador.Evaluation of segregating populations from crosses between cultivated tomato S. lycopersicum L. cv. maravilla and PI134418 wild accession of Solanum habrochaites var. glabratum with resistance to the fruit borer N. elegantalis was made. There was dominance of alleles that decrease the expression of the character mean fruit weight. The backcrossing method was more efficient than selfing in order to counteract the dominance of alleles that encode by small fruit size. The thrichomes and the mean number of fruit per bunch did not produce any effect on the fruit attack by the fruit borer; while that mean fruit weight had important effect on this attack

  11. Variabilidade genética de acessos obtidos de populações cultivadas e silvestres de maracujazeiro-doce com base em marcadores rapd Genetic diversity obtained from cultivated population and native accesses of seewt passion fruit based on rapd markers

    Directory of Open Access Journals (Sweden)

    Graciele Bellon

    2009-03-01

    Full Text Available O maracujazeiro-doce (Passiflora alata Curtis, devido a preços diferenciados, vem ganhando importância dentro do mercado de frutas in natura. O melhoramento genético é fundamental para elevar a qualidade e a produtividade da cultura. Os marcadores moleculares do DNA têm sido muito úteis por permitirem a obtenção de um número praticamente ilimitado de polimorfismo genético sem influência do ambiente. Objetivou-se, neste trabalho, estudar a variabilidade genética de 17 acessos de maracujá-doce, com base em marcadores moleculares RAPD. Um acesso de P. quadrangularis e um de P. edulis foram utilizados como outgroups. Amostras de DNA genômico de cada acesso foram extraídas e 11 iniciadores decâmeros (OPD 04; 07; 08 e16; OPE 18 e 20; OPF 01 e 14; OPG 08; OPH 12 e 16 foram utilizados para a obtenção dos marcadores. Os marcadores obtidos foram convertidos em uma matriz de dados binários, a partir da qual foram estimadas as distâncias genéticas entre os acessos e realizadas análises de agrupamento e de dispersão gráfica. Do total de marcadores, considerando-se apenas os acessos de P. alata, observaram-se 87 (62,12% bandas polimórficas, evidenciando a grande variabilidade intraespecífica. A análise de agrupamento realizada com base nas distâncias genéticas permitiu subdividir os 17 acessos de P. alata em, pelo menos, cinco grupos de similaridade genética. Os acessos silvestres foram os que mais contribuíram para a ampliação da base genética dos materiais estudados, abrindo perspectivas para o uso desses materiais em programas de melhoramento.Sweet passion fruit (Passiflora alata Curtis is gaining importance in the in natura fruit market due to differential value. Genetic breeding is crucial to improve crop quality and productivity. Molecular markers of DNA have been very useful by allowing obtaining a virtually unlimited number of genetic polymorphism without environment influence. This work's objective was to study the

  12. Roadkill of wild vertebrates along the GO-060 road between Goiânia and Iporá, Goiás State, Brazil = Atropelamento de vertebrados silvestres na rodovia GO-060 entre Goiânia e Iporá Estado de Goiás, Brasil

    Directory of Open Access Journals (Sweden)

    Hélida Ferreira da Cunha

    2010-07-01

    Full Text Available Roadkill of wild vertebrates along GO-060, Brazil. Roads represent an old and constant cause of accidental death of wildlife. From May 2004 to November 2005, we recorded the roadkills of vertebrates in the GO-060 road between Goiânia and Iporá. For each road-killed animal we wrote down the species and location along the road. We found 308 animals roadkilled from at least 25 vertebrate species: 86% mammals, 11% birds and 3% reptiles. Tamandua tetradactyla, Cerdocyon thous and Myrmecophaga tridactyla were, in decreasing order, the species withthe largest number of road-killed individuals. Among mammals, the number of road-killed individuals was not related to species weight. The number of species and road-killed animals was constant throughout the 17 months of the research. The average frequency of animal roadkills in the dry season (April to September is slightly higher than the frequency in the rainy season (October to March. The average frequency of species victim to accidents, however, is constantthroughout the dry and rainy seasons. The incidence of species and individuals of road-killed animals per 10 km was not influenced by the number of forest fragments along the sides of the road. We suggest that speed reducers could decrease the number of animals killed on the road. As rodovias representam uma antiga e constante causa de mortalidade acidental da fauna silvestre. Entre maio/2004 e novembro/2005, registramos os vertebrados atropelados às margens da rodovia GO-060, entre Goiânia e Iporá. Para cada animal atropelado anotamos a espécie e a localização ao longo da estrada. Foram registrados 308 animaisatropelados de pelo menos 25 espécies de vertebrados: 86% de mamíferos, 11% de aves e 3% de répteis. Tamandua tetradactyla, Cerdocyon thous e Myrmecophaga tridactyla foram em ordem decrescente as espécies com maior número de indivíduos atropelados. Entre os mamíferos, o número de animais atropelados não esteve relacionado a

  13. Crystal structure of pira toxin-I: a calcium-independent, myotoxic phospholipase A2 - homologue from Bothrops pirajai venom

    International Nuclear Information System (INIS)

    Canduri, R.J.; Ward, R.J.; Azevedo Junior, G.W.F. de; Arni, R.K.; Soares, A.M.; Giglio, J.R.

    1997-01-01

    Full text. Phospho lipases A2 (PLA 2 ) are small enzymes that specifically hydrolysed the sn-2 ester bond of phospholipids, preferentially in lamellar or micellar aggregates at membrane surfaces. These enzymes are widely distributed in nature and have been extensively studied. Toxic proteins from venoms from Bothrops species include catalytically active PLA 2 s and calcium independent PLA 2L ys 49 homologues. The substitution of Asp49 by Lys greatly diminishes the ability of these PLA 2 to bind calcium, an ion that plays a critical role in the stabilization of the tetrahedral transition state intermediate in the catalytic mechanism. The Lys 49 PLA 2 homologues and therefore catalytically inactive yet maintain cytolytic and myotoxic activities and furthermore retain the ability to disrupt the integrity of both plasma membranes and model lipid bilayers by a poorly understood Ca 2+ independente mechanism. Lys49 PLA 2 homologues demonstrate a specific toxic activity against skeletal muscle, affecting only muscle fibers and leaving other tissue structure such as connective tissue, nerves and vessels essentially unharmed. In order to improve our understanding of the molecular basis of the myotoxic and Ca 2+ -independent membrane damaging activities, we have determined the crystal structure of Pr TX-I, a Lys49 variant from the venom of B. pirajai. The model presented has been determined at 2.8 angstrom resolution and refined to a crystallographic residual of 19.7% (R free =29.7%). (author)

  14. Comportamentos de abandono e migração de colônias silvestres da abelha melífera africanizada (Apis mellifera L. - DOI: 10.4025/actascibiolsci.v29i4.882 Absconding and migratory behaviors of feral Africanized honey bee (Apis mellifera L. colonies in NE Brazil - DOI: 10.4025/actascibiolsci.v29i4.882

    Directory of Open Access Journals (Sweden)

    Raimundo Maciel Souza

    2008-02-01

    Full Text Available Os movimentos de colônias silvestres da abelha melífera africanizada (Apis mellifera L. no Estado do Ceará, Brasil, foram investigados com o objetivo de compreender variações anuais em sua população. A chegada e a partida de colônias de abelhas africanizadas (AHB, no município semi-árido de Canindé e na úmida cidade litorânea de Fortaleza (separadas por 120 km, foram monitoradas semanalmente, de janeiro de 1999 a dezembro de 2001, e comparados com os dados pluviométricos de chuvas em ambas as áreas. Os resultados demonstraram que as abelhas africanizadas somente nidificaram no semi-árido durante a estação chuvosa e o abandonaram na estação seca, ao contrário do observado em Fortaleza. Apenas 5% das colônias permaneceram na área semi-árida por todo o ano, por causa dos ataques de formigas (Camponotus sp. e carência de néctar e água na estação seca. A maioria das colônias migrou para as áreas litorâneas onde o clima é mais ameno e muitas espécies vegetais florescem nesta época do ano. O excesso de chuvas provavelmente forçava as colônias africanizadas a migrarem de volta ao semi-árido durante a estação chuvosa. Conclui-se que o abandono e a migração são estratégias que permitem às abelhas africanizadas sobreviverem no semi-árido nordestino, em contraste com as raças européias que nunca conseguiram estabelecer populações silvestres na região.We investigated the annual movements of feral Africanized honey bee (Apis melliferaL. colonies in the state of Ceará, Brazil, aiming to understand seasonal variations in their population. Arrival and absconding of Africanized honey bee (AHB colonies in the semiarid municipality of Canindé and the coastal humid city of Fortaleza (120 km apart were recorded weekly from January 1999 to December 2001, and the data compared to rainfall records in both areas. Results showed that AHB colonies only nest in the semiarid during the rainy season and abscond during the

  15. OPTIMIZACIÓN DEL RENDIMIENTO Y CONTENIDO DE TIMOL DE ACEITE ESENCIAL DE ORÉGANO SILVESTRE OBTENIDO POR ARRASTRE CON VAPOR OPTIMIZAÇÃO DO RENDIMENTO E CONTEÚDO DE TIMOL DO ÓLEO ESSENCIAL DO ORÉGANO SELVAGEM OBTIDO POR ARRASTRE À VAPOR OPTIMIZATION OF YIELD AND THYMOL CONTENT OF WILD OREGANO ESSENTIAL OIL OBTAINED BY STEAM DISTILLATION PROCESS

    Directory of Open Access Journals (Sweden)

    OSCAR ARANGO B

    2012-12-01

    Full Text Available Se estudió el proceso de extracción por arrastre con vapor a escala de planta piloto del aceite esencial de orégano silvestre (Lippia origanoides H.B.K de la región del Alto Patía (Colombia utilizando la metodología de superficie de respuesta. Los factores estudiados fueron el tiempo de extracción (1-3 horas, la densidad del lecho (60-100 g/L y la presión de extracción (1-3 psi. Las variables de respuesta fueron el rendimiento de extracción y el contenido de timol del aceite esencial. La composición de los aceites esenciales fue determinada mediante cromatografía de gases. Con respecto al rendimiento se obtuvo que solamente la densidad del lecho presentó un efecto estadísticamente significativo (PO processo de extração do óleo essencial de orégano silvestre (Lippia origanoides H.B.K por arraste a vapor foi estudado a escala piloto na região do Alto Patía (Colômbia, utilizando a metodologia de superfície resposta. Os fatores estudados foram o tempo de extração (1-3 horas, a densidade do leito (60-100 g/L e a pressão de extração (1-3 psi. As variáveis de resposta foram: o rendimento da extração e o conteúdo de timol do óleo essencial. A composição dos óleos essenciais foi determinada mediante cromatografia de gases. Com respeito ao rendimento, foi obtido que somente a densidade do leito apresentou um efeito estatisticamente significativo (PThe extraction process by steam distillation on pilot plant of essential oil from wild oregano (Lippia origanoides H.B.K from Alto Patía region (Colombia was studied using surface response methodology. Factors studied were the extraction time (1-3 hours, the density of the bed (60-100 g/L and the extraction pressure (1-3 psi. The response variables were the extraction yield and the content of thymol in the essential oil. The composition of essential oils was determined by gas chromatography. Regarding yield only the bed density presented a statistically significant effect (P

  16. Intervención grupal con mujeres víctimas de violencia de género : taller "creciendo juntas"

    OpenAIRE

    Lafuente Bolufer, María Eugenia

    2014-01-01

    Treball Final de Màster Universitari en Igualtat i Gènere en l'Àmbit Públic i Privat (Pla de 2013). Codi: SRM042. Curs: 2014/2015 El trabajo que presento a continuación consiste en el desarrollo de un proyecto de intervención social con mujeres víctimas de violencia de género, que tiene como origen la realización del periodo de prácticas del Máster Universitario en Igualdad y Género en el Ámbito Público y Privado de la Universidad Jaume I de Castellón durante el curso 2014-15. Dichas pr...

  17. Enterobacterias en tortugas silvestres y cautivas del Amazonas, Podocnemis expansa (Testudines: Podocnemididae)

    OpenAIRE

    Meyer Junior, Júlio Cesar; Marinho, Márcia; Táparo, Cilene Vidovix; Costa, João Bosco da; Dias, Hilma Lúcia Tavares

    2015-01-01

    ResumenLa tortuga amazónica Podocnemis expansa Schweigger, 1812 es un recurso muy importante para las poblaciones ribereñas de fauna de la región amazónica, además de ser una de las principales especies enumeradas para la producción en cautiverio. El consumo de esta especie como alimento en la región ha generado una demanda de estudios sobre salud animal y sus posibles impactos en la salud pública. El objetivo principal de este estudio fue evaluar la microbiota gastrointestinal de las tortuga...

  18. PRIMER REGISTRO DE EPIBIONTES EN EJEMPLARES JUVENILES DE CROCODYLUS ACUTUS EN EL MEDIO SILVESTRE

    Directory of Open Access Journals (Sweden)

    CUPUL-MAGAÑA FABIO GERMÁN

    2005-06-01

    Full Text Available Se registra por vez primera la presencia de cuatro géneros de diatomeas (Amphora, Cymbella, Navicula y Nitzschia, un alga azul-verde del género Trichodesmium y colonias de protozoarios ciliados del género Epistylis, como epibiontes de cocodrilos de río juveniles (Crocodylus acutus. Los epibiontes se encontraron en la región ventral del cuerpo de cocodrilos juveniles, menores de 75 cm de largo, capturados en el estero Boca Negra, Jalisco, México.

  19. Propagación de especies herbáceas silvestres con potencial para paisajismo

    OpenAIRE

    García-Albarado, J. Cruz; Gómez-Merino, Fernando Carlos; Trejo-Téllez, Libia Iris; Sandoval Pérez, Isauro Alfonso; Morales Ramos, Victorino

    2013-01-01

    En esta investigación se evaluó la propagación sexual (por semillas) y asexual (por esquejes) de Ruellia nudiflora, Centratherum punctatum y Salvia coccinea, en diferentes combinaciones de sustratos a base lombricomposta, turba, arena y vermiculita. Los volúmenes de lombricomposta y turba variaron de 50 a 100% (v/v), mientras que los de arena y vermiculita lo hicieron de 0 a 50% (v/v). En cuanto a semillas, la especie que respondió de manera más eficiente a los tratamientos fue S. coccinea, l...

  20. Usos potenciales de germoplasma animal masculino con fines de preservación de fauna silvestre

    OpenAIRE

    Francisco Cabrera; Andrés Caicedo; Pedro M. Aponte

    2017-01-01

    El germoplasma animal comprende células o tejidos que pueden generar nuevos individuos. Su preservación y uso puede instrumentarse en la reproducción de animales en peligro de extinción. El germoplasma animal, además de los gametos, incluye células diploides como las células madre, potencialmente capaces de dividirse indefinidamente. Las células madre espermatogoniales (CMEs) generan los espermatozoides en el testículo (espermatogénesis). Las CME ofrecen múltiples opciones biotecnológicas....

  1. Genetic identification of new alien pest species Illinoia liriodendri and its parasitoid Areopraon silvestre in Croatia

    OpenAIRE

    Franjević, Milivoj; Glavaš, Milan; Hrašovec, Boris; Koletić, Nikola; Franjević, Damjan

    2016-01-01

    Background and Purpose: During June 2015 in Zagreb city area (Croatia) samples of tulip tree (Liriodendron tulipifera) leaves were collected with symptoms of attack by some unknown aphid. Material and methods: Aphids were collected form leaves of tulip trees on different locations in Zagreb during July 2015. Total genomic DNA was extracted from ethanol-preserved specimens. PCR analysis was carried out and PCR products were purified from 1% agarose gel for sequencing purposes. The obtaine...

  2. COMPOSICIÓN ELEMENTAL DE ALGUNAS ESPECIES DE PLANTAS SILVESTRES MEXICANAS

    Directory of Open Access Journals (Sweden)

    J. C. Raya Pérez

    2009-01-01

    Full Text Available El conocer la composición elemental de las plantas puede ser útil desde varios puntos de vista, como el saber sus necesidades nutricionales y tener una idea del tipo de mantillo que se podría formar en un momento dado. En el caso específico del silicio, las plantas que lo acumulan pueden formar fitolitos, muy útiles en paleoecología y arqueología. Se recolectaron especies de plantas de varias partes del centro-occidente de México y se determinó su composición elemental mediante sonda dispersiva de rayos X acoplada a un microscopio electrónico de barrido. Las plantas semiparásitas (plantas que fotosintetizan pero que toman sus nutrientes de la planta que parasitan acumulan cantidades considerables de iones como potasio y cloro para usarlos como osmolitos. Tillandsia recurvata, a pesar de ser epífita, acumula una buena cantidad de silicio, lo mismo que Cyperus sp., registrada como acumuladora de este elemento. Otras especies como Tagetes micrantha, de uso en la cocina mexicana, podrían contribuir en alguna medida al aporte de micronutrientes como potasio y magnesio.

  3. Diversidad de Piojos de Aves Silvestres en Bosque Seco Tropical al Norte del Tolima -resumen-

    OpenAIRE

    M K Ariza-Lozano; Gloria María Ariza-Lozano; M J Gómez-Martínez

    2014-01-01

    Los Phthiraptera son insectos ápteros dorsoventralmente aplanados. Se encuentran divididos en cuatro subórdenes de los cuales Amblycera e Ischnocera son los que parasitan aves. En Colombia los estudios de ectoparásitos son escasos en comparación con otros grupos de insectos‚ los existentes poseen un enfoque generalmente taxonómico. Con respecto al departamento del Tolima hasta el momento se ha realizado una única investigación en la que se identificaron los organismos hasta el nivel de famili...

  4. The importance of maintaining carnivores in wildlands (La Importancia de mantener carnivoros en Areas silvestres)

    Science.gov (United States)

    Dave Foreman

    2006-01-01

    I'd like to talk a little bit about another important disturbance regime in much of the western United States and Mexico. We've talked some about the importance of fire. Another one is the importance of natural hydrological cycles. But an often-overlooked important ecological disturbance regime is predation. Research around the world and in many habitats has...

  5. Relación del Virus del Oeste del Nilo con las Aves Silvestres

    OpenAIRE

    Diego Soler-Tovar; Victor J Vera

    2009-01-01

    El Virus del Oeste del Nilo (VON) es un Flavivirus que produce una encefalomielitis y puede afectar aves y mamíferos; los efectos varían desde poco notorios hasta la muerte, y en su difusión es importante la participación de especies animales como las aves donde es transmitido a través de mosquitos vectores. El VON se conoce de Uganda desde 1937 y está ampliamente distribuido en África, el oriente y la región sur y tropical de Eurasia. En el Hemisferio Occidental, el VON fue la primera causa ...

  6. De la vida silvestre a la colonización mecanizada en el Caribe colombiano

    Directory of Open Access Journals (Sweden)

    Mario Mejía Gutiérrez

    1990-01-01

    Full Text Available En el período 1958 - 1975 el autor residió durante catorce años en diversas localidades del Caribe Colombiano, desempeñando diferentes labores, particularmente en los terrenos de la investigación agropecuaria y pesquera. Así, las páginas siguientes son resumen de una voluminosa información recogida por el autor como primer director de investigaciones del Instituto de Fomento Algodonero en Codazzi, donde construyó la Estación Experimental La Europa; como uno de los creadores del Departamento de Economía Agropecuaria y Pesquera de la C V M en Barranquilla; como Asesor del Departamento Técnico de la Corporación Financiera del Norte en Barranquilla; como primer director colombiano por INDERENA del Instituto Colombiano-Alemán de Investigaciones de Punta Betín en Santa Marta; como promotor-fundador de la Facultad de Ingeniería Pesquera en la Universidad Tecnológica del Magdalena; como Director de los Parques Salamanca y Tayrona; como Jefe de Exportación de Fauna en Inderena, Barranquilla.. .

  7. Propagación y crecimiento inicial del abarco (Cariniana pyriformis Miers, utilizando semillas silvestres

    Directory of Open Access Journals (Sweden)

    Harlenson Pinilla Cespedes

    2016-12-01

    Full Text Available Se realizó la propagación de la especie forestal Abarco Cariniana Pyriformis Miers, con el objetivo de analizar su comportamiento en vivero utilizando semillas botánicas no mejoradas. Se utilizó un diseño completamente aleatorio con arreglo factorial compuesto por 10 factores por condición lumínica -luz y sombra- y 45 unidades experimentales. Se utilizaron diferentes combinaciones de sustratos orgánicos. Las semillas fueron sometidas a un tratamiento pre-germinativo en presencia de un testigo. Las variables evaluadas fueron porcentaje de germinación, crecimiento en altura y diámetro y porcentaje de supervivencia. La especie comenzó la germinación 13 días después de la siembra y se extendió hasta el día 27. Los resultados del proceso de germinación fueron de 60 % y 40% a plena exposición solar y bajo malla poli-sombra, respectivamente. El crecimiento en altura de las plántulas muestra al factor CF con el mejor valor 28,94 cm, bajo condiciones de luz y el factor EF, con 25,56 cm a plena exposición de sombra. Mientras el incremento en diámetro los factores DF y EF registraron valores de 1,04 cm y 0,84 cm, bajo las condiciones sol y sombra respetivamente. Las semillas de esta especie son no-fotoblásticas, es decir que para su germinación es indiferente la presencia o ausencia de luz. Las plántulas ubicadas en la condición ambiental sol registraron mejores valores promedios en las variables diámetro y altura. Por tanto, esta condición ejerce efecto positivo para el crecimiento inicial de las plántulas de Abarco C. pyriformis. 

  8. Caracterización química y propiedades bioactivas de hongos silvestres portugeses comestibles

    OpenAIRE

    Barros, Lillian Bouçada de

    2008-01-01

    Nineteen different mushroom species (Agaricus arvensis, Agaricus bisporus, Agaricusromagnesii, Agaricus silvaticus, Agaricus silvicola, Cantharellus cibarius, Hypholomafasciculare, Lactarius deliciosus, Lactarius piperatus, Lepista nuda, Leucopaxillusgiganteus, Lycoperdon molle, Lycoperdon perlatum, Macrolepiota mastoidea,Macrolepiota procera, Ramaria botrytis, Sarcodon imbricatus, Tricholoma acerbum and Tricholoma portentosum) from Northeast of Portugal, one of the European regions with high...

  9. Variações espaciais na assembléia de peixes no Rio Paraíba do Sul (Barra Mansa, Barra do Piraí, Rio de Janeiro, Brasil Spatial variation in fish assemblage in the Paraíba do Sul River (Barra Mansa, Barra do Piraí, Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Francisco Gerson Araújo

    2001-06-01

    Full Text Available The Paraíba do Sul is a major running water system in southeastern Brazil (22º24' -22º26'S; 43º43' -44º16' W, draining one of the most important industrial regions in the country. Because of its location, it has suffered a large amount of alteration due to discharges of urban and industrial effluents with direct influence in the ichthyofauna. The aim of this study is to up-to-date information on fish assemblage structure and its variation in the vicinity of a major industrial effluent outfall at Volta Redonda industrial complex. A standardized fishing sampling program, using seines, casting nets, gill nets and net trays, was carried out from October 1997 to September 1999, at six sites in three zones of the river (upstream, nearby and downstream the industrial complex, aiming to compare variation in fish assemblage due to anthropogenic alteration. Fifty-two species in 13 families were identified in the total of 7286 fish specimens. Characidae was the most diverse family contributing with 28,85% to total number of species, followed by Cichlidae (17,31 %. Overall 15,38% of the species were introduced from other watershed systems, four exotic cichlids (genera Oreochromis Günther, 1862 and Tilapia A. Smith, 1840 and three aloctone (Cichla ocellaris Bloch & Schneider, 1801, Hyphessobricon callistus (Boulenger, 1900 e Metynnis maculatus (Kner, 1860. Lebistes reticulatus (Peters, 1859 was the most abundant fish species contributing to 39,7% of the total number of fish, followed by Geophagus brasiliensis (Quoy & Gaimard, 1824 amounting to 27,4%. Fish abundance was higher in the industrial zone, but only a few very dominant species were captured, while the upstream zone showed the most even community. Species replacement tolerance along the alterations gradient in the three zone seems to be a strategy to use the limited resources in the area.

  10. “Sou caipira pira pora...”: representations of the provincial, from the parasite of the land to the paradigm of national reality (1889-1945“Sou caipira pira pora...”: representações sobre o caboclo, do parasita da terra a paradigma da realidade nacional (1889-1945

    Directory of Open Access Journals (Sweden)

    Jonathan de Oliveira Molar

    2009-04-01

    Full Text Available This paper is aimed at discussing the representations about the hillbilly, the national peasant based on visions of two intellectuals: writer Monteiro Lobato and painter José Ferraz de Almeida Jr. Therefore, both literature and iconographic sources will support an analysis of the living standards of the rustic, as found in the historical period covered – 1889 until 1945. Contributions from authors who work with image analysis will be used as method, such as Henry Silva’s and Ana M. Mauad’s, and authors who work with the said period and the provincial issue: Lilia Schwarcz, Glauco Barsalini and Antonio Candido. O presente trabalho se propõe a discutir as representações elaboradas acerca do caboclo, do caipira nacional a partir das visões de dois intelectuais: o escritor Monteiro Lobato e o pintor José Ferraz de Almeida Júnior. Desse modo, analisar tanto na literatura quanto no conjunto iconográfico o ir e vir que perpassa as considerações sobre o modo de vida do caboclo, de acordo com o período histórico abordado – de 1889 até 1945. Para tanto, utiliza-se de autores que trabalham com análise de imagens, tais como: Henrique Silva e Ana M. Mauad; e, autores que trabalham com o citado período e a questão cabocla: Lilia Schwarcz, Glauco Barsaline e Antônio Cândido.

  11. Surveillance of arbovirus infections in the atlantic forest region, State of São Paulo, Brazil: I. detection of hemagglutination-inhibition antibodies in wild birds between 1978 and 1990 Vigilância de infecções por arbovírus na Região da Mata Atlântica, Estado de São Paulo, Brasil.: I. Detecção de anticorpos inibidores de hemaglutinação em aves silvestres entre 1978 e 1990

    Directory of Open Access Journals (Sweden)

    Ivani B. Ferreira

    1994-06-01

    Full Text Available We report data related to arbovirus antibodies detected in wild birds periodically captured from January 1978 to December 1990 in the counties of Salesópolis (Casa Grande Station, Itapetininga and Ribeira Valley, considering the different capture environments. Plasmas were examined using hemagglutination-inhibition (HI tests. Only monotypic reactions were considered, except for two heterotypic reactions in which a significant difference in titer was observed for a determined virus of the same antigenic group. Among a total of 39,911 birds, 269 birds (0.7% belonging to 66 species and 22 families were found to have a monotypic reaction for Eastern equine encephalitis (EEE, Venezuelan equine encephalitis (VEE, Western equine encephalitis (WEE, Ilheus (ILH, Rocio (ROC, St. Louis encephalitis (SLE, SP An 71686, or Caraparu (CAR viruses. Analysis of the data provided information of epidemiologic interest with respect to these agents. Birds with positive serology were distributed among different habitats, with a predominance of unforested habitats. The greatest diversity of positive reactions was observed among species which concentrate in culture fields.Apresentam-se os resultados referentes a anticorpos para arbovírus em aves silvestres capturadas, periodicamente, de janeiro de 1978 a dezembro de 1990, nos municípios de Salesópolis (Estação de Casa Grande; Itapetininga e municípios do Vale do Ribeira, considerando-se os diferentes ambientes de captura. Plasmas foram examinados, por testes de Inibição de Hemaglutinação (IH. Considerou-se apenas as reações monotípicas, com exceção de duas reações heterotípicas, onde ocorreu uma diferença de título significativa para um determinado vírus de um mesmo grupo antigênico. Em um total de 39.911 aves, foram encontradas 269 aves pertencentes a 66 espécies e 22 famílias, com reação monotípica para os vírus Encefalite Equina do Leste (EEE, Encefalite Equina Venezuelana (VEE

  12. Pesquisa de anticorpos contra Leptospira spp. em animais silvestres e em estado feral da região de Nhecolândia, Mato Grosso do Sul, Brasil: utilização da técnica de imuno-histoquímica para detecção do agente Investigation of antibodies to Leptospira spp. in wild and feral animals from the region of Nhecolândia, Mato Grosso do Sul, Brazil: use of the immunohistochemistry technique for the agent detection

    Directory of Open Access Journals (Sweden)

    Raul José Silva Girio

    2004-02-01

    Full Text Available Foram examinadas 315 amostras de soros sangüíneos de diversas espécies de animais que vivem em estado feral ou silvestre na região de Nhecolândia, Corumbá, MS, por meio da prova de soroaglutinação microscópica para leptospirose. Dessas amostras, 67 foram de bois baguás (Bos taurus indicus, 39 de porcos-monteiros (Sus scrofa, 39 de búfalos (Bubalus bubalis, nove de quatis (Nasua nasua, 41 de veados-campeiros (Ozotoceros bezoarticus, 10 de veados-mateiros (Mazama americana e 110 amostras de ovinos (Ovis aries. Em 12 animais que vieram a óbito, seis porcos-monteiros, quatro veados-campeiros e dois ovinos, foram realizadas tentativas de isolamento de Leptospira do fígado e dos rins por cultura em meio semi-sólido. Fragmentos desses órgãos foram submetidos a exame histopatológico e também a exame para detecção das Leptospiras pela técnica de imuno-histoquímica. Os resultados dos exames sorológicos mostraram que 64 (20,3% das amostras foram reagentes para, pelo menos, um sorovar de Leptospira patogênica; foram reagentes 41,0% das amostras de búfalos, 40,3% das de bois baguás, 17,9% das de porcos-monteiros, 9% das de ovinos e 9,7% das amostras de veados-campeiros; nenhuma das amostras de veados-mateiros e de quatis foi reagente. Os sorovares mais freqüentes foram: pomona, para búfalos e ovinos; icterohaemorrhagiae, para ovinos, veados-campeiros e suínos; e copenhageni, para veados-campeiros e suínos. As tentativas de isolamento dos rins e fígados foram todas negativas, e pela técnica da imuno-histoquímica foi detectada Leptospira no fígado de um porco-monteiro. As principais alterações estruturais, encontradas nos rins de dois veados-campeiros e de um porco-monteiro, foram infiltrado inflamatório intersticial com congestão associada a hemorragias.Three hundred and fifteen serum samples of several animal species living in wild or in feral state in the area of Nhecolândia, Corumbá, MS, Brazil, were examined by the

  13. Inverting the Army Intelligence Pyramid

    Science.gov (United States)

    2011-05-19

    British experience fighting the Provisional Irish Republican Army ( PIRA ) in Northern Ireland, which began an insurgency in 1969.91...they became extremely successful.”93 Martin Van Creveld posits that the British Army’s success against the PIRA in Northern Ireland stands out as...and MI6 (Secret Intelligence Service) to defeat the PIRA .97 92 John Kiszely, "Learning About

  14. Concentración de Diclorodifeniltricloroetano (DDT) en poblaciones silvestres de Cocodrilos (Crocodylus acutus y C. Moreletti) en la zona Costera de México

    OpenAIRE

    Loa Loza, Eleazar

    2012-01-01

    Para determinar la concentración de DDT y sus metabolitos en ejemplares de cocodrilos (Crocodylus acutus y C. moreletii), durante el período de junio a diciembre de 2004 se tomaron 80 muestras de sangre en 37 localidades de 13 estados de la zona costera de México. En algunos de estos sitios, ha sido aplicado el DDT para el control del vector del paludismo. Las muestras fueron procesadas en el laboratorio mediante cromatografía de gases con detector de captura de electrones. Se realizó un anál...

  15. Estudo sobre triatomíneos e reservatórios silvestres de Trypanosoma cruzi no estado do Paraná, Sul do Brasil. Resultados preliminares

    Directory of Open Access Journals (Sweden)

    Toledo Max Jean de Ornelas

    1997-01-01

    Full Text Available Em localidades da zona rural de cinco municípios da região noroeste do Paraná adultos e ninfas de Triatoma sordida foram capturados em 21 (41,2% de 51 unidades domiciliares pesquisadas. Foram capturados 154 exemplares de T. sordida e 2 Panstrongylus megistus. De 135 exemplares examinados 58 (43,0% apresentavam o Trypanosoma tipo cruzi. Constatou-se também a infecção em 57,1% (4/7 dos gambás (Didelphis sp examinados. O peridomicílio apresentou-se mais infestado que o intradomicílio, sendo a casa de madeira abandonada a construção mais freqüente (34,7% do total investigado e com maior taxa de infestação (53,9%. Os dados mostram um elevado índice de infestação da zona rural por espécies secundárias de triatomíneos com altas taxas de infecção por flagelados do tipo T. cruzi, em uma área endêmica para a doença de Chagas já em fase de vigilância epidemiológica.

  16. Evaluación de medios de cultivo para propagación in vitro de semillas y explantes de especies silvestres de Solanum

    Directory of Open Access Journals (Sweden)

    Danita Andrade Díaz

    2013-01-01

    Full Text Available Se evaluaron los medios de cultivo Hussey-Stacey (A, Hendrix et al. (H, Atkinson et al. (AT y mitad de Murashyge y Skoog (½MS para la propagación in vitro de semillas y explantes de Solanum mammosum, S. marginatum, S. hirtum y S. umbellatum. En la fase de propagación sexual se evaluó el porcentaje de germinación, número de raíces, longitud de planta, días a formación de hojas y raíces, días a morfogénesis completa y materia seca. Se determinó el tipo de morfogénesis a través de callos, vástago y plantas totalmente formadas. Se estudiaron el número y longitud de brotes, número de raíces y hojas, producción de materia seca y días a morfogénesis completa. Para S. mammosum el mejor medio de germinación fue ½MS, para el desarrollo de plantas fue A y para propagación vegetativa, A-Nudos (Medio A con explantes tipo nudos. En el mismo orden, para S. marginatum fueron los medios A, H y ½MS y/o H con nudos, mientras que en S. hirtum fueron H,A y H-nudos. Para S. umbellatum no se encontraron diferencias en germinación entre H, ½MS y A. Para la formación de plantas el mejor medio fue ½ MS y para propagación vegetativa fue H-Nudo.

  17. Patrones de asociación entre insectos polinizadores y palmas silvestres en Colombia con énfasis en palmas de importancia económica

    OpenAIRE

    Núñez Avellaneda, Luis Alberto

    2014-01-01

    Se describe, analiza y valida el papel de los insectos que han sido considerados los principales polinizadores de palmas neotropicales: las especies del género Mystrops (Nitidulidae), diferentes grupos de gorgojos (Curculionidae), los escarabajos del género Cyclocephala (Dynastidae), especies de y Abejas sin aguijón (Apidae Meliponinae). El estudio se realizó a partir de un análisis multiespecífico y multitemporal de polinizadores que involucró la colecta, separación e identificacion de visit...

  18. Animais silvestres utilizados como recurso alimentar em assentamentos rurais no município de Uruará, Pará, Brasil

    Directory of Open Access Journals (Sweden)

    Reinaldo Lucas Cajaiba

    2015-08-01

    Full Text Available The consumption of hunting animals is of fundamental importance for human subsistence in different tropical areas. Knowing the chosen species, the techniques of capture and the quantity are fundamental aspects to understand how to use and the degree of threat of hunting on each wild species. In this perspective, the objective of this work was to record the wild animal species most commonly used as food resource in five rural settlements in the municipality of Uruará-PA, in addition to qualify the main techniques of capturing these species. The data collection was made through semi-structured interviews and participant observation. For the selection of the interviewees, we adopted the “snowball” method. As a result, we identified 38 species of animals consumed, most being mammals (42.1%, followed by birds (39.4% and reptiles (18.5%. The species most frequently mentioned were: Cuniculus paca (n=156, Euphractus sexcinctus (n=154 and Pecari tajacu (n=137. The most used technique was hunting with shotgun. Among the animals cited, Priodontes maximus, Tayassu pecari, Tapirus terrestris, Myrmecophaga tridactyla, Podocnemis unifilis, Tinamus tao, Crax fasciolata and Podocnemis unifilis are in the list of threatened species. The results point to the urgent need for educational programs to farmers regarding the unsustainable use of animals.

  19. Aedes albopictus em área rural do Brasil e implicações na transmissão de febre amarela silvestre

    Directory of Open Access Journals (Sweden)

    Almério de Castro Gomes

    1999-02-01

    Full Text Available Durante estudos ecológicos sobre mosquitos anofelíneos no município de Bataguassu, Estado de Mato Grosso do Sul, foram encontradas larvas e adultos de Aedes albopictus. Pela primeira vez sua introdução ocorre numa área enzoótica do vírus selvático da febre amarela no Brasil. Isto sugere risco potencial para transferência desse vírus para área urbana infestada com Aedes aegypti.

  20. Aedes albopictus em área rural do Brasil e implicações na transmissão de febre amarela silvestre

    Directory of Open Access Journals (Sweden)

    Gomes Almério de Castro

    1999-01-01

    Full Text Available Durante estudos ecológicos sobre mosquitos anofelíneos no município de Bataguassu, Estado de Mato Grosso do Sul, foram encontradas larvas e adultos de Aedes albopictus. Pela primeira vez sua introdução ocorre numa área enzoótica do vírus selvático da febre amarela no Brasil. Isto sugere risco potencial para transferência desse vírus para área urbana infestada com Aedes aegypti.

  1. Nuevos registros de nemátodes parásitos de animales de vida silvestre en el Perú

    Directory of Open Access Journals (Sweden)

    Manuel Tantaleán

    2014-06-01

    Full Text Available Se registran, por primera vez para el Perú, 4 especies de nemátodes: Dipetalonema graciliformis Freitas, 1964 parásito de Saguinus labiatus; Evaginuris branickii (McCiure, 1932 Quentín, 1973 de Dinomys branickii; Alaeuris caudatus (Lent & Freitas, 1948 de Iguana iguana y Serpinema amazonicus de Podocnemis expansa. También, se considera a Saguinus labiatus como un nuevo huésped para Dipetalonema graciliformis.

  2. Capacidad antioxidante de poblaciones silvestres de “tara” (Caesalpinia spinosa de las localidades de Picoy y Santa Fe (Provincia de Tarma, departamento de Junín

    Directory of Open Access Journals (Sweden)

    Alberto López S.

    2011-01-01

    Full Text Available El Perú es el principal abastecedor de “tara”, gracias a que nuestro país posee una gran variedad de climas y tipos de suelos, haciendo posible la obtención de este cultivo durante la mayor parte del año. El departamento de Junín cuenta con poblaciones naturales de “tara” que aun no han sido caracterizadas bioquímica ni genéticamente, que podrían aprovecharse en beneficio de las comunidades locales. En este trabajo se reporta la capacidad antioxidante de “tara” provenientes de las localidades de Picoy y Santa Fe, ambas ubicadas en Tarma, Junín. Se utilizó la técnica del DPPH y del ABTS para valorar la capacidad antioxidante; para la determinación de fenoles y flavonoides se utilizó el reactivo de Folin-Ciocalteau según la técnica de Singleton. La muestra de Picoy reportó mayor cantidad de fenoles siendo de 563.70 mg/g de extracto seco, mientras que la cantidad de flavonoides fue de 0.664 mg/g. La capacidad antioxidante mostro una mejor respuesta en la muestra de Picoy, reportándose mediante el DPPH un IC50 1.244 mg/ml y con el ABTS un 35.3% de inhibición. Estos datos podrían aprovecharse para incrementar el valor agregado y mejorar la oferta de este recurso en dicha localidad debido a sus mejores características antioxidantes.

  3. Causa de morte de animais silvestres oriundos de uma área de resgate: implicações na conservação

    OpenAIRE

    Elmer Alexander Genoy Puerto

    2012-01-01

    No Brasil, no transcorrer da última década tem-se aumentado a produção de energia renovável. Dessa forma, empreendimentos visando produção e distribuição de energia tem sido desenvolvidos, exemplo disto são as Pequenas Centrais Hidrelétricas (PCHs). Perda e fragmentação de habitat são consideradas fatores negativos para a conservação in situ, sendo que podem colocar em perigo de extinção numerosas espécies de vertebrados terrestres. Durante a construção de hidrelétricas, esses dois eventos po...

  4. Evaluación de medios de cultivo para propagación in vitro de semillas y explantes de especies silvestres de solanum

    OpenAIRE

    Lagos Burbano, Tulio César; Andrade Díaz, Danita; Córdoba Figueroa, Mónica Eliana; Criollo Escobar, Hernando

    2014-01-01

    Se evaluaron los medios de cultivo Hussey-Stacey (A), Hendrix et al. (H), Atkinson et al. (AT) y mitad de Murashyge y Skoog (½MS) para la propagación in vitro de semillas y explantes de Solanum mammosum, S. marginatum, S. hirtum y S. umbellatum. En la fase de propagación sexual se evaluó el porcentaje de germinación, número de raíces, longitud de planta, días a formación de hojas y raíces, días a morfogénesis completa y materia seca. Se determinó el tipo de morfogénesis a través de callos, vá...

  5. Variación del fenotipo antenal de poblaciones del domicilio, peridomicilio y silvestres de Triatoma dimidiata (Hemiptera: Reduviidae en Santander, Colombia

    Directory of Open Access Journals (Sweden)

    Corina María Arroyo

    2007-01-01

    Conclusiones. El fenotipo de sensilla antenal fue útil en la diferenciación intraespecífica de Triatoma dimidiata en diferentes hábitats. Las diferencias en hembras ponen de manifiesto nuevos arreglos sensoriales para la explotación del hábitat a diferencia de los machos, que por su mayor capacidad de dispersión, no se diferenciaron entre los ecotopos. La similitud entre hembras de zona urbana, con hembras de peridomicilio rural permite proponer al fenotipo antenal como un sencillo y eficiente indicador para la determinación del origen de triatominos que intentan colonizar nuevos hábitats.

  6. OCORRÊNCIA DE PARASITOS GASTRINTESTINAIS EM AVES SILVESTRES NO MUNICÍPIO DE SEROPÉDICA, RIO DE JANEIRO, BRASIL

    Directory of Open Access Journals (Sweden)

    Ísis Alves Costa

    2010-12-01

    Full Text Available This study aimed to assess the role of endoparasitic infections as another factor of biological pressure on both migratory and local bird species. The occurrence of endoparasites may be considered a sign of undesirable hygienic alterations, causing the shortening of natural fields, compromising the resting area and the habitat nutritional quality. A total of 75 fecal samples were collected at the Campus of the Universidade Federal Rural do Rio de Janeiro (UFRRJ, Brazil, between August 2007 and May 2008, and they were analyzed in a Lugol´s solution by Faust´s technique. Amongst the 82.66% positive samples for enteric parasites, 44% were parasitized by the trichomonads and 5.33% by the Chilomastix enterozoary genera, 52% presented coccidian oocysts, 29.33% showed Entamoeba coli, 37.22% presented Iodamoeba butschlii vegetative forms, and 10.66% were positive for worm eggs. The high prevalence of enteroparasites observed indicates the need of more detailed and frequent evaluations of the environmental sanitary conditions, whose impact seems to be associated to the scarce local hygienic conditions due to the growing anthropization.

  7. Flowering induction in radicchio (cichorium intybus l.var silvestre bischoff:the influence of vernalization in different types and classes of precocity

    Directory of Open Access Journals (Sweden)

    Ferdinando Pimpini

    2008-07-01

    Full Text Available All experiments were carried out at the Experimental Station “L. Toniolo” of the University of Padova (45°21’ N; 11°58’ E. Experiment 1. This research was undertaken to study the effect of increasing duration of cold periods (0-5-10-15- 20 and 30 days on three classes of “Rosso di Chioggia” with different precocity: “Perseo” (Precocious, “Leo” (Medium and “Virgo” (Late. Seeds were sown on different dates (V30-V20-V15-V10-V5 and V0, i.e. May 10th- 20th-25th and 30th, June 5th and 10th 2004 respectively and placed in pre-formed polystyrene multiple trays. Treatments with low temperatures (5 °C started on the 1st June for V30 and for the others (V5-V10-V15 and V20 25-20-15 and 10 days later in controlled growth chambers, while plants that did not require vernalization stayed in the greenhouse. After vernalization and its stabilisation for 15 days, plants were transplanted in open field (July 24th. Moreover, on the 30th of August the number of leaves in rosette and elongated stem on five flowered plants for each group was determined, to verify the possible existing relation between flowering and the number of leaves on plant. Experiment 2. This experiment was undertaken to compare the effect of vernalization on flowering of 8 cultivars of radicchio to assess their membership of annual or biennial species. The 8 cultivars were Rosso di Treviso tardivo “Sile tardivo”, Rosso di Treviso precoce “Mesola precoce”, Rosso di Chioggia “Perseo” (P, “Leo” (M and “Virgo” (L, Rosso di Verona “Cologna medio”, Variegato di Lusia “Adige tardivo” e Variegato di Castelfranco “Castellano medio”. All types were vernalized for 0-5 and 15 days (V0-V5 and V15. Seeds were placed (January 15th-25th and 30th 2005 for V15, V5 and V0 respectively in pre-formed polystyrene multiple trays. Vernalization (5 °C started on February 14th in controlled growth chambers and, at the end, was stabilized for 15 days. After vernalization and its stabilisation, plants were transplanted in open field (May 26th. In both experiments, after the transplant, plants were controlled everyday to determine the exact day in which the stem elongation started (stage 51 BBCH. Results showed that: (1 there is no relation between the number of leaves on plant and flowering; (2 vernalization exerts different effect on promoting flowering among types; (3 on average the effect of cold period is quantitatively related to its duration; (4 low temperature increased flowering precocity anticipating the stage of phase transition; (5 the behaviour of different types of radicchio shows that Rosso di Treviso tardivo is probably a biennial plant, while the others act as annual species.

  8. Métodos e Implicaciones de la Contracepción en Fauna Silvestre y Exótica en Zoológicos

    OpenAIRE

    Dave Wehdeking

    2010-01-01

    Es fácil comprender la importancia de los programas de mejoramiento diseñados para conservar las especies amenazadas y en peligro. Al mantener en cautiverio las poblaciones de animales, los zoológicos y acuarios son capaces de realizar investigación fundamental y allanar el camino a la posible reintroducción de especies en la naturaleza...

  9. Installation of devices in water tanks to prevent drowning of wild animals (Instalacion de Estructuras Dentro de Tanques de Agua Para Evitar El Ahogamiento de Animales Silvestres)

    Science.gov (United States)

    Alberto Lafon

    2006-01-01

    Domestic farm and ranch properties use a variety of water retention structures and water supply infrastructures that benefit wildlife. Some water supply systems, however, are harmful to wild birds, small mammals, and reptiles. Water supply systems include metal water tanks, cemented reservoirs, or excavated earthen retention ponds (or tanques as they are known in...

  10. Enraizamento de estacas de três espécies silvestres de Passiflora Cutting rooting of three wild Passiflora species

    Directory of Open Access Journals (Sweden)

    Marcelo Fideles Braga

    2006-08-01

    Full Text Available Em ambiente com nebulização controlada, estacas herbáceas com um par de folhas, contendo 2 ou 3 nós, foram testadas quanto ao enraizamento, utilizando-se de bandeja de poliestireno com célula de 95cm³ e saco plástico de 15x25x0,02cm com 1.730 cm³. Foram testadas estacas de Passiflora actinia, P. serrato-digitata e P. setacea. Observou-se que P. serrato-digitata apresentou 94,3% de estacas enraizadas com brotos e 2,4% de mortalidade; enquanto P. actinia e P. setacea apresentaram, respetivamente, 30,5% e 28,6% de estacas enraizadas com brotos e 56,8% e 60,7% de mortalidade. A alta mortalidade das estacas foi atribuída ao estado fenológico das matrizes de P. actinia e P. setacea e ao ataque de larvas de bradisia (Bradysia spp. Estacas com dois e três nós não apresentaram diferenças significativas, e o recipiente saco plástico de 1.730 cm³ proporcionou melhor desenvolvimento das mudas.Steam cuttings of three wild Passiflora species where tested for rooting in a mist regulated greenhouse. Cuttings with two or three buds were used with two kinds of containers: polystyrene trays with 95 cm³ cells and perforated plastic bags of 15x25x0.02cm, with 1,730 cm³. Passiflora serrato-digitata was the best, with 94.3% of rooted cuttings with shoots e only 2.4% of death cuttings. P. actinia and P. setacea showed , respectivelly, 30.5% and 28.6% of rooted cuttings and 56.8% and 60.7%, of death cuttings. The high death were attribute to phenological phases of P. actinia and P. setacea or injury caused by fungus-gnat larvae (Bradysia spp.. Cuttings with two or three buds didn't show differences among them. Plastic bags proporcioned the best results, increasing rooted cuttings and plant development.

  11. Influência do tamanho da amostra na estimativa da riqueza em espécies em levantamentos de abelhas silvestres (Hymenoptera, Apoidea

    Directory of Open Access Journals (Sweden)

    José Ricardo Cure

    1990-01-01

    Full Text Available The effect of area size, number of collecting hours and months surveyed, on the estimation of relative richness of bees is analized. In order to characterize a biogeographical region, it is suggested to collect various samples of no less than 400 especimens for each one, in contrasting localities within a region, utilizing the usual standardized methodology for wild bees collecting. Thus, it is possible to have a better profit of the effort invested in the survey, making it possible to estimate the relative species richness among different biogeographical regions, in shorter periods of time.

  12. La utilidad de los modelos de distribución de especies en la gestión cinegética de los ungulados silvestres

    Directory of Open Access Journals (Sweden)

    Refoyo, P.

    2014-12-01

    Full Text Available The usefulness of species distribution models in hunting management of wild ungulates We developed a distribution model of Iberian ibex (Capra pyrenaica using the maximum entropy method (Maxent based on information from the database of the Spanish Ministry of Agriculture, Food and Environment. The goal was to study the usefulness of such models to determine potential areas for reintroduction or natural colonization of the species. To validate the model, we used data generated from known densities of the Iberian ibex in 107 protected areas: 26 areas where the species is present, and 81 where it is not present. Findings showed that the preferred habitat for the species has steep slopes, altitude over 1,000 m, and seasonal variation in precipitation and temperature. We detected a significant relationship between the densities obtained in the study areas and their relation to the preferred habitat. Our results indicate these models can be useful in species management planning to determine areas for reintroduction of the species.

  13. Uma estação biológica para o estudo dos mosquitos e dos outros animaes silvestres relacionados com a febre amarela

    Directory of Open Access Journals (Sweden)

    Henrique de Beaurepaire de Aragão

    1943-01-01

    Full Text Available The outbreak of the jungle or forest yellow fever, through the adapta¬tion, quite recently of the yellow fever virus o the forest mosquitoes, brou¬ght the necessity of ecological researches on hese mosquitoes, as well as on the wild animals they bite, some of them being susceptible to the desease. This has been done by the special yellow fever Service of the State of Sao Paulo, in a special Biological Station in Perús, São Paulo, which has been built in the midst of the jungle. This station was made with plain materials, and covered with straw, but was confortable enough for the technical work, i nthe early months of 1938. During the months in which the investigations were being carried on, the following interesting results were obtained: 1. As we have already pointed out in other places, the forest mosquitoes biting us during daytime, are always new born insects, having not yet sucked blood, as it is the general rule with all mosquitoes, and therefore also, with the anopheles and stegomyia, and this explains why nobody gets malaria or yellow fever, transmitted by anofeles or by aedes aegypti during the day. We think therefore, the jungle yellow fever, got during daytime is not due to the infected jungle or forest mosquito biting, but to infection through the human skin coming into close contact with tre virus, which the forest mosquitoes lay with their dejections, on the leaves of the trees where they remain sitting du¬ring the day. 2. As it is the rule with anopheles, stegomyia and other mosquitoes, the insects once having sucked blood, take nocturnal habits and, therefore, bite us, only during the night, so it happens with the forest mosquito, and insects with developped eggs and blood in stomach have been caught within the sta¬tion house, during the night. During the day, these mosquitoes do not bite, but remain quite still on the leaves of the trees, in the damp parts of the woods. 3. Jungle or forest mosquitoes can easely bite wild animals, some with more avidity then ethers, as it has bee npointed out to the opossum (didei-phis and other animals. They also bite birds having very thin skin and only exceptionally, cold bloods animals. 5. Is has hot been possible to ascertain how forest mosquitoes are able to live, from onde season to another, through winter, when temperature drops near and even below zero. They have not been found in holes of the terrain, of trees and of animals, as it is the rule in cold countries. During winter, in the forest, it is possible to find larvs in the holes of bambus and trees full of water. As wild animals do not harbour the yellow fever virus for a long time in their body, it is diffcult to explain how the desease lasts from one season to another. Many ecological features on the mosquito, remains yet to be explained and therefore it in necessary to go on with the investigations, in bio¬logical stations, such as that one built up in Perús, São Paulo.

  14. Reporte de albinismo en Podiceps major, Pelecanus thagus y Cinclodes fuscus y revisión de aves silvestres albinas del Perú

    Directory of Open Access Journals (Sweden)

    Miriam Torres

    2013-03-01

    Full Text Available Reportamos observaciones de individuos albinos en tres especies de aves peruanas, el Zambullidor Grande (Podiceps major, el Pelícano peruano (Pelecanus thagus y el Churrete cordillerano (Cinclodes fuscus. Los individuos eran albinos parciales casi totalmente blancos, aparentemente adultos, que mostraron un comportamiento normal entre sus conespecíficos. La supervivencia después de varios meses pudo ser comprobada para el Pelícano peruano y el Churrete cordillerano. Debido a que la información publicada sobre albinismo en aves peruanas es muy escasa, se realizó una revisión y se recopilaron registros para otras nueve especies que son también presentados.

  15. Toxoplasmose em animais silvestres e domésticos da região de Botucatu, estado de São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Ednir Salata

    1985-02-01

    Full Text Available Os Autores analisaram soros de 47 Cannis familiaris, de 9 Felis cattus, de 64 Didelphis marsupialis aurita, de 9 Dasypus novemcinctus, de 4 Cabassous tatouay e de 29 Rattus rattus, através da reação de imunofluorescência indireta, para pesquisar a presença de anticorpos anti Toxoplasma gondii. Estes foram encontrados apenas em C. familiaris (63,8% e em D. m. aurita (4,7%. Frente aos resultados obtidos, os Autores sugerem que novas pesquisas nesta área sejam realizadas, para que se conheça melhor a importância epidemiológica de várias espécies animais na disseminação da toxoplasmose.

  16. Estudio de la composición en ácidos grasos del aceite de las semillas en algunas plantas silvestres españolas

    OpenAIRE

    Vioque, Javier; Pastor Díaz, Julio Enrique; Vioque Martínez, Eduardo

    1994-01-01

    The fatty acid composition of 34 species of plants from a variety of families that grow wild in the Iberian Peninsula was analysed. The aim to the survey was to indentify oils that contain a mix of fatty acids that from a qualitative or quantitative point of view have a commercial value. Because of the diverse taxonomic origin of the samples, the oil content between species was very variable, fluctuating between an average value of 3.4% in the Caryophyllaceae and 31.1% in &...

  17. Aves silvestres infestadas por Phthiraptera (Insecta na Zona da Mata Norte de Pernambuco, Brasil Wild birds infested by Phthiraptera (Insecta in Pernambuco North Zona da Mata

    Directory of Open Access Journals (Sweden)

    Sônia Aline Roda

    1999-01-01

    Full Text Available Studies were carried out on the relationship between Phthiraptera and wild birds captured by mist nets at the Engenho Independência, at Vicência's county. Three families of Phthiraptera were identified. The Menoponidae were the one with the highest number of hosts. They were specially found in the dorsal face of the remiges. The Trochiloecetidae were only seen infesting the neck of birds belonging to the hummingbirds. The Philopteridae were observed on birds from three orders showing the highest variety of distribution on the birds.

  18. Creciendo en la adversidad. Una revisión del proceso de adaptación al diagnóstico de cáncer y el crecimiento postraumático (Growing through adversity. Analysis of the process of adaptation to a diagnosis of cancer and subsequent posttraumatic growth. A review

    Directory of Open Access Journals (Sweden)

    María del Mar Campos-Ríos

    2013-04-01

    Full Text Available The aim of this paper was to examine adjustment to a diagnosis of cancer, cancer as trauma, and the posttraumatic growth process by reviewing the scientific literature. We first present Folkman & Greer's (2000 adjustment to cancer model updated by Holland (2002 and then review cancer as a possible cause of posttraumatic stress. Finally, we describe Tedeschi & Calhoun's (2004 Posttraumatic Growth construct. The review is concluded with a sample of different points of view about posttraumatic growth related to cancer, and with some suggestions about future researches.

  19. Estrategias metodológicas para mejorar la motricidad fina en niños de 3 a 4 años en la Unidad de Atención MIES, Creciendo con Nuestros Hijos (CNH) Estrellitas Radiantes de la parroquia Luis Cordero Vega, del cantón Gualaceo, período lectivo 2016-2017

    OpenAIRE

    Banegas Cabrera, Tania Maribel

    2017-01-01

    El presente trabajo de investigación consiste en la elaboración de la Guía Metodológica para el mejoramiento de la Motricidad Fina para los niños y niñas del MIES-CNH Estrellitas Radiantes. Se basa en motricidad fina y técnicas grafoplásticas estructuradas en una guía constituida y organizada en principios, criterios, procedimientos, implementación y evaluación. This research work consists on the development of a Methodological Guide for the improvement of fine motor control for children o...

  20. Effects of Soil Aluminum on Early Arbuscular Mycorrhizal Colonization of Wheat an Barley Cultivars Growing in an Andisol Efecto del Aluminio del Suelo en la Colonización Temprana por Micorrizas Arbusculares en Cultivares de Trigo y Cebada Creciendo en un Andisol

    Directory of Open Access Journals (Sweden)

    Alex Seguel

    2012-09-01

    Full Text Available Aluminum phytotoxicity in acid soils is an important environmental stress that negatively affects crop production, but arbuscular mycorrhizal (AM fungi performance would allow plants to better withstand this environmental condition. This study aimed to analyze the effect of soil Al on early AM colonization of wheat (Triticum aestivum L. and barley (Hordeum vulgare L. cultivars. Near-isogenic Crac, Invento, and Porfiado wheat cultivars and Sebastián and Aurora barley cultivars were sown in pots in an acid soil at three Al saturation levels (60, 34, and 11%. At 20 d after sowing (DAS 'Crac' presented higher AM colonization (27% than other cultivars. However, 'Invento' had the fastest colonization at 41 DAS, which was inhibited in short term at lower Al-saturation. Moreover, roots of 'Aurora' were colonized 28 and 51% at 20 and 66 DAS, respectively, and also decreased at lower Al-saturation. In soil with 60% Al-saturation a great spore production was observed at 41 DAS, 'Aurora' had the highest spore density at 66 DAS. At 20 DAS a negative relationship (r = -0.37; p La fitotoxicidad por Al en suelos ácidos es un importante estrés que afecta negativamente la producción de cultivos, pero la actividad de hongos micorrícicos arbusculares (MA permitiría que las plantas soporten mejor esta condición ambiental. Este estudio tuvo como objetivo analizar el efecto del Al en la colonización MA temprana de cultivares de trigo (Triticum aestivum L. y cebada (Hordeum vulgare L.. Cultivares de trigo Crac, Invento, y Porfiado, y de cebada Sebastián y Aurora fueron sembrados en macetas en un suelo ácido con tres niveles de saturación de Al (60, 34, y 11%. A los 20 días después de la siembra (DDS 'Crac' presentó la mayor colonización MA (27%; sin embargo, 'Invento' tuvo la más rápida colonización a los 41 DDS, la cual fue inhibida a corto plazo a una menor saturación de Al. Por otra parte, las raíces de 'Aurora' fueron colonizadas 28 y 51% a los 20 y 66 DDS, respectivamente, y también se redujo a una menor saturación de Al. En suelos con 60% de saturación de Al se observó una gran producción de esporas a los 41 DDS, siendo 'Aurora' el de más alta densidad de esporas a los 66 DDS. A los 20 DDS se observó una relación negativa (r = -0.37, p < 0,001 entre la colonización MA temprana y la masa de las raíces. Además, dicha relación fue más fuerte (r = -0.49, p < 0,001 cuando las plantas fueron cultivadas en alta saturación de Al. Una temprana colonización MA se observó en todos los cultivares ensayados cuando se cultivaron en alta saturación de Al y fue superior en las variedades aparentemente más tolerantes a Al, sugiriendo que una temprana colonización MA puede ser un factor importante en la tolerancia a Al para plantas agrícolas cultivadas en suelos ácidos.

  1. Growing up with HIV/AIDS: a study on adolescents with HIV/AIDS and their family caregivers Creciendo con VIH/SIDA: un estudio con adolescentes portadoras de VIH/SIDA y sus cuidadoras familiares Crescendo com HIV/AIDS: estudo com adolescentes portadoras de HIV/AIDS e suas cuidadoras-familiares

    Directory of Open Access Journals (Sweden)

    Ana Amélia Antunes Lima

    2008-06-01

    Full Text Available This is an exploratory study with a qualitative approach, which looks at the adolescent process with HIV/AIDS. The purpose is to identify how the adolescent process occurs, from the perspective of these teenagers and their family caregivers. The investigation was performed in Porto Alegre, RS between May and July 2005, and the subjects were four adolescents and three caregivers. Data were collected by means of interviews, which were subject to the content analysis technique. The study revealed that both teenagers and family caregivers did not show concern with the changes typical of the period, especially regarding sexuality questions. Yet, the underlying diagnosis and coping with HIV remain in the family core in order to protect these agents against the stigma of the disease.Es un estudio exploratorio con abordaje cualitativo, que trata del proceso de desarrollo de la adolescencia en portadoras de VIH/SIDA, con el objetivo de identificar cómo ocurre el proceso de la adolescencia, en la visión de estas adolescentes y de sus cuidadoras familiares.La investigación se realizó en Porto Alegre-RS, entre los meses de mayo y julio de 2005; los sujetos fueron cuatro adolescentes y tres cuidadoras. La colecta de las informaciones se hizo por medio de entrevistas que fueron sometidas a la técnica de análisis de contenido. El estudio reveló que las adolescentes y sus cuidadoras familiares, manifestaron preocupación con los cambios propios de ese período, especialmente en asuntos relacionados a la sexualidad. Se hizo evidente que el diagnóstico y la convivencia con el VIH permanecen ocultos en el contexto familiar, con el objetivo de proteger, a estos actores, del estigma de la enfermedad.Estudo exploratório com abordagem qualitativa, que trata do processo de adolescer de portadoras de HIV/AIDS, com o objetivo de identificar como ocorre o processo da adolescência, na ótica dessas adolescentes e de suas cuidadoras-familiares. A investigação foi realizada em Porto Alegre, RS, entre os meses de maio e julho de 2005, sendo que os sujeitos foram quatro adolescentes e três cuidadoras. A coleta das informações ocorreu por meio de entrevistas que foram submetidas à técnica de análise de conteúdo. O estudo revelou que tanto as adolescentes quanto suas cuidadoras-familiares não manifestaram preocupação com as transformações próprias do período, especialmente nas questões que envolvem a sexualidade. Evidenciou-se que o diagnóstico e a convivência com o HIV ainda permanecem velados no círculo familiar, visando a proteção desses atores com relação ao estigma da doença.

  2. Field Insect Pests and Crop Damage Assessment of Pigeon Pea (Cajanus cajan [L.] Huth grown under Ratoon and in Mixture with Maize Evaluación de Campo de Insectos Pestes y Daño del cultivo de Gandul (Cajanus cajan [L.] Huth creciendo bajo Rebrotes o en Mezcla con Maíz

    Directory of Open Access Journals (Sweden)

    Madang A Dasbak

    2012-03-01

    Full Text Available The widespread adoption of cropping systems that are sustainable and environmentally friendly is vital for the macroeconomic survival of civilization. Intercropping could ensure stability of insect populations in a system. A 3-yr (2005-2007 field trial was therefore carried out in Nigeria under regular and ratoon crops to evaluate five recently developed pigeon pea (Cajanus cajan [L.] Huth genotypes (ICPL 87, ICPL 161, ICPL 85063, ICP 7120, and ICPL 87119 from the International Crops Research Institute for Semi-Arid Tropics (ICRISAT and one local variety for their relative performance and susceptibility to insect pests. The pigeon pea genotypes were in a mixture with two maize genotypes (Zea mays L., open-pollinated and hybrid in regular crops for 2 yr (2005-2006 followed by a ratoon crop for 1 yr (2007. Termites (Odontotermes badius, crickets (Gymnogryllus lucens, and variegated grasshoppers (Zonocerus variegatus were the crop's seedling pests and caused minimal damage. Clavigralla spp. infestations were high at the reproductive stage causing 24% and 29% seed damage in regular and ratoon pigeon pea crops, respectively. Maize slightly suppressed insect pest incidence and damage to pigeon pea pods and seeds but significantly (P La extendida adopción de sistemas de cultivo que son sustentables y benignos para el medio ambiente es vital para la supervivencia macro-económica de la civilización. El intercultivo podría asegurar la estabilidad de población de insectos en un sistema. Un ensayo de campo de 3 anos (2005-2007 fue realizado en Nigeria bajo condiciones de cultivo regular y ratoon para evaluar cinco genotipos de poroto gandul (Cajanus cajan [L.] Huth: ICPL 87, ICPL 161, ICPL 85063, ICP 7120, e ICPL 87119 desde International Crops Research Institute for Semi-Arid Tropics (ICRISAT y una variedad local, por sus rendimientos y susceptibilidades relativas a insectos plaga. Los genotipos de poroto gandul estaban en mezcla con dos genotipos de maíz (Zea mays L., de polinización abierta e híbrido en cultivos regulares por 2 anos (2005-2006 seguido por un ratoon por 1 ano (2007. Termitas (Odontotermes badius, grillos (Gymnogryllus lucens y saltamontes variegado (Zonocerus variegatus fueron las plagas de plántula del cultivo, causando dano mínimo. Infestaciones con Clavigralla spp. fueron altas en el estado reproductivo causando 24% y 29% de dano seminal en cultivos regular y de poroto gandul ratoon. El maíz suprimió la incidencia de la plaga y el dano a las vainas y semillas de poroto gandul pero redujeron significativamente (P < 0,01 el rendimiento de grano en los cultivos de poroto gandul en 2005 y 2006, pero no en ratoon en 2007. Los genotipos de poroto gandul difirieron significativamente (P < 0,05 en incidencia de la plaga al estado de vaina en cultivos regular y ratoon y en rendimiento de grano (P < 0,01 bajo el cultivo regular. El rendimiento de granos de los cultivos de poroto gandul ratoon fue aproximadamente 60% de aquel del cultivo regular. Los genotipos ICPL 161 e ICPL 87 se recomendaron para adopción por los agricultores basados en tolerancia a las plagas y alto rendimiento de granos o como idiotipos en programas de hibridación de poroto gandul.

  3. A Preliminary Investigation into CNO Availability Schedule Overruns

    Science.gov (United States)

    2012-06-01

    days PHNSY Pearl Harbor Naval Shipyard and IMF PIA Planned Incremental Availability PIRA Pre-Inactivated Restricted Availability PNSY Portsmouth...DSRA 6 DEM 2 EOH 6 IA 2 PIA 3 MMP 1 ERO 3 SRA 1 PIRA 2 DMP 1 RCD 2 CM 1 DPIA 2 Table 23. High Level Work Stoppage Data Characteristics 1

  4. Highway Security: Filling the Void

    Science.gov (United States)

    2011-09-01

    Infrastructure Protection Plan PERF – Police Executive Research Forum PIRA – Provisional Irish Republican Army SCC – Sector Coordinating Council TSA...experience dealing with IEDs, such as the United Kingdom whose “troubles” with the Provisional Irish Republic Army ( PIRA ) was fraught with IED

  5. Th e rediscovery of the Redwood orpiment and a Th e rediscovery of the Redwood orpiment and a cocktail of plants macerates containing arbutin to cocktail of plants macerates containing arbutin to defeat the Arribas-Silvestre defeat the Arribas-Silvestre,s syndrome in a bien agée s syndrome in a bien agée upper class lady

    Directory of Open Access Journals (Sweden)

    Lorenzo Martini

    2017-10-01

    Full Text Available The Arribas-Silvestre’s syndrome is a sort of photodermatitis induced especially in elder (especially women when they use to put pure essences or fragrances directly onto their skin, take some medicaments and expose to sun rays periodically. The black spots are irreversible and are aesthetically unpleasant. Generally people tend to renounce to treat this disease, since it seems no remedy is available and strongest lotions or emulsions containing 2-5% of hydroquinone are banished and anyway perilous. Here I herald a simplest method using on alternate days an ancient orpiment to abrade black spots and a mix of herb macerates containing arbutin, apt to bleach the original brownish or black maculae.Results are amazing.

  6. 77 FR 33307 - Columbia Unlimited Hydroplane Races; Kennewick, WA

    Science.gov (United States)

    2012-06-06

    .... FOR FURTHER INFORMATION CONTACT: If you have questions on this notice, call or email BM1 Silvestre Suga III, Coast Guard Marine Safety Unit Portland; telephone 503-240-9327, email Silvestre[email protected

  7. 76 FR 73511 - Safety Zone; M/V DAVY CROCKETT, Columbia River

    Science.gov (United States)

    2011-11-29

    ... INFORMATION CONTACT: If you have questions on this temporary rule, call or email BM1 Silvestre Suga, Waterways Management Division, Marine Safety Unit Portland, Coast Guard; telephone (503) 240-9319, email Silvestre.G...

  8. 77 FR 19544 - Regulated Navigation Area, Zidell Waterfront Property, Willamette River, OR

    Science.gov (United States)

    2012-04-02

    ... INFORMATION CONTACT: If you have questions on this rule, call or email BM1 Silvestre Suga III, Waterways Management Division, Coast Guard Sector Columbia River, telephone 503-240-9319, email Silvestre[email protected

  9. 76 FR 58112 - Safety Zone; M/V DAVY CROCKETT, Columbia River

    Science.gov (United States)

    2011-09-20

    ... Silvestre Suga, Waterways Management Division, Marine Safety Unit Portland, Coast Guard; telephone 503-240- 9319, e-mail Silvestre[email protected] . If you have questions on viewing the docket, call Renee V...

  10. 76 FR 49664 - Safety Zone; M/V DAVY CROCKETT, Columbia River

    Science.gov (United States)

    2011-08-11

    ... questions on this temporary rule, call or e-mail BM1 Silvestre Suga, Waterways Management Division, Marine Safety Unit Portland, Coast Guard; telephone 503-240- 9319, e-mail Silvestre[email protected] . If you...

  11. 76 FR 42549 - Columbia Unlimited Hydroplane Races; Kennewick, WA

    Science.gov (United States)

    2011-07-19

    ... have questions on this notice, call or e-mail BM1 Silvestre Suga III, Coast Guard Marine Safety Unit Portland; telephone 503-240-9327, e-mail Silvestre[email protected] . SUPPLEMENTARY INFORMATION: The Coast...

  12. PirAB Toxin from Photorhabdus asymbiotica as a Larvicide against Dengue Vectors▿

    OpenAIRE

    Ahantarig, Arunee; Chantawat, Nantarat; Waterfield, Nicholas R.; ffrench-Constant, Richard; Kittayapong, Pattamaporn

    2009-01-01

    We have evaluated Photorhabdus insect-related protein (Pir) from Photorhabdus asymbiotica against dengue vectors. PirAB shows larvicidal activity against both Aedes aegypti and Aedes albopictus larvae but did not affect the Mesocyclops thermocyclopoides predator. PirAB expressed the strongest toxicity compared to PirA, PirB, or the mixture of PirA plus PirB. Whether the presence of an enterobacterial repetitive intergenic consensus sequence in PirAB, but not in PirA, PirB, or the mixture of P...

  13. Development and Validation of RP-LC Method for the Determination of Cinnarizine/Piracetam and Cinnarizine/Heptaminol Acefyllinate in Presence of Cinnarizine Reported Degradation Products

    Directory of Open Access Journals (Sweden)

    Ola M. EL-Houssini

    2013-01-01

    Full Text Available Specific stability indicating reverse-phase liquid chromatography (RP-LC assay method (SIAM was developed for the determination of cinnarizine (Cinn/piracetam (Pira and cinnarizine (Cinn/heptaminol acefyllinate (Hept in the presence of the reported degradation products of Cinn. A C 18 column and gradient mobile phase was applied for good resolution of all peaks. The detection was achieved at 210 nm and 254 nm for Cinn/Pira and Cinn/Hept, respectively. The responses were linear over concentration ranges of 20-200, 20-1000 and 25-1000 μgmL −1 for Cinn, Pira, and Hept respectively. The proposed method was validated for linearity, accuracy, repeatability, intermediate precision, and robustness via statistical analysis of the data. The method was shown to be precise, accurate, reproducible, sensitive, and selective for the analysis of Cinn/Pira and Cinn/Hept in laboratory prepared mixtures and in pharmaceutical formulations.

  14. Development and Validation of RP-LC Method for the Determination of Cinnarizine/Piracetam and Cinnarizine/Heptaminol Acefyllinate in Presence of Cinnarizine Reported Degradation Products

    Science.gov (United States)

    EL-Houssini, Ola M.; Zawilla, Nagwan H.; Mohammad, Mohammad A.

    2013-01-01

    Specific stability indicating reverse-phase liquid chromatography (RP-LC) assay method (SIAM) was developed for the determination of cinnarizine (Cinn)/piracetam (Pira) and cinnarizine (Cinn)/heptaminol acefyllinate (Hept) in the presence of the reported degradation products of Cinn. A C18 column and gradient mobile phase was applied for good resolution of all peaks. The detection was achieved at 210 nm and 254 nm for Cinn/Pira and Cinn/Hept, respectively. The responses were linear over concentration ranges of 20–200, 20–1000 and 25–1000 μgmL−1 for Cinn, Pira, and Hept respectively. The proposed method was validated for linearity, accuracy, repeatability, intermediate precision, and robustness via statistical analysis of the data. The method was shown to be precise, accurate, reproducible, sensitive, and selective for the analysis of Cinn/Pira and Cinn/Hept in laboratory prepared mixtures and in pharmaceutical formulations. PMID:24137049

  15. Curvature Analysis of Cardiac Excitation Wavefronts

    Science.gov (United States)

    2013-04-01

    reconstructed the isolines of 10,000 frames, both with PIRA and the contour function of MATLAB. The first took 1.65 seconds while the second took 720...seconds. Hence, PIRA had a 444.44-fold speedup compared to contour. The platform was equipped with Intel Core i7-930 2.8 GHz LGA 1,366 130W Quad-Core

  16. Effect of pioglitazone and ramipril on biomarkers of low-grade inflammation and vascular function in nondiabetic patients with increased cardiovascular risk and an activated inflammation: results from the PIOace study.

    Science.gov (United States)

    Pfützner, Andreas; Hanefeld, Markolf; Dekordi, Lida A; Müller, Jürgen; Kleine, Iris; Fuchs, Winfried; Forst, Thomas

    2011-07-01

    This study investigated the effects of pioglitazone (PIO), ramipril (RAM), or their combination (PIRA) on low-grade inflammation in nondiabetic hypertensive patients with increased cardiovascular risk. Patients enrolled in this placebo-controlled, double-blind, randomized, parallel trial (72 male, 77 female, aged 60 ± 9 years, body mass index 30.4 ± 4.7 kg/m(2), duration of hypertension 9 ± 8 years) were treated with either 30/45 mg PIO (dose titration), 2.5/5 mg RAM, or their combination for 12 weeks. A reduction in high-sensitivity C-reactive protein was observed with PIO (-0.89 ± 1.98 mg/liter; -25%) and PIRA (-0.49 ± 2.11 mg/liter; -16%), while an increase was seen with RAM (0.58 ± 2.13 mg/liter; +20%, p PIRA). The 24-hour blood pressure profile showed a small increase with both monotherapies but a decrease with PIRA (p PIRA arms only [PIO/RAM/PIRA: homeostasis model of assessment of IR: -0.78 ± 1.39 (-29%)/0.15 ± 1.03 (+5%)/ -1.44 ± 2.83 (-40%); adiponectin: 8.51 ± 5.91 (+104%)/ 0.09 ± 2.63 (+1%)/ 8.86 ± 6.37 mg/liter (+107%); matrix metallo-proteinase-9: -48 ± 127 (-12%)/-1 ± 224 (0%)/-60 ± 210 ng/ml (-13%), p PIRA in all cases]. Our 3-month study in nondiabetic hypertensive patients showed a decrease in biomarkers of IR and chronic systemic inflammation with the PIO monotherapy and the PIRA combination only, which may help to explain some findings in other cardiovascular outcome trials. © 2011 Diabetes Technology Society.

  17. Caracterización de los aceites crudo, neutro y decolorado de la pulpa y cascara de la fruta silvestre Paraqueiba sericea tulasne «Umarí».

    Directory of Open Access Journals (Sweden)

    Chasquibol Silva, Nancy A.

    1997-02-01

    Full Text Available Crude, neutro and blenched oil extracted from pulp and peel of jungle fruit Paraqueiba sericea tulasne «Umarí» were studied. The crude oil was extracted with hexane by the soxhlet method giving a 47.86% yield, a 31.72% yield in neutro oil and a 94.89% yield in blenched oil. Chemical and physical constants were determined. In addition, five methyl esters of fatty acids were quantitatively determined by GLC using DEGS as stationary phase. The results indicated that Umarí oil belongs to a not drying type with a high content of unsaturated fatty acids principaly oleic. The analytical values obtained confirm the convenience of using Umarí oil in food and cosmetic industries.

    Se estudian los aceites crudo, neutro y decolorado del fruto del Umarí. La extracción del aceite crudo se realizó mediante hexano por el método de soxhlet. El rendimiento fue de un 47,86% en aceite crudo, 31,72% en aceite neutro y 94,89% en aceite decolorado. Por métodos analíticos se determinaron constantes químicas y físicas. Además por cromatografía gas-líquido se cuantificaron cinco esteres metílicos de ácidos grasos, usando DEGS como fase estacionaria. Los resultados del estudio indican que el aceite de Umarí corresponde a un aceite del tipo no secante y con alto contenido de ácidos grasos insaturados principalmente oleico. Los índices analíticos obtenidos confirman la conveniencia de usar aceite de Umarí para aplicaciones en alimentos y cosmética.

  18. Contribuição da fauna silvestre em projetos de restauração ecológica no Brasil Contribution of the wildlife in ecological restoration projects in Brazil

    Directory of Open Access Journals (Sweden)

    Wanuza Helena Campos

    2012-12-01

    Full Text Available O sucesso no processo de restauração e manutenção da dinâmica de um ecossistema é extremamente dependente da capacidade das espécies em promover interações interespecíficas entre as diversas formas de vida. Estas interações criam um cenário favorável à restauração ecológica de ecossistemas degradados. Assim, por meio de revisão de literatura, o objetivo deste trabalho é relatar a contribuição e utilização dos diferentes grupos de animais na execução de projetos de restauração ecológica no Brasil. As aves e mamíferos frugívoros e também outros animais, como os répteis, peixes e insetos, têm se destacado como ferramentas de auxílio aos projetos de restauração ecológica. As técnicas para atração de animais e consequente chegada de propágulos em um ecossistema degradado compreende a utilização de poleiros, que servem de pouso e abrigo para a avifauna e morcegos, e a utilização de abrigos artificiais, que servem para fuga de predadores, descanso e reprodução dos animais. De modo geral, estes estudos são excelentes ferramentas para gerir ações de manejo ambiental em ecossistemas degradados, possibilitando a recuperação da biodiversidade destes ambientes. The success in the process of restoration and maintenance of the dynamics of an ecosystem is highly dependent on the capacity of species to promote interspecific interactions among the various life forms. These interactions create a favorable environment for the ecological restoration of degraded ecosystems. Thus, by review the literature, the objective of this study is to report the contribution and use of different animal groups in carrying out ecological restoration projects in Brazil. The fruit-eating birds and mammals and also other animals such as reptiles, fish and insects have been highlighted as tools to aid environmental ecological restoration projects. Techniques for attracting animals and consequent arrival of seedlings in a degraded ecosystem comprises the use of perches, which serve as landing and shelter for birds and bats, and the use of artificial shelters, which serve to escape from predators, resting and reproduction of animals. In general, these studies are excellent tools for managing environmental management actions in degraded ecosystems, enabling the recovery of biodiversity in these environments.

  19. Analysis of the generation and monitoring of impact on fauna in the gas pipeline works in the current environmental legislation; Analise da geracao e monitoramento do impacto sobre a fauna silvestre em obras de gasodutos face a legislacao ambiental vigente

    Energy Technology Data Exchange (ETDEWEB)

    Caldas, Flaviana V.; Serricchio, Claudio [PETROBRAS, Rio de Janeiro, RJ (Brazil); Akahori, Lisa [TELSAN Engenharia e Servicos Ltda, Vitoria, ES (Brazil); Nascimento, Reinaldo R. [IMC Saste - Construcoes, Servicos e Comercio Ltda., Sao Paulo, SP (Brazil)

    2008-07-01

    The impacts to wildlife in areas where gas pipelines will be implemented are considerable, changing the existing balance. The main environmental measure adopted in the cases is the deployment of the Fauna Management Programme. This programme is sub - divided into two: Monitoring and Rescue of the fauna. The tracking step starts before the installation of the venture, with the completion of a first in order to identify the impacts before the venture, and finishes two years after the end of the works. These studies are based on guidelines set in the Normative Instruction of the environmental licensor agency, in which the criteria for implementation are restrictive, often without making a license agency distinction of methodology for enterprises with different characteristics. This article intended to review the criteria and the procedures established by the legislation and its real applicability in gas pipeline projects face to the environmental impacts identified to this activity. For this analysis, the methodology used was the case study of two gas pipelines: Cabiunas - Vitoria (GASCAV) and Cacimbas - Catu (GASCAC). The results allowed to conclude that the actions developed to the Sub-Programme of Rescue of the fauna are satisfactory to control environmental impacts and that the Sub-Programme of Monitoring of the fauna just confirm behaviors and information's previous detected. (author)

  20. An English-Spanish Glossary of Terminology Used in Forestry, Range, Wildlife, Fishery, Soils, and Botany = Glosario en Ingles-Espanol de Terminologia Usada en Forestales, Pastizales, Fauna, Silvestre, Pesqueria, Suelos, y Botanica.

    Science.gov (United States)

    Medina, Alvin Leroy

    This document presents English-Spanish/Spanish-English equivalent translations of scientific and management terms commonly used in the field of natural resource management. The glossary is composed of two sections. Section 1 contains the English to Spanish translations, while Section 2 provides the Spanish to English translations. Each section is…

  1. Estudos dos agrupamentos vegetativos relacionados com as áreas onde foram efetuadas as pesquisas sôbre a febre amarela silvestre no Município de Passos, Estado de Minas Gerais

    Directory of Open Access Journals (Sweden)

    Henrique P. Veloso

    1947-09-01

    Full Text Available The work reported here was carried-out on the invitation of Dr. Henry Kumm, Director of the Rockefeller Foundation, and by appointment from Dr. Henrique Aragão, Director of the Instituto Oswaldo Cruz. It was done during the investigation of sylvan yellow fever, in June 1947, with a view to establishing the phyto-ecological conditions of the county of Passos. The pe¬riod was, however, too short for definite conclusions to be reached. Thanks are due to Dr. O. R. Causey, Chief of Research on Yellow Fever for transpor¬tation and other help. THE REGIONAL VEGETATION. Aerial photographs of the county of Passos shoto that it is covered by three great types of vegetation: Rain Forest, Secondary Pasture Land and Scrub.1 Detailed investigation, however, brings out the fact that these correspond to different seres; furthermore, each type presents not only the specific, characteristics of the biological form dominant for the climate, but also are at various stages, which express HABITATS differing from those of the normal sere. The phytogeographic survey of the region shows that most of it is now covered by secondary pasture land (disclimax in which Melinis minutiflora, v. "fat grass" (fig. 1, predominates. The mosaic of Rain Forest and of small patches of Scrub reveals the effects of human intervention (BARRETO, H. L. de Mello 1; consequently, all the formations have to be regarded as secon¬dary, though some of them probably include relicts of the primitive climax (WARMING, E. 2. On close examination, the Scrub cannot be considered as the climax, because of the following facts: 1. In the zone of Rain-Forest stretches of forest are present in very varied topographic conditions and the reconstitution of the associations show that man has destroyed an ecological unit (fig. 2. 2. In the zone of Scrub the characteristic patches are small. The banks of rivers and brooks, the valleys and ravine and whatever the soil has retained some humidity, is being invaded fry Rain Forest, which seems to be growing under optimum conditions. The Scrub is thus limited to small belts on the calcareous mountains and on sandy soils with alcaline depths (pH abo¬ve 7 which do not retain enough moisture for the Rain Forest that is progres¬sively restricting the area occupied by Scrub. In view of the topographic and present climatic conditions the Rain Forest must consequently be regarded as the regional climax. The presence of ecologically contradictory elements and associations shows that the real problem is that of the fluctuations of the climate of Passos or even of Minas Geraes during the quaternary and recent periods (DAN-SEREAU, P. : 3, a subject on which little is known and which is tied to the evolution of the climate of Brazil (OLIVEIRA, E. : 4 . The transformation of Scrub into Rain Forest has been - observed by the author before, in other parts of Brazil (VELOSO, PL P.: 5 . It seems probable that the Rio Grande has also greatly influenced the change of the regional vegetation, by invading areas of Scrub and dislocating the limit of the Pluvial climate towards the Canastra Range, though there are remnants of Scrub (postclimax transfor¬med into secondary open country (disclimax, fig. 5 by human devastation and the setting of fire to the land. VEGETATION GROUPS OF THE PLUVIAL TYPE. The map of the region also shows that at the present time the small patches of forest (whether devasted or intact occupy the least accessible places, such as valleys, peaks and abrupt slopes (fig. 2. Even these are now being destroyed, so that in the near future this forested region will be en¬tirely reduced to poor pasture land unless energetic measures of conservation are undertaken in time. The Special Service for Prophylaxis against Yellow Fever installed two of their four Stations for the Capture of Mosquitos in this area, one of them at Batatal and the other at Cachoeira, which have separate formations each of them composed of several associations. Other vegetation formations were also analysed, from the synecological point of view, so as to ascertain of which degree of succession their associations belong. These phytosociological sur¬veys give an idea of the principal characteristics of each station. BATATAL FORMATION. The abrupt nature of the valley has rendered this location inappropriate for agricultural purposes since colonial times. The relict of the primitive forest climax saved by this circumstance has expanded gradually to zones whose paedologic conditions favour the eatablishment of mesophilous species. The aerial photograph shows two small stretches of forest, one apparently primi¬tive, the other composed of associations belonging to the subclimax of the subsere. CACHOEIRA FORMATION. Aerial photographs show that this station is crossed by a small river, which divides it into two separate parts. The first, which presents ecological conditions similar, though not identical to those of Batatal, is favoured by topography and apparently remains primitive forest. Though the topography of the other, on the whole, favours the establishment of groups belonging to the normal sere of the climax, is has been partly devastated recently and the aspect of the associations has been completely modified. It was is this part that the four posts for the capturing of mosquitos were set up. The first forest is favoured by deposition of organic matter, washed out from the nearby devasted areas by torrential rains, and thus provides, an appropriate HABITAT for the climax species with certain hygrophilous trends of the ecological quasiclimax type. This association seems to have reached a biological equilibrium, as the dominates. Gallesia gorarema and Cariniana legalis (fig. 10, present an optimum vitality with a vigorous habit and a normal evolutionary cycle. The Cariniantum legalis Gallesiosum equilibrium, corresponds however, to a provisory association, because if the moving of soil by torrential rains should cease it would become possible…

  2. OBTENCIÓN DE CEPAS Y PRODUCCIÓN DE INÓCULO DE CINCO ESPECIES DE HONGOS SILVESTRES COMESTIBLES DE ALTA MONTAÑA EN EL CENTRO DE MÉXICO

    Directory of Open Access Journals (Sweden)

    Yolanda Arana-Gabriel

    2014-01-01

    Full Text Available Se obtuvieron cepas de Psathyrella spadicea , Floccularia aff. luteovirens , Clitocybe squamulosa , Flammulina mexicana y Lyophyllum aff. shimeji , cuyos esporomas son recolectados y consumi - dos por habitantes del Nevado de Toluca, México. Las cepas se estudiaron in vitro en seis medios de cultivo (ACP: Agar croquetas de perro, AM: Agar maíz, PDA-PL: Agar papa dextrosa-pepto - na y levadura, EMA-PL: Agar extracto de malta-peptona y levadura, PDA y EMA a 18 °C y 25 °C. Las especies se desarrollaron satisfactoriamente a 18 °C , siendo F. mexicana y L . aff. shimeji las que tuvieron mayor velocidad de crecimiento y producción de biomasa. Flammulina mexicana solo se desarrolló a 18 °C, presentando mayor crecimiento y producción de biomasa en ACP. La cepa de L. aff. shimeji creció a 18 y 25 °C, la mayor velocidad de crecimiento se registró en medio PDA a 18 °C y la mayor producción de biomasa en EMA-PL a 18 °C. Considerando las mejores condiciones para el desarrollo de micelio in vitro, se produjo inóculo primario de F. mexicana y L . aff. shimeji en trigo y sorgo. La mayor densidad del micelio y porcentaje de grano cubierto se obtuvieron con el sustrato de trigo.

  3. Characterization and cultivation of a wild mushroom species isolated in Brazil
    Caracterização e cultivo de uma espécie de cogumelo silvestre isolado no Brasil

    OpenAIRE

    Luzia Doretto Paccola-Meirelles; Cristina Sayuri Maki

    2002-01-01

    Wild mushrooms were collected close to cattle manure in pasture areas in Tamarana (Paraná/Brazil), with the objective of finding and domesticating new non-exploited basidiomycetes. An edible basidiomycete of the Agaricales order was classified as belonging to the Macrolepiota bonaerensis species (=Lepiota procera, form bonaerensis (Speg.) Rick or M. procera (Scop.:Fr) Sing.). The mycelia was isolated and characterized for growth rate in different culture media. A vigorous growth was observed ...

  4. Aedes albopictus em área rural do Brasil e implicações na transmissão de febre amarela silvestre Aedes albopictus in rural zone of Brazil and its implication in the sylvatic yellow fever transmission

    Directory of Open Access Journals (Sweden)

    Almério de Castro Gomes

    1999-02-01

    Full Text Available Durante estudos ecológicos sobre mosquitos anofelíneos no município de Bataguassu, Estado de Mato Grosso do Sul, foram encontradas larvas e adultos de Aedes albopictus. Pela primeira vez sua introdução ocorre numa área enzoótica do vírus selvático da febre amarela no Brasil. Isto sugere risco potencial para transferência desse vírus para área urbana infestada com Aedes aegypti.Larvae and adult forms of Aedes albopictus were found during ecological study of anopheline mosquitos in the rural zone of the state of Mato Grosso do Sul in Brazil. This occurrence was registered, for the first time in Brazil, in an enzoootic area if sylvatic yellow fever virus. This implies a potential risk of the transfer of this virus to an urban area infested with Aedes aegypti.

  5. Percepción y patronos de uso de la fauna silvestre o comunidades indigenas Embera - Katíos en la cuenca del río San Jorge, zona amortiguadora del PNN - Paramillo.

    Directory of Open Access Journals (Sweden)

    Javier Alfonso Racero - Casarrubia

    2008-12-01

    Full Text Available In workshops with four indigenous communities in the Embera-Katíos communal lands (resguardo , located in the upper San Jorge River Valley (Tres Playitas, Las Piedras, Boca San Cipriano, San Juan Medio, information about the wild fauna that they recognized inside their hunting grounds was collected. Mammals, reptiles, and birds, especially the Psittacidae family, are the vertebrates most used by the indigenous communities. No kind of use was found for amphibians. The consumption of reptiles such as Iguana iguana, Tupinambis teguixin, Caiman crocodylus fuscus, and Crocodylus acutus show them to be an important part of their culture. The indigenous communities associate environmental problems with habitat destruction due to the cultivation of illicit crops and forest clearing in the buffer zone around Paramillo National Park.

  6. Conservação, diversidade e distribuição de variedades locais de milho e seus parentes silvestres no extremo oeste de Santa Catarina, Sul do Brasil

    OpenAIRE

    Silva, Natália Carolina de Almeida

    2015-01-01

    Tese (doutorado) - Universidade Federal de Santa Catarina, Centro de Ciências Agrárias, Programa de Pós-Graduação em Recursos Genéticos Vegetais, Florianópolis, 2015. As informações sobre a atual diversidade de milho do Brasil são escassas e a maior parte dos estudos tem se destinado a caracterizar e analisar a diversidade conservada ex situ. Pesquisas antecedentes têm demonstrado que a microrregião Extremo Oeste do estado de Santa Catarina possui uma importante riqueza de variedades locai...

  7. Patrones de distribución de felinos silvestres (Carnívora: Felidae en el trópico seco del Centro-Occidente de México

    Directory of Open Access Journals (Sweden)

    Juan Felipe Charre-Medellín

    2015-09-01

    Full Text Available El estado de Michoacán se caracteriza por presentar una importante heterogeneidad ambiental, en términos de clima, topografía y tipos de vegetación, que incluyen al bosque tropical seco que se encuentra en peligro de extinción a nivel mundial. Algunos trabajos mencionan la presencia de las seis especies de felinos que habitan en México, para la región; sin embargo, la evidencia para apoyar estos trabajos es escasa, por lo que llenar esta falta de información es especialmente crítico en el caso de especies o hábitats amenazados. El objetivo de este estudio fue sistematizar la información y analizar los patrones de distribución de los felinos en el estado de Michoacán, dentro del centro-occidente de México. Realizamos una revisión de la información bibliográfica y contenida en bases de datos sobre la presencia de felinos en esta región. Asimismo, realizamos trabajo de campo que en el curso de diez años donde se aplicaron distintos métodos para detectar la presencia de especies de felinos (recorrido de senderos para obtener evidencia directa e indirecta de la presencia de las especies, trampas cámara y entrevistas. Localizamos 29 registros de presencia en literatura y bases de datos. Por otra parte acumulamos un total de 1 107.5 km de transectos recorridos y 8 699 días/cámara-trampa. A través de este esfuerzo de muestreo, generamos 672 registros de presencia de las seis especies. Lynx rufusfue la especie con menos registros totales (n = 3 y cuya distribución contrastó más con la del resto de las especies. La especie con más registros fue Leopardus pardalis(n = 343. En general, el 89% de los registros de felinos se obtuvieron por debajo de los 1 000 msnm. En promedio, la temperatura media anual y la precipitación anual donde se ubicaron los registros fue de 24 °C y 1 040 mm respectivamente. La especie que mostro un patrón más claro en términos de temperatura y precipitación fue L. rufus(15.8 ± 1.3°C y 941 ± 171 mm. De acuerdo con el dendrograma resultante del análisis de conglomerados de las combinaciones de ecorregiones y tipos de vegetación se logró distinguir cinco grupos. Este estudio permite tener un panorama más completo de los patrones de distribución de los felinos en una región de importante contraste ambiental y sujeto a un fuerte impacto por las actividades humanas. Asimismo, los datos generados en este estudio pueden ayudar a profundizar nuestro entendimiento de la relación que existe entre la distribución de especies de felinos y las características del ambiente y servir como base para el desarrollo de estrategias de conservación local y regional.

  8. Repelência de substâncias naturais e sintéticas aos mamíferos silvestres consumidores de sementes de Araucaria angustifolia (Bertol. Kuntze em semeadura no campo.

    Directory of Open Access Journals (Sweden)

    Guilherme O. S. Ferraz de Arruda

    2008-01-01

    Full Text Available This work aimed at testing some natural and synthetic substances, not phytotoxics and not lethal for the fauna, to verify the repellence action for the consuming wild animals of Parana-Pine seeds, in two direct sowing experiments in the field. In experiment I, there was the direct application of the treatments in the Parana-Pine seeds and, in the experiment II, there was the application of the treatments only in the surface of the plantation hollows, after the sowing of Parana-Pine seeds. The Parana-Pine seeds and the treatments were prepared at Laboratory of Center of Agroveterinary Sciences, University of Santa Catarina State, at Lages city, Brazil. The experiments were carried to a native-antropic field area at Lages city. It was adopted the experimental design of randomized blocks for both experiments. Experiment I was composed of 15 treatments, 10 seeds per treatment, with 4 replications, and experiment II was composed of 11 treatments, 10 seeds per treatment, with 4 replications. The tested substances, isolated or in mixtures, were: fruit of red pepper, root of parsley, stem and leaf of wormwood herb, lemon scented gum essential oil, linseed oil, castor bean oil, rosin, copper oxychloride, copper sulphate, sulphur, látex ink and calcium lignosulfonate. Through the periodic inspections, during 167 and 165 days respectively for the experiments I and II, data were collected and organized through the attacked and not attacked Paraná-Pine seeds, being submitted to statistical analysis later. The predation rates were considered high for both experiments: 86,7% in experiment I and 84,3% in experiment II. In the experiment with treated Parana-Pine seeds, the longer time for the beginning of the predation was 104 days after the sowing, while, in the experiment with treatment in the environment (hollows, it was 64 days after the sowing. Solution of rosin and alcohol + lemon scented gum oil, applied in the seeds, presented potential for reduction of the predation level. The treatments with linseed oil presented changeable behaviors, equally to the treatments with latex ink, in the experiment with treated Parana-Pine seeds. In the experiment with treated hollows, the lignosulfonate of calcium in mixture with extracts of pepper, with root of parsley and with wormwood herb presented significant effect of reduction on the predation. The solution of linseed with red pepper extracts and with root of parsley extract also had significant effect for reduction of the predation of these seeds, in the experiment with treated hollows

  9. Plantas medicinales silvestres y/o naturalizadas en la península de Araya, estado Sucre, Venezuela | wild and/or naturalized medicinal plants in the Araya peninsula of Sucre state, Venezuela

    Directory of Open Access Journals (Sweden)

    Jesús Bello Pulido

    2017-11-01

    Full Text Available Currently, the accelerated processes of transculturation and the eminent deterioration of ecosystems are jeopardizing the biodiversity that has contributed to the welfare of the inhabitants of the planet, whether by providing food, medicine or craft. For this reason, the present study attempts to expand the ethnobotanical knowledge within 21 coastal communities of the Araya peninsula in Sucre state, Venezuela. To gather this information, non-structured interviews were conducted on older adults and key-informants who maintain an ongoing relationship with the plants of their local environment. These interviews were held during field trips made between 2010 and 2016. A total of 24 families, 47 genera and 52 species (50 dicots and 2 monocots of plants with some degree of utility were identified. Among them, 46 species are wild and 6 were introduced and now naturalized. A total of 26 new products of the medicinal flora from the peninsula is reported.

  10. ¿Es posible la recuperación de especies silvestres extintas a través de la transferencia somática nuclear? Is the recovery of extinct wild species through somatic nuclear transfer possible?

    Directory of Open Access Journals (Sweden)

    Janet López-Saucedo

    2010-08-01

    Full Text Available El avance de las ciencias biomédicas está llegando a campos inexplorados y sorprendentes; en fecha reciente, se ponderó la posibilidad de "recuperar" especies extintas al publicarse la "resurrección" de la primera subespecie extinta: el bucardo. No obstante, la incorporación de técnicas reproductivas avanzadas en el mundo de la conservación biológica se mantiene hasta ahora limitada e incluso, en ocasiones, mal encaminada. Los factores involucrados en este pobre desarrollo son diversos, pero uno de los más importantes es el rechazo de la comunidad "conservacionista" a las estrategias de alta tecnología. Sin embargo, considerando que México es un país megadiverso, con un gran número de especies de mamíferos amenazados, es urgente la necesidad de que se incorporen herramientas biotecnológicas al estudio y conservación de las especies del país, y más aún, que sean las mismas comunidades científicas latinoamericanas quienes desarrollen y utilicen sus propias herramientas. En esta nota, se discuten los avances científicos que proponen la transferencia somática nuclear como una herramienta de conservación, sus posibilidades reales, las necesidades y sugerencias para su aplicación y desarrollo con el fin de convertir la biotecnología moderna en instrumento para la lucha por la conservación de las especies amenazadas de México y Latinoamérica.The advances in the world of the biomedical sciences are reaching unexplored and unexpected areas, such as the possibility of "recovering" extinct species. This has been highlighted by the recent publication of the "resurrection" of the first extinct subspecies: the Pyrenean ibex. Nevertheless, the incorporation of advanced reproductive techniques in the world of biological conservation has been limited until now and in occasions even misguided. The factors involved in this slow development are diverse but the most important one is the rejection by the "conservationist" community to high technology approaches. However, considering that Mexico is one of the megadiverse countries with a great number of species of threatened mammals, biotechnological tools are urgently needed for conservation research of Mexican species. Furthermore, these tools need to be utilized and developed by our own scientific Latin-American community. In this note, we discuss the scientific advances that have proposed the use of somatic nuclear transfer as a conservation tool, its real possibilities, the needs and suggestions for its development in threatened Mexican / Latin-American mammal species that should allow modern biotechnology to turn into one more tool in the battle of biological conservation.

  11. An English-Spanish glossary of terminology used in forestry, range, wildlife, fishery, soils, and botany (Glosario en Ingles-Espanol de terminologia usada en forestales, pastizales, fauna, silvestre, pesqueria, suelos, y botanica)

    Science.gov (United States)

    Alvin Leroy Medina

    1988-01-01

    The English-Spanish/Spanish-English equivalent translations of scientific and management terms (jargon) commonly used in the field of natural resource management are presented. The glossary is useful in improving communications and fostering understanding between Spanish- and English-speaking persons.

  12. Estudos sôbre reservatórios e vetores silvestres do Trypanosoma cruzi. XXII. Modificações dos focos naturais da tripanossomose americana e suas conseqüências

    Directory of Open Access Journals (Sweden)

    Mauro Pereira Barreto

    1967-08-01

    Full Text Available Os focos naturais da tripanossomose americana, como tôda biogeocenose, podem. permanecer relativamente estáveis, sendo esta estabilidade necessária para a própria existência dêsses focos. Mas o balanço ecológico pode ser alterado, sendo muito importante aquelas alterações devidas à interferência direta ou indireta do homem ao exercer atividades ligadas ao desbravamento e à colonização. Entre as conseqüências podemos citar: 1 redução ou desaparição dos focos naturais; 2 concentração de hospedeiros e vectores em áreas favoráveis limitadas; 3 deslocamento de hospedeiros e vectores para outras áreas; 4 invasão das habitações humanas e anexos, com a instalação do ciclo doméstico da infecção. Estas possibilidades são analisadas e ilustradas com exemplos.

  13. Estudio jurídico sobre la aplicación del proceso sancionatorio ambiental para la protección de la fauna silvestre en tres municipios del departamento del Chocó, 2005-2010

    Directory of Open Access Journals (Sweden)

    Lisneider Hinestroza Cuesta

    2012-01-01

    Full Text Available El régimen sancionatorio ambiental se define como el conjunto de normas, procedimientos y/o acciones utilizados para imponer los correctivos administrativos y castigar al que infringe o viola las normas ambientales vigentes, para garantizar la conservación del medio ambiente y el uso racional de los recursos naturales. Con el objetivo de analizar desde un enfoque jurídico su aplicación y el cumplimiento de las funciones administrativas de las Autoridades Ambientales, asignadas por la Ley 99 de 1993, la Ley 1333 de 2009, decretos y resoluciones que la reglamentan, se realizó una investigación de tipo descriptivo en los municipios de Istmina, Riosucio y Quibdó, en el departamento del Chocó, a partir del estudio de casos, análisis de legislación ambiental nacional y jurisprudencia de la Corte Constitucional colombiana, determinando las competencias de la autoridad ambiental con jurisdicción en la región (Corporación Autónoma Regional para el Desarrollo Sostenible del Chocó, CODECHOCÓ. No existen reportes concretos sobre la imposición de sanciones ambientales para la protección del recurso fauna durante los años 2005 a 2010 y se presentan en medios de comunicación local y por la comunidad en general cuestionamientos sobre el ejercicio de la potestad sancionatoria de esta autoridad ambiental.

  14. Caracterización de los aceites crudo, neutro y decolorado de la pulpa y cascara de la fruta silvestre Paraqueiba sericea tulasne «Umarí».

    OpenAIRE

    Chasquibol Silva, Nancy A.

    1997-01-01

    Crude, neutro and blenched oil extracted from pulp and peel of jungle fruit Paraqueiba sericea tulasne «Umarí» were studied. The crude oil was extracted with hexane by the soxhlet method giving a 47.86% yield, a 31.72% yield in neutro oil and a 94.89% yield in blenched oil. Chemical and physical constants were determined. In addition, five methyl esters of fatty acids were quantitatively determined by GLC using DEGS as stationary phase. The results indicated that Umarí oil ...

  15. Las áreas silvestres protegidas del estado como zonas de conservación de la naturaleza: El Parque Nacional Torres del Paine, Región de Magallanes y de la Antártica Chilena

    Directory of Open Access Journals (Sweden)

    M. González

    2013-12-01

    Full Text Available El presente trabajo es una breve descripción del Parque Nacional Torres del Paine, un área protegida localizada en el sur de Chile, que se caracteriza por la presencia de paisajes montañosos de origen glaciar, con una serie de lagos, lagunas, y ríos, los cuales albergan especies endémicas de flora y fauna. Estas características convierten a este parque en uno de los más visitados a nivel nacional. Se discuten aspectos sobre conservación y manejo del parque.

  16. Auteurs affichés, auteurs dissimulés. Le recours aux citations dans le 'Commentaire sur l'Enéide' attribué à Bernard Silvestre

    Directory of Open Access Journals (Sweden)

    Francine Mora

    2017-06-01

    Full Text Available Birger Munk Olsen's works have pointed out the importance of the commentaries in the reception and canonization of the Latin auctores during the twelfth-century Renaissance. In Bonaventure's famous classification, the commentator, who writes both with his own words and with the words of the others, but gives to the second of these the primary position, is lower in rank than the author. He is also dependent on the commentators who wrote before him. However, the study of mentions or quotations of auctores and former commentators in medieval commentaries shows that the latter used their predecessors only in order to expose their own point of view. A good example of this is furnished by the commentary of the Aeneid commonly attributed to Bernardus Silvestris. This article studies its difference of treatment between its two models, Macrobius and Fulgentius – the first is displayed, the second is more concealed –, and also its use of Ovid, whose Metamorphoses are used as early as in the commentary of Book 1, but who is not explicitly claimed as a model.

  17. Enraizamento adventício de estacas do maracujazeiro silvestre Passiflora mucronata Lam.: forma de veiculação e concentrações do ácido indol-3-butírico

    Directory of Open Access Journals (Sweden)

    Rodrigo Sobreira Alexandre

    2014-08-01

    Full Text Available Passiflora mucronata Lam. apresenta como características ser ornamental, medicinal e resistente à bacteriose nas folhas, além de ser altamente resistente à antracnose nos frutos e ramos. Objetivou-se, com este trabalho, avaliar a forma de veiculação, líquida ou sólida, e as concentrações do ácido indol-3-butírico (AIB no enraizamento adventício de estacas de P. mucronata. O experimento foi conduzido no delineamento de blocos ao acaso, em esquema fatorial 2x5 (formas de veiculação do AIB: líquida e sólida x concentrações de AIB: 0; 250; 500; 750 e 1000 mg L-1, se líquido, ou mg Kg-1, se sólido, com quatro repetições, de 16 estacas cada. As características avaliadas foram enraizamento (%, número de raiz, comprimento da maior raiz (cm, volume de raiz (cm³ e massa de matéria seca de raiz (g. Verificou-se que o enraizamento de estacas de P. mucronata Lam. independe da forma como é veiculado o AIB, se sólida ou líquida, porém a qualidade do sistema radicular, avaliada por meio do número, volume e massa de matéria seca de raízes, foi superior à obtida ao se empregar o AIB sólido. O comportamento do enraizamento, do número e do comprimento de raízes foi linear crescente, até a máxima concentração de AIB (1000 mg L-1 ou mg Kg-1.

  18. DIDÁCTICA DESARROLLADORA: POSICIÓN DESDE EL ENFOQUE HISTÓRICO CULTURAL

    OpenAIRE

    Toruncha, José Zilberstein; Cruz, Silvia Olmedo

    2016-01-01

    ResumenEl trabajo expone una revisión de los fundamentos esenciales de una propuesta denominada Didáctica Desarrolladora, elaborada por docentes e investigadores cubanos en las dos ultimas décadas del pasado siglo (SILVESTRE, 1985; SANTOS,1989; MIEDES, SANTOS; ZILBERSTEIN, 1992; SILVESTRE et al., 1993; SILVESTRE;1999; ZILBERSTEIN, 1997, 2000, 2003b; ZILBERSTEIN; PORTELA;MCPHERSON, 1999; SILVESTRE; ZILBERSTEIN 2000a, 2000b, 2002; LEAL,2000; RICO; SANTOS; MARTÍN-VIAÑA, 2001; CASTELLANOS et al.,...

  19. CHRISTIAN PHILOSOPHERS OF THE WEST ABOUT THE “COLD WAR”, TOTALITARIANISM AND COMMUNISM: COMPARATIVE ANALYSIS OF REINHOLD NIEBUHR’S AND GIORGIO LA PIRA’S CONCEPTS

    Directory of Open Access Journals (Sweden)

    T. V. Zonova

    2012-01-01

    Full Text Available The author examines the legacy of two great Christian thinkers, the American Reinhold Niebuhr and the Italian Giorgio La Pira, both very influential during the Cold War. Niebuhr was a Protestant theologian and political adviser to the American establishment. The Mayor of Florence, La Pira, was a prominent Italian statesman and an eminent Catholic thinker. The author analyzes their views on international relations, in particularly on the western policy towards the Soviet Union, the use of nuclear weapons, the war in Vietnam and communism. The legacy of two thinkers is highly topical in front of the ethical dimension of choices needed in international politics today.

  20. determination of lipophilic extractives in ionic liquid extracts

    African Journals Online (AJOL)

    dell

    Chem. 9: 63-69. Freire CSR, Pinto PCR, Santiago AS,. Silvestre AJD, Evtuquin DV and Neto. CP 2006a Comparative study of lipophilic extractives of hardwoods and corresponding ECF bleached kraft pulps. BioResources. 1: 3-17. Freire CSR, Silvestre AJD and Neto CP. 2005. Lipophilic extractives in. Eucalyptus globulus.

  1. 76 FR 53054 - Safety Zone; TriMet Bridge Project, Willamette River; Portland, OR

    Science.gov (United States)

    2011-08-25

    ... holidays. FOR FURTHER INFORMATION CONTACT: If you have questions on this rule, call or e-mail BM1 Silvestre... 503-240- 9319, e-mail Silvestre[email protected] . If you have questions on viewing the docket, call...

  2. Uso de terreno urbano y rural en Puerto Rico

    Science.gov (United States)

    Sebastian Martinuzzi; William A. Gould; Olga M. Ramos Gonzalez; Maya Quinones; Michael E. Jimenez

    2008-01-01

    El Proyecto de Analisis de Gap de Puerto Rico (PRGAP) (Gould et al. 2008) desarrollo tres usos de terrenos para Puerto Rico: Urbano, Suburbano, y Rural (Martinuzzi et al. 2007). Estas regiones tambien pueden ser consideradas como urbano, densamente-poblado rural, y escasamente-poblado rural, o como urbano y area silvestre con una interfase de area silvestre-urbana. La...

  3. Densidad de la madera de Pinus ponderosa (Dougl. Ex Laws) en tres localidades de Argentina

    OpenAIRE

    JOVANOVSKI, A; JARAMILLO, M; LOGUERCIO, G; ANTEQUERA, S

    2002-01-01

    Se estudió el ancho de anillo, la densidad básica de la madera y su variación y la relación entre ancho de anillo y densidad en Pinus ponderosa (Dougl. Ex. Laws) creciendo en tres localidades de la Patagonia andina argentina. El ancho de anillo obtenido se corresponde con una conífera de rápido crecimiento, mientras que la densidad media es levemente menor que la de la especie creciendo en los sitios de origen en Estados Unidos. Ring-width growth, wood specific gravity and its variation, a...

  4. Reprodução do pirá-brasília, Simpsonichthys boitonei Carvalho (Cyprinodontiformes, Rivulidae, e caracterização de seu habitat na Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística, Brasília, Distrito Federal, Brasil Reproduction of pira-brasília, Simpsonichthys boitonei Carvalho (Cyprinodontiformes, Rivulidae and its habitat characterization in the Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística, Brasília, Distrito Federal, Brazil

    Directory of Open Access Journals (Sweden)

    Oscar A. Shibatta

    2005-12-01

    Full Text Available Este trabalho teve como objetivo analisar a reprodução e as características físicas e químicas do habitat de Simpsonichthys boitonei Carvalho, 1959, uma espécie rara e endêmica do Distrito Federal. Os peixes foram coletados com peneira em uma poça temporária localizada na Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística (RECOR, bacia do rio Taquara, Distrito Federal. Os exemplares foram medidos (comprimento total em mm e pesados (peso total, peso das gônadas femininas e peso do corpo em gramas para o cálculo do fator de condição (K, do índice gonado-somático (IGS e do índice gonadal (IG. Também foram feitas análises físicas e químicas do ambiente. O brejo permaneceu com água durante oito meses (de dezembro a agosto, com transparência total, profundidade não ultrapassando 25 cm, condutividade menor que 15 µS/cm e pH entre 4,70 a 5,11. O oxigênio dissolvido variou entre 2,60 a 4,15 ppm, e a temperatura da água entre 20 a 25,5ºC. A análise da reprodução evidenciou que são peixes de desova parcelada, cujas fêmeas adultas permanecem com fator de condição alto durante boa parte da vida, diminuindo à medida que envelhecem. Os ovos foram depositados no substrato, e o período de incubação variou de 55 a 100 dias. Em laboratório esses ovos foram mantidos em água, onde 15,4% completaram o desenvolvimento embrionário. A proporção de fêmeas foi significativamente maior que a de machos. Pelas características acima, pode-se inferir que duas gerações do pirá-brasília podem ser encontradas no mesmo período de inundação.This study aims to analyze the reproduction and the physical and chemical characteristics of the habitat of Simpsonichthys boitonei Carvalho, 1959, a rare and endemic species of Distrito Federal. The fish were collected with sieve in a temporary pool located in the Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística (RECOR, rio Taquara basin, Distrito Federal. The specimens were measured (total length in mm, weighted (total weight, feminine gonad weight and body weight in grams, for calculation of condition factor (K, gonad-somatic index (IGS and gonad index (IG. Physical and chemical analyses of environment were also made. The temporary pool was filled with water for eight months (December to August, with total transparency, depth not surpassing 25 cm, conductivity smaller than 15 µS/cm and pH among 4,70 to 5,11. The dissolved oxygen varied among 2,60 to 4,15 ppm, and the temperature of the water among 20 to 25,5 ºC. The analysis of reproduction evidenced that the fish has fractional spawning, whose adult females stay with high condition factor during great part of life, but decreasing with their age. The eggs were deposited in the substratum, and the incubation period varied among 55 to 100 days. In laboratory these eggs were maintained in water, where 15,4% complete the embryonic development. The proportion of females was significantly larger than males. For the characteristics above, we can infer that at least two generations of pirá-brasília can be found in the same flood period.

  5. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_003317 gi|17988031 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  6. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_002696 gi|16127809 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  7. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26247437 >1j9iA 1 68 1 68 7e-21 ... ref|NP_753477.1| Prophage Qin DNA packaging... protein NU1 homolog [Escherichia coli ... CFT073] gb|AAN80037.1| Prophage Qin DNA packaging ... ...teriophage ... 21] pir||A49849 DNA-packaging protein Nu1 - phage 21 ...

  8. Breaching the Fortress Wall. Understanding Terrorist Efforts to Overcome Defensive Technologies

    Science.gov (United States)

    2007-01-01

    that affect, in overlapping ways, sequential parts of the terrorist activity chain (Figure 1.2). The purposes of each of these types of technologies...fication lineup .51 The ways in which PIRA chose to manage operations also contrib- uted to its overall counterforensic effort. For example, although

  9. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16126641 >1uzbA 58 515 12 462 8e-77 ... ref|NP_421205.1| vanillin dehydr...ogenase [Caulobacter crescentus CB15] gb|AAK24373.1| ... vanillin dehydrogenase [Caulobacter crescent...us CB15] ... pir||A87547 vanillin dehydrogenase [imported] - ... Caulobacter crescentus ...

  10. NCBI nr-aa BLAST: CBRC-GACU-10-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-10-0021 ref|YP_177714.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H...37Rv] pir||A70524 probable PPE protein - Mycobacterium tuberculosis (strain H37RV) emb|CAE55269.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177714.1 1e-30 41% ...

  11. Database Overlap vs. Complementary Coverage in Forestry and Forest Products: Factors in Database Acquisition.

    Science.gov (United States)

    Hoover, Ryan E.

    This study examines (1) subject content, (2) file size, (3) types of documents indexed, (4) range of years spanned, and (5) level of indexing and abstracting in five databases which collectively provide extensive coverage of the forestry and forest products industries: AGRICOLA, CAB ABSTRACTS, FOREST PRODUCTS (AIDS), PAPERCHEM, and PIRA. The…

  12. Comparison of allele-specific PCR, created restriction-site PCR, and PCR with primer-introduced restriction analysis methods used for screening complex vertebral malformation carriers in Holstein cattle

    Science.gov (United States)

    Altınel, Ahmet

    2017-01-01

    Complex vertebral malformation (CVM) is an inherited, autosomal recessive disorder of Holstein cattle. The aim of this study was to compare sensitivity, specificity, positive and negative predictive values, accuracy, and rapidity of allele-specific polymerase chain reaction (AS-PCR), created restriction-site PCR (CRS-PCR), and PCR with primer-introduced restriction analysis (PCR-PIRA), three methods used in identification of CVM carriers in a Holstein cattle population. In order to screen for the G>T mutation in the solute carrier family 35 member A3 (SLC35A3) gene, DNA sequencing as the gold standard method was used. The prevalence of carriers and the mutant allele frequency were 3.2% and 0.016, respectively, among Holstein cattle in the Thrace region of Turkey. Among the three methods, the fastest but least accurate was AS-PCR. Although the rapidity of CRS-PCR and PCR-PIRA were nearly equal, the accuracy of PCR-PIRA was higher than that of CRS-PCR. Therefore, among the three methods, PCR-PIRA appears to be the most efficacious for screening of mutant alleles when identifying CVM carriers in a Holstein cattle population. PMID:28927256

  13. ORF Alignment: NC_003071 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003071 gi|42569531 >1wd2A 1 58 290 342 7e-13 ... gb|AAD32294.1| similar to Ariadne... protein from Drosophila [Arabidopsis thaliana] ... emb|CAD52893.1| ARIADNE-like protein ARI11 [Arabi...dopsis ... thaliana] pir||A84725 similar to Ariadne protein from ... Drosophila [imported] - A

  14. Tiocfaidh ar la : A Critical Examination of British Counterinsurgency Operations in Northern Ireland 1969-1998

    Science.gov (United States)

    2012-05-17

    mid to late 18th century, a large Protestant Irish bourgeoisie had emerged that was dissatisfied with British mercantile economic policies. There was...of the cargo ship Eksund off the coast of France in 1987, which was carrying a large consignment of Libyan arms for the PIRA is one of the most

  15. ORF Alignment: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... antitermination factor [Ureaplasma parvum serovar 3 str. ... ATCC 700970] pir||A82874 tran...scription antitermination ... factor UU581 [imported] - Ureaplasma urealyt...icum ... Length = 137 ... Query: 24 ... HQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDLXXXXXXXXXXXXYEPSEAPRSMKN 83 ... ... ... HQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDL ... YEPSEAPRSMKN Sbjct: 1 ... HQWYIVTVVSGNEQKVIENIKDKLNGYG... NC_002162 gi|13358146 >1nz8A 2 112 24 160 9e-13 ... ref|NP_078420.1| transcription an

  16. Micropropagação de cebola a partir de bulbinhos induzidos in vitro Micropropagation of onion from in vitro induced bulblet

    Directory of Open Access Journals (Sweden)

    Benedita Maria Rodrigues

    1996-01-01

    Full Text Available Visando determinar um método para micropropagação a partir de bulbinhos in vitro, de cultivares de cebola (Allium cepa L., foram realizados três experimentos, avaliando-se a influência do 6-benzilaminopurina (BAP x ácido naftalenoacético (ANA e posição do explante no meio de cultura, a influência de bulbinhos desenvolvidos em diversas concentrações de sacarose e o efeito do diâmetro dos bulbinhos sobre a taxa de multiplicação in vitro. Pelos resultados, a posição vertical dos explantes mostrou maior tendência para porcentagem de regeneração nos cultivares Pira Ouro e Pirana Precoce. 0 efeito das concentrações de fitorreguladores na porcentagem de regeneração não foi verificado para o 'Pira Ouro', enquanto para o 'Pirana Precoce', porcentagem mais elevada foi obtida em 4,0 mg/L de BAP x 0,5 mg/L de ANA. Maior taxa de multiplicação foi observada para os dois cultivares em BAP (2,0 mg/L x ANA (0,25 mg/L. Bulbinhos do cultivar Pira Ouro e híbrido entre Pira Ouro e Pirana Precoce, desenvolvidos em 120 g/L de sacarose, mostraram-se mais adequados à micropropagação in vitro no material utilizado. Com relação ao diâmetro inicial do explante, o 'Pira Ouro' não mostrou diferença estatística para os parâmetros avaliados, enquanto no 'Pirana Precoce' maior porcentagem de regeneração foi obtida nos diâmetros M (5 a 10 mm e P (Series of three different experiments were carried out, in order to study the optimization of the use of bulblets obtained in vitro, in the micropropagation of the onion (Allium cepa L.. Initially, it was evaluated the effects of the interaction between two doais of 6-benzylaminopurine (BAP and naphthaleneacetic acid (NAA, and the position of the explant in the medium, for the cultivara Pira Ouro and Pirana Precoce. For 'Pira Ouro' the phytohormone concentrations did not affect the percentage of regeneration; however, for 'Pirana Precoce', the rates of 4.0 mg/L of BAP and 0.5 mg/L of NAA gave the

  17. Human population, economic activities, and wild bird conservation in Mexico: factors influencing their relationships at two different geopolitical scales Población humana, actividades económicas y conservación de aves silvestres en México: factores que influencian sus relaciones en dos escalas geopolíticas diferentes

    Directory of Open Access Journals (Sweden)

    Xavier López-Medellín

    2011-12-01

    Full Text Available Population growth poses threats to biodiversity, specifically to sensitive species. Therefore, an understanding of the conflict between biodiversity and human population is needed to enable long-term planning of development and conservation policies by state and federal governments and society based on limitations and potentials of environments. We used a geopolitical approach to analyze data on human demography, economic activities, natural vegetation, avian diversity, and protected areas of the 32 states of Mexico and the 30 districts of the state of Oaxaca. Using factor analysis, we identified the biodiversity-rich geopolitical units that have a large human population and are developing intense economic activities. We then carried out a series of linear regressions between the resulting factors to test whether they were related, suggesting areas where conservation conflicts may exist, and found that relations between human activities and natural resources vary from region to region. These results help us identify geopolitical units that require detailed studies of the interactions between population and natural resources, and also highlight the importance of using geopolitical scales as study units, where most conservation and development policies are determined, to inform local stakeholders and decision makers.El crecimiento humano representa amenazas para la biodiversidad, especialmente para especies sensibles. Se necesita conocer a fondo el conflicto que representa el crecimiento de la población para la biodiversidad y llevar a cabo políticas y acciones a largo plazo de actividades de desarrollo y conservación evaluadas por gobiernos federales y estatales, basándose en las limitaciones y potenciales de los ecosistemas. Utilizamos una aproximación geopolítica para analizar variables de demografía humana, actividades económicas, superficie de vegetación, diversidad de aves y áreas protegidas de los 32 estados de México y los 30 distritos de Oaxaca. Mediante un análisis de factores, identificamos las entidades geopolíticas con más biodiversidad con alta población humana y que desarrollan intensamente actividades económicas. Posteriormente realizamos regresiones lineales entre los factores para analizar su interrelación, lo que sugiere áreas en las que la conservación está amenazada, encontrando que estas relaciones varían en cada región. Estos resultados identifican las unidades geopolíticas que requieren un estudio detallado de la interacción entre población y recursos naturales y resaltan la importancia de utilizar una escala geopolítica, que es el nivel donde se determinan la mayor parte de las políticas de conservación y desarrollo, para proveer información detallada a usuarios y tomadores de decisiones.

  18. Uso de plâncton silvestre, fermento fresco e levedura desidratada na alimentação de larvas do cascudo chinelo, Loricariichthys platymetopon (Isbrüchen & Nijssen, 1979 (Osteichthyes, Loricariidae Natural plankton, fresh ferment and dehydrated yeast utilization at Loricariichthys platymetopon (Isbrüchen & Nijssen, 1979 (Osteichthyes, Loricariidae, cascudo chinelo, fry feeding

    Directory of Open Access Journals (Sweden)

    Claudemir Martins Soares

    2002-05-01

    Full Text Available Objetivando avaliar a utilização de diferentes alimentos para larvas do cascudo chinelo Loricariichthys platymetopon (Osteichthyes, Loricariidae, 240 larvas com cinco dias pós-eclosão foram distribuídas em 20 aquários (12 L. Foram utilizados cinco tratamentos com quatro repetições cada, os quais consistiram do emprego de diferentes tipos de alimentos como: plâncton (P, fermento (F, levedura desidratada (LD e as combinações P+F e P+LD por 15 dias consecutivos. O F e a LD foram fornecidos à vontade três vezes ao dia, enquanto o P foi fornecido pela manhã, após os aquários serem sifonados. Os valores da temperatura, pH, condutividade elétrica e oxigênio dissolvido se mantiveram dentro de níveis aceitáveis para a aquicultura. Os valores de biomassa/aquário das larvas alimentadas com P+LD foram superiores aos dos alimentados com P, F e P+F, entretanto não diferiram daqueles com o uso de LD. As larvas alimentadas com P+LD apresentaram valores de peso final médio superiores às dos demais tratamentos, sendo que F levou a valores de peso final médio inferiores em comparação ao uso de P, LD e P+F. Observou-se menor sobrevivência com o uso de P em comparação a LD e P+LD. Conclui-se que se pode utilizar P+LD na criação do cascudo chinelo em suas fases iniciais de desenvolvimento.Aiming to evaluate different foods effects in the rearing of Loricariichthys platymetopon (Osteichthyes, Loricariidae fry, 240 5-day-after-hatch specimens were distributed in 20 aquarium glasses (12 L. Five treatments, with four repetitions each, were tested, consisting in: plankton (P, fresh ferment (F, dehydrated yeast (DY and the combinations P+F and P+DY, for 15 days. F and DY were given ad libitum three times a day, and P only in the morning, after the aquariums siphoning. Temperature, pH, electric conductivity and dissolved oxygen were in levels acceptable for fish. The fry biomass per aquarium values were higher for the P + DY treatment, when compared to P, F and P+F, but equal to DY. Also, P +DY-fed fry showed higher mean final weight than all the other treatments. F-treated fry showed mean final weight lower than the ones treated with P, DY and P+F. The P treatment showed lower survival rate than DY and P+DY. The results indicate that P + DY can be used for Loricariichthys platymetopon fry rearing during their initial development phases.

  19. Levantamento da fauna de abelhas silvestres na "zona da mata" de Minas Gerais: III. Mata secundária na região de Viçosa (Hymenoptera, Apoidea Survey of the wild bees of the "zona da mata" of Minas Gerais, Brazil: III. Secondary forest in Viçosa region (Hymenoptera, Apoidea

    Directory of Open Access Journals (Sweden)

    José Ricardo Cure

    1992-01-01

    Full Text Available The outcome of a wild bee fauna survey in a secondary forest is reported. Sampling was carried out mainly on herbaceous and shrubby vegetation under and at the border of the forest. Results are compared with data collected with the same methodology from a previously surveyed grassland nearby. The secondary forest was richer in Anthophoridae and Apidae species, and less diverse in Megachilidae. Similarity between the two habitats was low. Several unidentified species of Ceratinula, Trichocerapis mirabilis and the stingless bees Melipona bicolor, M. quadrifasciata, M. marginata, Paratrigona subnuda, Scaptotrigona tubiba and S. xanthotricha, are among the species dependent on the forest environment to survive. Bee population densities in the forest understory are as large as the largest values found for open vegetation in Southeastern Brazil; species richness is also comparable to those of other areas in Southeastern Brazil. Sampling strategies are discussed.

  20. Mamíferos silvestres de la Reserva Ecológica del Pedregal de San Ángel en Ciudad Universitaria, Universidad Nacional Autónoma de México, México, D. F. Wild mammals of Reserva Ecológica del Pedregal de San Ángel, Ciudad Universitaria, UNAM, Mexico, D.F.

    Directory of Open Access Journals (Sweden)

    Yolanda Hortelano-Moncada

    2009-08-01

    Full Text Available Se realizó un inventario de las especies de mamíferos que habitan en la Reserva Ecológica del Pedregal de San Ángel (REPSA. Los datos se obtuvieron a partir de registros de colecciones científicas, de recolectas recientes en el área y de consultas en literatura especializada. Los resultados comprenden 628 registros acumulados desde 1943 y corresponden a 33 especies, agrupadas en 28 géneros, 15 familias y 6 órdenes de mamíferos. La ardilla gris (Sciurus aureogaster nigrescens y el ratón del altiplano (Peromyscus melanophrys melanophrys se registran por primera vez para la REPSA; asimismo, existen 2 registros que están publicados pero no listados en los inventarios previos a la reserva, el murciélago colorado, Lasiurus blossevillii teliotis, y el cuinique, Spermophilus adocetus adocetus; en las categorías de riesgo se encuentran como amenazadas 2 especies y 1 en la de protección especial, y hay 7 endémicas de México. La Reserva es uno de los últimos reductos de material genético de especies cuya localidad tipo se encuentra en la cuenca de México. El componente mastofaunístico de la zona es importante para el mantenimiento de la biodiversidad, por lo que el estudio y la protección de este ecosistema al interior de la ciudad de México debe continuarse.This paper documents the mammals from the Reserva Ecológica del Pedregal de San Ángel. Data were gathered from records in mammal collections, the specialized literature, and through collecting efforts in the area. Records spanning 1943 to the present document the presence of 33 species, 28 genera, 15 families, and 6 orders of mammals. One squirrel and one mouse (Sciurus aureogaster nigrescens, and Peromyscus m. melanophrys are reported for the first time for the reserve. Two addtional records have been previously published but have not been included in previous inventories for the reserve: the red bat, Lasiurus blossevillii teliotis and the cuinique, Spermophilus adocetus adocetus. Two species are currently listed under the risk category of threatened, 1 is under special protection, and 7 are endemic to Mexico. This mammal component is important for the ecosystem of the area and the conservation of biodiversity. The richness of mammals of the area deserves efforts to conserve and preserve the biodiversity of this unique ecosystem within México City.

  1. CaracterizaÃÃo estrutural das formas silvestre e recombinante de uma lectina de sementes de Vatairea macrocarpa Benth e anÃlise das suas bases moleculares de ligaÃÃo ao antÃgeno Tn

    OpenAIRE

    Bruno Lopes de Sousa

    2014-01-01

    As lectinas consitem em uma classe diversificada de proteÃnas, capazes de reconhecer estruturas glicÃdicas de forma reversÃvel e com alta especificidade, no entanto sem alterar suas estruturas quÃmicas, participando de vÃrios processos celulares importantes. Dentre as diferentes famÃlias de lectinas, as isoladas a partir de leguminosas sÃo as mais extensivamente estudadas, havendo sido relatada a influÃncias dessas molÃculas sobre diversos processos patolÃgicos, incluindo a carcinogÃnese. Not...

  2. A list of mosquito species of the Brazilian State of Pernambuco, including the first report of Haemagogus janthinomys (Diptera: Culicidae, yellow fever vector and 14 other species (Diptera: Culicidae Lista de espécies de mosquitos do Estado de Pernambuco e primeiro relato de Haemagogus janthinomys (Diptera: Culicidae vetor de febre amarela silvestre e outras 14 espécies (Diptera: Culicidae

    Directory of Open Access Journals (Sweden)

    Nádia Consuelo Aragão

    2010-08-01

    Full Text Available INTRODUCTION: Besides mosquito species adapted to urban environments (Culex quinquefasciatus, Aedes aegypti and Aedes albopictus, only 15 species of Anopheles had been recorded in the State of Pernambuco. METHODS: Human-landing mosquitoes were collected in Dois Irmãos Park, in Recife. RESULTS: The first report for the state of Haemagogus janthinomys, an important vector of yellow fever virus, and 14 other species, including Trichoprosopon lampropus, a first reported for Brazil. CONCLUSIONS: The mosquito fauna in the area is diversified and has potential medical and veterinary importance.INTRODUÇÃO: Além de mosquitos adaptados ao ambiente urbano (Culex quinquefasciatus, Aedes aegypti e Ae. albopictus, apenas 15 espécies de Anopheles haviam sido relatadas no Estado de Pernambuco. MÉTODOS: Mosquitos que pousavam em humanos no Parque Dois Irmãos, em Recife foram coletados. RESULTADOS: Haemagogus janthinomys, importante vetor de vírus de febre amarela, e outras 14 espécies são relatadas pela primeira vez no estado, incluindo Trichoprosopon lampropus, relatado pela primeira vez no Brasil. CONCLUSÕES: A fauna de mosquitos na área é muito diversificada e tem potencial importância médica e veterinária.

  3. Mamíferos silvestres de la Reserva Ecológica del Pedregal de San Ángel en Ciudad Universitaria, Universidad Nacional Autónoma de México, México, D. F. Wild mammals of Reserva Ecológica del Pedregal de San Ángel, Ciudad Universitaria, UNAM, Mexico, D.F.

    OpenAIRE

    Yolanda Hortelano-Moncada; Fernando A. Cervantes; Aída Trejo-Ortiz

    2009-01-01

    Se realizó un inventario de las especies de mamíferos que habitan en la Reserva Ecológica del Pedregal de San Ángel (REPSA). Los datos se obtuvieron a partir de registros de colecciones científicas, de recolectas recientes en el área y de consultas en literatura especializada. Los resultados comprenden 628 registros acumulados desde 1943 y corresponden a 33 especies, agrupadas en 28 géneros, 15 familias y 6 órdenes de mamíferos. La ardilla gris (Sciurus aureogaster nigrescens) y el ratón del ...

  4. Removal new alternative to chemical and mechanical removal for the study of pollen carried on the wild bee scopae Remoción química como nueva alternativa a la remoción mecánica para el estudio del polen transportado en las escopas de abejas silvestres

    Directory of Open Access Journals (Sweden)

    Marta Caccavari

    2010-12-01

    Full Text Available Taxonomic recognition and quantification of the different pollen types collected by bees offer the most direct method to study the diet. To determine the importance of each plant taxon, it is necessary to separate the pollen deposited only in the collecting structures in order to minimize contamination of grains collected passively in other parts of the body. The technique currently applied is based on the mechanical removal of the pollen loads with dissecting needles and repeated washings with ethanol. Metathoracic scopae that underwent this procedure showed traces of pollen in varying amounts when observed under the microscope. As an alternative to this technique chemical removal using HOK is proposed. The leg is removed and treated separatedly to avoid contamination. The deflocculant properties of HOK successfully allowed to separate the pollen adhered to the scopae, which can be then returned to the individual, unaffected by the procedure. Suspend the pollen in a know quantity of mounting fluid permit take the subsamples and determine the total number of pollen grains of each taxon. In this paper, the new technique is presented and its effectiveness is compared to the technique currenty used.El reconocimiento taxonómico y la cuantificación de los distintos tipos polínicos colectados por las abejas ofrecen el método más directo para estudiar la dieta. Para determinar la importancia de cada taxón vegetal y minimizar la contaminación, es necesario separar el polen depositado en las estructuras de colecta, de los granos recolectados en forma pasiva en otras partes del cuerpo. La técnica que se aplica hasta el momento se basa en la remoción mecánica de las cargas polínicas con agujas de disección y sucesivos lavados con etanol. Escopas de patas metatoráxicas sometidas a este procedimiento al ser observadas bajo lupa presentaban aún granos de polen en cantidades variables. Como una alternativa a esta técnica proponemos la remoción química, mediante la utilización de HOK. La pata se extrae y es tratada por separado para impedir la contaminación. Las propiedades defloculantes del HOK permiten separar exitosamente el polen adherido a la escopa, la cual puede ser devuelta al ejemplar al no ser afectada por el procedimiento. Suspender todo el contenido de polen en un volumen de medio de montaje conocido y luego tomar una submuestra, permite determinar el número total de granos de polen de cada taxón. En este trabajo se presenta la nueva técnica y se compara su efectividad con la técnica utilizada hasta el momento.

  5. Estudos sôbre reservatórios e vectores silvestres do Trypanosoma cruzi. XXIV. Variação dos dados biométricos obtidos em amostras do T. cruzi isolados de casos humanos da Doença de Chagas

    Directory of Open Access Journals (Sweden)

    Francisco Ferriolli Filho

    1968-02-01

    Full Text Available Estudo biométrico de 10 amostras de Trypanosoma cruzi isoladas de casos humanos da doença de CHAGAS, nove mantidas em camundongos brancos jovens e uma mantida em ratos brancos jovens, mostrou a existência de grandes variações amostrais. Assim os valores do comprimento total médio das diferentes amostras variaram entre 16,3μ e 21,8μ., enquanto os valores do índice nuclear médio oscilaram entre 0,93 e 1,52. Êstes resultados ampliam os limites de variações amostrais até agora observadas no T. cruzi, especialmente os que se referem ao índice nuclear médio.

  6. Free and total testosterone levels in field males of Octodon degus (Rodentia, Octodontidae: accuracy of the hormonal regulation of behavior Niveles de testosterona libre y totales en machos silvestres de Octodon degus (Rodentia, Octodontidae: exactitud de la regulación hormonal del comportamiento

    Directory of Open Access Journals (Sweden)

    MAURICIO SOTO- GAMBOA

    2005-06-01

    Full Text Available Animals exhibit continuous seasonal changes in physiological, morphological and behavioral traits associated to their natural annual cycles. One of the most important changes in the organism occurs at the initiation of breeding season. In males these changes include activation of spermatogenesis, enhance of sexual secondary characters and an increase of aggressiveness. All of theses changes are basically regulated by testosterone, but the physiological basis of this testosterone regulation and the effective hormone proportion that acts in target tissues are unknown. In this work I evaluated the relationship between total testosterone, free testosterone associated to aggressive behavior in wild males of Octodon degus. I compared hormonal levels and aggressive behavior during pre, middle and post breeding periods. Results showed that behavioral aggressiveness was correlated with both total and free testosterone in June, during the beginning of breeding season, but not at other times. Results also indicated a lack of relationship between free and total testosterone in most of breeding period. I discuss the importance of this behavior-hormonal regulation (determined by free testosterone and the physiological importance of this mechanism to the organismLos animales presentan variaciones estacionales continuas que incluyen cambios fisiológicos, morfológicos y conductuales, asociados al ciclo anual. Estos cambios generalmente están activados por factores endógenos o exógenos, pero son regulados por el sistema endocrino de organismo. Uno de los cambios más importantes ocurre en el inicio del periodo reproductivo. Durante este periodo los machos presentan cambios asociados a la producción de esperatozoides, exacerbación de caracteres sexuales secundarios y un aumento de la agresividad. Todos estos cambios son regulados en parte por los niveles de testosterona, sin embargo, los mecanismos fisiológicos de esta regulación son desconocidos. En este trabajo evalué la relación que existe entre los niveles de testosterona libre y totales, y examiné su posible asociación con los niveles de agresividad en machos de una población natural de Octodon degus. Mis resultados indicaron que la agresividad se correlaciona directamente con los niveles de testosterona libre y totales solo durante el mes de junio, al inicio del periodo reproductivo, pero no durante el resto del ciclo reproductivo de esta especie. Esto indicaría que la agresividad solo se correlaciona con los niveles de testosterona libre ya que en el medio y el final del periodo reproductivo los niveles de testosterona se mantienen altos sin que se manifiesten dichas conductas. Finalmente, discuto la importancia de la regulación fina de la conducta determinada por la testosterona libre y la importancia fisiológica de este mecanismo de regulación dentro del organismo

  7. Clinical signs suggestive of mange infestation in a free-ranging maned wolf (Chrysocyon brachyurus) in the Moxos Savannahs of Beni, Bolivia

    OpenAIRE

    Díaz Luque, José A; Müller, Helen; González, Lyliam; Berkunsky, Igor

    2014-01-01

    La sarna sarcóptica es generalmente endémica de las poblaciones de cánidos silvestres. Algunos agentes de enfermedades infecciosas y parasitarias han sido reportados para el borochi (Chrysocyon brachyurus) en estado silvestre. Este trabajo documenta el avistaje de un borochi silvestre en el departamento del Beni, Bolivia, con signos clínicos que sugieren infestación por sarna sarcóptica. La amenaza constante de transmisión de sarna proveniente de perros domésticos así como de otras especies d...

  8. Mathematical modeling tendencies in plant pathology

    African Journals Online (AJOL)

    STORAGESEVER

    2009-12-29

    Dec 29, 2009 ... inclusion of new terms into the model as needed. (Madden, 2006). ... the first programs was the EPIDEM written by Wagonner and Horsfall (1969) and it ..... Oyama K (1998). Los parientes silvestres del chile (Capsicum spp.).

  9. Características qualitativas de cultivares de cebola no sul de Minas Gerais Qualitative characteristics of onion cultivars in southern Minas Gerais State

    Directory of Open Access Journals (Sweden)

    Silvio Júlio de Rezende Chagas

    2004-02-01

    Full Text Available Com o objetivo de determinar a composição físico-química e química de cultivares de cebola (Allium cepa L., conduziu-se um ensaio na Fazenda Experimental de Lavras da EPAMIG, Lavras-MG, no período de março a setembro de 1995. O delineamento experimental foi de blocos ao acaso com quatro repetições e 6 tratamentos, constituídos pelas cultivares Baia Periforme, Crioula, Granex 33, Pira Ouro, Jubileu e Texas Grano 502. Após a cura, avaliaram-se o pH, sólidos solúveis e totais (%, acidez titulável (%, ácido pirúvico (µmol/g, açúcares totais, redutores e não-redutores (% e índice industrial dos bulbos. As cultivares Crioula, Baia Periforme, Pira Ouro e Jubileu apresentaram as maiores concentrações de sólidos totais e solúveis. A acidez mais elevada foi observada nas cultivares Crioula (0,370% e Pira Ouro (0,315%. Os maiores índices industriais foram apresentados pelas cultivares Crioula (0,87 e Baia Periforme (0,75, e os menores, pelas cultivares Texas Grano 502 (0,51 e Granex 33 (0,32.This study was carried out from March to September of 1995, in the Experimental Field of EPAMIG, Lavras-MG, Brazil, with the objective of determining the physico-chemical and chemical composition of onions from different cultivars (Allium cepa L.. The experimental design was completely randomized blocks with four repetitions and six cultivars as follow: Baia Periforme, Crioula, Granex 33, Pira Ouro, Jubileu and Texas Grano 502. After the cure it was evaluated the pH, soluble and total solids (%, titrate acidity (%, pyruvic acid (µmol/g, total sugar, reducers and non reducers (% and industrial index. The cultivars Crioula, Baia Periforme, Pira Ouro and Jubileu showed the largest concentrations of total and soluble solids. The highest acidity indexes were observed in the cultivars Crioula (0.370% and Pira Ouro (0.315%. The largest industrial indexes were found in the cultivars Crioula (0.87 and Baia Periforme (0.75, and the smallest ones in the

  10. Developing European conservation and mitigation tools for pollination services: approaches of the STEP (Status and Trends of European Pollinators) project

    OpenAIRE

    Potts, Simon G.; Biesmeijer, Jacobus C.; Bommarco, Riccardo; Felicioli, Antonio; Fischer, Markus; Jokinen, Pekka; Kleijn, David; Klein, Alexandra-Maria; Kunin, William E.; Neumann, Peter; Penev, Lyubomir D.; Petanidou, Theodora; Rasmont, Pierre; Roberts, Stuart P. M.; Smith, Henrik G.

    2011-01-01

    [ES] Los insectos polinizadores forman un componente clave de la biodiversidad europea, y proporcionan servicios vitales a los ecosistemas de plantas cultivadas y silvestres. Existe una creciente evidencia del declive de polinizadores silvestres y domesticados, y del declive paralelo de las plantas que dependen de ellos. El proyecto STEP (Estado y tendencias de los polinizadores europeos, 2010-2015, www.step-project.net) está documentando elementos críticos en la naturaleza y la extensión de ...

  11. Diversidad de Triatominae (Hemiptera: Reduviidae en Santander, Colombia: implicaciones epidemiológicas

    Directory of Open Access Journals (Sweden)

    Lyda Esteban

    2017-01-01

    Conclusiones. Los resultados evidenciaron diferencias en la diversidad de las dos regiones, además del potencial de las especies silvestres para ocupar ecótopos artificiales. La intrusión de triatominos y la reciente incriminación de especies silvestres en la transmisión de Trypanosoma cruzi, indican la necesidad de un mayor conocimiento de la ecología de estos vectores para orientar las estrategias de control.

  12. Decoding Different Patterns in Various Grey Tones Incorporated in the QR Code

    Directory of Open Access Journals (Sweden)

    Filip Cvitić

    2014-07-01

    Full Text Available Using colors in bar codes causes errors that may adversely affect their readability (Tan etal. 2010, given that the contrast between data and background modules is reduced. Due to the unreliability of using color bar codes, most designers still keep to the limitations placed by Pira International (Smithers Pira in 2002 (Williams, 2004. Since the contrast between data modules and background modules is the most important aspect in the process of reliable bar code decoding, this paper explores the dependence of reliable decoding of QR codes incorporated with combinations of grey tones on the technical characteristics of the cameras on smartphones that were marketed in the period between 2008 and 2012.

  13. NCBI nr-aa BLAST: CBRC-XTRO-01-2365 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2365 ref|YP_177980.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] pir||A70807 hypothetical glycine-rich protein Rv3511 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55605.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177980.1 0.17 36% ...

  14. NCBI nr-aa BLAST: CBRC-GGAL-35-0050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-35-0050 ref|YP_177980.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] pir||A70807 hypothetical glycine-rich protein Rv3511 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55605.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177980.1 2e-18 33% ...

  15. The Prachanda Path and Oglaigh na hEireann: A Comparative Case Study of the Insurgencies in Nepal and Northern Ireland

    Science.gov (United States)

    2008-05-22

    Prior to the 1980s, politicians aligned with the PIRA conducted an activity called “ abstentionism ,” which meant that they participated in elections... The Prachanda Path and Óglaigh na hÉireann: A Comparative Case Study of the Insurgencies in Nepal and Northern Ireland A Monograph by MAJOR...burden for this collection of information is estimated to average 1 hour per response, including the time for reviewing instructions, searching existing

  16. An End to the Troubles: Unionism, Nationalism and the Path to Peace

    Science.gov (United States)

    2006-12-01

    Nationalist community but also provided a viable alternative to the violence espoused by the PIRA.14 The policy of abstentionism was not without risk...revolutionary socialism; and the continuation of the policy of abstentionism was hindering the party’s ability to achieve political change on its terms...NAVAL POSTGRADUATE SCHOOL MONTEREY, CALIFORNIA THESIS Approved for public release: distribution is unlimited AN END TO THE

  17. Browse Author Index

    African Journals Online (AJOL)

    Palacio-Grüber, Jose · Palacio-Gruber, Jose · Parga-Lozano, C · Perrin, P · Phylactou, LA · Piras, IS 1 - 6 of 6 Items. ISSN: 1737-8176. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of Use · Contact AJOL ...

  18. Killing Range

    Science.gov (United States)

    Asal, Victor; Rethemeyer, R. Karl; Horgan, John

    2015-01-01

    This paper presents an analysis of the Provisional Irish Republican Army's (PIRA) brigade level behavior during the Northern Ireland Conflict (1970-1998) and identifies the organizational factors that impact a brigade's lethality as measured via terrorist attacks. Key independent variables include levels of technical expertise, cadre age, counter-terrorism policies experienced, brigade size, and IED components and delivery methods. We find that technical expertise within a brigade allows for careful IED usage, which significantly minimizes civilian casualties (a specific strategic goal of PIRA) while increasing the ability to kill more high value targets with IEDs. Lethal counter-terrorism events also significantly affect a brigade's likelihood of killing both civilians and high-value targets but in different ways. Killing PIRA members significantly decreases IED fatalities but also significantly decreases the possibility of zero civilian IED-related deaths in a given year. Killing innocent Catholics in a Brigade's county significantly increases total and civilian IED fatalities. Together the results suggest the necessity to analyze dynamic situational variables that impact terrorist group behavior at the sub-unit level. PMID:25838603

  19. Chemical composition of oils from wild almond (Prunus scoparia and wild pistachio (Pistacia atlantica

    Directory of Open Access Journals (Sweden)

    Jafari Mohammadi, S. A.

    2013-03-01

    Full Text Available The aim of this study was to determine the fatty acids, sterols and triacylglycerol compositions as well as the amount of tocopherols, total phenols and pigments wild almond and cold pressed wild pistachio oils. Triacylglycerols, tocopherols and pigments were analyzed with HPLC, fatty acids and sterols with gas chromatography, and total phenols photometrically. The main fatty acids in both samples were oleic, linoleic and palmitic acids. The most predominant TAG species are SLL + PLO (21.83% in wild pistachio oil and OOO (47.27% in wild almond oil. Pheophytin a was the major pigment in wild pistachio oil. There were no pigments detected in wild almond oil. Total phenols were 57.6 mg kg-1 oil for wild pistachio and 45.3 mg kg-1 oil for wild almond oil.El objetivo de este estudio fue determinar la composición en ácidos grasos, esteroles, triglicéridos, así como tocoferoles, fenoles totales y pigmentos de aceites de almendras y pistachos silvestres prensados en frío. Triglicéridos (TAG, tocoferoles y pigmentos se analizaron mediante HPLC, los ácidos grasos y esteroles mediante cromatografía de gases, y los fenoles totales espectrofotométricamente. Los principales ácidos grasos de ambas especies fueron los ácidos oleico, linoleico y palmítico. Las especies de TAG predominantes son SLL + OLP (21,83% en el pistacho silvestre y OOO (47,27% en almendras silvestre. Feofitina a es un pigmento importante en los aceites de pistacho silvestre. No se detectó pigmentos en los aceites de almendras silvestres. Los fenoles totales fueron 57,6 mg kg-1 y 45,3 mg kg-1 en los aceites de pistacho silvestre y de almendra silvestre respectivamente.

  20. VARIABILIDAD Y RELACION ENTRE LAS PROPIEDADES ANATOMICAS, QUIMICAS Y LA APTITUD PULPABLE, EN CLONES DE EUCALYPTUS GLOBULUS.

    OpenAIRE

    RAMIREZ VIDAL, MAURICIO HERNAN; RAMIREZ VIDAL, MAURICIO HERNAN

    2008-01-01

    Se estudió la variación de la anatomía de la madera, variables biornétricas, aptitud pulpable y propiedades de la pulpa, en 14 clones de E. globulus de 7 años de edad, creciendo en un ensayo clonal en la zona de Arauco, región del Bio-Bio, Chile. Las Cara 61p.

  1. Posibilidades de reducción de los residuos sólidos (no peligrosos) en el Municipio de Barbosa : un estudio de caso

    OpenAIRE

    Mejía Ríos, Luis Santiago

    2007-01-01

    Este trabajo muestra los diferentes mecanismo utilizados en la actualidad para disminuir la cantidad de residuos sólidos en el municipio de Barbosa, explicando desde el problema de las externalidades que se generan en el sitio de disposición final y el medio ambiente, pasando por el desarrollo del manejo integral de estos desechos y formas en las cuales se puede contribuir al mejoramiento de esta situación que cada vez sigue creciendo.

  2. Comunicándonos con las cosas

    Directory of Open Access Journals (Sweden)

    Miguel Delgado

    2009-09-01

    Full Text Available Tras la Web 2.0 y gracias a la colaboración entre las personas, Internet sigue creciendo y evolucionando, pero esta vez a través de los objetos. La siguiente evolución pretende que las personas puedan interactuar con las cosas de una forma inteligente mediante tecnologías ampliamente utilizadas como el teléfono móvil e Internet, y tecnologías que permitan etiquetar objetos.

  3. La integración y legitimidad de los derechos culturales e históricos del Pueblo Malecu, en la figura de un comanejo sostenible de los recursos naturales y culturales para la conservación y restauración integral del refugio de vida silvestre caño negro cuenca y territorios del Río Frío

    OpenAIRE

    Cornejo Venegas, Elvis

    2014-01-01

    El presente estudio representa: La promoción y trabajo concerniente al desarrollo con autogestión de recursos ambientales culturales, al acceso en Comanejo intercomunitario de los recursos naturales en un Área protegida de conservación como lo es Caño Negro y la legitimación jurídica participativa de las comunidades; en este caso especifico del Cantón de Upala, Los Chiles Caño Negro y del Cantón de Guatuso y los Palenques de Sol, Margarita y Tonjibe que forman la Reserva (Ley 6172), territ...

  4. Aspectos ecológicos da tripanossomíase americana: XIV - Persistência e potencial de domiciliação de populações triatomínicas silvestres em região de intensa atividade agropecuária Ecological aspects of South American tripanosomiasis: XIV - Persistence and domiciliation potential of sylvatic triatominae populations in an intensive agricultural and cattle breeding region

    Directory of Open Access Journals (Sweden)

    Oswaldo Paulo Forattini

    1979-06-01

    Full Text Available São apresentados os resultados de observações sobre populações triatomínicas extradomiciliares em região de intensa atividade agropecuária. Os restos de vegetação primitiva, embora reduzidos a menos de 8,0%, mostraram-se suficientes para manter essas populações. Pelo menos para Triatoma sordida, a destruição progressiva parece favorecer sua sobrevivência, graças à multiplicação de ecótopos preferidos por esse triatomíneo. Tanto essa espécie como Panstrongylus megistus e Rhodnius neglectus mostraram-se aptos à colonização em ecótopos artificiais representados por galinheiros experimentais.The results of observation of sylvatic triatominae population in a region of intensive agricultural and cattle breeding activity are reported. Important environmental changes had occurred in the area, including destruction of the primitive vegetation and intensive use of pesticides. Nevertheless, these modifications apparently did not affect the survival of Triatominae, since they were found in the remaining vegetation. Moreover, this destruction seems to have favored, to some extent, survival of Triatoma sordida by increasing the available ecotopes. This species, as well as Panstrongylus megistus and Rhodnius neglectus, showed enough ecological valence to colonize experimental fowes houses, used as artificial ecotopes.

  5. Wild common bean in the Central Valley of Costa Rica: ecological distribution and molecular characterization

    Directory of Open Access Journals (Sweden)

    Rosa In\\u00E9s Gonz\\u00E1lez Torres

    2004-01-01

    Full Text Available Frijol silvestre en el Valle Central de Costa Rica: distribución ecológica y caracterización molecular. Este trabajo presenta una actualización sobre la distribución de las formas silvestres de fríjol común en Costa Rica, su ecología y su caracterización molecular. Ala fecha 22 poblaciones fueron encontradas en cuatro cuencas alrededor del Valle Central, generalmente en vegetaciones ruderales (frecuentemente bordes de cafetales, con estatuto de conservación variable (desde protegido a amenazado. Su caracterización molecular indica su pertenencia al acervo genético mesoamericano. Varios marcadores indican una variabilidad aumentada en las formas silvestres y permiten inferir la presencia de un fenómeno de flujo genético e introgresión desde materiales cultivados.

  6. Análise sensorial, teores de nitrato e de nutrientes de alface cultivada em hidroponia sob águas salinas Sensory analysis, nitrate and nutrient concentration of lettuce grown in hydroponics under saline water

    Directory of Open Access Journals (Sweden)

    Dalva Paulus

    2012-03-01

    Full Text Available O presente trabalho teve como objetivos determinar os teores de nutrientes e de nitrato e realizar análise sensorial de alface cultivada em sistema hidropônico sob água salina. O experimento foi conduzido em ambiente protegido no período de dezembro de 2007 a janeiro de 2008, em Piracicaba (SP. O delineamento experimental foi de blocos ao acaso, sendo estudados cinco níveis de salinidade da água de irrigação, utilizando-se NaCl (Condutividade elétrica da água (CEa: 0,42, 1,53, 3,52, 5,55 e 7,43 dS m-1 em duas cultivares de alface (Verônica e Pira Roxa, em esquema fatorial. Foram avaliados a análise sensorial aplicando escala hedônica e através dessa, o que os provadores mais apreciaram e o que menos gostaram de cada amostra, intenção de compra e consumo, teor de nitrato, absorção de nutrientes pela folhas e determinação dos nutrientes presentes na solução nutritiva. Para o atributo sabor a cultivar Verônica recebeu as melhores notas no nível de salinidade 1,53 e 5,55 dS m-1. Para a cultivar Pira Roxa a melhor nota foi atribuída para a alface produzida na água não salina. Para os demais atributos não houve diferença significativa nos diferentes níveis de salinidade. Com relação à intenção de compra, constatou-se que as alfaces cv. Verônica e Pira Roxa apresentaram boa aceitação de mercado. Os menores níveis de nitrato (1960 mg kg-1 e 2620 mg kg-1 de massa de matéria fresca, da Verônica e Pira Roxa, respectivamente, foram relacionados à condutividade elétrica de 0,42 dS m-1, aumentando a salinidade da água para 7,43 dS m-1, o teor foliar de nitrato aumentou para 2500 mg kg-1 e 3420 mg kg-1 para as cultivares Verônica e Pira Roxa. Como o tempo de exposição da alface à salinidade em sistema hidropônico foi curto, em torno de 25 dias, não se verificou sintomas de deficiência nutricional e toda alface foi classificada como apropriada para consumo humano.This study aimed to evaluate the content of

  7. Atualização/revisão do sistema de gestão de qualidade e sistema HACCP na fabrica, Foodstore e postos de venda

    OpenAIRE

    Paiva, Ana Filipa Teodoro

    2017-01-01

    Resumo O estágio profissionalizante desenvolvido na Fábrica de Pastelaria e Confeitaria S. Silvestre, Lda. encontra-se integrado no plano curricular do Mestrado em Engenharia Alimentar leccionado pela ESAC, tendo decorrido entre 1 de Março e 1 de Setembro de 2017. A Fábrica de Pastelaria e Confeitaria S. Silvestre, Lda. dedica-se à produção e distribuição de produtos de pastelaria e padaria, bem como à exploração de um restaurante, o Foodstore. Para além destas duas unidades apresenta ai...

  8. Folleto informativo sobre fauna y flora para la autopreparación de los inspectores aduanales

    OpenAIRE

    María Teresa Oviedo Pérez; Ángela M. Fernández Serrano

    2010-01-01

    La Convención sobre el Comercio Internacional de Especies Amenazadas de Fauna y Flora Silvestres, firmada en Washington el 3 de marzo de 1973, de la que la República de Cuba es parte desde el 19 de julio de 1990, establece los requisitos para la importación, la exportación, la reexportación y la introducción de las especies, partes o derivados de la fauna y la flora silvestres, amenazadas o en peligro de extinción y las Resoluciones adoptadas p...

  9. A Liouville Problem for the Stationary Fractional Navier-Stokes-Poisson System

    Science.gov (United States)

    Wang, Y.; Xiao, J.

    2017-06-01

    This paper deals with a Liouville problem for the stationary fractional Navier-Stokes-Poisson system whose special case k=0 covers the compressible and incompressible time-independent fractional Navier-Stokes systems in R^{N≥2} . An essential difficulty raises from the fractional Laplacian, which is a non-local operator and thus makes the local analysis unsuitable. To overcome the difficulty, we utilize a recently-introduced extension-method in Wang and Xiao (Commun Contemp Math 18(6):1650019, 2016) which develops Caffarelli-Silvestre's technique in Caffarelli and Silvestre (Commun Partial Diff Equ 32:1245-1260, 2007).

  10. Assesment of chemical and morphological variation of Spanish Marjoram: Spanish Sage and Spike Lavender

    OpenAIRE

    Méndez Tovar, Inés Rosa

    2015-01-01

    El presente estudio se llevó a cabo para apoyar al sector agronómico y superar los problemas actuales del mercado de las plantas aromáticas y medicinales (PAM). El problema principal se debe a que las PAM se han recolectado tradicionalmente de forma silvestre. La recolección silvestre no permite la recogida de material vegetal de alta calidad y produce la deforestación, amenazando las especies recolectadas. Hay que añadir que exi...

  11. Análise da predação de Puma concolor em rebanhos domésticos na região do Parque Nacional de São Joaquim e entorno, SC, Brasil

    OpenAIRE

    Luiz Guilherme Marins de Sá

    2005-01-01

    A predação de rebanhos domésticos por predadores silvestres é o conflito mais intenso entre seres humanos e animais silvestres por causa do prejuízo econômico. A solução encontrada pelos fazendeiros é o abate do predador, causa principal de mortalidade destes animais ao redor do mundo. Para compreender melhor as variáveis ambientais relacionadas a este conflito na região do Parque Nacional de São Joaquim, SC, Brasil, e entorno, foram visitadas propriedades que registraram a presença de leões-...

  12. Efeito da cerosidade foliar na reação de variedades de cebola (Allium cepa L. a herbicidas de pós-emergência Effect of the foliar waxiness of onion varieties (Allium cepa L. in reaction to post-emergence herbicides

    Directory of Open Access Journals (Sweden)

    P.V. Ferreira

    1982-12-01

    Full Text Available Em ensaios experimentais, realizados no Departamento de Genética da Escola Superior de Agricultura "Luiz de Queiroz" da Universidade de São Paulo, Piracicaba - SP, verificou-se o efeito da ce rosidade foliar na reação de variedades de cebola a herbicidas de pós-emergência. Utilizaram-se variedades do grupo não ceroso, como Granex e Texas Grano, e variedades do grupo ceroso, como Baia Periforme, Barreiro SMP-IV, Red Creole e Roxa Chata SMP-IV, no 1.º ensaio; e variedades do grupo não ceroso, como Excel Bermudas 986 e Texas Grano, e variedades do grupo ceroso, como Baia Periforme, Pira Couto, Pira Dura, Pira Ouro A/R, Red Creole e Roxa Chata SMP-IV, no 2.º ensaio. Os herbicidas de pós-emergência e as doses utilizadas foram: bentazon, 0,48 kg i.a./ha e prometryne 1,60 kg i.a./ha, no 1.0 ensaio; e ácido sulfúrico (4%, bentazon 0,48 kg i.a./ha, prometryne 1,60 kg i.a./ha e diuron 1,60 kg i.a./ha, no 2: ensaio. Os resultados obtidos mostram que a cerosidade foliar é um dos mecanismos de resistência de cebola à ação de herbicidas de pós-emergência.In experimental trials, carried out in the Department of Genetic of ESALQ, University of São Paulo, Piracicaba - SP, the effect of the foliar waxiness in reaction of onion varieties at postemergence herbicides was studied. Glossy group varieties such as Granex and Texas Grano and non-glossy group varieties such as Baia Periforme, Barreiro SMP-IV, Red Creole and Roxa-Chata SMP-IV, were tested in 1st. experiment; and glossy group varieties such as Excel Bermudas 986 and Texas Grano and nonglossy group varieties such as Baia Periforme, Pira Couto, Pira Dura, Pira Ouro A/R, Red Creole and Roxa Chata SMP-IV, in 2nd experiment. The following post-emergence herbicides and doses were used: bentazon 0,48 kg a.i./ha and prometryne 1,60 kg a.i./ha, in the last experiment: and sulphuric acid (4%, bentazon 0,48 kg a.i./ha, prometryne 1,60 kg a.i./ha and diuron 1,60 kg a.i./ha, in the 2nd experiment

  13. PirAB protein from Xenorhabdus nematophila HB310 exhibits a binary toxin with insecticidal activity and cytotoxicity in Galleria mellonella.

    Science.gov (United States)

    Yang, Qing; Zhang, Jie; Li, Tianhui; Liu, Shen; Song, Ping; Nangong, Ziyan; Wang, Qinying

    2017-09-01

    PirAB (Photorhabdus insect-related proteins, PirAB) toxin was initially found in the Photorhabdus luminescens TT01 strain and has been shown to be a binary toxin with high insecticidal activity. Based on GenBank data, this gene was also found in the Xenorhabdus nematophila genome sequence. The predicted amino acid sequence of pirA and pirB in the genome of X. nematophila showed 51% and 50% identity with those gene sequences from P. luminescens. The purpose of this experiment is to identify the relevant information for this toxin gene in X. nematophila. The pirA, pirB and pirAB genes of X. nematophila HB310 were cloned and expressed in Escherichia coli BL21 (DE3) using the pET-28a vector. A PirAB-fusion protein (PirAB-F) was constructed by linking the pirA and pirB genes with the flexible linker (Gly) 4 DNA encoding sequence and then efficiently expressed in E. coli. The hemocoel and oral insecticidal activities of the recombinant proteins were analyzed against the larvae of Galleria mellonella. The results show that PirA/B alone, PirA/B mixture, co-expressed PirAB protein, and PirAB-F all had no oral insecticidal activity against the second-instar larvae of G. mellonella. Only PirA/B mixture and co-expressed PirAB protein had hemocoel insecticidal activity against G. mellonella fifth-instar larvae, with an LD 50 of 2.718μg/larva or 1.566μg/larva, respectively. Therefore, we confirmed that PirAB protein of X. nematophila HB310 is a binary insecticidal toxin. The successful expression and purification of PirAB laid a foundation for further studies on the function, insecticidal mechanism and expression regulation of the binary toxin. Copyright © 2017 Elsevier Inc. All rights reserved.

  14. Social Movements and Interrelated Effects: The Process of Social Change in the Post-Movement Lives of Provisional IRA Volunteers

    Directory of Open Access Journals (Sweden)

    Bosi, Lorenzo

    2016-12-01

    Full Text Available This article systematizes a research perspective that assesses how different types of social movement outcomes mutually influence one another over time. This should offer a different perspective on the consequences of social movements by shifting the focus from single outcomes to processes of social change that are generated by the interaction between different types of effects. The variety of ways in which movement outcomes potentially influence each other in the short-term, or over an extended period of time, will be broken down into six hypothetical processes. Empirically, through a process-tracing approach, in this article I investigate how the British state’s responses at policy level toward the disruptive mobilization of the Catholic community in Northern Ireland and to the armed campaign of the PIRA have shaped the post-movement lives of PIRA volunteers.Este artículo sistematiza una perspectiva de investigación que evalúa cómo los diferentes tipos de resultados de los movimientos sociales se influyen mutuamente en el tiempo. Esto debería ofrecer una perspectiva diferente sobre las consecuencias de los movimientos sociales, cambiando el foco de atención desde los resultados individuales a procesos de cambio social generados a partir de la interacción entre diferentes tipos de efectos. La variedad de formas en las que los resultados de los movimientos se influyen potencialmente entre sí en el corto plazo, o durante un período prolongado de tiempo, se dividen en seis procesos hipotéticos. Empíricamente, a través de un enfoque centrado en los procesos, este artículo investiga cómo las respuestas políticas ofrecidas del Estado británico a la movilización disruptiva de la comunidad católica de Irlanda del Norte y la lucha armada del PIRA han dado forma a la vida post-movimiento de los voluntarios del PIRA.

  15. Herança de coloração de bulbos em cebola (Allium cepa L. com resistência a Colletotrichum gloeosporioides Inheritace of bulb color in onion (Alllum cepa L. resitant to Colletotrichum gloeosporioides

    Directory of Open Access Journals (Sweden)

    A.I.I. Cardoso

    1995-08-01

    Full Text Available O objetivo deste trabalho foi determinar a herança de coloração de bulbos de cebola a partir do cruzamento de bulbos brancos com resistência a Colletotrichum gloeosporioides (Mal de 7 voltas segregantes da população Roxa do Barreiro com bulbos amarelos de linhagens endogâmicas obtidas das variedades Super Precoce e Pira Ouro. Para tal obtiveram-se as gerações F1 e F2 entre (Super Precoce x Barreiro "Branca" e entre (Pira Ouro x Barreiro "Branca". Nas gerações F1 obtiveram-se apenas bulbos roxos, enquanto que nas gerações F2 obtiveram-se uma segregação para bulbos roxos, brancos e amarelos numa proporção aproximada de 9:4:3, o que permitiu concluir que a herança, para estes cruzamentos, foi devida a 2 pares de genes contrastantes nas populações progenitoras, cujos genótipos, com base na literatura, são: ii cc RR (Barreiro Branca e ii CC rr (linhagens de Super Precoce e de Pira Ouro. Conclui-se, também, que é possível, a partir destes cruzamentos, obter uma variedade ou linhagem com resistência a C. gloeosporioides somente com bulbos amarelos ou com bulbos brancos com genótipo homozigoto recessivo para todos os genes, que quando cruzada com outra amarela pode-se obter uma geração F1 com bulbos amarelos e com resistência a C. gloeosporioides.The inheritance of onion bulb color was studied utilizing white bulbs resistant to Colletotrichum gloeosporioides that segregated from the population 'Roxa do Barreiro' and two inbred Unes with yellow bulbs originated from 'Super Precoce" and 'Pira Ouro' cultivars. The white bulbs and the inbred Unes were crossed to obtain the F1 and F2 generations (yellow x white. Both F1 generations were of red bulbs and in the F2 generation there were segregations to red, white and yellow bulbs in a proportion of 9:4:3, respectively. It was concluded that the inheritance of bulb color in these crosses is controlled by two contrasting genes hi the parental (ii cc RR = white bulbs, ii CC rr

  16. Jedna strila, čet’ri krila. Carmina figurata u hrvatskoj vernakularnoj i novolatinskoj poeziji XVI. stoljeća

    OpenAIRE

    Stepanić, Gorana

    2015-01-01

    Članak se bavi figuralnim pjesmama (carmina figurata) na hrvatskom i latinskom u dubrovačkom pjesništvu 16. stoljeća. Nakon uvodnog osvrta na žanr tehnopegnija i terminoloških objašnjenja rekapitulira se dosadašnje znanje o primjerima figuralne poezije kod Dinka Ranjine (Dubrovnik, 1536 – Dubrovnik, 1607) te portugalskog humanista Didaka Pira (Évora, 1517 – Dubrovnik, 1599). Analiziraju se, korigiraju i nadopunjuju studije posvećene Ranjininoj hrvatskoj pjesmi u obliku strijele (Pavličić) i k...

  17. Bioacumulacion y biomagnificacion de mercurio en diferentes poblaciones de peces de la Amazonía boliviana

    OpenAIRE

    Lopez Siangas, E.I.

    2005-01-01

    La bioacumulación de mercurio respecto al tamaño, peso y edad, así como la influencia de aspectos biológicos como la alimentación, el crecimiento, la madurez sexual y el sexo, fueron determinadas en seis especies de peces piscívoros y no piscívoros de importancia regional: #Cichla monoculus# (Tucunaré), #Pygocentrus nattereri# (Piraña), #Psedoplatystoma fasciatum# (Surubí), #Plagioscion squamossisimus# (Corvina), #Colosoma macropomum# (Pacú) y #Piaractus brachypomus# (Tambaquí), en las cuenca...

  18. Identification of organic acids in Cichorium intybus inhibiting virulence-related properties of oral pathogenic bacteria

    NARCIS (Netherlands)

    Papetti, A.; Mascherpa, D.; Carazzone, C.; Stauder, M.; Spratt, D.A.; Wilson, M.; Pratten, J.; Ciric, L.; Lingström, P.; Zaura, E.; Weiss, E.; Ofek, I.; Signoretto, C.; Pruzzo, C.; Gazzani, G.

    2013-01-01

    The low molecular mass (LMM) extract of Cichorium intybus var. silvestre (red chicory) has been shown to inhibit virulence-linked properties of oral pathogens including Streptococcus mutans, Actinomyces naeslundii and Prevotella intermedia. In the present study HPLC-DAD-ESI/MS2 was used to

  19. CITES aplicació en fauna salvatge i clínica d'animals exótics /

    OpenAIRE

    Ticó Gil, Gemma.

    2011-01-01

    CITES: Convention on International Trade in Endangered Species of Wild Fauna and Flora = Conveni sobre el Comerç Internacional d’Espècies Amenaçades de Fauna i Flora Silvestre. Treball presentat a l'assignatura de Deontologia i Veterinària Legal (21223)

  20. Actualización de la distribución geográfica y ecoepidemiología de la fauna de triatominos (Reduviidae: Triatominae en Colombia

    Directory of Open Access Journals (Sweden)

    Felipe Guhl

    2007-01-01

    Se resalta la importancia de la vigilancia entomológica como herramienta indispensable para reforzar las estrategias de control de la transmisión de la enfermedad de Chagas, permitiendo también la evaluación del riesgo que representan las especies de triatominos silvestres en Colombia.

  1. Twenty Years of French "Didactique" Viewed from the United States

    Science.gov (United States)

    Kilpatrick, Jeremy

    2003-01-01

    One cannot begin considering the topic of this colloquium without asking, why twenty years? Why not two hundred? Two hundred years ago, Silvestre Franois Lacroix was about to be named chief officer of the Commission Executive de L'Instruction Publique. Out of that experience, together with his long career in instruction, especially as professor of…

  2. First New World Primate Papillomavirus Identification in the Atlantic Forest, Brazil: Alouatta guariba papillomavirus 1.

    Science.gov (United States)

    Silvestre, Rodrigo Vellasco Duarte; de Souza, Alex Junior Souza; Júnior, Edivaldo Costa Sousa; Silva, Allan Kaio; de Mello, Wyller Alencar; Nunes, Marcio Roberto T; Júnior, João Lídio S G V; Cardoso, Jedson Ferreira; de Vasconcelos, Janaina Mota; de Oliveira, Layanna Freitas; da Silva, Sandro Patroca; da Silva, Adriana Marques J; Fries, Brigida Gomes; Summa, Maria Eugênia L; de Sá, Lilian Rose M

    2016-08-18

    We report here the complete genome sequence of the first papillomavirus detected in a New World primate, howler monkey, Alouatta guariba clamitans papillomavirus 1 (AgPV1), from the Atlantic Forest in São Paulo State, Brazil. Copyright © 2016 Silvestre et al.

  3. Test of a chromomagnetic model for hadron mass differences

    Science.gov (United States)

    Lichtenberg, D. B.; Roncaglia, R.

    1993-05-01

    An oversimplified model consisting of the QCD color-magnetic interaction has been used previously by Silvestre-Brac and others to compare the masses of exotic and normal hadrons. We show that the model can give qualitatively wrong answers when applied to systems of normal hadrons.

  4. Exploring the Regional Distribution of Tourism and the Extent to Which There Is Convergence

    DEFF Research Database (Denmark)

    Mérida, Adrián L.; Carmona, Mónica; Congregado, Emilio

    2016-01-01

    proposed by Carrion-i-Silvestre et al. (2005). Finally, the hypothesis of club convergence (Philips and Sul, 2007) is also tested. The results point to absence of full convergence even when controlling for structural breaks while three different clubs of convergence are found. We discuss potential policy...

  5. Diquarks in rotating baryons

    International Nuclear Information System (INIS)

    Martin, A.

    1989-01-01

    This paper shows that the minimum energy three-quark classical configuration for a given angular momentum and linear two-body potentials between the quarks is a quark-diquark system. The authors deduce from this that baryons at large angular momentum have a quark-diquark structure. Explicit calculations by Flack, Richard and Silvestre-Brac show this effect

  6. H.R. 4015, Jobs for Veterans Act. Hearing before the Subcommittee on Benefits of the Committee on Veterans' Affairs, House of Representatives. One Hundred Seventh Congress, Second Session (April 18, 2002).

    Science.gov (United States)

    Congress of the U.S., Washington, DC. House Committee on Veterans' Affairs.

    This hearing provides the statements from the following individuals: Chairman Simpson; Hon. Silvestre Reyes; Hon. Ander Crenshaw; and Hon. Lane Evans (prepared statement of). This document also includes statements from over 10 wittinesses and contains an article, bill, chart, and statement submitted for the record relating to this hearing.…

  7. Test of a chromomagnetic model for hadron mass differences

    International Nuclear Information System (INIS)

    Lichtenberg, D.B.; Roncaglia, R.

    1993-01-01

    An oversimplified model consisting of the QCD color-magnetic interaction has been used previously by Silvestre-Brac and others to compare the masses of exotic and normal hadrons. We show that the model can give qualitatively wrong answers when applied to systems of normal hadrons

  8. Notes on the Cactaceae of Curaçao, Aruba, Bonaire and North Venezuela

    NARCIS (Netherlands)

    Wagenaar Hummelinck, P.

    1938-01-01

    La flora de cactos de las islas situadas entre Trinidad y la península de La Goajira comprende trece especies silvestres, aparte del género Melocactus: Pereskia Guamacho, Opuntia caribaea, O. curassavica, O. Wentiana, O. elatior, Rhipsalis cassutha, Hylocereus Lemairei, Acanthocereus pentagonus,

  9. Ontology supported system for searching evidence of wild animals trafficking in social network posts

    Directory of Open Access Journals (Sweden)

    Rafael da Silva Carrasco

    2014-04-01

    Full Text Available O comércio ilegal de animais silvestres é uma das atividades criminais mais lucrativas da atualidade. No Brasil, a grande variedade de fauna nativa tem alimentado o mercado ilegal, o que gera sérias implicações ambientais e sociais. A luta contra o comércio ilegal de animais silvestres é crucial para ajudar a proteger os recursos naturais e evitar a disseminação de outras formas de crime. Esse tipo de comércio ilegal usa cada vez mais, a internet para realizar suas atividades. A fim de combater tal crime, um sistema automático de monitorização é essencial. No entanto, para realizar essa tarefa de forma eficaz, o sistema deve ser capaz de analisar as mensagens trocadas durante essa prática. Para isso, é necessário o conhecimento dos conceitos e relações que ocorrem nesse domínio. Este artigo apresenta um sistema multiagente apoiado por ontologia de domínio e frames semânticos para buscar evidências de comércio ilegal de animais silvestres. No artigo, é mostrado como o sistema pode ser usado na tarefa de rastreamento do comércio ilegal de animais silvestres, além de apresentar os resultados da aplicação do sistema em um pequeno corpus.

  10. Aroideas comestibles de San José de Suaita (Suaita, Santander, Colombia

    Directory of Open Access Journals (Sweden)

    Irene López Cardozo

    2005-01-01

    encuentran cultivadas en las labranzas (áreas de cultivo o escapadas de cultivo, en los alrededores de las viviendas y las veredas. La especie Dracontium spruceanum se encuentra exclusivamente en estado silvestre y se restringe a la zona de La Meseta.

  11. Simón Bolívar y la cultura iberoamericana

    Directory of Open Access Journals (Sweden)

    Luis López de Mesa

    1979-08-01

    Full Text Available Simón Bolívar -en cuanto héroe de la historia de América- nació en Cartagena del Caribe en 1812 y murió en Lima hacia 1926. Comparando esos catorce años de prodigiosa actividad pública con el promedio de "realizaciones " que en el decurso de su vida lleva a cabo el hombre común, resultaría de longevidad casi milenaria: prueba de ello es que su pensamiento actúa aún en el continente americano, y que sus obras siguen creciendo a la faz del mundo.

  12. ¿OFRECEN CALIDAD LAS CONSULTORÍAS EN CALIDAD? /

    OpenAIRE

    Marimon Viadiu, F.; Casadesús Fa, M; Heras Saizarbitoria, I.

    2004-01-01

    En este artículo analizamos la calidad del servicio ofertado por las empresas consultoras. Concretamente aquellas especializadas en la implantación de sistemas basados en normativa ISO 9000. Es un mercado que sigue creciendo en los últimos años por todo el planeta. El principal objetivo es analizar el beneficio aportado por estas consultarías, así como la relación entre estos beneficios y la percepción de calidad del servicio. Para ello se ha realizado un trabajo empírico sobre una muestra de...

  13. Diseño para la implementación de los procesos de talento humano para la Pyme Producomercio Joseph´s Foods

    OpenAIRE

    Alvarado Villarreal, Maria del Rocio

    2014-01-01

    La empresa Producomercio Joseph´s Foods, es una empresa de tipo familiar, actualmente está formando parte del sector de las PYMES, inició sus operaciones hace 47 años como una pequeña empresa artesanal, con el pasar del tiempo ha ido creciendo progresivamente, por lo que cada día precisa la contratación de más personal con especialización de funciones; el compromiso de sus directivos es ofrecer productos de la mejor calidad y con el mejor servicio, por ello para seguir operando y llegar a tra...

  14. Paralelización de aplicaciones econométricas que requieren estimación de los modelos de elección discreta

    OpenAIRE

    Trigila, Mariano; Di Pasquale, Ricardo

    2016-01-01

    En las últimas dos décadas, el uso eficiente del hardware para aplicaciones científicas fue creciendo en dificultad. Además, muchas de estas aplicaciones requieren mejorar el rendimiento del procesamiento y tratar datos masivos. Estos son sistemas complejos de implementar y en especial para aquellos que no son especialista en computación. Es necesario desarrollar e implementar abstracciones de programación de alto nivel que permitan modelos de programación simples de usar. Las aplica...

  15. La docencia del marketing sensorial en el Grado de Publicidad y Relaciones Públicas de la Universidad de Valladolid

    OpenAIRE

    Figueroa Escribano, Carmen

    2014-01-01

    He querido plasmar en este trabajo de investigación cómo es la docencia y qué importancia se le da al Marketing en general y al Marketing Sensorial en particular, en el grado de Publicidad y Relaciones Públicas en la Universidad de Valladolid, en la cual he estado estudiando mis cuatro años de carrera. He querido centrarme en estos dos fenómenos, puesto que valoro que el Marketing Sensorial es una estrategia que está creciendo mucho y las empresas están utilizando como reclamo publicitario pa...

  16. Compromiso político y labor profesional : Estudios sobre psicólogos y abogados en los primeros setenta

    OpenAIRE

    Chama, Mauricio Sergio

    2016-01-01

    Este libro aborda el proceso de politización y radicalización de sectores medios de la sociedad argentina en los tempranos años setenta, a partir del análisis de dos grupos de profesionales. Por un lado, pone el foco en un núcleo de psicólogos que, creciendo desde los márgenes de una institución psiquiátrica tradicional, radicalizó sus posturas al impulsar un conjunto de innovaciones que tenían como horizonte la idea de “comunidades terapéuticas”. Por otro lado, reconstruye el itinerario de u...

  17. Implantación de un sistema de información para la comercialización tercerizada de productos financieros

    OpenAIRE

    Lara Bendezu, Junior Felix; Lara Bendezu, Junior Felix; Lara Bendezu, Junior Felix

    2013-01-01

    La tercerización es el proceso por el cual se transfieren actividades dentro de la cadena de valor a socios seleccionados. Es una práctica que ha ido creciendo y evolucionando dentro del mundo de los negocios ya que permite concentrar las energías empresariales en el núcleo del negocio. La empresa Certicom brinda el servicio de tercerización de los procesos de comercialización de créditos financieros de las entidades financieras. Este proceso es de suma importancia para dichas entidades po...

  18. Contribución al estudio del sistema de lipasas de Trichoderma harzianum

    OpenAIRE

    Jorge, Maria de Lurdes Antunes

    2015-01-01

    [ES]Entre los hongos del género Trichoderma se han descrito algunas especies importantes como agentes de biocontrol, tales como las parejas anamorfo/teleomorfo T. harzianum/Hypocrea lixii, T. viride/H. rufa, T. atroviride/H. atroviridis y T. virens/H. virens. Trichoderma tiene una amplia distribución geográfica, está presente en casi todos los suelos y en hábitats diversos (creciendo en madera, corteza, sobre y dentro otros hongos y sustratos innumerables). Por su adaptación a distintos en...

  19. Higiene Industrial en empresa de limpieza

    OpenAIRE

    Dorca-Mariño, José Ignacio

    2012-01-01

    Este trabajo se realiza basándose en la experiencia del autor al hacerse cargo del Servicio de Prevención Propio de SERLIMAT ESPAÑOLA , empresa de limpieza industrial con 28 años de experiencia en su sector y que ha ido creciendo tanto en número de empleados, como en actividades y en implantación geográfica. En la actualidad, formamos parte de la empresa más de 700 trabajadores, con una amplia mayoría femenina, que representa aproximadamente el 80%, y la principal actividad de la empresa e...

  20. Imagen corporal en pacientes sometidos a cirug?a bari?trica

    OpenAIRE

    Vega Meza, Mar?a Paula

    2017-01-01

    La obesidad es un problema de salud que ha ido creciendo de manera considerable en los ?ltimos a?os, afectando a un alto porcentaje de la poblaci?n mundial (WHO, 2015). Uno de los tratamientos que m?s se emplea en la actualidad para tratar esta condici?n es la cirug?a bari?trica, la cual ha mostrado, hasta el momento, ser una de las t?cnicas m?s eficaces en cuanto a la p?rdida significativa del peso y el mantenimiento de los resultados (Abeles & Shikora, 2008). En ese orden, es pertinente ent...

  1. Planeamiento estratégico del sector de las fuentes no convencionales de energía renovable en Colombia

    OpenAIRE

    Torres Wilches, Carlos Rolando; Rojas Patiño, Alejandro; Higuera Rincón, Diana Astrid; Hernández Henríquez, Jorge Daniel; Calle Forero, Jorge Alberto

    2017-01-01

    xiv, 192 h. : il. ; 30 cm. A través de los años y en el ámbito mundial, la generación de energía eléctrica por medio de fuentes no convencionales de energía como el sol, el viento, la biomasa, y la energía mareomotriz, ha estado creciendo constantemente tanto en capacidad instalada (i.e., megawatt) como en número de proyectos implementados. Parte importante de este crecimiento se debe a la mejora continua en la tecnología de producción que utilizan entre otros los paneles so...

  2. Inversión tecnológica empresarial para la instalación de una piscigranja de Paiche - Shapajilla - Tingo Maria

    OpenAIRE

    Martos Gurmendi, Victor Hugo; Martos Gurmendi, Victor Hugo

    2013-01-01

    Del mar, ya no es posible extraer más especies. Este consenso se consolida al advertir que existe la explotación plena de varias especies, por lo que no parece factible mayor crecimiento en la extracción. ¿De donde vendrá el alimento para las mayores necesidades de alimentación de una población mundial que sigue creciendo geométricamente? Todo hace suponer que de la acuicultura. Mundialmente la acuicultura es un sector dinámico, de crecimiento rápido y gran potencial. En la actualidad...

  3. Insuficiencia cardíaca y diabetes

    OpenAIRE

    Jorge Thierer

    2006-01-01

    La prevalencia de la insuficiencia cardíaca y la diabetes continúa creciendo. Ambas están fuertemente asociadas. La diabetes es un fuerte predictor de aparición de insuficiencia cardíaca. Las razones son la presencia de enfermedad coronaria y los trastornos metabólicos vinculados con la resistencia a la insulina que generan disfunción contráctil. Los pacientes con insuficiencia cardíaca que son diabéticos tienen peor evolución. Los Betabloqueantes, vasodilatadores y los inhibidores de la en...

  4. Insuficiencia cardíaca y diabetes

    OpenAIRE

    Thierer, Jorge

    2006-01-01

    La prevalencia de la insuficiencia cardíaca y la diabetes continúa creciendo. Ambas están fuertemente asociadas. La diabetes es un fuerte predictor de aparición de insuficiencia cardíaca. Las razones son la presencia de enfermedad coronaria y los trastornos metabólicos vinculados con la resistencia a la insulina que generan disfunción contráctil. Los pacientes con insuficiencia cardíaca que son diabéticos tienen peor evolución. Los betabloqueantes vasodilatadores y los inhibidores de la enzim...

  5. Condiciones de sostenibilidad de la ciudad compacta: análisis de superficies expuestas a la radiación y sombras arrojadas en la Ciudad de Mendoza

    OpenAIRE

    Ganem, Carolina; Balter, Julieta; Coch Roura, Helena

    2009-01-01

    ¿Podemos decir que toda ciudad compacta es una ciudad sostenible? ¿Cuáles son los parámetros que definen a una ciudad compacta sostenible? El objetivo de este trabajo es determinar las características de la ciudad compacta tal y como está creciendo hoy mediante el estudio en profundidad de una ciudad en plena densificación, la ciudad de Mendoza en la República Argentina. Se parte del estudio de los diferentes códigos de edificación vigentes desde su fundación y las restricciones y oportunida...

  6. Corporeidad y significado: naturaleza dual de lo físico

    OpenAIRE

    Arranz Rodrigo, Marceliano

    2015-01-01

    La información es una dimensión de lo real que, a pesar de no tener natu-raleza física, solo existe apoyada en una base física. Y su presencia en los objetos, eventos y procesos que constituyen nuestro entorno vital humano, es lo que permite que el mundo sea inteligible. Sin información no serían posibles las definiciones, ni el pensamiento, ni el lenguaje, ni la ciencia. La importancia de la información está creciendo de manera expo-nencial en nuestros días. Aclarar su estatuto ...

  7. INFLUENCIA DE LA MADERA JUVENIL DE PINO RADIATA SOBRE LAS PROPIEDADES MECÁNICAS DE TABLEROS OSB

    OpenAIRE

    PECHO,Robert; ANANIAS,Rubén A; BALLERINI,Aldo; CLOUTIER,Alain

    2004-01-01

    En este trabajo se estudia la influencia de la madera juvenil de pino radiata (Pinus radiata D. Don) sobre las propiedades mecánicas de tableros de hojuelas orientadas OSB. La madera para los ensayos es recogida de 10 árboles en pié de 26 años creciendo en plantaciones manejadas de la Octava región, Chile. La determinación de madera juvenil se realiza observando la variación radial de los anillos de crecimiento de la madera, usando un analizador de anillos en base a rayos X. Los detalles de l...

  8. Territorio virtual: arquitectrónica

    Directory of Open Access Journals (Sweden)

    Marta Borbonet

    2002-08-01

    Desde el nacimiento en 1989 del lenguaje HTML para el intercambio de datos entre científicos, de la mano de Tim Berners-Lee la densificación de la información en Internet ha adquirido proporciones colosales hasta hoy en día. Paralelamente al ingente volcado de información en la Red han ido creciendo lógicamente nodos de conexión, servidores, routers, etc. o sea, mecanismos de distribución y acceso a este flujo informacional.

  9. Influencia de los balances microscópicos en el diseño de reactores de flujo pistón. Aplicación para la obtención de propilenglicol a partir de óxido de propileno

    OpenAIRE

    López Rodríguez, Sergio

    2017-01-01

    Actualmente, la optimización de los equipos de la industria de procesos en base a criterios económicos (sin dejar de lado el impacto medioambiental) está creciendo de manera significante. Una de las grandes limitaciones, en este sentido, es el tiempo de computación debido a la necesidad de optimizar uno o varios objetivos (coste e impacto ambiental generalmente) utilizando modelos complejos basados en ecuaciones diferenciales. En este trabajo, se ha propuesto una estructura sistemática para e...

  10. Consumo responsable

    Directory of Open Access Journals (Sweden)

    Educadores por la sostenibilidad

    2007-01-01

    Full Text Available Hablar de consumo moderado es plantear el problema del hiperconsumo de las sociedades “desarrolladas” y de los grupos poderosos de cualquier sociedad, que sigue creciendo como si las capacidades de la Tierra fueran infinitas. Baste señalar que los 20 países más ricosdel mundo han consumido en este siglo más naturaleza, es decir, más materia prima y recursos energéticos no renovables, que toda la humanidad a lo largo de su historia y prehistoria

  11. Propuesta Para La Disposición Adecuada De Los Residuos Sólidos Reciclables En El Laboratorio San Martín

    OpenAIRE

    Araya-Trejos, Yesenia

    2011-01-01

    Proyecto de Graduación (Maestría en Gestión de Recursos Naturales y Tecnologías de Producción) Instituto Tecnológico de Costa Rica. Área Académica Agroforestal, 2011. En las últimas décadas la generación de residuos sólidos ha ido creciendo exponencialmente a nivel mundial. Dentro de los factores que han contribuido a tal expansión están: la cultura de usar y tirar los llamados “desechables”, la elevada cantidad y diversidad de materiales de empaque que se comercializan con los productos, ...

  12. A multi-scale analysis of transforming agricultural markets in the context of globalization: implications for natural resources, food prices and rural poverty in Latin America

    OpenAIRE

    Flachsbarth, Insa

    2015-01-01

    Vivimos una época en la que el mundo se transforma aceleradamente. La globalización está siguiendo un curso imparable, la población mundial así como la población urbana siguen creciendo, y en los países emergentes los ingresos promedios aumentan, resultando en un cambio también acelerado de las dietas y hábitos alimentarios. En conjunto esos factores están causando un aumento fundamental de la demanda de alimentos. Junto con la apertura de los mercados agrícolas, estos procesos han provocado ...

  13. Editorial

    Directory of Open Access Journals (Sweden)

    Oscar Oswaldo Rodriguez Díaz

    2014-12-01

    Full Text Available El mercado de alta tecnología está creciendo a pasos gigantescos, es importante explorarlo, conocerlo y tratar de aprovechar al máximo, es así como la sociedad de consumo compra en forma masiva productos que apenas aprendemos a usar en un bajo porcenytaje de capacidades, un ejemplo es el celular, dispositivo que en primera instancia fue creado para realizar llamadas de cualquier puto y lugar "realizar llamadas", pero el mercado de consumo necesita nuevos dispositivos que complementen la vida diaria.

  14. Estudio de factibilidad para empresa de experiencias culturales en Medellín “Colombia en una Noche”

    OpenAIRE

    Aristizábal Botero, Santiago

    2013-01-01

    El número de visitantes extranjeros y de otras ciudades de Colombia con fines de negocios y turismo ha venido aumentando considerablemente en Medellín durante los últimos años -- Esto tiende a seguir creciendo, más aún luego de que la ciudad fue escogida por el Citigoup y el Wall Street Journal como la más innovadora del mundo en febrero de 2013 -- Estos visitantes llegan a la ciudad buscando cumplir con sus propósitos principales de turismo y negocios, pero adicionalmente ansían tener experi...

  15. Personas mayores con demencia institucionalizadas : efectos de la musicoterapia versus los talleres de reminiscencia-recreación

    OpenAIRE

    Solé Resano, Carme; Mercadal-Brotons, Melissa; Castro, Mónica de; Asensio, Francisca María

    2017-01-01

    Las personas afectadas de demencia continúan creciendo cada año.. Dentro del marco de la Psicología Positiva, vamos a estudiar los efectos positivos de la musicoterapia en la calidad de vida de las personas con demencia. El objetivo principal es analizar y comparar los efectos de un programa de musicoterapia (grupo experimental), y un programa de reminiscencia/recreación (grupo control) en personas mayores institucionalizadas. Se analiza el impacto: cognitivo, estado anímico y participación-i...

  16. Planeación estratégico de marketing infantil y de control interno para la empresa de eventos "Magic" dirigido a los niños de clase socio-económica media alta de la ciudad de Guayaquil.

    OpenAIRE

    Peña Calle, Enrique Leonardo; Sánchez Limones, Christian

    2015-01-01

    “MAGIC” es una empresa relativamente nueva, la cual cuenta con menos de 2 años de vida dentro del mercado de eventos infantiles, fue fundada en el año 2013; pero a pesar del poco tiempo en el mercado ha venido creciendo en una manera positiva ya que la empresa ofrece servicio de eventos infantiles personalizados para cada cliente con el fin de generar satisfacción y seguridad a cada uno de los padres en la organización del evento. El presente trabajo de titulación se fundamenta en la necesida...

  17. La escolarización en Gambia

    OpenAIRE

    Farjas Bonet, Anna

    2002-01-01

    Actualmente en Gambia el número total de alumnos matriculados en escuelas de modelo británico es mucho más alto que en escuelas coránicas formales o madrasas. De todas formas, la popularidad de los centros coránicos formales va creciendo, aunque lentamente, en todo el país. Las escuelas de modelo británico aún son vistas por la población rural como un elemento extranjero. De hecho, la educación occidental ha sido vista como un elemento extranjero desde su introducción. Las escuelas, sobre...

  18. Redes sociales, políticas públicas y capital social

    OpenAIRE

    Lluís Ballester; Belén Pascual; Carlos Vecina

    2014-01-01

    La comunidad, o en un espacio más amplio la propia sociedad, en cualquiera de sus dimensiones, no es un espacio cerrado sin conexiones e interconexiones; más bien puede concebirse como una red de relaciones. En este sentido, desde las Ciencias Sociales ha ido creciendo el interés por el estudio de las redes sociales; esto ha permitido comprender mejor como se construyen y mantienen las relaciones sociales entre la población. Junto al concepto de redes sociales aparece también el de capital...

  19. Servidor dedicado de seguridad en contenedores de Linux Docker

    OpenAIRE

    Arjona Rivera, Daniel

    2017-01-01

    Actualmente, estamos viviendo en un momento en el que la importancia de la seguridad informática está creciendo exponencialmente, en parte, debido a la gran subida del porcentaje de cibercrimen en los últimos meses. El sector empresarial y financiero como grandes afectados, han entrado en un estado de alerta en el cual la preocupación se ha hecho notar. El presente proyecto plantea una posible solución informática enfocada principalmente para aquellas personas que por su constante movilidad t...

  20. Teleoperación de un robot mindstorm mediante técnicas de visión artificial

    OpenAIRE

    Méndez Rodríguez, Eduardo

    2011-01-01

    Las tres partes tratadas son la teleoperacióon (principalmente con comunicaciones mediante bluetooth), la visión arti cial para elementos móviles en tiempo real y proyectos realizados con el Mindstorm NXT. Hay que destacar que en los dos primeros campos hay innumerables aplicaciones debido a que ambos campos siguen hoy en día bajo invetigación en busca de lograr mejoras tecnológicas, también los proyectos con el Mindstorm están creciendo exponencialmente, mayormente debido a...

  1. Mexican Immigrants and Temporary Residents in Canada: Current Knowledge and Future Research

    OpenAIRE

    Richard E. Mueller

    2005-01-01

    La migración de mexicanos a Canadá, aunque es un fenómeno reciente, ha tenido uno de los incrementos más significativos entre los movimientos de personas de América Latina. Desde mediados de los noventa, el número de mexicanos en Canadá ha estado creciendo rápidamente como resultado del retorno de los descendientes de la población menonita que emigró a México y de las disposiciones del Tratado de Libre Comercio de América del Norte (tlcan), que facilita el ingreso de ciudadanos mexicanos. En ...

  2. Internacionalización de Mercadona: Análisis del Sector de la Distribución Alimentaria en Coímbra

    OpenAIRE

    Sastre García, Héctor

    2017-01-01

    En un mundo cada vez más globalizado las empresas que tienen éxito en su país de origen pueden internacionalizarse para seguir creciendo. Se presenta un estudio de la internacionalización de la empresa Mercadona, con una reflexión sobre los diferentes motivos que pueden animar a que las empresas se internacionalicen y las diferentes formas de hacerlo. Se hace hincapié en Coímbra, ciudad de Portugal, como futuro destino de la empresa, evaluando la prosperidad y el bienestar del contexto en el ...

  3. Brain-Computer Interfaces: Desarrollo de un sistema de identificación de estados mentales alfa

    OpenAIRE

    Iglesias López, Pablo

    2016-01-01

    En el mundo actual las aplicaciones basadas en sistemas biométricos, es decir, aquellas que miden las señales eléctricas de nuestro organismo, están creciendo a un gran ritmo. Todos estos sistemas incorporan sensores biomédicos, que ayudan a los usuarios a controlar mejor diferentes aspectos de la rutina diaria, como podría ser llevar un seguimiento detallado de una rutina deportiva, o de la calidad de los alimentos que ingerimos. Entre estos sistemas biométricos, los que se basan en la in...

  4. El Bambú como material estructural:análisis de un caso práctico

    OpenAIRE

    Rodríguez Alonso, Cesar A.; Morales Díaz, Estefan

    2008-01-01

    Esta investigación quiere participar en la búsqueda de encontrar nuevas formas para el uso del bambú porque creciendo rápido y siendo muy resistente, el bambú es muy competitivo con respecto a otros materiales. La idea principal de esa investigación es aplicar al bambú las técnicas modernas de estructuras livianas, espaciales y flexibles del acero o la madera. De allí que decidieramos investigar sistemas estructurales que respondan a las siguientes pautas de diseño: aprovechamiento de la l...

  5. Implementación del sistema de venta de recarga virtual para distribuidores de una empresa de telecomunicaciones

    OpenAIRE

    Ibarra Apaza, Wilson Daniel; Ibarra Apaza, Wilson Daniel

    2012-01-01

    En la actualidad se ha observa que el Sector de las Telecomunicaciones ha ido creciendo notablemente, esto debido en parte al crecimiento económico del país en los últimos años, lo cual ha traído consigo oportunidades de negocio para las empresas de telecomunicaciones, quienes constantemente ofrecen productos y servicios de calidad enfocados a la satisfacción de los clientes, con la finalidad de retener a los clientes y atraer nuevos clientes de segmentos que aún no han sido explorados y que ...

  6. MOOC de Introducción al Business intelligence

    OpenAIRE

    Masip Rodó, David; Garrigues Olivella, Carles; Guitart Hormigo, María Isabel; Rius Gavidia, Àngels; Minguillón Alfonso, Julià; Rodríguez González, M. Elena; Rodríguez Bermúdez, José Ramón; Pujol Jover, Maria; Conesa Caralt, Jordi; Marco Simó, Josep Maria

    2015-01-01

    Colección de vídeos docentes del MOOC de Introducción al Business intelligence que la Universitat Oberta de Catalunya. El Business Intelligence es uno de los puntales de la actual revolución tecnológica que estamos experimentando. La cantidad de datos generados por la sociedad de la información crece día a día, y seguirá creciendo gracias a la explosión de las redes sociales, las smarts cities, el big data, los dispositivos móviles, los sensores, etc. Este incremento exponencial del volumen d...

  7. La economía colaborativa. Una aproximación al turismo colaborativo en España

    OpenAIRE

    Rodríguez Antón, José Miguel; Alonso Almeida, María del Mar; Rubio Andrada, Luis; Celemín Pedroche, Soledad

    2016-01-01

    La actualmente denominada economía colaborativa, como modelo económico y social en el que los agentes comparten, de manera temporal, activos, bienes y servicios, en muchos casos infrautilizados, a cambio de dinero o de otros servicios, utilizando plataformas on line, está creciendo de manera imparable y se está introduciendo en sectores tradicionales como la producción de bienes y la prestación de servicios profesionales y financieros y, muy especialmente, en el sector turismo, en concreto en...

  8. El Mercado Europeo de Productos Orgánicos de Comercio Justo

    OpenAIRE

    Garibay, Salvador; Richter, Toralf

    2005-01-01

    Los países centroamericanos son importantes productores de productos orgánicos. Su base de exportaciones, sin embargo, es altamente dependiente de un número limitado de productos (café, cacao, banano, azúcar) lo que atenta contra la sostenibilidad del sector exportador. Por lo tanto, hay una urgente necesidad de diversificar la base de exportaciones y de desarrollar mercados nacionales y regionales, los cuales están creciendo continuamente y tienen un gran potencial. El propósito de este repo...

  9. Produção e indicadores fisiológicos de alface sob hidroponia com água salina Production and physiologic indicators of lettuce grown in hydroponics with saline water

    Directory of Open Access Journals (Sweden)

    Dalva Paulus

    2010-03-01

    Full Text Available O uso de água salina na produção de hortaliças constitui no momento atividade essencial, tendo em vista o aumento da demanda de água doce, tanto pela atividade agrícola quanto pelo abastecimento urbano e industrial. O objetivo do trabalho foi avaliar a produção e os indicadores fisiológicos de alface cultivada em hidroponia com a utilização de água salina. O experimento foi conduzido em ambiente protegido, em Piracicaba-SP. O delineamento experimental foi de blocos ao acaso, sendo estudados os efeitos de cinco níveis de salinidade da água de irrigação, utilizando-se NaCl [Condutividade elétrica (Cea: 0,42, 1,53, 3,52, 5,55 e 7,43 dS m-1] em duas cultivares de alface (Verônica e Pira Roxa, em esquema fatorial. Foram determinadas massa fresca e seca de folhas, caule, raízes e da parte aérea; teor de nitrato, prolina e clorofila. O aumento da salinidade da água reduziu linearmente as massas fresca e seca das folhas, caule, raízes e da parte aérea. As massas fresca e seca foram 36% e 57% superiores na cultivar Verônica, respectivamente. A cultivar Pira Roxa apresentou maior teor de nitrato 25% (3008 mg L-1, clorofila total 50% (1,46 mg g-1massa fresca e prolina, 71,43% (0,21 µM g-1massa fresca-1 em relação à Verônica, o que pode ser um mecanismo de adaptação daquela cultivar ao estresse salino. Com relação à produtividade comercial, obteve-se uma perda de 69 e 64% para as cultivares Pira Roxa e Verônica, quando se utilizou água mais salina (7,43 dS m-1. Em relação à produção de massa seca, a perda pelo uso dessa água foi de 53% e 44%, respectivamente. Os resultados obtidos em sistema de cultivo hidropônico podem indicar a possibilidade do uso da água salina como alternativa para produção de hortaliças para produtores que têm disponibilidade de água salina e restrita disponibilidade de água doce, embora com redução na produtividade.The use of saline water in the production of vegetables constitutes

  10. ANÁLISE DOS PARÂMETROS DE FUNCIONAMENTO E SIMULAÇÃO COMPUTACIONAL EM UM PROTÓTIPO DE TURBINA OPERANDO A AR COMPRIMIDO

    Directory of Open Access Journals (Sweden)

    Wesley Saldanha Nogueira Oliveira

    2016-12-01

    Full Text Available RESUMO. Este trabalho apresenta os resultados iniciais da comparação de alguns parâmetros de funcionamento do protótipo de uma turbina de ação simples, operando com ar comprimido como fluido de trabalho, realizados na unidade do SENAI de Barra do Piraí/RJ. O protótipo foi desenvolvido integralmente no Centro Universitário Geraldo Di Biase - UGB - Campus de Barra do Piraí/RJ, que inicialmente teve como o fluido de trabalho o vapor d’água, que nos testes inicias se mostrou ineficiente. A simulação computacional do sistema foi feita através do software SolidWorks na Universidade Federal Fluminense - UFF - Campus de Volta Redonda/RJ, o que permitiu determinar a faixa de trabalho que apresentou maior eficiência nos resultados experimentais do sistema por meio da relação entre pressão de operação, velocidade angular transmitida pelo fluido ao eixo da turbina e a potência da mesma. Os valores nas simulações em velocidade tangencial na região rotacional apresentaram-se convergentes aos valores experimentais medidos no protótipo.

  11. Spatio-temporal evaluation of emerging contaminants and their partitioning along a Brazilian watershed.

    Science.gov (United States)

    de Sousa, Diana Nara Ribeiro; Mozeto, Antonio Aparecido; Carneiro, Renato Lajarim; Fadini, Pedro Sergio

    2018-02-01

    The occurrence, partitioning, and spatio-temporal distribution of seven pharmaceuticals for human use, three steroid hormones and one personal care product were determined in surface water, suspended particulate matter (SPM), and sediment of Piraí Creek and Jundiaí River (Jundiaí River Basin, São Paulo, Brazil). The maximum average detected concentrations of the compounds in the Piraí River samples were contaminants most frequently detected in sediment and SPM samples. Triclosan had the highest average proportion of SPM as opposed to in the aqueous phase (> 75%). Contaminants with acid functional groups showed, in general, a lower tendency to bind to particulate matter and sediments. In addition, hydrophobicity had an important effect on their environmental partitioning. The spatial distribution of contaminants along the Jundiaí River was mainly affected by the higher concentration of contaminants in water samples collected downstream from a sewage treatment plant (STP). The results obtained here clearly showed the importance of the analysis of some contaminants in the whole water, meaning both dissolved and particulate compartments in the water, and that the partitioning is ruled by a set of parameters associated to the physicochemical characteristics of contaminants and the matrix properties of the studied, which need be considered in an integrated approach to understand the fate of emerging chemical contaminants in aquatic environments.

  12. Genetic variants of serum butyrylcholinesterase in Chilean Mapuche Indians.

    Science.gov (United States)

    Acuña, M; Eaton, L; Ramírez, N R; Cifuentes, L; Llop, E

    2003-05-01

    We estimated the frequencies of serum butyrylcholinesterase (BChE) alleles in three tribes of Mapuche Indians from southern Chile, using enzymatic methods, and we estimated the frequency of allele BCHE*K in one tribe using primer reduced restriction analysis (PCR-PIRA). The three tribes have different degrees of European admixture, which is reflected in the observed frequencies of the atypical allele BCHE*A: 1.11% in Huilliches, 0.89% in Cuncos, and 0% in Pehuenches. This result is evidence in favor of the hypothesis that BCHE*A is absent in native Amerindians. The frequencies of BCHE*F were higher than in most reported studies (3.89%, 5.78%, and 4.41%, respectively). These results are probably due to an overestimation of the frequency of allele BCHE*F, since none of the 20 BCHE UF individuals (by the enzymatic test) individuals analyzed showed either of the two DNA base substitutions associated with this allele. Although enzymatic methods rarely detect the presence of allele BCHE*K, PCR-PIRA found the allele in an appreciable frequency (5.76%), although lower than that found in other ethnic groups. Since observed frequencies of unusual alleles correspond to estimated percentages of European admixture, it is likely that none of these unusual alleles were present in Mapuche Indians before the arrival of Europeans. Copyright 2003 Wiley-Liss, Inc.

  13. Selection for bulb maturity in onion Seleção para maturidade de bulbos em cebola

    Directory of Open Access Journals (Sweden)

    Antonio Ismael Inácio Cardoso

    2003-02-01

    Full Text Available It is possible to produce onions (Allium cepa all over the year in Brazil, but most of the Brazilian cultivars have poor quality bulbs, a fact that favours onion imports from Argentina, a producer of Valenciana type cultivars that does not bulb in Brazil, but please Brazilian consumers. To study the effect of selection for bulb maturity, seventeen half sib progenies selected for early maturity and twenty five for late maturity, from the intervarietal triple cross [Crioula x (Pira Ouro x Valenciana Sintetica 14] were grown, along with the triple cross itself and the cultivars Pira Ouro (short-day, Crioula (intermediate-day and Armada (long-day. A total of forty six treatments were tested in a randomized block design with three replications of 32 plants per plot. The progenies selected for earliness had cycles from 67 to 83 days, whereas those selected for lateness had cycles of 85 to 103 days. This difference was evident when comparisons were made for the percent thick neck bulbs, which varied from 0 to 6.2% and from 8.1 to 59.8% for the early and late progenies, respectively. High heritability estimates were obtained for all characters and they varied from 0.65 (thick neck percentage, in the late selection to 0.80 (average bulb weight, in the early selection. Progenies of higher bulb weight and maturity similar to the standard cultivars were obtained. Selection for maturity was highly efficient and the population selected for early maturity has potential to originate adapted cultivars, with bulb yield and quality superior to the available cultivars.Embora seja possível produzir cebola (Allium cepa o ano inteiro no Brasil, a maioria dos cultivares nacionais apresentam bulbos com baixa qualidade, o que proporcionou grande importação de cebola da Argentina, do tipo Valenciana, que não bulbifica no Brasil, mas que agradou os consumidores brasileiros. Para estudar o efeito da seleção para maturidade de bulbos baseada em progênies de meios irm

  14. Presence of two alternative kdr-like mutations, L1014F and L1014S, and a novel mutation, V1010L, in the voltage gated Na+ channel of Anopheles culicifacies from Orissa, India

    Directory of Open Access Journals (Sweden)

    Bhatt Rajendra M

    2010-05-01

    Full Text Available Abstract Background Knockdown resistance in insects resulting from mutation(s in the voltage gated Na+ channel (VGSC is one of the mechanisms of resistance against DDT and pyrethroids. Recently a point mutation leading to Leu-to-Phe substitution in the VGSC at residue 1014, a most common kdr mutation in insects, was reported in Anopheles culicifacies-a major malaria vector in the Indian subcontinent. This study reports the presence of two additional amino acid substitutions in the VGSC of an An. culicifacies population from Malkangiri district of Orissa, India. Methods Anopheles culicifacies sensu lato (s.l. samples, collected from a population of Malkangiri district of Orissa (India, were sequenced for part of the second transmembrane segment of VGSC and analyzed for the presence of non-synonymous mutations. A new primer introduced restriction analysis-PCR (PIRA-PCR was developed for the detection of the new mutation L1014S. The An. culicifacies population was genotyped for the presence of L1014F substitution by an amplification refractory mutation system (ARMS and for L1014S substitutions by using a new PIRA-PCR developed in this study. The results were validated through DNA sequencing. Results DNA sequencing of An. culicifacies individuals collected from district Malkangiri revealed the presence of three amino acid substitutions in the IIS6 transmembrane segments of VGSC, each one resulting from a single point mutation. Two alternative point mutations, 3042A>T transversion or 3041T>C transition, were found at residue L1014 leading to Leu (TTA-to-Phe (TTT or -Ser (TCA changes, respectively. A third and novel substitution, Val (GTG-to-Leu (TTG or CTG, was identified at residue V1010 resulting from either of the two transversions–3028G>T or 3028G>C. The L1014S substitution co-existed with V1010L in all the samples analyzed irrespective of the type of point mutation associated with the latter. The PIRA-PCR strategy developed for the

  15. Mujeres migrantes en un país en crisis

    Directory of Open Access Journals (Sweden)

    Giovanna Campani

    2013-10-01

    Full Text Available ¿Cuáles son los problemas que los migrantes, y especialmente las mujeres migrantes, enfrentan en Italia desde el inicio de la crisis económica, la que ha sido reforzada por las austeras políticas impuestas por el liderazgo germano de la Unión Europea? Datos recientes muestran que el desempleo está creciendo entre extranjeros, alcanzando el número de 318.000 personas en el segundo semestre de 2012 y de 385.000 en el primer semestre de 2013 sobre un total de 2.334.000 extranjeros activos. Además, estos datos indican que el porcentaje de desempleo es ahora más alto entre los extranjeros que entre los italianos: esta es una tendencia creciente, hasta 2010 ocurría lo contrario (Ministerio del Trabajo, 2013. Al mismo tiempo, la demanda por trabajo domestico, luego de una breve y limitada debacle en 2010 y 2011, está creciendo. Hay razones estructurales para esta paradoja.

  16. Influência de hábitos antrópicos na dispersão de Triatoma pseudomaculata Corrêa & Espínola, 1964, através de Mimosa tenuiflora (Willdenow (Mimosaceae no Estado do Ceará, Brasil

    Directory of Open Access Journals (Sweden)

    Freitas Simone Patrícia Carneiro

    2004-01-01

    Full Text Available Triatoma pseudomaculata foram capturados em entrecascas de Mimosa tenuiflora (jurema-preta em ecótopo silvestre de sete municípios do Estado do Ceará. Esta planta apresenta alta taxa de cobertura geográfica nas áreas de caatingas, sendo freqüentemente utilizada pela população rural. A presença de triatomíneos no peridomicílio, na região do Cariri, pode estar associada ao uso pela população da madeira de M. tenuiflora, quando trazida do ambiente silvestre, repleta de triatomíneos, facilitando conseqüentemente sua mobilização e dispersão.

  17. Fauna de Culicidae em municípios da zona rural do estado do Amazonas, com incidência de febre amarela

    Directory of Open Access Journals (Sweden)

    Fé Nelson Ferreira

    2003-01-01

    Full Text Available Em 1996, foi realizado um levantamento da fauna de Culicidae (coleta de adultos e imaturos em cinco dos dez municípios onde foram registrados 14 casos de febre amarela silvestre (Rio Preto da Eva, Iranduba, Manacapuru, Manaquiri e Careiro. Os mosquitos foram coletados utilizando-se armadilhas de luz CDC, inspeções domiciliares e captura com tubos coletores para isca humana. Foram identificadas entre adultos e imaturos 36 espécies de Culicidae, entre estas, nove foram encontradas apenas na fase imatura. Dentre os adultos, coletou-se espécies de Haemagogus janthinomys, Ha. leucocelaenus e Aedes fulvus, incluídas entre os vetores de febre amarela silvestre.

  18. Epidemiologia da doença de Chagas no Ceará VIII - estudo da infecção de animais por T. cruzi no município de Morada Nova

    Directory of Open Access Journals (Sweden)

    J. E. Alencar

    1977-02-01

    Full Text Available Foram examinados 1.368 mamíferos em ecótopos naturais ou artificiais: 443 cães com 2,5% positivos; 605 gatos com 0,7%, 65 roedores domésticos com 4,6%, 6 coelhos e 10 cobaias negativos. Dentre os animais silvestres, foram examinados 115 preás (Galea s. spixii com 2,3% positivos, 12 "cassacos" (Didelphis azarae dos quais 9 positivos; 5 quirópteros, 5 punáres (Cercomys c. laurentius e 3 pebas (Dasypus sexcinctus negativos. A amostra apresentada é suficiente para considerada a existência de ciclos doméstico e silvestre de T. cruzi na área estudada e considerada endêmica da Doença de Chagas.

  19. Estado de la diversidad de la flora vascular de los Pantanos de Villa (Lima - Perú

    Directory of Open Access Journals (Sweden)

    Dámaso W. Ramirez

    2011-05-01

    Full Text Available Se presentan los resultados del estudio de la flora vascular de los Pantanos de Villa realizadas en el 2007 y se analiza los cambios florísticos en los últimos años. Se registraron 47 especies silvestres comprendidas en 43 géneros y 27 familias. Las familias con mayor numero de especies fueron Poaceae (7, Cyperaceae (4 y Asteraceae (4. Se reportan 7 especies silvestres como nuevos registros para el humedal: Alternanthera pubiflora, Alternanthera halimifolia, Limnobium laevigatum, Colocasia esculenta, Rumex obtusifolius, Elodea potamogeton, Plantago major. Se encontraron 11 especies cultivadas en el ecosistema. En comparación con estudios anteriores, los resultados muestran una disminución en la riqueza florística, principalmente de las especies acuáticas. El análisis de similitud con anteriores estudios indica un cambio en la composición de la flora en el tiempo.

  20. Amblyomma dissimile (Acari: Ixodidae PARÁSITO DE Boa constrictor EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    Ana Torres M

    2009-08-01

    Full Text Available Objetivo. Describir algunas garrapatas encontradas en dos ejemplares de Boa constrictor, llevados al Centro de Atención y Valoración de Fauna Silvestre en Montería, Córdoba, Colombia. Materiales y métodos. Se recolectaron 37 garrapatas provenientes de dos individuos adultos de Boa constrictor, los parásitos fueron conservados en alcohol al 70% y posteriormente identificados mediante diversas claves taxonómicas. Resultados. Todas las garrapatas fueron identificadas como Amblyomma dissimile, de las cuales, 9 fueron hembras, 24 machos y 4 ninfas. Conclusiones. La identificación de ectoparásitos en especies de Boa c. constrictor contribuye a mantener adecuadamente esta especie en cautiverio y provee datos para establecer medidas profilácticas y tratamiento, igualmente, ayuda en el conocimiento de los agentes parasitarios de la fauna silvestre.

  1. Energy prices, multiple structural breaks, and efficient market hypothesis

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Chien-Chiang; Lee, Jun-De [Department of Applied Economics, National Chung Hsing University, Taichung (China)

    2009-04-15

    This paper investigates the efficient market hypothesis using total energy price and four kinds of various disaggregated energy prices - coal, oil, gas, and electricity - for OECD countries over the period 1978-2006. We employ a highly flexible panel data stationarity test of Carrion-i-Silvestre et al. [Carrion-i-Silvestre JL, Del Barrio-Castro T, Lopez-Bazo E. Breaking the panels: an application to GDP per capita. J Econometrics 2005;8:159-75], which incorporates multiple shifts in level and slope, thereby controlling for cross-sectional dependence through bootstrap methods. Overwhelming evidence in favor of the broken stationarity hypothesis is found, implying that energy prices are not characterized by an efficient market. Thus, it shows the presence of profitable arbitrage opportunities among energy prices. The estimated breaks are meaningful and coincide with the most critical events which affected the energy prices. (author)

  2. Diferença no tamanho de cascas de ovos de colônias de Panstrongylus megistus

    Directory of Open Access Journals (Sweden)

    Rosa João A da

    2003-01-01

    Full Text Available O objetivo do estudo foi avaliar as mensurações de cascas de ovos de duas colônias laboratoriais e uma silvestre de P. megistus. De cada uma das colônias, 50 cascas de ovos foram mensuradas por meio de microscópio estereoscópico e sistema de análise de imagem QWin. A análise estatística foi efetuada utilizando o teste t-Student, não pareado no programa INSTAT. A largura, o comprimento e o diâmetro da abertura opercular das cascas de ovos de uma colônia silvestre foram maiores que de duas colônias laboratoriais de P. megistus.

  3. Energy prices, multiple structural breaks, and efficient market hypothesis

    International Nuclear Information System (INIS)

    Lee, Chien-Chiang; Lee, Jun-De

    2009-01-01

    This paper investigates the efficient market hypothesis using total energy price and four kinds of various disaggregated energy prices - coal, oil, gas, and electricity - for OECD countries over the period 1978-2006. We employ a highly flexible panel data stationarity test of Carrion-i-Silvestre et al. [Carrion-i-Silvestre JL, Del Barrio-Castro T, Lopez-Bazo E. Breaking the panels: an application to GDP per capita. J Econometrics 2005;8:159-75], which incorporates multiple shifts in level and slope, thereby controlling for cross-sectional dependence through bootstrap methods. Overwhelming evidence in favor of the broken stationarity hypothesis is found, implying that energy prices are not characterized by an efficient market. Thus, it shows the presence of profitable arbitrage opportunities among energy prices. The estimated breaks are meaningful and coincide with the most critical events which affected the energy prices. (author)

  4. Aspectos críticos do controle da febre amarela no Brasil Aspectos críticos del control de la fiebre amarilla en Brasil Critical aspects of yellow fever control in Brazil

    Directory of Open Access Journals (Sweden)

    Pedro Luiz Tauil

    2010-06-01

    Full Text Available São apresentados aspectos epidemiológicos e do controle da febre amarela no Brasil, considerando os ciclos de transmissão silvestre e urbano. Sem registros de transmissão no Brasil desde 1942, houve casos de febre amarela urbana em 2008 no Paraguai, depois de mais de 50 anos sem essa ocorrência nas Américas. A redução do número dos casos silvestres e a manutenção da eliminação dos casos urbanos são os dois principais objetivos do controle da febre amarela no Brasil. Embora haja consenso quanto às medidas que devem ser tomadas nas áreas endêmicas para a forma silvestre, isso não ocorre em relação às áreas infestadas pelo Aedes aegypti. São discutidos argumentos favoráveis e contrários à expansão da área de vacinação. Há necessidade de estudos ambientais e entomológicos para o reconhecimento de áreas receptivas para transmissão silvestre, mesmo que estejam silentes há muitos anos.Se presentan aspectos epidemiológicos y del control de la fiebre amarilla en Brasil, considerando los ciclos de transmisión silvestre y urbana. Sin registros de transmisión en Brasil desde 1942, hubo casos de fiebre amarilla urbana en 2008 en Paraguay, después de más de 50 años sin ocurrir en las Américas. La reducción del número de casos silvestre y el mantenimiento de la eliminación de los casos urbanos son los dos principales objetivos del control de la fiebre amarilla en Brasil. A pesar de que exista consenso con respecto a las medidas que deben ser tomadas en las áreas endémicas para la forma silvestre, esto no ocurre con relación a las áreas infestadas por el Aedes aegypti. Son discutidos argumentos favorables y contrarios a la expansión del área de vacunación. Hay necesidad de estudios ambientales y entomológicos para el reconocimiento de áreas receptivas para transmisión silvestre, aunque se encuentren silentes desde hace muchos años.This paper presents epidemiological and control characteristics of yellow

  5. Analisis de la microbiota en suelos cultivados del Altiplano central

    OpenAIRE

    Sivila, R.; Hervé, Dominique

    2001-01-01

    Se estudio la poblacion microbina en una rotacion de cultivos con descanso, comun en el Altiplano Central boliviano. Se determino la presencia y densidad de cuatro grupos taxonomicos de microorganismos: bacterias; hongos, actinomicetos y esporas de las micorrizas arbusculares en el suelo rizosferico de cuatro cultivos de la rotacion (papa, quinua, cebada y avena); en las principales especies silvestres perennes (#Stipa ichu, Festuca dolichophylla, Baccharis incarum$) que colonizan las parcela...

  6. Autonomie et gestion communautaire des aires protégées de la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Rapports. Desarrollo de estrategias de autonomía y control ciudadano para la gestión descentralizada de áreas silvestres protegidas del Estado en la Región de La Araucanía de Chile y la Provincia de Neuquén de Argentina : informe final (Agosto 2008-Noviembre... Téléchargez le PDF. Études. Gobernanza Indígena: un ...

  7. Southeast Asia Report.

    Science.gov (United States)

    1985-09-12

    Minister of Justice Comments on New Criminal Code (Phan Hien; NHAN DAN, 2, 3 Jul 85) m Army Paper Discusses Induction Task of Localities...administrative code , the local executives are responsible for the maintenance of peace and order in their respective jurisdiction. It is necessary...Albay 9 days ago. He died clutching the Philipping national flag as a touching symbol of what he fought and died for. 58 But M/Sgt Isaias Silvestre

  8. Serological surveillance on South American wild canids for Neospora caninum

    Directory of Open Access Journals (Sweden)

    Melo C.B.

    2002-01-01

    Full Text Available Esse trabalho objetivou pesquisar anticorpos para Neospora caninum em amostras de soro de canídeos silvestres sul-americanos pela técnica de imunofluorescência indireta (IFI. As amostras foram coletadas de 48 lobos-guará (Chrysocyon brachyurus, provenientes de zoológicos e de vida livre e de dois cachorros-do-mato (Cerdocyon thous. Anticorpos para N. caninum não foram detectados nas amostras testadas.

  9. Ground Vehicle Navigation Using Magnetic Field Variation

    Science.gov (United States)

    2012-09-13

    points on the sphere to resolve the calibration parameters. This approach is nearly identical to 5 Vasconcelos [44]. Additionally, the composition of...possible. 1.1.5 Three-axis Magnetometer Calibration. Vasconcelos et al., addressed three-dimensional ellipsoid calibration techniques for...Strangway, David W. History of the Earth’s Magnetic Field. McGraw-Hill, Inc., New York, NY, 1970. 44. Vasconcelos , J.F., G. Elkaim, C. Silvestre, P

  10. Aspectos epidemiológicos da Leishmaniose Tegumentar Americana no município de Juína, Mato Grosso, Brasil = Epidemiological aspects of American Cutaneous Leishmaniasis in the city of Juína, Mato Grosso state, Brazil

    Directory of Open Access Journals (Sweden)

    França, Eduardo Luzia

    2009-01-01

    Conclusões: a análise dos dados revelou que a Leishmaniose Tegumentar Americana é uma parasitose importante no município de Juína. Os dados sugerem relação com a atividade laboral e um perfil de transmissão predominantemente silvestre, o que deve ser levado em conta ao definir medidas de controle da doença na região

  11. Brotes de rabia humana transmitida por vampiros en los municipios de Bajo y Alto Baudó, departamento del Chocó, Colombia 2004-2005

    Directory of Open Access Journals (Sweden)

    Jessika Valderrama

    2006-09-01

    Conclusiones. El brote de rabia humana en Bajo Baudó 2004 ha sido el de mayor magnitud reportado en Colombia. Este fue causado por vampiros, demostrando la amenaza que representa la rabia de especies silvestres para la salud pública, y la necesidad de implementar acciones para evitar su impacto en humanos. Se desconoce si existen vínculos entre este brote y el reportado en Alto Baudó seis meses después.

  12. Leposoma percarinatum (Müller, 1923 (Sauria: Gymnophthalmidae

    Directory of Open Access Journals (Sweden)

    Quinteros Muñoz, Oliver

    2008-04-01

    Full Text Available República de Bolivia, Departamento de Pando, Provincia Federico Román, Reserva de Vida Silvestre Bruno Racua, laguna Tucunaré (9º55'15,43" S, 65º20'37,36" O. Fecha de colección: 05/09/2007. Col.: Oliver Quinteros. Colección de vertebrados del Centro de Biodiversidad y Genética (CBG 356, Cochabamba, Bolivia. Un ejemplar hembra adulta (34,12 mm LHC.

  13. METHODOLOGY OF THE AUDIT OF ENVIRONMENTAL MANAGEMENT OF THE WETLANDSOF PERÚ WTHIN THE FRAMEWORK OF THE RAMSAR CONVENTION

    OpenAIRE

    Mogrovejo Espinoza, Martín Edmundo

    2014-01-01

    The study formulates how the technical/operative alignments of the Ramsar Convention facilitate the implementation of the environmental and audit management methodology of the wetlands of Peru. It’s an investigation on an explanatory level, developed in a sample of five wetlands: Reserva Nacional de Paracas (Ica), Refugio de Vida Silvestre Los Pantanos de Villa (Lima), Santuario Nacional Lagunas de Mejia (Arequipa), Santuario Nacional Manglares de Tumbes (Tumbes) y Reserva Nacional Junín ( Ju...

  14. Infecciones parasitarias del coyote, Canis latrans (Carnivora: Canidae en un Parque Nacional y una zona agrícola en Costa Rica

    Directory of Open Access Journals (Sweden)

    Carmen Niehaus

    2012-06-01

    Full Text Available Conforme las poblaciones humanas se expanden hacia los hábitats silvestres con sus mascotas y ganado, el potencial de transmisión de enfermedades hacia los animales silvestres -y viceversa- aumenta, y hace necesario identificar interacciones zoonóticas potenciales. Los cánidos domésticos y silvestres pueden funcionar como reservorios o diseminadores de enfermedades infecciosas (se incluyen parásitos, por lo que el coyote (Canis latrans puede también servir como indicador de la salud ecológica. Asimismo, se estudiaron los parásitos de 209 muestras de heces de coyotes en una zona mixta de área silvestre protegida y campo agrícola del Parque Nacional Volcán Irazú (PNVI en Costa Rica. La recolección fue realizada mensualmente durante un año en tres sub-áreas denominadas: Irazú (la más cercana al volcán, papales (por el cultivo de papas, y Prusia (un sector del PNVI. Entonces, se empleó examen directo y concentración mecánica, se obtuvo 36.84% de muestras positivas por al menos un helminto. La presencia de parásitos fue muy similar para ambos sectores boscosos del PNVI (33.3% en Prusia y 37.4% en Irazú, pero contrastó con el 63.63% observado en los papales. También, se identificaron uncinarias (probablemente Ancylostoma caninum, estrongilidios (posiblemente Strongyloides sp., Toxocara canis, Trichuris sp. y Taenia pisiformis, así como Hymenolepis diminuta, probablemente un parásito espurio proveniente de roedores ingeridos por los coyotes. Se comenta la importancia de estos primeros hallazgos y se concluye que las estaciones seca y lluviosa influyen en la presencia de los parásitos.

  15. El cuento americano: Güeno-mapu

    Directory of Open Access Journals (Sweden)

    Gabriel Carvajal

    1966-02-01

    Full Text Available Helechos. Susurran como el abanico del pavo real. Ahí están. En grupos o hileras sobre la huella rojiza que va al caserío. Junto a la selva. Lejos, adentro, a donde solo llegan a ramonear los vahuales. En la traba de pellines, ulmos y araucarias, rosal silvestre y zarza levantada en altura de lianas y cañaveral.

  16. Evolución de la música de cámara en Ecuador en el formato de quinteto de vientos maderas durante el siglo XX

    OpenAIRE

    Morocho Guamo, Paulo César

    2014-01-01

    El presente trabajo investigativo tiene por objeto el estudio formal de los quintetos para vientos maderas conformado por flauta, oboe, clarinete, fagot y corno francés, escritos por compositores académicos ecuatorianos durante el siglo XX, las obras que se encontrarán son: • Quinteto de Alientos. Compositor Luis Humberto Salgado. • Cinco miniaturas. Compositor Gerardo Guevara. • Danza profana. Compositor Marcelo Ruano. • Quinteto silvestre. Compositor Diego Luzuriaga. En este ...

  17. Occurrence of ticks on wild animals received and attended at the Parque Zoológico Municipal Quinzinho de Barros, Sorocaba, São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Thiago Fernandes Martins

    2015-12-01

    Full Text Available Os carrapatos são ectoparasitas da classe Arachnida que parasitam vertebrados terrestres, anfíbios, repteis, aves e mamíferos. O presente trabalho relata a ocorrência de carrapatos ixodídeos em animais silvestres recebidos e atendidos pelo Hospital Veterinário do Parque Zoológico Municipal Quinzinho de Barros, localizado no município de Sorocaba, estado de São Paulo, Brasil. De setembro de 1999 a maio de 2015, foram coletados carrapatos em animais silvestres da região de Sorocaba e de outros 20 municípios do interior do estado de São Paulo. Ao todo, foram identificados 43 larvas, 637 ninfas e 1.178 adultos (631 machos e 547 fêmeas, totalizando 1.858 exemplares de 14 espécies distintas de ixodídeos. Durante exames clínicos de rotina, foram inspecionadas duas espécies de repteis, uma espécie de ave e 11 espécies distintas de mamíferos de um total de 103 animais silvestres amostrados. Nos repteis foram identificados Amblyomma rotundatum, nas aves Amblyomma sculptum e nos mamíferos Amblyomma aureolatum, Amblyomma brasiliense, Amblyomma calcaratum, Amblyomma dubitatum, Amblyomma longirostre, Amblyomma nodosum, Amblyomma ovale, A. sculptum, Amblyomma varium, Ixodes aragaoi, Haemaphysalis juxtakochi, Rhipicephalus microplus e Dermacentor nitens. Este estudo relata os primeiros registros de fêmeas de A. rotundatum parasitando Hydromedusa tectifera e Oxyrhopus guibei, assim como ninfas de A. dubitatum e H. juxtakochi em Chrysocyon brachyurus, ninfas de A. brasiliense em Myrmecophaga tridactyla e Tamandua tetradactyla, além de ninfas de A. sculptum em Alouatta guariba e Sphiggurus villosus no país, demonstrando que os zoológicos são uma fonte de informação valiosa para o conhecimento parasitológico da fauna silvestre brasileira.

  18. Triatominos del departamento de San Martín, Perú, 2005

    OpenAIRE

    Cáceres, Abraham; Zavaleta, Gina; Ruiz, Juan; Vega, Silvia; Arevalo, Heriberto; Náquira, César

    2005-01-01

    La presencia de los triatominos transmisores de Trypanosoma cruzi y Trypanosoma rangeli ha sido reportada en todos los departamentos del Perú, excepto en Huancavelica. En el sudoeste, el Triatoma infestans es de hábitos domiciliarios y en la zona norte y nororiente hay numerosas especies de hábitos intradomiciliarios (Panstrongylus herreri, Rhodnius ecuadoriensis) aunque ocasionalmente ingresan a las viviendas (T. Carroni, P. geniculatus, P. chinai), mientras que otras son de hábitos silvestr...

  19. Las abejas de Porce familia colletidae (hymenoptera: apoidea notas y claves para los géneros presentes en la zona de influencia del embalse Porce ii.

    Directory of Open Access Journals (Sweden)

    Smith Pardo Allan H.

    1999-12-01

    Full Text Available Se presentan claves taxonómicas a nivel de género para la identificación de las abejas colletidas de la zona de Influencia del Embalse Porce II (Porce, Antioquía, Colombia S.A. Adicionalmente se presentan algunas notas para los géneros de colletidos capturados durante el inventario de las abejas silvestres de la zona.

  20. Proyecto de cooperación para el desarrollo: Fomento de prácticas apícolas en el Distrito de Muanza-Sofala-Mozambique

    OpenAIRE

    Nur Mário Alves, Rafael

    2016-01-01

    El presente proyecto surge como iniciativa frente a la pobreza, deforestación y pérdida de biodiversidad presentes en las inmediaciones del Parque Nacional de Gorongosa, en el centro de Mozambique, asociada a una agricultura poco desarrollada, que provoca que las comunidades rurales tengan que buscar medios de subsistencia ambientalmente insostenibles, destruyendo la flora y fauna silvestre, para su posterior transformación en productos de autoconsumo y comercializables. En la ...

  1. Estructura poblacional y variabilidad genética de Rhodnius prolixus (Hemiptera: Reduviidae procedente de diferentes áreas geográficas de Colombia

    Directory of Open Access Journals (Sweden)

    Diana Carolina López

    2007-01-01

    Resultados. R. prolixus presenta variabilidad genética moderada (Fst 0,057-0,15, entre las poblaciones domiciliadas se encontraron tasas de migración (Nm>1 que revelan flujo genético. Se encontró diferenciación genética de moderada-alta entre la población silvestre de Casanare y las poblaciones domésticas del centro del país (Tolima y Cundinamarca. Conclusión. Las poblaciones domiciliadas de R. prolixus son homogéneas debido a que existe flujo genético entre éstas; lo cual es favorable para el control químico, mientras que la población silvestre agrupa aparte de las domiciliadas. Se evidencia la necesidad de estudiar la estructura genética de los focos silvestres, sus posibles rutas de dispersión y el riesgo epidemiológico que representan.

  2. Distribución actual e importancia epidemiológica de las especies de triatominos (Reduviidae: Triatominae en Colombia

    Directory of Open Access Journals (Sweden)

    Jorge A. Molina

    2000-12-01

    Full Text Available Se presenta la distribución geográfica y la importancia epidemiológica en la transmisión de la enfermedad de Chagas de las 23 especies de triatominos presentes en Colombia, tomando como base los registros bibliográficos existentes en el pais y las colecciones de referencia del Laboratorio de Entomologia del Instituto Nacional de Salud y del Centro de Investigaciones en Microbiologia y Parasitologia Tropical de la Universidad de los Andes; además, se realiza un análisis de las condiciones ecológicas en las cuales han sido registrados triatominos en los paises con fronteras con Colombia para poder establecer la presencia de posibles especies que aún no se han registrado en nuestro pais. De esta manera. existe la posibilidad de tener en Colombia especies con hábitos silvestres como: Alberprosenia malheiroi. Belminus laportei y Cavernicola lenti, preentes todas ellas en los departamentos amazónicos; Triatoma nigromaculata en la Cordillera Oriental y con hábitos intradomiciliarios; Panstrongylus chinai con posibilidad de encontrarse en hábitats selváticos o en las viviendas de los colonos de la Amazonia debido a su atracción por la luz y Alberprosenia goyovargasien hábitats silvestres de la frontera con Venezuela. Se resalta la importancia de la vigilancia entomológica a nivel nacional como estrategia para reforzar los estudios de triatominos silvestres en Colombia.

  3. [The issue of medico-legal assessment of noise induced hearing loss: comparison of methods].

    Science.gov (United States)

    Bosio, D; Coggiola, M; Baracco, A; Andreis, P; Perrelli, F

    2011-01-01

    Audiogram classification is crucial for hearing protection of workers occupationally exposed to noise. The methods that have been proposed are based on two principles: the morphological evaluation of the audiometric curve (eg. Merluzzi-Pira-Bosio--MPB) or the average hearing loss on different frequencies (eg. Albera-Beatrice--AB). The purpose of this study was to classify audiograms compatible with chronic acoustic trauma performed at the Occupational Medicine Outpatient Clinic of CTO Hospital in Turin from 2004 to 2011 with the methods outlined in Guidelines published by SIMLII. A substantial agreement among the methods was observed. While MPB is the most appropriate method for secondary prevention, the AB would seem more appropriate for the verification of a permanent weakening that has to be reported to the competent legal authorities.

  4. Características estruturais de ácidos húmicos isolados de solos com adição de resíduos orgânicos de origem urbana: composição elementar, análise de RMN 13C e Pi-CG/EM

    OpenAIRE

    L. P. Canellas; A. A. Moraes; V. M. Rumjanek; M. R. Garcia; F. Guridi; G. A. Santos; A. C. X. Velloso; R. Braz-Filho

    2002-01-01

    Foram avaliadas as alterações nas características estruturais de ácidos húmicos (AH) decorrentes da adição de matéria orgânica de resíduos urbanos. Os AH foram extraídos da camada superficial (0-20 cm) de um Argissolo Vermelho-Amarelo (Seropédica, RJ) e de um Latossolo Vermelho Amarelo (Piraí, RJ), ambos tratados com o equivalente a 80 t ha-1 (em base seca) de composto de lixo urbano e lodo de estação de tratamento de esgotos. O tempo de incubação em laboratório foi de 24 semanas à temperatur...

  5. O CARAMUJO AFRICANO EM CONTEXTO ESCOLAR: AS PERCEPÇÕES DE ESTUDANTES DO ENSINO FUNDAMENTAL E O ESTUDO DA HELMINTOFAUNA ASSOCIADA AO CARAMUJO EM BARRA DO PIRAÍ (RJ

    Directory of Open Access Journals (Sweden)

    Zilene Moreira Pereira

    2012-01-01

    Full Text Available The study investigates elementary students’ perception of the species Achatina fulica (African snail and the risks this mollusc may pose to the population of Barra do Piraí – in the state of Rio de Janeiro. The research involved questionnaires, focus groups and field observations, besides A. fulica specimens parasitological analysis. The results indicated the presence of snails infected with nematodes of medical and veterinary interest in the locality. The students have a negative perception of the snail, and there is great difference between their perceptions and scientific knowledge. Based on the contributions of the perceptions study and of Meaningful Learning Theory, guidelines are suggested so that strategies for teaching the content regarding the African snail at school environment can be developed.

  6. What I wish I had in my stockroom

    Science.gov (United States)

    Sampere, Samuel

    2015-12-01

    Most new teachers walk into their new classroom territory and find at least some equipment. Perhaps there are items there that you don't recognize. One way to get those types of questions answered is to post a question and/or picture on the TAP-L (Teaching Apparatus List) listserv (see: http://www.pira-online.org for more information). Within a few short minutes, the sender will receive at least a couple of responses. But what if a new teacher walks into a totally empty prep room? Now that teacher is tasked with purchasing useful equipment, and we know that the opportunity for a similar acquisition in the near future is slim. So you better choose wisely! Whether my new stockroom is well equipped or completely empty, I would make sure to have the following six items in my arsenal.

  7. Edge stability and pedestal profile sensitivity of snowflake diverted equilibria in the TCV Tokamak

    International Nuclear Information System (INIS)

    Medvedev, S.Yu.; Ivanov, A.A.; Martynov, A.A.; Poshekhonov, Yu.Yu.; Behn, R.; Martin, Y.R.; Moret, J.M.; Piras, F.; Pitzschke, A.; Pochelon, A.; Sauter, O.; Villard, L.

    2010-01-01

    A second order null divertor (snowflake) has been successfully created and controlled in the TCV tokamak[1] (F. Piras et al., Plasma Phys. Control. Fusion, 2009). The results of ideal MHD edge stability computations show an enhancement of the edge stability properties of the snowflake equilibria compared to standard x-point configurations[2] (S. Yu. Medvedev et al., 36th EPS Conference on Plasma Physics, 2009). However, a sensitivity study of the stability limits to variations of the pedestal profiles is essential for making conclusions about possibilities of ELM control in snowflake plasmas. Variations of the edge stability and beta limits for several types of snowflake equilibria, different values of triangularity and various pedestal profiles are investigated (copyright 2010 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  8. The Provisional Irish Republican Army and the Development of Mortars

    Directory of Open Access Journals (Sweden)

    Gary Ackerman

    2016-03-01

    Full Text Available The Provisional Irish Republican Army (PIRA repeatedly showed itself to be one of the most inventive and adaptive of all the violent non-state actors who operated in the latter part of the twentieth century. Among its most innovative exploits was the PIRA’s successful development and fielding – spanning almost its entire operational lifetime – of improvised mortar systems. This chapter will trace the sustained development of mortars, including the underlying motivations for pursuing mortars as a complex engineering effort, the process by which the development took place and the underpinnings of its success. The discussion will show that the PIRA’s mortar development program was born out of tactical necessity but enabled by good organizational practices and the organization’s access to materials, expertise and places in which to leverage these.

  9. Cristiani ed Ebrei dopo la Shoah. Momenti e protagonisti dell’Amicizia ebraico-cristiana di Firenze (1945-1965

    Directory of Open Access Journals (Sweden)

    Elena Mazzini

    2014-04-01

    Full Text Available Il contributo punta a ricostruire la genesi e la storia dell’Amicizia ebraico-cristiana di Firenze (AEC, fondata nel capoluogo toscano nel 1950 con l’intento di promuovere un dialogo interreligioso fra ebrei e cristiani all’indomani dell’Olocausto. La periodizzazione proposta prende avvio dalla data della nascita della stessa associazione e si conclude con il 1965, anno della chiusura del Concilio Vaticano II, che decreta prospettive religiose nuove della Chiesa cattolica nei suoi rapporti con l’ebraismo. Nata per volontà di Arrigo Levasti, Giorgio La Pira, Ines Zilli, Giorgio Spini, Giacomo Devoto, Angelo Orvieto e Aldo Neppi Modona, l’Amicizia fiorentina rappresentava la sezione italiana dell’International Council of Christians and Jews e dell’Amitié judéo-chrétienne di Parigi, divenendo presto un luogo di attività feconde per il dialogo interreligioso in età pre-conciliare.

  10. A BWR Safety and Operability Improvements

    International Nuclear Information System (INIS)

    Sawyer, Craig D.

    1993-01-01

    The A BWR is the culmination of 30 years of design, development and operating experience of BWRs around the world. It represents across the board improvements is safety, operation and maintenance practices (O and M), economics, radiation exposure and rad waste generation. More than ten years and $20m5 went into the design and development of its new features, and it is now under construction in Japan. This paper concentrates on the safety and operability improvements. In the safety area, more than a decade improvement in core damage frequency (CDFR) has been assessed by formal PIRA techniques, with CDFR less than 10 -6 /year. Severe accident mitigation has also been formally addressed in the design. Plant operations were simplified by incorporation of better materials, optimum use of redundancy in mechanical and electrical equipment so that on-line maintenance can be performed, by better arrangements which account for required maintenance practices, and by an advanced control room

  11. La configuración de un modelo : los catafalcos madrileños durante el reinado de Felipe V

    Directory of Open Access Journals (Sweden)

    Victoria Soto Caba

    1989-01-01

    Full Text Available En el último tercio del siglo xvii la tendencia decorativista y la variedad tipológica fueron las características más acusadas de los aparatos provisionales de las exequias reales. Las tradiciones locales y los talleres barrocos mantuvieron ambos rasgos durante gran parte de la centuria siguiente. El tapizado ornamental recubrió túmulos en forma de torre, pira, templetes, baldaquinos... Estas estructuras heredadas apenas dejaron sitio para nuevas variantes arquitectónicas, por lo que se puede decir que el siglo xviii, al menos la primera mitad, contribuyó muy poco en el enriquecimiento del repertorio tipológico de los catafalcos reales.

  12. Avaliação da perda de mercúrio total em peixe antes e após os processos de fritura e cocção Determination of mercury losses in fish after cooking

    Directory of Open Access Journals (Sweden)

    Aricelso Maia LIMAVERDE FILHO

    1999-01-01

    Full Text Available A perda de mercúrio contido em músculo de peixes (Piraíba, Brachyplatystoma ssp; Traíra, Hoplias malabaricus submetidos a dois distintos processos de cozimento foi investigada. Os resultados mostraram perdas variando entre 0 e 30% (base seca, indicando que a maior parte do mercúrio foi retida. Assim, tais processos não protegem as populações, que deles se utilizam, contra a exposição por ingestão ao mercúrio originariamente contido na amostra "in natura".Mercury losses from flesh fish after two cooking process were investigated. Results showed losses ranging from 0 to 30% (dry weight basis. Such result indicates that fish consuming populations are not protected from mercury exposition by the studied cooking processes.

  13. Evidence of spotted fever group rickettsiae in state of Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    ROZENTAL Tatiana

    2002-01-01

    Full Text Available Ticks were obtained from dogs from February to September of 1999 at weekly intervals, in the County of Piraí, State of Rio de Janeiro. Four hundred seventy four ixodids were taxonomically identified, 103 Amblyomma cajennense, seven Amblyomma ovale, 209 Rhipicephalus sanguineus, and 155 Amblyomma sp. An hemolymph test associated with Giemsa's stain revealed two specimens in 163 ticks tested (R. sanguineus and Amblyomma sp, containing rickettsia-like organisms. Direct immunofluorescence verified the presence of spotted fever group rickettsia in one specimen of R. sanguineus. Considering the limited information on rickettsiosis in Brazil, principally in relation to the vectors involved in perpetuating it in foci, these preliminary results give us an idea on the importance of infection in ticks, allowing to expand our knowledge on this zoonosis.

  14. Características qualitativas de cultivares de cebola no sul de Minas Gerais Qualitative characteristics of onion cultivars in southern Minas Gerais State

    OpenAIRE

    Silvio Júlio de Rezende Chagas; Geraldo Milanez de Resende; Lair Victor Pereira

    2004-01-01

    Com o objetivo de determinar a composição físico-química e química de cultivares de cebola (Allium cepa L.), conduziu-se um ensaio na Fazenda Experimental de Lavras da EPAMIG, Lavras-MG, no período de março a setembro de 1995. O delineamento experimental foi de blocos ao acaso com quatro repetições e 6 tratamentos, constituídos pelas cultivares Baia Periforme, Crioula, Granex 33, Pira Ouro, Jubileu e Texas Grano 502. Após a cura, avaliaram-se o pH, sólidos solúveis e totais (%), acidez titulá...

  15. Características qualitativas de cultivares de cebola no sul de Minas Gerais

    OpenAIRE

    Chagas, Silvio Júlio de Rezende; Resende, Geraldo Milanez de; Pereira, Lair Victor

    2004-01-01

    Com o objetivo de determinar a composição físico-química e química de cultivares de cebola (Allium cepa L.), conduziu-se um ensaio na Fazenda Experimental de Lavras da EPAMIG, Lavras-MG, no período de março a setembro de 1995. O delineamento experimental foi de blocos ao acaso com quatro repetições e 6 tratamentos, constituídos pelas cultivares Baia Periforme, Crioula, Granex 33, Pira Ouro, Jubileu e Texas Grano 502. Após a cura, avaliaram-se o pH, sólidos solúveis e totais (%), acidez titulá...

  16. Photorhabdus insect-related (Pir) toxin-like genes in a plasmid of Vibrio parahaemolyticus, the causative agent of acute hepatopancreatic necrosis disease (AHPND) of shrimp

    Science.gov (United States)

    Han, Jee Eun; Tang, Kathy F. J.; Tran, Loc H.; Lightner, Donald V.

    2016-01-01

    The 69 kb plasmid pVPA3-1 was identified in Vibrio parahaemolyticus strain 13-028/A3 that can cause acute hepatopancreatic necrosis disease (AHPND). This disease is responsible for mass mortalities in farmed penaeid shrimp and is referred to as early mortality syndrome (EMS). The plasmid has a GC content of 45.9% with a copy number of 37 per bacterial cell as determined by comparative quantitative PCR analyses. It consists of 92 open reading frames that encode mobilization proteins, replication enzymes, transposases, virulence-associated proteins, and proteins similar to Photorhabdus insect-related (Pir) toxins. In V. parahaemolyticus, these Pir toxin-like proteins are encoded by 2 genes ( pirA- and pirB-like) located within a 3.5 kb fragment flanked with inverted repeats of a transposase-coding sequence (1 kb). The GC content of these 2 genes is only 38.2%, substantially lower than that of the rest of the plasmid, which suggests that these genes were recently acquired. Based on a proteomic analysis, the pirA-like (336 bp) and pirB-like (1317 bp) genes encode for 13 and 50 kDa proteins, respectively. In laboratory cultures of V. parahaemolyticus 13-028/A3, both proteins were secreted into the culture medium. We developed a duplex PCR diagnostic method, with a detection limit of 105 CFU ml−1 and targeting pirA- and pirB-like genes in this strain of V. parahaemolyticus. This PCR protocol can reliably detect AHPND-causing strains of V. parahaemolyticus and does not cross react with non-pathogenic strains or with other species of Vibrio isolated from shrimp ponds. PMID:25667334

  17. Application of iterative reconstruction in dynamic studies

    International Nuclear Information System (INIS)

    Meikle, S.R.

    1998-01-01

    Full text: The conventional approach to analysing dynamic tomographic data (SPECT or PET) is to reconstruct projections corresponding to each time interval separately and then fit a suitable tracer kinetic model to the dynamic sequence (method 1 ) . This approach assumes that the tracer distribution remains static during any given time interval and, for practical reasons, filtered back-projection (FBP) is the preferred reconstruction algorithm. However, alternative approaches exist which lend themselves to iterative algorithms, such as EM. One approach is to fit the model directly to the projection data, followed by EM reconstruction of the parameter estimates (method 2). This requires that the tracer model can be expressed as a linear function of the unknown model parameters. A third alternative is to incorporate the tracer model into the reconstruction algorithm (method 3). Such an extension was described during the early development of the EM algorithm, referred to as the EM parametric image reconstruction algorithm (EM-PIRA). We have investigated these various strategies for analysing dynamic data and their relative pros and cons. Tracer modelling was performed using a general model, referred to as spectral analysis, which makes no restriction on the number of physiological compartments and satisfies the linearity requirement of method 2. A kinetic software phantom was created and used to test the convergence and noise properties of the different approaches. In summary, method 2 is the most practical as it reduces the number of reconstructions by at least an order of magnitude and provides improved signal-to-noise ratios compared with method 1. EM-PIRA allows greater flexibility in the choice of parametric images and appears to have a regularising effect on convergence. Methods 2 and 3 are also better suited to dynamic scanning with a rotating camera, as they can potentially account for changes in tracer distribution between projections

  18. Characterization and PCR Detection Of Binary, Pir-Like Toxins from Vibrio parahaemolyticus Isolates that Cause Acute Hepatopancreatic Necrosis Disease (AHPND in Shrimp.

    Directory of Open Access Journals (Sweden)

    Ratchanok Sirikharin

    Full Text Available Unique isolates of Vibrio parahaemolyticus (VPAHPND have previously been identified as the causative agent of acute hepatopancreatic necrosis disease (AHPND in shrimp. AHPND is characterized by massive sloughing of tubule epithelial cells of the hepatopancreas (HP, proposed to be induced by soluble toxins released from VPAHPND that colonize the shrimp stomach. Since these toxins (produced in broth culture have been reported to cause AHPND pathology in reverse gavage bioassays with shrimp, we used ammonium sulfate precipitation to prepare protein fractions from broth cultures of VPAHPND isolates for screening by reverse gavage assays. The dialyzed 60% ammonium sulfate fraction caused high mortality within 24-48 hours post-administration, and histological analysis of the moribund shrimp showed typical massive sloughing of hepatopancreatic tubule epithelial cells characteristic of AHPND. Analysis of the active fraction by SDS-PAGE revealed two major bands at marker levels of approximately 16 kDa (ToxA and 50 kDa (ToxB. Mass spectrometry analysis followed by MASCOT analysis revealed that both proteins had similarity to hypothetical proteins of V. parahaemolyticus M0605 (contig034 GenBank accession no. JALL01000066.1 and similarity to known binary insecticidal toxins called 'Photorhabdus insect related' proteins A and B (Pir-A and Pir-B, respectively, produced by the symbiotic, nematode bacterium Photorhabdus luminescens. In in vivo tests, it was shown that recombinant ToxA and ToxB were both required in a dose dependent manner to cause AHPND pathology, indicating further similarity to Pir-A and -B. A single-step PCR method was designed for detection of the ToxA gene and was validated using 104 bacterial isolates consisting of 51 VPAHPND isolates, 34 non-AHPND VP isolates and 19 other isolates of bacteria commonly found in shrimp ponds (including other species of Vibrio and Photobacterium. The results showed 100% specificity and sensitivity for

  19. Comparison of some reproductive characteristics of farmed and wild white shrimp males Litopenaeus vannamei (Decapoda: Penaeidae

    Directory of Open Access Journals (Sweden)

    Sergio Rendón Rodríguez

    2007-03-01

    Full Text Available We rated some reproductive characteristics of white shrimp Litopenaeus vannamei (Boone, 1931 males using 46 farmed individuals (weighing 21.42±0.56 g and 40 wild individuals (weighing 36.10±0.72 g. In farmed shrimps, spermatophore mean weight was 8.94±0.51 mg; total mean sperm count was 3.90±0.27 x 10(6 in each spermatophore; and mean percentage of normal sperm was 86.9±0.37 %. In wild individuals, the respective values were 30.68±2.32 mg; 6.22±1.09 x 10(6; and 62.1±3.56 %. In both groups, the differences between right and left spermatophore were not significant (pResumen Se evaluaron características reproductivas como peso del espermatóforo, número de espermatozoides y porcentaje de espermatozoides normales en 86 organismos de camarón blanco (Litopenaeus vannamei. de éstos, 46 individuos provinieron de estanques de cultivo con un peso de 21.42±0.56 g y el resto, 40, silvestres con un peso de 36.10±0.72 g. En los camarones cultivados, el peso de los espermatóforos fue de 8.94±0.51 mg; el número total de espermatozoides en cada espermatóforo fue de 3.90±0.27 x 10(6; y el porcentaje de espermatozoides normales fue de 86.9±0.37 %. En los silvestres, los valores respectivos fueron de 30.68±2.32 mg; 6.22±1.09 x 10(6; y 62.1±3.56 %. En ambos grupos, las diferencias entre los espermatóforos derecho e izquierdo no fueron estadísticamente diferentes (p<0.01. Las diferencias en el peso de los espermatóforos y el porcentaje de espermatozoides normales, entre los camarones cultivados y silvestres, fueron significativas (p<0.01; sin embargo, en el número de espermatozoides tales diferencias no fueron significativas (p<0.01. La relación entre el peso del espermatóforo (Ws y el peso de los individuos (Wo fue Ws (mg=1.23(Wo-17.34 (r²=0.89, en camarones cultivados; y Ws (mg=2.57(Wo-60.04 (r²=0.64, en los silvestres. En organismos cultivados, la relación entre el número de espermatozoides (Cs y el peso de los individuos (Wo fue

  20. El emprendimiento social: una comparativa entre España y países sudamericanos

    Directory of Open Access Journals (Sweden)

    Catalina Nicolás Martínez

    2012-07-01

    Full Text Available La crisis global que sufrimos en la actualidad está haciendo que las labores realizadas por las empresas sociales sean imprescindibles para alcanzar una sociedad igualitaria, eficiente y justa. El número empresas sociales va creciendo año tras año, atendiendo problemas sociales generalmente olvidados por las instituciones. Los estudios empíricos que profundizan en el conocimiento de este tipo de emprendimiento social son escasos. Este trabajo, bajo el marco del proyecto Global Entrepreneurship Monitor (GEM, analiza la influencia de una serie de variables objetivas y cognitivas del emprendedor social, sobre una muestra constituida por emprendedores sociales en España y en diversos países sudamericanos.

  1. Gestión de calidad de las empresas comercializadoras de agua de mesa de la provincia de San Martin

    OpenAIRE

    Reátegui Vela, Aldo Omar

    2011-01-01

    Las ventas y el consumo de agua embotellada se han incrementado drásticamente en los últimos años. De 1988 a 2009, las ventas de agua embotellada a nivel mundial se han más que cuadruplicado a más de 131 millones de metros cúbicos anuales. Las ventas de agua embotellada en todo el mundo están aumentando a razón de 6% por año, mientras que el volumen de las bebidas de fruta que se consume es cada vez menos del 2% anual y venta de cerveza y la venta de refrescos están creciendo a menos del 1% a...

  2. Residencia Universitaria + Centro de Producción Cultural en Edimburgo

    OpenAIRE

    García Blaya, Paula

    2018-01-01

    EDIMBURGO: DATOS DEMOGRÁFICOS. Edimburgo es la ciudad que más está creciendo en Escocia desde hace varios años. En el último censo, realizado en el año 2011, se puso de manifiesto que la población había crecido un 6,2% entre 2001-2011, y este aumento ha ido incrementándose en los últimos años; se espera que la población crezca, entre 2012-2037, más que cualquier otra ciudad en el Reino Unido. Esto se debe, principalmente, al crecimiento de población extranjera, que ha pasado de ser el 8% de l...

  3. La reciente narrative Espaňola en el context postmoderno

    Directory of Open Access Journals (Sweden)

    Yvonna Vaňková

    2001-12-01

    Full Text Available Año tras año está creciendo la cantidad de biografia, escrita desde diversas fuentes, per­ spectivas y ramas del saber sobre lo que, en estas últimas décadas del siglo XX, se ha denominado posmodernidad/posmodernismo. Este fenómeno es tratado y debatido en numerosos articulos y volúmenes monográficos, en congresos, seminarios y reuniones científicas, abordado desde puntos de vista especializados o de forma interdisciplinar. Los teóricos más destacados y tan diferentes entre si como Habermas, Sontag, Lyotard, Vattimo, Foucault, Derrida o Jameson, desde posiciones distintas y utilizando diferentes planteamientos, intentan proporcionarnos las claves de comprensión y un sistema mas o menos adecuado para orientarnos mejor en el mundo contemporaneo.

  4. Capítulo 2. Introducción, epidemiología de la falla cardiaca e historia de las clínicas de falla cardiaca en Colombia

    Directory of Open Access Journals (Sweden)

    Efraín Gómez

    2016-03-01

    Conclusión: Las clínicas de falla cardiaca surgieron en Colombia en 1985. Desde entonces se cuenta con varios programas en ciudades como Bogotá, Medellín, Cali y Bucaramanga que ofrecen la opción de seguimiento multidisciplinario por Enfermería y Cardiología, e incluso muchas de ellas tienen programas de trasplante de corazón. Sin embargo, el reto actual para todos los programas es continuar creciendo e integrándose con los niveles básicos de atención para permitir intervenir desde la prevención, el diagnóstico temprano y el tratamiento adecuado de la falla cardiaca.

  5. Comunicación 2.0, visibilidad e interactividad: fundamentos de la imagen corporativa de las Universidades Públicas de Madrid en YouTube

    OpenAIRE

    Oliva Marañón, Carlos

    2012-01-01

    En los últimos años, el marketing en la Educación Superior ha ido creciendo en interés no sólo por su valor económico y comercial, sino por su carácter estratégico y por la promoción, la formación y el fortalecimiento de la comunicación de la marca Universidad. La plataforma YouTube se ha posicionado como un medio audiovisual de referencia en la que el usuario decide qué contenidos quiere ver, dónde y cuándo. Los objetivos de esta investigación son analizar la Publicidad Institucional Audi...

  6. La “defensa social”. Pugnas y competencias en torno a la mano de obra en el Oriente Boliviano, 1890-1910.

    Directory of Open Access Journals (Sweden)

    Ana María Lema Garrett

    2010-01-01

    la región amazónica boliviana, al norte del país, suscitó profundos cambios en otros departamentos y, entre otras cuestiones, en el mercado laboral. Los departamentos de Beni y de Santa Cruz se constituyeron entonces en reservorios de mano de obra y el flujo migratorio hacia las regiones gomeras del norte fue creciendo proporcionalmente a las necesidades de los empresarios gomeros. Sin embargo, las regiones de origen, y específicamente Santa Cruz, reaccionaron en contra de este “vaciamiento”, desarrollando estrategias para controlar las migraciones o, eventualmente, frenarlas. Este proceso fue acompañado por el despliegue de varias normas novedosas en el ámbito laboral, producto de un debate parlamentario en torno al tema de las migraciones.

  7. Industrias, distritos, instituciones y escenas : tipología de clústeres culturales en Barcelona.

    OpenAIRE

    Rius-Ulldemolins, Joaquim; Zarlenga, Matías I.

    2014-01-01

    En los últimos veinte años ha ido creciendo en el ámbito de las ciencias sociales el interés por el análisis de la dinámica territorial de la cultura y en particular su tendencia a la clusterización. La mayor parte de la literatura sobre el tema analiza los clústeres culturales entendiéndolos como un solo tipo y desde la dimensión de la planificación urbana o los impactos económicos. No obstante, cada vez se toma más consciencia de la importancia de la naturaleza de la actividad y de las diná...

  8. El fundamentalismo islámico en América Latina.

    OpenAIRE

    Rosemberg Fuentes, Velvet

    2018-01-01

    238 p. El islam, aunado al cristianismo, budismo, judaísmo e hinduismo entre otros, forma parte de los sistemas religiosos que cuentan con un gran número de seguidores en el mundo. Con el correr de los años el Islam ha ido ganando una gran cantidad de adeptos alrededor del orbe y día con día continúa creciendo. Los musulmanes se han expandido a lo largo del planeta y con ellos el Islam como un sistema de vida que va más allá del ámbito religioso. Para 2009, según Pew Research Center 0.3 po...

  9. Pentecostalismo en contextos rurales de violencia. El caso de El Garzal, sur de Bolívar, Colombia

    Directory of Open Access Journals (Sweden)

    William Mauricio Beltrán

    2016-01-01

    Full Text Available Como en el resto de Colombia, el movimiento pentecostal está creciendo aceleradamente en los espacios rurales y en las zonas golpeadas por el conflicto armado. Este ar-tículo explora, por medio de un estudio de caso, algunos de los impactos económicos y políticos de este proceso. En particular, se pregunta por la capacidad de las comu-nidades pentecostales de constituirse en espacios de organización social para hacer frente a la precariedad económica y a las amenazas propias del conflicto armado co-lombiano (secuestros, masacres y desplaza-miento forzado. Según el caso estudiado, las comunidades pentecostales pueden fa-cilitar la asociación de campesinos para el desarrollo de emprendimientos productivos y para la organización política desde la base, especialmente en procesos de resistencia pacífica.

  10. EVALUACIÓN DE LA TELEVISIÓN INTERACTIVA DESDE UNA PERSPECTIVA DE USABILIDAD: CASO PRÁCTICO

    Directory of Open Access Journals (Sweden)

    César Alberto Collazos Ordoñez

    2009-01-01

    Full Text Available La televisión interactiva ha ido creciendo en popularidad, en poco tiempo esta tecnología estará en nuestros hogares. A diferencia de la televisión analógica, la televisión digital posibilita la transformación de televidentes pasivos en activos con la capacidad de interactuar con nuevos servicios superpuestos sobre los contenidos y novedosas formas de negocio. Uno de los aspectos más importantes a analizar en este nuevo estilo interactivo es su usabilidad. Este trabajo presenta una pauta para evaluar la usabilidad de este tipo de servicios. Por último, se presentan los resultados de un caso práctico.

  11. La mujer y la investigación en tecnología educativa: Análisis de su presencia en la autoría de artículos científicos

    OpenAIRE

    Julio CABERO ALMENARA; Verónica MARÍN DÍAZ; Ana Isabel VÁZQUEZ MARTÍNEZ

    2011-01-01

    La figura de la mujer en el mundo de la tecnología ha ido creciendo poco a poco en las últimas décadas, reflejándose esta circunstancia en las publicaciones derivadas de sus trabajos tanto teóricos como investigadores. El presente artículo muestra la presencia del género femenino en la publicación de artículos realizados en la revista Píxel-Bit, Revista de Medios y Educación, a lo largo de sus 38 números de edición. Para la realización del mismo se ha empleado un sistema categorial, previame...

  12. La mujer y la investigación en tecnología educativa: Análisis de su presencia en la autoría de artículos científicos Women and research in educational technology. Analysis of its presence in the author of scientific papers

    OpenAIRE

    Julio CABERO ALMENARA; Verónica MARÍN DÍAZ; Ana Isabel VÁZQUEZ MARTÍNEZ

    2011-01-01

    La figura de la mujer en el mundo de la tecnología ha ido creciendo poco a poco en las últimas décadas, reflejándose esta circunstancia en las publicaciones derivadas de sus trabajos tanto teóricos como investigadores. El presente artículo muestra la presencia del género femenino en la publicación de artículos realizados en la revista Píxel-Bit, Revista de Medios y Educación, a lo largo de sus 38 números de edición. Para la realización del mismo se ha empleado un sistema categorial, previame...

  13. UN SEGMENTO DEL TURISMO INTERNACIONAL EN AUGE: EL TURISMO DE CAZA

    Directory of Open Access Journals (Sweden)

    Juan Ignacio Rengifo Gallego

    2008-01-01

    Full Text Available El número de turistas internacionales viene creciendo de forma continuada desde que existen fuentes estadísticas. Este crecimiento, que no sólo ha sido cuantitativo, sino espacial, ha ido acompañado de una segmentación del mercado en función de las motivaciones. Entre estos segmentos se halla el turismo cinegético, modalidad que ha experimentado un importante crecimiento en los últimos años por diversos motivos. Este incremento ha ido asociado a la movilidad de un porcentaje importante de cazadores de Europa y Estados Unidos, a la existencia de una gran variedad de especies cinegéticas en el mundo que se distribuyen de forma irregular por el territorio y al desarrollo de un entramado empresarial que participa en la comercialización de la caza.

  14. Cervecería Artesanal, Mela`s Craft Beer : trabajo de Grado en emprendimiento

    OpenAIRE

    Manotas, Eduardo Alejandro

    2017-01-01

    En Colombia, el consumo de cerveza viene creciendo a pasos agigantados, nada más en los últimos 4 años pasamos de ser el octavo país en consumo per cápita de cerveza en Latinoamérica con 45 Litros a ser el tercero con un consumo de 58Lt. Al año. EL crecimiento de Bavaria se ha sostenido alrededor de los 18 puntos porcentuales y el de la cerveza artesanal esta aproximadamente en un 40% año a año. Mela´s Craft Beer nace bajo la necesidad de traer al país cerveza de calidad mundial como no ex...

  15. Control de un generador doblemente alimentado para turbinas eólicas

    OpenAIRE

    Gamarra Rodríguez, Isabel

    2009-01-01

    En los últimos años se está produciendo un crecimiento de demanda energética y un aumento de los niveles de contaminación, debido en parte a la industrialización de países en vías de desarrollo. Para controlar la problemática actual y contribuir al desarrollo sostenible se hace uso, cada vez más, de sistemas de conversión eléctrica mediante fuentes renovables. En particular una de ellas está sufriendo un aumento considerable y se prevé seguirá creciendo, la energía eólica. ...

  16. Influencia de la corrupción en la implantación de la ISO 9001

    OpenAIRE

    Olga Rodriguez Arnaldo; Angel R. Martinez Lorente

    2014-01-01

    En las últimas dos décadas, el número de empresas certificadas por ISO 9001 ha ido creciendo constantemente llegando a finales de 2011 a más de 1,1 millones en todo el mundo (ISO, 2012). Sin embargo, la distribución de certificados entre los países no coincide con el peso que cada uno tiene en la economía global. Este artículo comienza con una breve revisión de la literatura sobre las razones por las que las empresas implantan un sistema de gestión que se ajusta a la norma ISO 9001. Esta revi...

  17. Reconocimiento de una plataforma para aterrizaje de UAV mediante procesamiento de imágenes

    OpenAIRE

    Álvarez Piñeiro, Emilio

    2016-01-01

    En el año 2016 se vendieron en EE.UU más de un millón de Unmanned Aerial Vehicles (UAVs, Vehículos aéreos no tripulados), casi el doble que el año anterior, país del que se dispone de información. Para el año 2020 se estima que este mercado alcance los 5.600 millones de dólares en todo el mundo, creciendo a un ritmo del 30% anual. Este crecimiento demuestra que existe un mercado en expansión con muchas y diversas oportunidades de investigación. El rango de aplicaciones en los que se utiliz...

  18. Sistema de prototipos para control numérico

    Directory of Open Access Journals (Sweden)

    Abdón Sánchez Sossa

    1992-05-01

    Full Text Available La mejor utilización de equipos de alta tecnología implica el contar con el adecuado entrenamiento. La conformaci6n del Grupo de Control Numérico Computarizado de Ingenierfa de Sistemas en 1987, pionero, al permitir canalizar y consolidar en tres cursos electivos interdisciplinarios una respuesta a las inquietudes académico-docentes de apoyo al sector manufacturero. El desarrollo de varios programas, cuya complejidad ha venido creciendo con el tiempo, permitió explorar la aplicabilidad de los conceptos presentados en clase y sirvió de vinculo con la realidad Nacional de manera activa y comprometida, con el desarrollo del país. Los programas descritos en este trabajo son el resultado de muchas horas de labor y realizados contando con un exiguo presupuesto.

  19. Estudio teórico del comportamiento no lineal de losas de cimentación. Obtención de un método simplificado para la determinación del coeficiente de balasto y de los esfuerzos en losas de cimentación con geometría regular

    OpenAIRE

    Arroyo Portero, Juan Carlos

    2017-01-01

    Los métodos de análisis de losas de cimentación utilizados en la mayoría de los proyectos, desde Winkler hasta hoy, utilizan la hipótesis de relación lineal entre el asiento y la presión, denominada balasto. También desde hace tiempo, se sabe que esta relación no es cierta ni siquiera en todos los puntos de una misma losa en un terreno homogéneo, cargada con una carga uniforme, porque la relación real entre la presión y el asiento va creciendo del centro a los bordes. Sin embargo, e...

  20. Heterogeneity of Human Melanoma Cell Lines: a quantitative study of protein and mRNA expression profiles using Flow Cytometry and Real time PCR

    OpenAIRE

    Norte Pinto, Sandra Cristina

    2015-01-01

    El melanoma es el tipo de cáncer de piel más agresivo. Ocurre en los melanocitos, células productoras de melanina ubicadas en la capa inferior de la epidermis, en la piel. El melanoma puede propagarse a través del tejido creciendo en áreas cercanas. Cuando las células tumorales se separan del tumor primario y viajan a través del sistema linfático o de la sangre para otras partes del cuerpo donde se establecen y empiezan a formar un tumor metastásico, se denomina metástasis. La metástasis gene...

  1. Mexican Immigrants and Temporary Residents in Canada: Current Knowledge and Future Research

    Directory of Open Access Journals (Sweden)

    Richard E. Mueller

    2005-01-01

    Full Text Available La migración de mexicanos a Canadá, aunque es un fenómeno reciente, ha tenido uno de los incrementos más significativos entre los movimientos de personas de América Latina. Desde mediados de los noventa, el número de mexicanos en Canadá ha estado creciendo rápidamente como resultado del retorno de los descendientes de la población menonita que emigró a México y de las disposiciones del Tratado de Libre Comercio de América del Norte (tlcan, que facilita el ingreso de ciudadanos mexicanos. En este artículo se examina el número de mexicanos en Canadá, el tiempo de su ingreso y el número de migrantes temporales admitidos, y sugiere áreas de investigación para el futuro.

  2. Talento emprendedor, inteligencia, creatividad y sistema educativo

    Directory of Open Access Journals (Sweden)

    Mariano Gutiérrez Tapias

    2014-01-01

    Full Text Available En este artículo, pretendemos realizar un sencillo análisis de términos relacionados con el talento, el emprendimiento y la creatividad por entender que dichos conceptos deben estar presentes en aquellas sociedades que pretenden seguir creciendo en lo cultural, en lo social y en lo económico. Ya decía Einstein que es muy difícil encontrar niños que sigan siendo creativos al terminar la escuela. Este reto debe afrontarlo el sistema educativo si quiere ser de utilidad a la sociedad, favorecer personas críticas y creativas, con pensamientos divergentes, capaces de aprender y desaprender, de reinventarse varias veces a lo largo de su vida.

  3. PROPUESTAS PARA EL DESARROLLO Y COMERCIALIZACIÓN DEL TURISMO ORNITOLÓGICO EN EXTREMADURA

    Directory of Open Access Journals (Sweden)

    José Manuel Hernández Mogollón

    2011-01-01

    Full Text Available El turismo ornitológico es una de las grandes apuestas en el desarrollo turístico de Extremadura dada su riqueza en aves. El número de empresas enfocadas a este segmento está creciendo, las agencias de viajes ya incluyen estos paquetes en sus programaciones y la administración turística regional promueve eventos como la Feria Internacional de Turismo Ornitológico (FIO en Monfragüe, considerado punto de referencia mundial. Este trabajo trata de poner de manifiesto la relevancia de Extremadura como destino de turismo ornitológico aportando propuestas para su desarrollo y comercialización.

  4. ESTUDIOS EMBRIOLOGICOS Y CITOLOGICOS EN LA YERBA MATE ILEX PARAGUARIENSIS (AQUIFOLIACEAE

    Directory of Open Access Journals (Sweden)

    Cesar Otto Niklas

    1987-01-01

    Full Text Available El recuento cromosómico de Ilex paraguariensis St. Hil. confirmó el número 2n = 40 para todo el material estudiado. En el análisis de la meiosis se comprobó que tiene un comportamiento normal, presentando 20 II. El polen analizado presentó cerca de 100% de fertilidad. Se estableció que el saco embrionario es del tipo Polygonum. Cuando la fruta está madura, los embriones se encuentran en diferentes etapas: globulares 2,6%, corazón 70,24%, post corazón 23,3%; torpedo 2,62% y maduros 0,96%. Estos embriones seguen creciendo cuando la semilla está en condiciones para germinar, esta es la razón del lento desarrollo observado en la germinación.

  5. Hifenaciones instrumentales entre la cromatografía líquida, diferentes sistemas detectores y nuevos métodos de pretratamiento de muestra para la determinación de vitaminas en alimentos

    OpenAIRE

    Bravo Bravo, María de los Ángeles

    2013-01-01

    El Objetivo Principal de esta Tesis Doctoral es desarrollar nuevos métodos analíticos para la determinación de vitaminas, constituyentes esenciales en la dieta humana. La Cromatografía Líquida (LC) combinada en línea con Espectrometría de Masas (MS) es una de las metodologías analíticas más sensibles y selectivas, y la aplicación de esta técnica está creciendo rápidamente en análisis de alimentos. Dependiendo de las estructuras químicas y características analíticas de los grupos de vitamin...

  6. Terapias alternativas contra el cáncer basadas en la aplicación de campos eléctricos

    OpenAIRE

    Marshall, Guillermo Ricardo; Suárez, Cecilia

    2017-01-01

    El cáncer es la segunda causa de muerte por enfermedad en el mundo y su incidencia sigue creciendo con el aumento de la contaminación y del envejecimiento del promedio poblacional. La Argentina no es la excepción, como lo muestran las estadísticas del Ministerio de Salud (Estadísticas Vitales de 2002 a 2006). Además de un problema médico, el cáncer es un problema económico: el impacto en la economía es enorme y la tendencia actual en los países centrales es invertir recursos en investigación,...

  7. Marketing Relacional como Factor para la Competitividad

    Directory of Open Access Journals (Sweden)

    Francisca Sánchez de Dusso

    2009-12-01

    Full Text Available Durante los últimos años ha venido creciendo el interés por el estudio del marketing relacional focalizado en el establecimiento de relaciones a largo plazo con los consumidores, dejando atrás al concepto del marketing desde una perspectiva sólo transaccional. Sin embargo muy poco ha sido investigado sobre la aplicación de este nuevo paradigma en empresas de mediana y pequeña envergadura. El objetivo del presente trabajo es describir cómo el marketing relacional puede contribuir al desarrollo de las pequeñas y medianas empresas de nuestra región. Este artículo se enmarca en un estudio mayor en el que se realizará una bajada empírica.

  8. Modelización del crecimiento de una población microbiana en medio líquido y su implicación en el estudio de la morfología celular a través del análisis digital de imágenes

    Directory of Open Access Journals (Sweden)

    Ángel Viteri

    2017-08-01

    Full Text Available Cuando la levadura crece en un medio líquido rico en nutrientes genera una curva de crecimiento que presenta principalmente tres fases: fase de adaptación (o fase lag, fase exponencial (o fase log, y fase estacionaria. El modelo de Buchanan es un modelo lineal a trozos, simple pero suficientemente bueno para obtener estimaciones de los principales parámetros cinéticos de crecimiento microbiano. La morfometría de las levaduras que se reproducen por gemación (con células madre y células hija informa sobre el estado de las poblaciones y su capacidad productiva. Se han analizado de forma conjunta resultados experimentales en relación al número de células de S. cerevisiae creciendo en un medio de cultivo líquido cerrado con glucosa y con dos concentraciones diferentes de oxígeno (condiciones aerobias y microaerófilas, y un conjunto de imágenes digitales tomadas de estas células creciendo. Las distribuciones de valores obtenidos para los parámetros morfológicos de las células (área, perímetro, diámetro mayor, diámetro menor, circularidad y elongación se han relacionado con las distintas fases de crecimiento identificadas con el modelo Buchanan ajustado. La utilización de un modelo de crecimiento poblacional y los parámetros cinéticos estimados junto con el análisis de imágenes digitales de células individuales ha generado una aproximación muy atractiva del sistema, permitiendo conjugar conceptos matemáticos y biológicos a la vez que realizar un estudio a dos niveles distintos del sistema, a nivel poblacional y a nivel individual.

  9. Acoustic courtship songs in males of the fruit fly Anastrepha ludens (Diptera: Tephritidae associated with geography, mass rearing and courtship success

    Directory of Open Access Journals (Sweden)

    R.D Briceño

    2009-11-01

    Full Text Available The Sterile Insect Technique (SIT has been used successfully to control or eradicate fruit flies. The commonly observed inferiority of mass-reared males, compared with wild males, when they are paired with wild females, is apparently due to their inadequate courtship. Anastrepha ludens males produce two types of wing vibration during courtship and mating, the "calling sound" and the "premating or precopulatory sound". There were clear differences in the calling songs between successful and unsuccessful courtships in sterile (irradiated and fertile Mexican flies. Among sterile flies, successful males produce longer buzzes, shorter interpulses and a higher power spectrum in the signal. Fertile flies showed the same trend. For mating songs a significant difference occurred in two parameters: power spectrum between sterile and fertile flies with respect to the type of song, and the signal duration and intensity were greater in non-irradiated flies. Calling songs of wild flies compared with laboratory grown flies from Mexico had shorter interpulses, longer pulses, and a greater power spectrum. However, in the case of premating songs, the only difference was in the intensity, which was significantly greater in wild males. An unexpected result was not observing pulses during pheromone deposition in wild males from Costa Rica. Comparing the premating songs of wild flies from Costa Rica and Mexico, no significant differences were observed in the duration, and the intensity of the signal was slightly greater in flies from Mexico. Rev. Biol. Trop. 57 (Suppl. 1: 257-265. Epub 2009 November 30.La técnica estéril del insecto (SIT se ha utilizado con éxito para controlar o para suprimir las moscas de fruta y su impacto en los cultivos. La inferioridad comúnmente observada de machos criados masivamente, comparada con los machos silvestres, cuando se aparean con las hembras silvestres es al parecer debido a su inadecuado cortejo. Los machos de Anastrepha

  10. DIVERSIDAD Y DISTRIBUCIÓN DE LAS Passifloraceae EN EL DEPARTAMENTO DEL HUILA EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    John Ocampo Pérez

    2013-09-01

    Full Text Available Colombia es el país con mayor diversidad de Passifloraceae con 170 especies reportadas, tanto en formas silvestres como cultivadas. Sin embargo, existen zonas en el país donde esta riqueza ha sido poco explorada, como el departamento del Huila en el suroriente de la zona andina. Por esta razón, se revisaron las listas de inventarios con el objetivo de actualizar y establecer la distribución espacial de las especies en esta región con base en registros de herbario, literatura y datos de campo, para proponer estrategias de conservación. Un total de 26 especies pertenecientes al género Passiflora L. son registradas en el Huila entre los 1500 y 2500 msnm. Ocho de las especies son cultivadas y las otras 18 silvestres, se localizan principalmente en bordes de caminos y bosques secundarios. El bajo número de registros y de especies presentes en este departamento es el reflejo de la carencia de iniciativas de investigación sobre la biodiversidad florística. Lo anterior sugiere que esta región puede ser el escenario de muchas especies desconocidas en zonas poco o no exploradas. Por esta razón, la conservación in situ y de sus hábitats es una tarea urgente, al igual que la caracterización y evaluación de los recursos genéticos, lo que permitirá conocer los atributos de las especies silvestres y cultivadas para un mejor uso de la biodiversidad.

  11. Variación en loci isoenzimáticos entre machos y hembras de Lutzomyia shannoni (Dyar (Diptera: Psychodidae de Colombia

    Directory of Open Access Journals (Sweden)

    Estrella Cárdenas

    2000-12-01

    Full Text Available Se analizaron por sexo poblaciones silvestres de Lutzomyia shannoni de tres localidades distantes entre si: Palambi (Nariño, Cimitarra (Santander y Chinácota (Norte de Santander, con el fin de establecer la variación en 11 isoenzimas. Estas muestras se compararon con ejemplares de una colonia mantenida en el Laboratorio de Entomologia del INS desde 1992. Se utilizó el sistema de electroforesis vertical en geles de poliacrilarnida al 6%. Se encontró una heterocigosidad promedio entre 18.5 y 24,7% en las hembras silvestres y entre 13,5 y 19.4% entre los machos silvestres. La heterocigosidad promedio en las hembras de la colonia fue de 14,8% mientras que en los machos fue de 20.1%. Se detectaron entre 2,0 y 2,5 alelos por locus. La distancia genética de Nei entre las poblaciones fue baja y osciló entre 0,005 y 0,073. En la muestra de la colonia de 79 individuos. el locus Gpifue homocigoto en todas las hembras y heterocigoto en todos los machos. Aunque esta observación es probablemente una consecuencia de la colonización, indica que el locus Gpi está fuertemente unido a los cromosomas que determinan el sexo, con el alelo Gpi0,62 unido al locus que determina hembras y el alelo Gpi0,72 asociado con el locus que determina machos.

  12. Evaluación de la seroconversión como respuesta a la vacunación antirrábica en perros en el departamento del Valle del Cauca, Colombia, 2009

    OpenAIRE

    Andrés Páez; Constanza Hernández; Humberto Escobar; John Jairo Zapata; Jairo Méndez; Gloria Rey-Benito

    2011-01-01

    Introducción. El departamento del Valle del Cauca ha estado libre de rabia canina por más de 20 años, aunque persisten focos de rabia silvestre que amenazan a humanos y sus mascotas; por ello, como medida preventiva. se realizan anualmente campañas de vacunación antirrábica canina. Objetivos. Medir el impacto de la vacunación en términos de seroconversión de anticuerpos neutralizadores y de porcentaje de perros con respuesta inmunitaria humoral adecuada, relacionando variables ...

  13. Evaluación de la seroconversión como respuesta a la vacunación antirrábica en perros en el departamento del Valle del Cauca, Colombia, 2009

    OpenAIRE

    Páez, Andrés; Hernández, Constanza; Escobar, Humberto; Zapata, John Jairo; Méndez, Jairo; Rey-Benito, Gloria

    2011-01-01

    Introducción. El departamento del Valle del Cauca ha estado libre de rabia canina por más de 20 años, aunque persisten focos de rabia silvestre que amenazan a humanos y sus mascotas; por ello, como medida preventiva. se realizan anualmente campañas de vacunación antirrábica canina. Objetivos. Medir el impacto de la vacunación en términos de seroconversión de anticuerpos neutralizadores y de porcentaje de perros con respuesta inmunitaria humoral adecuada, relacionando variables propias de esto...

  14. Germinación en semilla de chile piquín (Capsicum annuum var. aviculare).

    OpenAIRE

    Cano Vázquez, Anaid

    2013-01-01

    El chile piquín es una planta silvestre que presenta ciertos mecanismos para asegurar la perpetuación de la especie. Dentro de estos mecanismos se encuentra la latencia de sus semillas. La germinación de las semillas de chile piquín presenta problemas para siembras intensivas comerciales. En este trabajo se planteó: 1) comparar diversas colectas en cuanto a su capacidad germinativa; 2) indagar si la baja germinación se debe a impermeabilidad en la semilla o a alguna característica estructura...

  15. Modelagem e análise geográfica integrada das variáveis ambientais e socioeconomicas para o mapeamento da ocorrência de morcegos em Belo Horizonte

    OpenAIRE

    Jorge Luis Costa Pinto

    2015-01-01

    O processo de urbanização possui consequências, uma delas refere-se à presença de animais silvestres no ambiente urbano. Dentre outros animais, os morcegos (Ordem Chiroptera) adaptaram-se à vida nas cidades. Assim como em seu habitat natural, nas cidades os morcegos também exercem importantes funções ambientais como a dispersão de sementes, polinização e controle de insetos, no entanto, os morcegos também podem ser transmissores de zoonoses. Investigar as relações entre esses animais e as var...

  16. Enfermedades Dermatológicas de los Primates

    OpenAIRE

    Alba Lorena López-Ruíz

    2008-01-01

    El Centro de Atención y Valoración de Animales Silvestres (CAV) Torre 4 esta ubicado en el Km 13 de la vía que conduce de Manizales a Bogotá, a una altitud de 2600msnm y temperatura promedio de 13ºC. Cuenta con 4 encierros para animales de alta montaña y 6 encierros en condiciones de climatización para animales tropicales. Las especies que ingresan provienen de decomisos realizados por la Corporación Autónoma Regional de Caldas (CORPOCALDAS)...

  17. Análisis morfológico del sistema reproductor femenino de Baeacris punctulatus (Orthoptera: Acrididae: Melanoplinae)

    OpenAIRE

    Adriana A. MICHEL; Héctor R. TERÁN

    2005-01-01

    Baeacris punctulatus (Thunberg) es una especie de importancia económica, de amplia distribución en Sudamérica. En el presente trabajo se realiza un estudio anatomo-histológico de los órganos reproductivos internos, en hembras silvestres y obtenidas en cámara de cría. El estudio permitió determinar particularidades histomorfológicas, en ovarios, glándulas accesorias, oviductos laterales y oviducto medio, relacionadas con la génesis y transferencia de las gametas y la ovoposición. Se caracteriz...

  18. Análisis morfológico del sistema reproductor femenino de Baeacris punctulatus (Orthoptera: Acrididae: Melanoplinae) Morphological analysis of the female reproductive system in Baeacris punctulatus (Orthoptera, Acrididae, Melanoplinae)

    OpenAIRE

    Adriana A. Michel; Héctor R. Terán

    2005-01-01

    RESUMEN. Baeacris punctulatus (Thunberg) es una especie de importancia económica, de amplia distribución en Sudamérica. En el presente trabajo se realiza un estudio anatomo-histológico de los órganos reproductivos internos, en hembras silvestres y obtenidas en cámara de cría. El estudio permitió determinar particularidades histomorfológicas, en ovarios, glándulas accesorias, oviductos laterales y oviducto medio, relacionadas con la génesis y transferencia de las gametas y la ovoposición. Se c...

  19. EXTRACCIÓN, CRISTALIZACIÓN Y CARACTERIZACIÓN DE INULINA A PARTIR DE YACÓN (Smallanthus sonchifolius (Poepp. & Endl.) PARA SU UTILIZACIÓN EN LA INDUSTRIA ALIMENTARIA Y FARMACÉUTICA EXTRACTION, CRYSTALIZATION AND CHARACTERIZATION OF INULIN FROM YACON (Smallanthus sonchifolius (Poepp. & Endl.) FOR TO BE USED IN FOOD AND FARMACEUTIC INDUSTRY

    OpenAIRE

    OSCAR ARANGO BEDOYA; GINNA PAOLA CUARÁN; JUAN CAMILO FAJARDO

    2008-01-01

    La tendencia hacia la adopción de una alimentación sana y balanceada que incluya elementos naturales y benéficos es creciente. Se plantea el aprovechamiento del yacón (Smallanthus sonchifolius (Poepp. & Endl.)), planta silvestre de la región andina de Nariño, por su alto contenido de inulina, fructooligosacárido utilizado en la industria alimentaria y farmacéutica para la elaboración de edulcorantes para diabéticos y como fibra en alimentos refinados. Este estudio reporta la optimización del ...

  20. Evaluación de la infestación de cinco especies de solanáceas al parasitismo del nemátodo del nudo de la raíz Meloidogyne incognita y el contenido de alcaloides en frutos de tomate de árbol y naranjilla injertados en estas especies

    OpenAIRE

    Navarrete Bastidas, Ximena Elianet

    2017-01-01

    Existe una alta incidencia del nemátodo Meloidogyne incognita en Solanáceas de importancia económica. Este patógeno ocasiona daños en la planta, llegando a producir hasta la muerte y ocasionando pérdidas para el agricultor. En la presente investigación, se evaluó la respuesta de infestación de cinco especies de Solanáceas silvestres (Solanum auriculatum, S.hirtum, S.hispidum, S.arboreum y Nicotiana glauca) al parasitismo de M. incognita. Se utilizó un diseño de bloques completamente al azar c...

  1. Hymenoptera parasitoides associados às larvas de Lepidoptera em reflorestamento e sistemas agroflorestais da fazenda Canchim (Embrapa Pecuária Sudeste), São Carlos, São Paulo, Brasil

    OpenAIRE

    Aline Garcia Pereira

    2013-01-01

    Estudos da flora e fauna silvestres são importantes por contribuirem para a compreensão dos processos ecológicos que ocorrem em resposta às estratégias de manejo utilizadas. Os Hymenoptera são um grupo-chave para o estabelecimento de prioridades em conservação do ambiente, pois representam alta proporção da diversidade de insetos, sendo facilmente amostrados. O objetivo deste trabalho foi caracterizar a fauna de Hymenoptera parasitoides associada às larvas de Lepidoptera em área de refloresta...

  2. Extracción y caracterización de aceite esencial del Molle Schinus linneo por medio de fluidos supercríticos

    OpenAIRE

    Angulo Gutiérrez, Olga Eugenia

    2015-01-01

    EL MOLLE (SCHINUS LINNEO), es una planta que crece en la región Junín de manera silvestre de la familia de las Anacardiaceae, no aprovechada. Dado que tiene una serie de propiedades farmacológicas a veces usado con fines ornamentales en jardines y lugares públicos. Por las bondades que presenta el molle (frutos) ha motivado realizan el trabajo de investigación extraídas de los alrededores del Distrito de Viquez Provincia de Huancayo Departamento De Junín, (en épocas de maduración de los fruto...

  3. Historia natural de los plátanos y las bananas

    OpenAIRE

    López Sáez, José Antonio; Pérez Soto, Josué

    2011-01-01

    Los plátanos y las bananas que se cultivan en muchos países de clima tropical proceden de dos especies silvestres del género Musa que habitan en el Sureste Asiático: el plátano malayo y el plátano macho. A partir de ellas se han obtenido más de un millar de híbridos, razas o cultivares de agradable sabor y alto valor nutritivo. Otras plataneras se han utilizado como plantas ornamentales, proporcionan fibra o tintes naturales, materiales de construcción e incluso remedios en medicina tradicion...

  4. Caracterización morfológica de cuarenta y seis accesiones de uchuva (Physalis peruviana L.), en Antioquia (Colombia)

    OpenAIRE

    Trillos González,Ofelia; Cotes Torres,José Miguel; Medina Cano,Clara Inés; Lobo Arias,Mario; Navas Arboleda,Alejandro Alberto

    2008-01-01

    La uchuva, Physalis peruviana L., crece como planta silvestre en las zonas tropicales altas de América, estando el centro de origen y diversificación en los Andes Suramericanos, principalmente de Colombia, Perú y Ecuador. Se realizó la caracterización morfológica de 46 accesiones de uchuva provenientes del Banco de Germoplasma de la nación Colombiana, a cargo de La Corporación Colombiana de Investigación Agropecuarias, CORPOICA, en el Centro de Investigación La Selva, ubicado en la vereda Lla...

  5. Morphologic characterization of forty six accessions of cape gooseberry (Physalis peruviana L.), in Antioquia (Colombia)

    OpenAIRE

    Trillos González, Ofelia; Cotes Torres, José Miguel; Medina Cano, Clara Inés; Lobo Arias, Mario; Navas Arboleda, Alejandro Alberto

    2008-01-01

    La uchuva, Physalis peruviana L., crece como planta silvestre en las zonas tropicales altas de América, estando el centro de origen y diversificación en los Andes Suramericanos, principalmente de Colombia, Perú y Ecuador. Se realizó la caracterización morfológica de 46 accesiones de uchuva provenientes del Banco de Germoplasma de la nación Colombiana, a cargo de La Corporación Colombiana de Investigación Agropecuarias, CORPOICA, en el Centro de Investigación La Selva, ubicado en la vereda Lla...

  6. Natural infection of the opossum Didelphis albiventris (Marsupialia, Didelphidae with Leishmania donovani, in Brazil

    Directory of Open Access Journals (Sweden)

    Ítalo A. Sherlock

    1984-12-01

    Full Text Available An opossum, Didelphis albiventris, from Jacobina, bahia State, was found naturally infected with Leishmania donovani, being the first non-canid wild mammal to be detected with agent of kala-azar in the New World.Um gambá, Didelphis albiventris, de Jacobina, Bahia, foi encontrado com infecção natural pela Leishmania donovani, sendo o primeiro mamífero silvestre não-canídeo a ser achado com o agente do calazar nas Américas.

  7. PCR dúplex a tiempo real para la detección de la variante clásica (RHDV) y nueva (RHDV2) de la enfermedad hemorrágica del conejo

    OpenAIRE

    Sarto, P.; Mendoza, M.; Calvo, A.J.; Monroy, F.; Jiménez de Bagüés Picazo, María Pilar; Calvete Margolles, Carlos; Calvo Lacosta, Jorge Hugo

    2017-01-01

    La enfermedad hemorrágica (RHD) es uno de los principales factores de mortalidad del conejo silvestre en la península ibérica. Desde su aparición a finales de los años 80 el agente etiológico predominante han sido cepas víricas pertenecientes a un único genogrupo (RHDV). Sin embargo, en 2011 se detectó, inicialmente en el tercio norte de España, una nueva variante vlrica (RHDV2) que cursó de forma atlpica, modificando la epidemiologla de la enfermedad y afectando a animales con menos de...

  8. Afecções cirúrgicas em aves: estudo retrospectivo

    OpenAIRE

    Patricia Ferreira de Castro

    2010-01-01

    As aves representam a grande maioria das espécies da fauna silvestre mantidas como animais de companhia em nosso meio e respondem diretamente pela crescente demanda pelo atendimento médico veterinário. O avanço na área da anestesiologia viabilizou a realização de procedimentos cirúrgicos mais longos e complexos e contribuiu para o desenvolvimento e aprimoramento da técnica operatória em aves, contudo, dados nacionais de casuística relacionados às afecções cirúrgicas de aves ainda são inexiste...

  9. Introducción al Control de Plagas: consideraciones éticas y ambientales

    OpenAIRE

    Nestor Varela

    2010-01-01

    Plaga es un concepto antropocéntrico para definir organismos que entran en conflicto con los intereses humanos, pero en el manejo de vida silvestre es más apropiado denominar a estos organismos como invasores. Muchos de los cambios causados al entorno natural y uso de los recursos naturales determinan la presentación de animales plaga o invasores, en particular el comercio internacional, la alteración del entorno y el almacenamiento masivo de recursos. El control de plagas se realiza mediante...

  10. Efeito da enxertia em mandioca

    OpenAIRE

    Bomfim, Nayra Nascimento

    2011-01-01

    Enxertos de duas espécies silvestres (M. glaziovii e M. fortalezensis) sobre M. esculenta, mandioca, foram estudados morfologicamente, anatomicamente e citogeneticamente e a fim de se avaliar possíveis efeitos devido à interação entre enxerto e porta-enxerto. Foram feitas análises anatômicas das raízes dos porta-enxertos UnB 201 e UnB 122 (variedades de M. esculenta), em comparação com as variedades não enxertadas. Analisou-se a meiose em enxerto da espécie M. glaziovii que apresentava morfol...

  11. Ocorrência de Dioctophyma renale em Galictis cuja

    OpenAIRE

    Zabott, Marivone V.; Pinto, Simone B.; Viott, Aline M.; Tostes, Raimundo A.; Bittencourt, Laura H.F.B.; Konell, Aline L.; Gruchouskei, Leonardo

    2012-01-01

    A dioctofimose é uma parasitose causada pelo Dioctophyma renale (Goeze, 1782) de ocorrência mundial e acomete animais domésticos e silvestres. Em março de 2010, um exemplar adulto (macho) de Galictis cuja (Molina, 1782), encontrado morto por atropelamento no município de Guaíra, Paraná foi encaminhado ao laboratório de Patologia Veterinária de Universidade Federal do Paraná (UFPR), Campus Palotina, para a realização da necropsia. O cadáver apresentava bom estado nutricional e autólise moderad...

  12. NEFRECTOMIA UNILATERAL EM CADELA PARASITADA POR Dioctophyma renale : RELATO DE CASO

    OpenAIRE

    Hermeto, Larissa; Mauad, Juliana Rosa Carrijo; Universidade Federal da Grande Dourados; Mattei, Douglas Rodrigo; Faculdade Anhanguera de Dourados; Ferrarezi, Ana Paula Ferreira; Faculdade Anhanguera de Dourados; Ventura, Arlene Sobrinho; Faculdade Anhanguera de Dourados

    2012-01-01

    O dioctophyma renale, conhecido como verme gigante renal é um nematóide de ocorrência mundialque parasita os rins, podendo ser encontrado na cavidade peritoneal e em outros órgãos do cão, e em outras espéciesde animais domésticos e silvestres, inclusive o homem. Foi atendida uma cadela sem raça definida, apresentandosecreção vaginal sanguinolenta persistente, neoformação vaginal, hiporexia e hematúria. Foram solicitados examescomplementares, e através da ultrassonografia abdominal foi detecta...

  13. Ecoturismo en la reserva Cuyabeno : realidad y retórica en la relación de los Siona con el turismo ecológico 1994

    OpenAIRE

    Arrueta, José Antonio

    1996-01-01

    El Turismo es una actividad que consiste básicamente en visitar lugares en donde buscamos satisfacer demandas relacionadas a información, diversión, conocimiento y placer. El turismo ecológico implica reglamentos de conducta de los visitantes, en relación a la preservación y conservación de los sitios naturales a silvestres que se visita. Incluye la participación de las poblaciones locales de los sitos de reserva como “beneficiarias” del ecoturismo. Estos "principios generales" del turismo ec...

  14. La arquitectura del hierro en España durante el siglo XIX

    OpenAIRE

    Navascués Palacio, Pedro; Calvo Serraller, Francisco

    1980-01-01

    Cuando el arquitecto neoclásico Silvestre Pérez, formado en la Academia de Bellas Artes y pensionado en Roma, recibe el encargo del ayuntamiento de Sevilla (1824) para hacer un proyecto de un puente sobre el Guadalquivir, éste se ve postergado al optarse por otro en hierro según se había experimentado ya en Inglaterra y Francia. Este hecho pone de relieve la forma violenta con que el hierro irrumpe en nuestra historia de la construcción, como fenómeno mimético, al margen de la lenta maduració...

  15. Detection and characterization of mango malformation and its causal agent in Spain

    OpenAIRE

    Crespo Palomo, María

    2014-01-01

    El mango (Mangifera indica L.) es un árbol originario de la región indobirmana, laderas del Himalaya y Sri Lanka, donde aún existen poblaciones silvestres y ha sido cultivado desde la antigüedad en la India como atestiguan las sagradas escrituras hindúes, los libros de los Vedas, redactadas entre el 1500 y el 1000 a. C. (Galán-Saúco, 2009). La dispersión del mango fue muy rápida por el subcontinente de la India y el archipiélago malayo con la apertura del comercio entre Asia y Europa. El mang...

  16. Aporte de serrapilheira e macronutrientes em diferentes ambientes naturais atingidos por incêndio

    OpenAIRE

    Coelho, Polyanne Aparecida

    2015-01-01

    A compreensão dos processos que mantêm os ecossistemas naturais sempre foi de grande interesse do homem. Ao longo do tempo, percebeu-se que a análise de tais processos fornece informações relevantes, que podem balizar tomadas de decisões ligadas à conservação e manejo da vida silvestre. Nesse sentido, os estudos ligados à serrapilheira fornecem informações valiosas sobre a vegetação e a capacidade do ecossistema em reciclar nutrientes e matéria orgânica. Entre os fatores que...

  17. Miologia do membro pélvico da paca (Cuniculus paca Linnaeus, 1766)

    OpenAIRE

    Leonardo M. Leal; Rafaela M. de Sá; Fabricio S. de Oliveira; Tais H.C. Sasahara; Bruno W. Minto; Marcia R.F. Machado

    2015-01-01

    Resumo: Objetivam-se descrever os músculos do membro pélvico da paca (Cuniculus paca Linnaeus, 1766), mediante dissecção anatômica dessa região. Foram utilizadas dez Cuniculus paca adultas, machos e fêmeas, pesando entre cinco e 10 kg do plantel de pacas do setor de Animais Silvestres da FCAV, Unesp, Jaboticabal/SP. Os animais foram fixados em formaldeído 10% e conservados em solução salina a 30% para dissecação anatômica da musculatura da pelve, coxa e perna, identificando-se a origem e inse...

  18. Estudo do papel funcional da cisteína sintase e da cistationina B-sintase na resposta ao estresse oxidativo e nitrosativo em leishmania (viannia) braziliensis, trypanosoma rangeli e trypanosoma cruzi

    OpenAIRE

    Romero Calderon, Ibeth Cristina

    2014-01-01

    Tese (doutorado) - Universidade Federal de Santa Catarina, Centro de Ciências Biológicas, Programa de Pós-Graduação em Biotecnologia e Biociências, Florianópolis, 2014 Leishmania (Viannia) braziliensis, Trypanosoma rangeli e o Trypanosoma cruzi são parasitos hemoflagelados pertencentes à Ordem Kinetoplastida, família Trypanosomatidae, capazes de infectar insetos, animais silvestres e domésticos, assim como o homem. Durante seu ciclo de vida, estes parasitos são expostos a uma grande quanti...

  19. Acción comunitaria frente al fenómeno del cambio climático, en el páramo de la región del Guavio, Cundinamarca, Colombia

    OpenAIRE

    Sonia Astrid Mendoza Velásquez; Juan Guillermo Cano Muñoz; Fabián Rojas Sánchez

    2015-01-01

    El municipio de Junín, Cundinamarca, Colombia, hace parte de la zona de amortiguamiento del Parque Nacional Natural Chingaza y se caracteriza por poseer una gran variedad de recursos naturales, abundante agua y bosques naturales; sin embargo, presenta un alto grado de contaminación del recurso hídrico y adicionalmente, se ha presentado extinción de la fauna y la flora silvestre, destrucción de los bosques por talas y quemas indiscriminadas. La presente investigación tiene el propósito de docu...

  20. Caracterización cromatográfica de pigmentos oculares en mutantes de Drosophila melanogaster (Diptera: Drosophilidae)

    OpenAIRE

    Duberney García García; Soraya Villalobos Hernández; William Usaquén Martínez

    2005-01-01

    Se reconocen los compuestos pteridínicos asociados con la pigmentación ocular del tipo silvestre y cuatro mutantes (Vermilion, Sepia, Plum y White) de Drosophila melanogaster, relacionando las rutas metabólicas de los pigmentos oculares y su modificación en la manifestación de la coloración ocular de cada mutante. Adicionalmente, se describe la ruta completa de biosíntesis de compuestos pteridínicos. La separación de pigmentos se realizó por medio de cromatografía en papel y el
    rev...

  1. LA SELECCIÓN NATURAL Y LOS CULTIVOS TRANSGENICOS: ¿UN HIATO DARWINISTA?.

    Directory of Open Access Journals (Sweden)

    Alejandro Chaparro Giraldo

    2009-10-01

    Full Text Available En diciembre del 2008, se reportaron 125 millones de hectáreas de variedades transgénicas de soya, maíz, algodón y canola, sembradas en 23 países de los cinco continentes.  Estas variedades fueron transformadas con genes de origen procariote, que les confieren la capacidad de resistir el ataque de insectos lepidópteros o tolerar dosis comerciales de herbicidas. Desde el inicio de la ingeniería genética, se ha planteado la cuestion de si estos organismos, liberados de manera masiva en los agroecosistemas, pueden causar efectos ambientales negativos en el mediano plazo, o efectos evolutivos desastrosos en el largo plazo. Una manera de analizar este problema, es considerar si pueden escapar a la selección natural darwinista, por el hecho de haberse introducido genes foráneos mediante manipulación humana. Para ello, se estudia la literatura disponible sobre el flujo de genes, desde los cultivos modificados hacía sus parientes silvestres estrechamente relacionados. Existe evidencia empírica de la hibridación entre  materiales mejorados por métodos convencionales (hibridación, retrocruces, selección o biotecnológicos (transferencia de genes foráneos y parientes silvestres estrechamente relacionados. En todo caso, los efectos de estas hibridaciones dependen de la interacción entre el gene transferido y el pariente silvestre, en el ecosistema particular en que ocurra.  El mayor efecto ambiental y evolutivo, es el resultado de la introgresión del transgene en el pariente silvestre, proceso que implica la estabilización del transgene en el genoma hospedero, resultado de sucesivas generaciones de hibridación y retrocruce. La introgresión depende mas de la naturaleza del gene, y del local que ocupa en el genoma donante, que del mecanismo de introducción en dicho parental. No se han reportado efectos negativos sobre la diversidad genética de las especies transformadas, ni sobre el ambiente o los consumidores. Los cultivos transg

  2. Producción de metabolitos secundarios en cultivo de raíces in vitro y suspensiones celulares de Ipomoea carnea spp. carnea Jacq.

    OpenAIRE

    Rojas Idrogo, Consuelo; Kato, Massuo J.; Delgado-Paredes, Guillermo E.; Segal Floh, Eny Iochevet; Handro, Walter

    2014-01-01

    Ipomoea carnea spp. carnea Jacq. es un arbusto dominante en el bosque estacionalmente seco del Perú y Ecuador. Los cultivos de raíces fueron establecidos en medio MS con diferentes concentraciones de AIB, sacarosa y combinaciones de AIB-sacarosa. Diversos explantes obtenidos de plántulas in vitro y plantas silvestres se cultivaron en diferentes combinaciones de 2,4-D, AIA, ANA y BAP, para inducir callos friables, dependiendo del tipo de explante y los reguladores de creci...

  3. Estudio citogenético de tres especies de guacamayas ( Ara clhoroptera , Ara ararauna y Ara macao en cautiverio, pruebas preliminares

    Directory of Open Access Journals (Sweden)

    C. Stelle

    2001-07-01

    Full Text Available Este trabajo busca presentar el primer reporte de bandeo cromosómico, en tres especies del género Ara encontradas en el territorio nacional; y así contribuir al conocimiento genotípico de la especie, el cual serviría en programas de conservación y reproducción en cautiverio o espacios abiertos controlados, y la posible aplicación metodológica a otras especies del mismo género. Así mismo, colaborar con el establecimiento de un banco de información genética en especies silvestres neotropicales.

  4. Estudio químico de los compuestos lipídicos de las hojas, tallos y flores de Vernonanthura patens (Kunth) H. Rob. (Asteraceae)

    OpenAIRE

    Manzano Santana, Patricia; Miranda Martínez, Migdalia; Montes de Oca Porto, Rodney; Orellana León, Tulio; Abreu Payrol, Juan; Peralta García, Esther L

    2013-01-01

    Introducción: Vernonanthura patens (Kunth) H. Rob. es una especie que crece silvestre en el Ecuador, para la cual existen escasos antecedentes de estudios químicos y biológicos, y en ninguno de estos se aborda el estudio de fracciones lipídicas. Objetivos: estudiar las fracciones de compuestos lipídicos presentes en las hojas, tallos y flores de la especie. Métodos: la planta se recolectó en estado adulto, en época de floración, los órganos vegetales fueron secados en estufa por separado, se ...

  5. Isolamento e identificação de Lactobacillus spp., Bifidobacterium spp., Enterococcus spp., Pediococcus spp. e Lactococcus spp. da microbiota intestinal de Papagaio-verdadeiro (Amazona aestiva)

    OpenAIRE

    Luciana Allegretti

    2009-01-01

    No Brasil, o papagaio-verdadeiro (Amazona aestiva) é uma das aves mais procuradas como animal de estimação e comercializadas ilegalmente. Na literatura pouco é descrito sobre a microbiota intestinal de aves silvestres. O trato intestinal das aves é composto por inúmeras e diferentes espécies bacterianas. A grande maioria são bactérias gram-positivas pertencentes ao grupo de bactérias ácido-láticas. Este estudo teve como objetivo isolar e identificar a presença de bactérias dos gêneros Lactoba...

  6. Crianza Artificial de Aves Rapaces Nocturnas en Cautiverio

    OpenAIRE

    Carolina Sastre-Corredor

    2009-01-01

    El objetivo de este trabajo, fue realizar el seguimiento a dos casos de aves rapaces neonatos que ingresaron al Centro de Recepción y Rehabilitación de Fauna Silvestre (CRRFS) de la Secretaria Distrital de Ambiente (SDA), con el fin de registrar, conocer e informar el manejo general de los mismos. Al momento de ingresar el primer grupo de ejemplares al CRRFS, se detectaron varias limitaciones de tipo físico, por ejemplo insumos alimentarios en mal estado o inexistencia de los mismos, y de...

  7. External parasites of raptors (Falconiformes and Strigiformes): identification in an ex situ population from Mexico

    OpenAIRE

    de Oliveira, JaquelineB; Santos, Tiziano; Vaughan, Christopher; Santiago, Heber

    2011-01-01

    Raptorial birds harbor a variety of ectoparasites and the mayority of them are host specific. The aim of this study was to identify the ectoparasites of captive birds of prey from Mexico, as well as to verify their impact in the health of infested birds. Raptorial birds were confiscated and kept in captivity at the Centro de Investigación y Conservación de Vida Silvestre (CIVS) in Los Reyes La Paz, Mexico State. Seventy-four birds of prey (66 Falconiformes and eigth Strigiformes) of 15 specie...

  8. Guía de campo de las especies de aves y mamíferos marinos del sur de Chile: especies comunes de avistar en las regiones de Los Lagos y Aysén.

    OpenAIRE

    Hucke-Gaete, Rodrigo; Ruiz Troemel, Jorge

    2010-01-01

    Dentro de la macrofauna marina están las aves y los mamíferos en donde en Chile hay una gran diversidad.En este libro se describen aspectos generales sobre el área en la cual se focaliza el estudio, una descripción general de los grupos animales incluidos (con figuras ilustradas de cada animal), algunos aspectos clave sobre los códigos de conducta para la observación responsable de fauna marina silvestre, así como descripciones detalladas de las características más relevantes para la identifi...

  9. DISTRIBUCIÓN ACTUAL Y ÁREAS PRIORITARIAS PARA LA CONSERVACIÓN DE PSITÁCIDOS EN EL PACÍFICO MEXICANO

    OpenAIRE

    Marín Togo, María Consuelo

    2012-01-01

    Entre las aves terrestres, la familia Psittacidae presenta el mayor número de especies en riesgo de extinción en el medio silvestre, tanto en México como globalmente. La fuerte presión que sufren por la acelerada pérdida de hábitat por el cambio de uso de suelo, y la elevada cantidad de organismos que son extraídos para satisfacer el mercado de mascotas son consideradas las principales causas. Por otra parte la falta de información sobre su distribución actual dificulta el dise...

  10. CARACTERIZACIÓN BROMATOLÓGICA Y MICROBIOLÓGICA DE CARNES PROCEDENTES DE ESPECIES DE ANIMALES REGIONALES DE LA AMAZONIA PERUANA PARA CONSUMO HUMANO

    OpenAIRE

    Lozano, Ronald; Pinedo, Weninger; Inga, Lylyams

    2012-01-01

    La investigación consistió en la caracterización bromatológica y determinación microbiológica de muestras de carnes procedentes de ocho especies de animales silvestres: huangana (Tayassu pecari), majaz o picuro (Agouti paca), sajino (Tayassu tajacu), venado colorado (Mazama americana), tapir (Tapirus terrestris), añuje (Dasyprota fuliginosa), ronsoco (Hydrochaeris hydrochaeris) y armadillo (Dasypus novemcinctus); en las localidades de Puerto Belén-Roya-Utucuro, Santa Rosa de Aguaytía, Santa L...

  11. Hongos asociados con el declinamiento de la manzanita Arctostaphylos pungens HBK en la Sierra Fría de Aguascalientes, México

    OpenAIRE

    Moreno-Rico, O.; Marmolejo-Monsivais, G.J.; Sánchez-Martínez, G.; Díaz-Moreno, R.; Luna-Ruíz, J.J.; Sosa-Ramírez, J.; Pérez-Hernández, K.J.; Moreno-Manzano, C.E.

    2015-01-01

    La manzanita (Arctostaphylos pungens) es un arbusto que se encuentra con regularidad en la Sierra Fría del estado de Aguascalientes, México. Este arbusto, al igual que otras plantas silvestres, es afectado por factores bióticos, como las enfermedades, que pueden causar desde daños insignificantes hasta la muerte de las plantas. Los objetivos de este trabajo fueron: 1) identificar los hongos relacionados con el declinamiento de la manzanita en la Sierra Fría de Aguascalientes y 2) conocer la i...

  12. Delincuencia organizada ambiental en México, una nueva manifestación criminal del tráfico de especies

    OpenAIRE

    Alvarado-Martínez, Israel

    2012-01-01

    El estudio arroja la presencia de grupos delictivos organizados en el territorio mexicano, que trafican con especies de fauna protegidas, valiéndose de las mismas rutas que utiliza el narcotráfico y, en muchas ocasiones, mediante la diversificación de actividades criminales, por lo que lo mismo trafican con personas, armas y drogas que con ejemplares de vida silvestre, y obtienen ganancias calculadas solo por debajo del tráfico ilícito de drogas. No obstante estas características, en la legis...

  13. Delincuencia organizada ambiental en México, una nueva manifestación criminal del trá co de especies

    OpenAIRE

    Israel Alvarado Martínez

    2012-01-01

    El estudio arroja la presencia de grupos delictivos organizados en el territorio mexicano, que trafican con especies de fauna protegidas, valiéndose de las mismas rutas que utiliza el narcotráfico y, en muchas ocasiones, mediante la diversificación de actividades criminales, por lo que lo mismo trafican con personas, armas y drogas que con ejemplares de vida silvestre, y obtienen ganancias calculadas solo por debajo del tráfico ilícito de drogas. No obstante estas características, en la legis...

  14. Registro de un ejemplar de Trachemys scripta elegans (Wied 1839) en la provincia de Jujuy, Argentina

    OpenAIRE

    Quiroga, María Fernanda; González Baffa Trasci, Noelia; Akmentins, Mauricio

    2015-01-01

    La tortuga de orejas rojas (Trachemys scripta elegans) es originaria del centro este de los Estados Unidos y noreste de México (Ernst, 1990), pero debido al comercio internacional de animales silvestres se ha convertido en un invasor biológico a nivel global. En Argentina, Trachemys scripta elegans ha sido reportada para dos localidades en la provincia de Buenos Aires y en ambos casos se trató del registro de individuos aislados, por lo que se desconoce si la tortuga de orejas rojas ha lograd...

  15. Efeitos do citrato de fentanila em Trachemys dorbigni (Duméril e Bibron, 1835) e Trachemys scripta elegans (Wied, 1839)

    OpenAIRE

    Kaminishi, árthur Paulino Sanzo

    2013-01-01

    Foram utilizados 30 animais, 15 Trachemys dorbigni e 15 Trachemys scripta elegans, com massa corporal variando de 0,750 a 1,800 kg, provenientes do acervo do Laboratório de Ensino e Pesquisa em Animais Silvestres - UFU (LAPAS). Cada espécie foi separada em dois grupos, sendo um experimental, com 10 animais, e outro controle, com cinco animais. Foi administrado citrato de fentanila 0,05 mg/kg aos grupos experimentais, e solução fisiológica 1 ml/kg aos grupos controle, todos por via subcutânea ...

  16. Biodiversidad de Chordata (Mammalia) en México

    OpenAIRE

    Sánchez-Cordero, Víctor; Botello, Francisco; Flores-Martínez, José Juan; Gómez-Rodríguez, Ruth A.; Guevara, Lázaro; Gutiérrez-Granados, Gabriel; Rodríguez-Moreno, Ángel

    2014-01-01

    Los mamíferos son uno de los grupos más conspicuos de las comunidades terrestres de vertebrados y muestran una serie de características internas y externas que los han llevado a ser exitosos en casi todos los ecosistemas del mundo. El objetivo de esta revisión es actualizar el estado de conocimiento de los mamíferos de México. En México los mamíferos forman un grupo altamente diverso, ubicando al país en el tercer lugar mundial con 564 especies silvestres, alcanzando aproximadamente el 10% de...

  17. Representações de luto e lamentação em fontes medievais peninsulares da Idade Média e início da Idade Moderna

    Directory of Open Access Journals (Sweden)

    Marta Miriam Ramos Dias

    2016-09-01

    Full Text Available This study intends to highlight  the depictions of mourning in written and iconographic sources from the late period of the Middle Ages. In the first part of this article, excerpts belonging to the synods, to the chronicles of Fernão Lopes and to the Siete Partidas of Alfonso X were analyzed regarding the ecclesiastical requirements and popular customs. In the second part, the tomb of Gomes Martins Silvestre and the painted planks from the tomb of Sancho Sáiz de Carrillo were also submitted to analysis.

  18. Caracterización preliminar de la lepidopterofauna (insecta: rophalocera) presente en la reserva privada: refugio del oso de anteojos (Calvario –Meta), Colombia

    OpenAIRE

    Ruth Castillo; Diana Cabrera; Elizabeth Lombana

    2011-01-01

    Ubicada en el piedemonte de la cordillera Oriental, la reserva privada: Refugio del Oso de Anteojos, se encuentra sujeta a presión antrópicalocal representada por deforestación, quemas,pastoreo y caza de fauna silvestre. Por tanto, es necesario conocer el estado de conservación de algunas áreas mediante el empleo de organismos bioindicadores como los Lepidopteros (Rhopalocera). Los muestreos se realizaron en los meses de mayo, junio, julio y septiembre de 2008, en cuatro zonas características...

  19. DIVERSIDAD DE LA FAMILIA POACEAE (GRAMINEAE) EN LA REGIÓN DEL BÍO-BÍO, CHILE, BASADA EN COLECCIONES DE HERBARIO

    OpenAIRE

    Finot, Víctor L; Marticorena, Clodomiro; Barrera, Juan A; Muñoz-Schick, Mélica; Negritto, María A

    2009-01-01

    La Región del Bío-Bío se encuentra en la zona sur de Chile central, considerado un hotspot de biodiversidad. Aunque es una región fuertemente intervenida por el hombre, principalmente por la agricultura, la forestación, la industrialización y la urbanización, tiene un bajo porcentaje de superficie protegida por el Sistema Nacional de Áreas Silvestres Protegidas del Estado (SNASPE). Por ello, documentar la biodiversidad de la región es una tarea ineludible. Se analizó la diversidad de la famil...

  20. Análisis econométrico del riesgo de extinción del las especies de fauna en Colombia: reptiles y peces dulceacuícolas

    OpenAIRE

    Fabio Alberto Arias Arbeláez

    2004-01-01

    El riesgo de extinción de una especie se estima por la evaluación del estado de deterioro de la población. Una especie silvestre y no extinta puede ser evaluada y clasificada como: en peligro crítico, en peligro, vulnerable, cuasiamenazada o de preocupación menor. En Colombia se ha realizado esta clasificación para algunos grupos de fauna y flora. En este trabajo se utiliza la información de la serie libros rojos de especies amenazadas de Colombia (reptiles y peces dulceacuícolas) para calcul...

  1. Registros de zopilote rey (Sarcoramphus papa) en el área de Laguna de Términos, Campeche, México

    OpenAIRE

    Mircea Hidalgo-Mihart; Fernando M. Contreras-Moreno; Luz A. Pérez-Solano

    2012-01-01

    Reportamos la presencia de dos individuos juveniles de zopilote rey, Sarcoramphus papa, en la Selva La Montaña localizada al suroeste del Área de Protección de Flora y Fauna Silvestre Laguna de Términos, Campeche, México. Realizamos el registro por medio de fotografías utilizando cámaras trampa. La presencia de esta especie protegida en el área evidencia la importancia que tiene la región de la Selva La Montaña para la conservación de la biodiversidad, especialmente para especies en peligro d...

  2. Attenuation Factors for B(E2) in the Microscopic Description of Multiphonon States ---A Simple Model Analysis---

    Science.gov (United States)

    Matsuyanagi, K.

    1982-05-01

    With an exactly solvable O(4) model of Piepenbring, Silvestre-Brac and Szymanski, we demonstrate that the attenuation factor for the B(E2) values, derived by the lowest-order approximation of the multiphonon method, takes excellent care of the kinematical anharmonicity effects, if multiphonon states are defined in the intrinsic subspace orthogonal to the pairing rotation. It is also shown that the other attenuation effect characterizing the interacting boson model is not a dominant effect in the model analysed here.

  3. Espíritos cheios de bichos: A fauna nas viagens de Louis Agassiz e Richard Francis Burton pelo Brasil oitocentista

    Directory of Open Access Journals (Sweden)

    Janaina Zito Losada

    2015-04-01

    Full Text Available O Brasil do século XIX foi alvo de inúmeras viagens realizadas por cientistas estrangeiros. O objetivo deste artigo é analisar as impressões sobre a fauna brasileira presentes nos relatos das viagens realizadas pelo naturalista suíço Louis Agassiz, em 1865, e pelo explorador inglês Richard Francis Burton, em 1868. Destes relatos privilegiam-se as descrições do meio natural de diferentes regiões brasileiras e das particularidades da fauna silvestre por eles encontrada.

  4. Attenuation factors for B(E2) in the microscopic description of multiphonon states

    International Nuclear Information System (INIS)

    Matsuyanagi, Kenichi

    1982-01-01

    With an exactly solvable O(4) model of Piepenbring, Silvestre-Brac and Szymanski, we demonstrate that the attenuation factor for the B(E2) values, derived by the lowest-order approximation of the multiphonon method, takes excellent care of the kinematical anharmonicity effects, if multiphonon states are defined in the intrinsic subspace orthogonal to the pairing rotation. It is also shown that the other attenuation effect characterizing the interacting boson model is not a dominant effect in the model analysed here. (author)

  5. Financial development and poverty reduction in emerging market economies

    Directory of Open Access Journals (Sweden)

    Bayar Yılmaz

    2017-01-01

    Full Text Available Poverty reduction is one of the key challenges in the globalized world. This study investigates the relationship between financial development and poverty reduction in emerging market economies during the period 1993- 2012. The Carrión-i-Silvestre, del Barrio-Castro, and López-Bazo (2005 panel unit root test and the Basher and Westerlund (2009 cointegration test was applied considering the cross-sectional dependence and multiple structural breaks in the study period. The findings indicated that financial development, including banking sector development and stock market development, had a significant positive impact on poverty reduction in emerging market economies.

  6. Cariotipo del tit? gris (Saguinus leucopus): similitudes con el cariotipo humano

    OpenAIRE

    Tabares, Juan Hember; Fierro, Carlos Humberto; Pulido, Paola Del Pilar; Ossa Reyes, Humberto

    2008-01-01

    El tit? gris (Saguinus leucopus) es un primate end?mico de Colombia cuyo cariotipo se describe en el presente estudio a partir de una pareja de individuos ubicados en el Centro de Rehabilitaci?n de Fauna Silvestre del Oriente de Caldas, Colombia. Las muestras de sangre fueron recolectadas de la vena femoral y anticoaguladas con heparina de sodio. Los cromosomas se obtuvieron por el m?todo cl?sico de cultivo de linfocitos y bandeamiento Q y G Los individuos presentan 46 cromosomas (2n = 46: 30...

  7. Respuesta al estrés por limitación de nitrógeno de plántulas de castilleja tenuiflora benth. cultivadas in vitro.

    OpenAIRE

    Cortes Morales, Jorge Alberto

    2016-01-01

    Castilleja tenuiflora Benth. (Orobanchaceae), es una planta medicinal silvestre que sintetiza diversos compuestos químicos como feniletanoides e iridoides glicosilados y flavonoides. El perfil químico de los cultivos in vitro de C. tenuiflora varía dependiendo de factores bióticos y de factores abióticos como el nitrógeno. El objetivo general de este trabajo fue evaluar la respuesta al estrés por limitación de nitrógeno de plántulas de C. tenuiflora cultivadas in vitro. Se cult...

  8. INNOVACION TECNOLOGICA Y COMERCIAL DE PRODUCTOS FORESTALES NO MADEREROS (PFNM) EN CHILE.

    OpenAIRE

    VALDEBENITO R., GERARDO

    2013-01-01

    Los Productos Forestales No Madereros (PFNM) son definidos por FAO como "bienes de origen biológico distinto de la madera, procedentes de los bosques, de otros terrenos arbolados y de árboles situados fuera de los bosques". Chile posee una gran cantidad de PFNM, los cuales han sido utilizados históricamente por nuestra población, destacando las especies que poseen propiedades medicinales, frutos silvestres y alimentos, entre otros bienes. Este rubro económico, a pesar de presentar bajos ni...

  9. La influenza aviar y el riesgo de infección en seres humanos

    OpenAIRE

    Vargas, Javier

    2005-01-01

    La gripe aviar es una infección causada por el virus influenza de aves. La infección ocurre de manera natural entre aves silvestres, las cuales portan el virus en su vía digestiva. Ocasionalmente pueden transmitirla a aves domésticas como gallinas, patos, palomas, etc. las cuales pueden enfermar y ocacionalmente morir. Comúnmente los virus de la influenza aviar no infectan a los seres humanos sin embargo desde 1997, se han documentado casos de infección humana.

  10. PROPAGACIÓN in vitro DE Geranium chilloense WILLD. EX KUNTH. PARA LA OBTENCIÓN DE PLANTAS COMPLETAS

    OpenAIRE

    Benavides, Thaly; Córdova, Adriana; Vaca, Ivonne

    2016-01-01

    Geranium chilloense Willd. ex Kunth es conocida con el nombre de Geranio de los Chillos, es una planta ornamental silvestre, nativa de Los Andes se encuentra distribuida en las quebradas del Distrito Metropolitano de Quito y forma parte de la historia de la flora nativa de Quito ya que ha sido descrita desde la expedición de Alexander Humboldt y Aimé Bonpland en 1802. El presente estudio presenta un protocolo de propagación in vitro de Geranium chilloense Willd. ex Kunth, para la ...

  11. Expressão do gene ASYMMETRIC LEAVES1 (AS1) em explantes radiculares de Passiflora edulis Sims e organogênese in vitro em Passiflora setacea D.C. (Passifloraceae)

    OpenAIRE

    Vieira, Lorena Melo

    2011-01-01

    O presente estudo teve como objetivos caracterizar a expressão do gene ASYMMETRIC LEAVES1 (AS1), via hibridização in situ, durante a regeneração in vitro de segmentos radiculares de Passiflora edulis Sims, espécie comercialmente cultivada, e estabelecer um protocolo reproduzível via organogênese in vitro em Passiflora setacea, espécie silvestre. Explantes radiculares de P. edulis foram cultivados em meio MS, para indução de organogênese de ramos, suplementado com 2,35 μM de BA. Para dete...

  12. Trophic ecology of the wild boar (Sus scrofa) in Chile

    OpenAIRE

    SKEWES, ÓSCAR; RODRÍGUEZ, ROBERTO; JAKSIC, FABIÁN M

    2007-01-01

    Documentamos la dieta del jabalí silvestre en el centro-sur de Chile basados en el examen de 20 estómagos colectados en los faldeos de volcán Mocho-Choshuenco (39°54' S, 72°02' O) y en el Parque Nacional Vicente Pérez Rosales (41°03' S, 71°54' O). La dieta está representada por animales, vegetales y hongos. Entre los vegetales y hongos son consumidas tanto las partes epígeas como hipógeas, lo mismo que frutos y semillas. Hongos y rizomas de Gunnera tinctoria constituyen ítemes vegetales cuant...

  13. THERMOTOLERANT Campylobacter SPECIES ISOLATED FROM PSITTACIFORMES IN THE PERUVIAN AMAZON REGION

    Directory of Open Access Journals (Sweden)

    Alvaro TRESIERRA-AYALA

    1998-07-01

    Full Text Available Foi determinada a freqüência de isolamento de campylobacters termotolerantes em Psittaciformes silvestres capturados na região amazônica do Peru. Campylobacters foram isolados em 10/142 (7.0% dos animais estudados, sendo C. jejuni subsp. jejuni biovar I (6/10 o mais freqüente, seguido de C. coli biovar II (2/10, C. lari não foi isolado. Os resultados sugerem que estas aves podem ser importantes reservatórios destas bactérias.

  14. Revisión de la producción, composición fitoquímica y propiedades nutracéuticas del orégano mexicano Revision of the production, phytochemical composition, and nutraceutical properties of Mexican oregano

    OpenAIRE

    Enrique García-Pérez; Castro-Álvarez Fernando Francisco; Janet Alejandra Gutiérrez-Uribe; Silverio García-Lara

    2012-01-01

    El orégano es una planta de distribución mundial, el cual está representado principalmente por dos especies: Origanum vulgare (Lamiaceace) nativo de Europa, y Lippia graveolens (Verbenaceae), originaria de América. México ocupa el segundo lugar como productor mundial de orégano con la especie L. graveolens H. B. K. Sin embargo, la mayoría de las especies explotadas son silvestres y su cultivo es aún tradicional y limitado. En este trabajo se presenta un análisis de las estrategias de propagac...

  15. “Diagnóstico Y Análisis De La Comercialización De Arroz Para Elaborar Una Alternativa De Mejorar La Rentabilidad De Los Productores De La Zona De Babahoyo”

    OpenAIRE

    VERA SUÁREZ, MARIBEL JESSENIA

    2012-01-01

    El cultivo del arroz comenzó hace casi 10.000 años en las regiones húmedas de Asia tropical y subtropical, posiblemente sea la India el país donde se cultivó por primera vez esta gramínea debido a que en ella abundaban los arroces silvestres. Pero el desarrollo del cultivo tuvo lugar en China, desde sus tierras bajas a sus tierras altas, probablemente hubo varias rutas por las cuales se introdujeron de Asia a otras partes del mundo. Este cultivo es el alimento básico para más de la mitad...

  16. A modification of QuEChERS method to analyse anticoagulant rodenticides using small blood samples

    OpenAIRE

    P Gómez-Ramírez; E Martínez-López; I Navas; P María-Mojica; AJ García-Fernández

    2012-01-01

    El uso de rodenticidas anticoagulantes es el método más frecuentemente utilizado para el control de plagas de roedores. Debido a sus características físico-químicas y particular mecanismo de acción, la utilización de estos compuestos en zonas rurales puede suponer un riesgo de intoxicación secundaria de sus depredadores. Para evaluar el riesgo a estos compuestos para la fauna silvestre, especialmente en aves rapaces que se alimentan de roedores, se llevan a cabo los programas de biomonitoriza...

  17. Estudo anatômico descritivo dos órgãos genitais masculinos do macaco-prego (Cebus apella Linnaeus, 1758)

    OpenAIRE

    Dulcinea Gonçalves Teixeira

    2005-01-01

    A Anatomia comparada de mamíferos é tema de grande interesse em pesquisas e tem como objetivo buscar conhecimentos que possam auxiliar o entendimento do binômio unidadevariedade. O conhecimento da Anatomia de qualquer animal silvestre é de importância capital para a sua preservação e proteção (RIBEIRO, 2002). Os primatas do novo mundo estão distribuídos na Região Neotropical das Américas Central e do Sul, (RYLANDS; MITTERMEIER; RODRÍGUEZ-LUNA, 1997). O Cebus apella, animal das matas do contin...

  18. Importancia y desafíos de la conservación de Vanilla spp. (orquidaceae) en Costa Rica

    OpenAIRE

    Azofeifa-Bolaños, José Bernal; Paniagua-Vásquez, Amelia; García-García, José Antonio

    2014-01-01

    El objetivo de este trabajo fue describir la importancia y los principales retos del uso, manejo y conservación del género Vanilla en Costa Rica. Los temas tratados fueron: taxonomía en el país y a nivel mundial, datos sobre recolección y nuevas estimaciones de parientes silvestres, la importancia económica, ecológica y social, el acervo genético de las especies costarricenses, la situación del cultivo a nivel mundial (área cosechada, producción, rendimiento, principales países productores), ...

  19. Heterosis en la longevidad de obreras Apis mielífera

    Directory of Open Access Journals (Sweden)

    J. Tello

    2001-07-01

    Full Text Available Se estimó la media y la heterosis de la longevidad en obreras de abejas Apis mellifera. El expe-rimento fue desarrollado en el Apiario del Departamento de Genética de la Facultad de Medi-cina de la USP-Ribeirão Preto-Brasil y en Jaboticabal-SP, de 03/1997 a 05/1999. Seleccionamos 8 matrices inseminadas del apiário-USP (2africanizadas, 2italianas, 2cárnicasy 2italianas*cárnicos y 2 matrices (grupo-testigo de abejas Africanizadas-Silvestres.

  20. Brote de rabia humana transmitida por gato en el municipio de Santander de Quilichao, Colombia, 2008

    OpenAIRE

    Paez, Andrés; Polo, Luis; Heredia, Damaris; Nuñez, Constanza; Rodriguez, Milena; Agudelo, Carlos; Parra, Edgar; Paredes, Andrea; Moreno, Teresa; Rey, Gloria

    2009-01-01

    Objetivos En marzo de 2008 ocurrió en el municipio de Santander de Quilichao- Cauca, Colombia, un brote de rabia de origen silvestre con 2 víctimas humanas. El presente artículo apunta a describir las técnicas diagnósticas de laboratorio, las acciones de investigación de campo y control de foco empleadas, y su significado epidemiológico e implicaciones en salud pública. Métodos La rabia se diagnosticó por inmunofluorescencia directa, prueba biológica en ratón, histopatología e inmunohistoquím...