WorldWideScience

Sample records for pira creciendo silvestre

  1. FAUNA SILVESTRE

    Directory of Open Access Journals (Sweden)

    Luis Fernando Osorio, Director 5 Simp. For.

    2012-10-01

    Full Text Available Comité científico del simposio Director Luis Fernando Osorio Vélez, Ph.D. Universidad Nacional de Colombia, sede Medellín. Colombia. Fauna silvestre Brian C. Bock, Ph.D. Universidad de Antioquia. Colombia. Jaime Polanía Vorenberg, Ph.D. Universidad Nacional de Colombia. Colombia. Joan Gastón Zamora Abrego, Ph.D. Universidad Nacional de Colombia. Colombia. Néstor Javier Mancera Rodríguez, Ph.D. Universidad Nacional de Colombia. Colombia. Sergio Solari, Ph.D. Universidad de Antioquia. Colombia.

  2. 'PiraRoxa': cultivar de alface crespa de cor vermelha intensa 'PiraRoxa': triple red lettuce cultivar

    OpenAIRE

    Fernando César Sala; Cyro Paulino da Costa

    2005-01-01

    'PiraRoxa' é uma cultivar de alface (Lactuca sativa L.) crespa de cor vermelha intensa, resistente à Bremia lactucae, Thielaviopsis basicola e LMV, patótipo II. Foi selecionada por meio do método genealógico a partir do cruzamento entre o tipo Lolla Rossa 'RS 521998' e a cv. Gizela. Apresenta plantas grandes e vigorosas, folhas crespas, coloração vermelha intensa e brilhante. Em ensaios conduzidos no verão (2003/2004) o pendoamento da 'PiraRoxa' foi de 10 e 20 dias mais lento quando comparado...

  3. 'PiraRoxa': cultivar de alface crespa de cor vermelha intensa 'PiraRoxa': triple red lettuce cultivar

    Directory of Open Access Journals (Sweden)

    Fernando César Sala

    2005-03-01

    Full Text Available 'PiraRoxa' é uma cultivar de alface (Lactuca sativa L. crespa de cor vermelha intensa, resistente à Bremia lactucae, Thielaviopsis basicola e LMV, patótipo II. Foi selecionada por meio do método genealógico a partir do cruzamento entre o tipo Lolla Rossa 'RS 521998' e a cv. Gizela. Apresenta plantas grandes e vigorosas, folhas crespas, coloração vermelha intensa e brilhante. Em ensaios conduzidos no verão (2003/2004 o pendoamento da 'PiraRoxa' foi de 10 e 20 dias mais lento quando comparado às cvs. Banchu New Red Fire e Loretta, respectivamente. Trata-se da primeira cultivar tropicalizada para o segmento de alface vermelha com resistência a doenças no Brasil.'PiraRoxa' is a triple red leaf lettuce (Lactuca sativa L. cultivar resistant to Bremia lactucae, Thielaviopsis basicola and LMV, pathotype II. This cv. was obtained through pedigree selection from the cross between a Lolla Rossa 'RS 521998' and cv. Gizela. This shiny and intense red lettuce presents vigorous plants with loose leaves. In summer trials (2003/2004 'PiraRoxa' presented slow bolting performance (10 to 20 days later in comparison to cvs. Banchu New Red Fire and Loretta. This is the first tropicalized red leaf lettuce with multiple disease resistance developed in Brazil.

  4. 'PiraRoxa': cultivar de alface crespa de cor vermelha intensa

    OpenAIRE

    Sala,Fernando César; Costa,Cyro Paulino da

    2005-01-01

    'PiraRoxa' é uma cultivar de alface (Lactuca sativa L.) crespa de cor vermelha intensa, resistente à Bremia lactucae, Thielaviopsis basicola e LMV, patótipo II. Foi selecionada por meio do método genealógico a partir do cruzamento entre o tipo Lolla Rossa 'RS 521998' e a cv. Gizela. Apresenta plantas grandes e vigorosas, folhas crespas, coloração vermelha intensa e brilhante. Em ensaios conduzidos no verão (2003/2004) o pendoamento da 'PiraRoxa' foi de 10 e 20 dias mais lento quando comparado...

  5. Migration from food contact plastics. Part I. Establishment and aims of the PIRA project.

    Science.gov (United States)

    Tice, P A; McGuinness, J D

    1987-01-01

    In the European Community regulatory approaches adopted by individual Member States to the control of food contact plastics differ markedly and, as a result, the European Commission has identified a need for harmonized legislation in this sector. The Commission requested its Scientific Committee for Food to advise on the toxicity of monomers and other starting substances used in the production of such plastics and the Committee's report has recently been published. It is apparent that, although some monomers have been studied in depth, for many little or no information was available to the Committee on either the levels migrating into food or their likely toxic effects. The Committee has requested that such information be provided within 3 years. Following discussions between the UK Ministry of Agriculture, Fisheries and Food, PIRA and companies involved in either the manufacture or use of food contact plastics, a Project has been established at PIRA to develop sensitive analytical procedures for the relevant UK-required monomers and to provide the required migration data. As a second part to this project the methodology for determining overall migration is being examined with a view to resolving existing experimental difficulties. The first analytical methods to be developed in the project are those for the determination or terephthalic acid and isophthalic acid. Residual levels of these monomers in plastics and the quantities migrating into food simulants and food have been shown to be very low.

  6. Bromeliaceae from Pico Piraí, Guaratuba Municipality (Parana, Brazil Bromeliaceae Juss. do Pico Piraí, município de Guaratuba (Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    Rosemeri Morokawa

    2011-12-01

    Full Text Available The results of a Bromeliaceae Juss. floristic survey in the Piraí Mountain, Araraquara complex(Guaratuba Municipality, Paraná State are presented. Twenty six species included in nine genera and three subfamilies were registered. Bromelioideae presented the highest genera diversity and Tillandsioideae showed the highest species diversity, including twelve species belonging to the genus Vriesea (46%. It was the first register of Nidularium procerum Lindm., Tillandsia stricta Sol. ex Ker Gawl., Vriesea altodaserrae L. B. Sm., Vriesea erythrodactylon (E. Morren E. Morren ex Mez, Vrieseaflava And.Costa, H. Luther & Wand., Vriesea friburgensis Mez, Vriesea hoehneana L. B. Sm., Vriesea inflata (Wawra Wawra e Wittrockia superba Lindm. at the Guaratuba Municipality. Dyckia leptostachya Baker was collected for the first time at the coastal zone of Paraná State, being this record done after 40 years since its last register in the State. For each species, information on phenology, geographic distribution and vulnerability level are included. Apresentam-se resultados de levantamento florístico das espécies de Bromeliaceae Juss. no Pico Piraí, Complexo do Araraquara (Guaratuba, Paraná. Verificou-se a ocorrência de 26 espécies pertencentes a nove gêneros e três subfamílias. Bromelioideae englobou a maior diversidade de gêneros e Tillandsioideae registrou-se a maior diversidade de espécies, sendo 12 delas incluídas no gênero Vriesea (46%. As seguintes espécies foram registradas pela primeira vez no município de Guaratuba: Nidularium procerum Lindm., Tillandsia stricta Sol. ex Ker Gawl., Vriesea altodaserrae L. B. Sm., Vriesea erythrodactylon (E. Morren E. Morren ex Mez, Vriesea flava And. Costa, H. Luther & Wand.,Vriesea friburgensis Mez, Vriesea hoehneana L. B. Sm., Vriesea inflata (Wawra Wawra e Wittrockia superba Lindm.. Dyckia leptostachya Baker foi registrada pela primeira vez na zona litorânea paranaense e após 40 anos do último

  7. Comercio de fauna silvestre en colombia.

    OpenAIRE

    Mancera Rodríguez, Néstor Javier; Reyes García, Otto

    2011-01-01

    Este trabajo ofrece un panorama sobre las actividades relacionadas con el comercio de bienes derivados de las especies de fauna silvestre en Colombia, abordando el tema desde el desarrollo que ha tenido su actividad productiva, el aprovechamiento extractivo, así como la dinámica de su comercio legal e ilegal en el país y el desarrollo y promoción de alternativas productivas sustentadas en su aprovechamiento. Se analizó la información secundaria de entidades como el Ministerio de Ambiente, Viv...

  8. Ranino ua uai: Palabra de cosecha de frutas silvestres

    Directory of Open Access Journals (Sweden)

    Hipolito Candre

    2016-01-01

    Full Text Available Este texto, transcrito de una narración del anciano Hipólito Candre, hace un inventario de los frutos silvestres que se encuentran en el monte y cómo eran aprovechados por las antiguas generaciones. También hace referencia a la colecta de miel silvestre, a la pesca con barbasco y trampas y la colecta de ranas comestibles en trampas. En las notas se da la identificación biológica de las especies mencionadas y se agrega información sobre sus épocas de fructificación y otras informaciones recogidas en el campo.

  9. Ranino ua uai: Palabra de cosecha de frutas silvestres

    OpenAIRE

    Hipolito Candre

    2016-01-01

    Este texto, transcrito de una narración del anciano Hipólito Candre, hace un inventario de los frutos silvestres que se encuentran en el monte y cómo eran aprovechados por las antiguas generaciones. También hace referencia a la colecta de miel silvestre, a la pesca con barbasco y trampas y la colecta de ranas comestibles en trampas. En las notas se da la identificación biológica de las especies mencionadas y se agrega información sobre sus épocas de fructificación y otras informaciones recogi...

  10. A tale of two very different comets: ISO and MSX measurements of dust emission from 126P/IRAS (1996) and 2P/Encke (1997)

    Science.gov (United States)

    Lisse, C. M.; Fernández, Y. R.; A'Hearn, M. F.; Grün, E.; Käufl, H. U.; Osip, D. J.; Lien, D. J.; Kostiuk, T.; Peschke, S. B.; Walker, R. G.

    2004-10-01

    We present the characteristics of the dust comae of two comets, 126P/IRAS, a member of the Halley family (a near-isotropic comet), and 2P/Encke, an ecliptic comet. We have primarily used mid- and far-infrared data obtained by the ISOPHOT instrument aboard the Infrared Space Observatory (ISO) in 1996 and 1997, and mid-infrared data obtained by the SPIRIT III instrument aboard the Midcourse Space Experiment (MSX) in 1996. We find that the dust grains emitted by the two comets have markedly different thermal and physical properties. P/IRAS's dust grain size distribution appears to be similar to that of fellow family member 1P/Halley, with grains smaller than 5 microns dominating by surface area, whereas P/Encke emits a much higher fraction of big (20 μm and higher) grains, with the grain mass distribution being similar to that which is inferred for the interplanetary dust population. P/Encke's dearth of micron-scale grains accounts for its visible-wavelength classification as a "gassy" comet. These conclusions are based on analyses of both imaging and spectrophotometry of the two comets; this combination provides a powerful way to constrain cometary dust properties. Specifically, P/IRAS was observed preperihelion while 1.71 AU from the Sun, and seen to have a 15-arcmin long mid-infrared dust tail pointing in the antisolar direction. No sunward spike was seen despite the vantage point being nearly in the comet's orbital plane. The tail's total mass at the time was about 8×10 9 kg. The spectral energy distribution (SED) is best fit by a modified greybody with temperature T=265±15 K and emissivity ɛ proportional to a steep power law in wavelength λ: ɛ∝ λ- α, where α=0.50±0.20 (2σ) . This temperature is elevated with respect to the expected equilibrium temperature for this heliocentric distance. The dust mass loss rate was between 150-600 kg/s (95% confidence), the dust-to-gas mass loss ratio was about 3.3, and the albedo of the dust was 0.15±0

  11. Factores asociados a parasitismo gastrointestinal en guanacos silvestres (Lama guanicoe)

    OpenAIRE

    Moreno, Pablo Gastón

    2015-01-01

    Fil: Moreno, Pablo Gastón. Universidad Nacional del Litoral. Facultad de Bioquímica y Ciencias Biológicas; Argentina. Recientes investigaciones han demostrado que el estado de salud en animales silvestres es crucial para modular las dinámicas de infección de las enfermedades. Existe un sinergismo entre la condición fisiológica, el sistema inmunológico de un individuo y su susceptibilidad para contraer enfermedades. La meta de esta tesis fue investigar los factores determinantes de abundanc...

  12. Tráfico y Venta Ilegal de Animales Silvestres en la Ciudad de Cochabamba, Bolivia

    OpenAIRE

    L P Meriles-Treviño; E R Fortón-Rojas

    2008-01-01

    Artículo divulgativo sobre venta ilegal de fauna silvestre en la Ciudad de Cochabamba, Bolívia. Identifica las problemáticas, marco legal, lugares de venta y actividades para mitigar el impacto de esta actividad.

  13. Fenologia de la floracion en tomate cultivado y especies silvestres relacionadas

    National Research Council Canada - National Science Library

    Restrepo Salazar, Edwin Fernando; Vallejo Cabrera, Franco Alirio; Lobo Arias, Mario

    2008-01-01

    En un diseno experimental de bloques completos al azar se comparo la fenologia de la floracion de doce accesiones silvestres de Solanum seccion Lycopersicum con la del tomate cultivado tipo "chonto...

  14. Sinopsis sobre la Casuística de Felinos Silvestres en la Unidad de Rescate y Rehabilitación de Animales Silvestres (URRAS): 1995 – 2008

    OpenAIRE

    Juliana Pérez; Diego Soler-Tovar; Claudia Brieva

    2009-01-01

    Entre 1995 y 2008, han ingresado 13 animales de la familia Felidae, a la Unidad de Rescate y Rehabilitación de Animales Silvestres (URRAS), como resultado del tráfico ilegal de fauna silvestre. Este estudio retrospectivo determinó el tipo de ingreso de los animales a la unidad, así como las especies que ingresaron con mayor frecuencia, las principales patologías que presentaron al ingreso o durante su estadía en la unidad, los tratamientos instaurados y su respuesta, así como el destino de lo...

  15. COMERCIO DE FAUNA SILVESTRE EN COLOMBIA WILDLIFE TRADE IN COLOMBIA

    Directory of Open Access Journals (Sweden)

    Néstor Javier Mancera Rodríguez

    2008-12-01

    Full Text Available Este trabajo ofrece un panorama sobre las actividades relacionadas con el comercio de bienes derivados de las especies de fauna silvestre en Colombia, abordando el tema desde el desarrollo que ha tenido su actividad productiva, el aprovechamiento extractivo, así como la dinámica de su comercio legal e ilegal en el país y el desarrollo y promoción de alternativas productivas sustentadas en su aprovechamiento. Se analizó la información secundaria de entidades como el Ministerio de Ambiente, Vivienda y Desarrollo Territorial, las Corporaciones Autónomas Regionales y Autoridades Ambientales Urbanas, el Instituto Colombiano de Desarrollo Rural-INCODER, las Autoridades Policiales, los Institutos de Investigación, el Departamento Administrativo Nacional de Estadística, la Dirección de Impuestos y Aduanas Nacionales-DIAN, el Ministerio de Comercio, Industria y Turismo, y PROEXPORT. entre otras. En Colombia, el comercio de especies de fauna silvestre está centrado principalmente en la extracción de ejemplares de forma ilegal, lo cual ha generado desequilibrios en las poblaciones naturales y ha repercutido en el deterioro de la dinámica de los ecosistemas. El comercio legal de fauna silvestre se basa en la producción de unas pocas especies entre las que se destacan la babilla (Caiman crocodilus, el chigüiro (Hydrochaeris hydrochaeris, cerca de 200 especies de peces ornamentales y en menor medida el lobo pollero (Tupinambis nigropunctatus, la iguana (Iguana iguana, la boa (Boa constrictor, escarabajos (Dynastes hercules y mariposas. En el país no se tiene información exacta sobre el número de incautaciones realizadas en los operativos de control al tráfico ilegal de fauna, y no existe un conocimiento de la dinámica de este comercio ilegal.This work offers a current view on the activities related to the trade of derived from the wildlife species in Colombia, approaching the topic from the development that has had its productive activity

  16. Febre amarela silvestre: reemergencia de transmissao no estado de Sao Paulo, Brasil, 2009

    OpenAIRE

    Melissa Mascheretti; Cilea H Tengan; Helena Keiko Sato; Akemi Suzuki; Renato Pereira de Souza; Marina Maeda; Roosecelis Brasil; Mariza Pereira; Rosa Maria Tubaki; Wanderley,Dalva M.V.; Carlos Magno Castelo Branco Fortaleza; Ana Freitas Ribeiro

    2013-01-01

    OBJETIVO Descrever a investigação do surto de febre amarela silvestre e as principais medidas de controle realizadas no estado de São Paulo. MÉTODOS Estudo descritivo do surto de febre amarela silvestre na região sudoeste do estado, entre fevereiro e abril de 2009. Foram avaliados casos suspeitos e confirmados em humanos e primatas não humanos. A investigação entomológica, em ambiente silvestre, envolveu captura em solo e copa de árvore para identificação das espécies e detecção de infecção...

  17. Vertebrados silvestres atropelados na BR 158, RS, Brasil

    Directory of Open Access Journals (Sweden)

    Daniela da Silva Oliveira

    2012-09-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2012v25n4p229   Entre os problemas que ameaçam a fauna silvestre, o atropelamento de animais é uma importante causa de mortalidade para várias espécies. O presente estudo visou identificar as espécies vitimadas por atropelamento em 98km da rodovia BR 158, entre o município de Cruz Alta e o distrito de Val de Serra, município de Júlio de Castilhos, RS e analisar as variações mensais nas taxas de atropelamento e sua correlação com o volume mensal de chuvas. Foram realizadas expedições mensais, entre os meses de abril a setembro de 2007, onde se registrou 61 animais atropelados pertencentes a 15 espécies, com uma taxa de atropelamento de 0,10 ind./km/mês. As espécies com maior número de atropelamentos foram o zorrilho (Conepatus chinga, com 17 indivíduos (28%, seguida pelo graxaim-do-campo (Lycalopex gymnocercus, com sete (11% e o graxaim-do-mato (Cerdocyon thous, com cinco (8%. Não foi encontrada diferença nas taxas de atropelamento entre os meses amostrados, contudo, o mês com maior registro de atropelamentos foi setembro (n=18. Também não foi verificada correlação entre os atropelamentos e a precipitação mensal, no entanto, há uma tendência entre a ocorrência dos atropelamentos com um volume maior de chuvas.

  18. Estudio de la triquinelosis en la fauna silvestre del noroeste español

    OpenAIRE

    2016-01-01

    La triquinelosis en España se considera una zoonosis endémica cuyo ciclo doméstico está aparentemente controlado, pero todos los años aparecen brotes en humana relacionados con el consumo de carne de cerdo y jabalí sin control sanitario. En este sentido, la fauna silvestre actúa de reservorio de Trichinella spp., especialmente el jabalí y los carnívoros. Para conocer la situación epidemiológica actual de Trichinella spp. en la fauna silvestre de Galicia, hemos realizado el estudio más ampl...

  19. Abejas silvestres (Hymenoptera: Apoidea) como bioindicadores en el neotrópico

    OpenAIRE

    Enrique Reyes-Novelo; Virginia Meléndez Ramírez; Hugo Delfín González; Ricardo Ayala

    2009-01-01

    Este trabajo es una revisión sobre el potencial de las abejas silvestres como grupo indicador en estudios de diversidad y fragmentación de hábitat. Se describen los criterios utilizados para seleccionar grupos de organismos como bioindicadores y se discute la información disponible para evaluar si las abejas pueden ser consideradas idóneas. La información disponible sugiere que las abejas silvestres cumplen con los criterios requeridos para considerarlas un grupo indicador y se recomienda su ...

  20. Valoración de la actividad antioxidante de verduras silvestres

    OpenAIRE

    Morales, Patricia; Fernández-Ruiz, Virginia; Sánchez Mata, María de Cortés; Cámara Hurtado, Montaña; Carvalho, Ana Maria; Pardo de Santayana, Manuel; Tardío, Javier; Isabel C. F. R. Ferreira

    2013-01-01

    En los últimos años se han llevado a cabo diversos estudios para evaluar el potencial nutricional y funcional de las plantas silvestres comestibles. Algunas de ellas son una buena fuente de compuestos bioactivos y han demostrado tener una interesante actividad biológica como antioxidantes. Por ello, este trabajo tiene como objetivo principal evaluar la actividad biológica in vitro de la parte comestible de 20 verduras silvestres tradicionalmente consumidas en la Península Ibérica, cuantifica...

  1. CITES felinos salvajes : (convenio sobre el comercio internacional de especies amenazadas de fauna y flora silvestres) /

    OpenAIRE

    Cabanellas Cabezas, Ana María.; Gómez Baca, Miriam.; González Medina, Sara.

    2011-01-01

    CITES: Convention on International Trade in Endangered Species of Wild Fauna and Flora = Conveni sobre el Comerç Internacional d’Espècies Amenaçades de Fauna i Flora Silvestre. Treball presentat a l'assignatura de Deontologia i Veterinària Legal (21223)

  2. Parásitos de animales silvestres en cautiverio en Lima, Perú

    Directory of Open Access Journals (Sweden)

    Lily Arrojo

    2013-06-01

    Full Text Available Los parásitos de los animales silvestres en cautiverio peruanos se registran aquí. La mayoría de las especies son nematodos. Dos especies son al patógeno de host: Prosthenorchois elegans y Strongyloides sp.

  3. Feasibility and impact of Creciendo Sanos, a clinic-based pilot intervention to prevent obesity among preschool children in Mexico City.

    Science.gov (United States)

    Martínez-Andrade, Gloria Oliva; Cespedes, Elizabeth M; Rifas-Shiman, Sheryl L; Romero-Quechol, Guillermina; González-Unzaga, Marco Aurelio; Benítez-Trejo, María Amalia; Flores-Huerta, Samuel; Horan, Chrissy; Haines, Jess; Taveras, Elsie M; Pérez-Cuevas, Ricardo; Gillman, Matthew W

    2014-03-20

    Mexico has the highest adult overweight and obesity prevalence in the Americas; 23.8% of children obese. Creciendo Sanos was a pilot intervention to prevent obesity among preschoolers in Instituto Mexicano del Seguro Social (IMSS) clinics. We randomized 4 IMSS primary care clinics to either 6 weekly educational sessions promoting healthful nutrition and physical activity or usual care. We recruited 306 parent-child pairs: 168 intervention, 138 usual care. Children were 2-5 years old with WHO body mass index (BMI) z-score 0-3. We measured children's height and weight and parents reported children's diet and physical activity at baseline and 3 and 6-month follow-up. We analyzed behavioral and BMI outcomes with generalized mixed models incorporating multiple imputation for missing values. 93 (55%) intervention and 96 (70%) usual care families completed 3 and 6-month follow-up. At 3 months, intervention v. usual care children increased vegetables by 6.3 servings/week (95% CI, 1.8, 10.8). In stratified analyses, intervention participants with high program adherence (5-6 sessions) decreased snacks and screen time and increased vegetables v. usual care. No further effects on behavioral outcomes or BMI were observed. Transportation time and expenses were barriers to adherence. 90% of parents who completed the post-intervention survey were satisfied with the program. Although satisfaction was high among participants, barriers to participation and retention included transportation cost and time. In intention to treat analyses, we found intervention effects on vegetable intake, but not other behaviors or BMI. ClinicalTrials.gov NCT01539070.Comisión Nacional de Investigación Científica del IMSS: 2009-785-120.

  4. Feasibility and impact of Creciendo Sanos, a clinic-based pilot intervention to prevent obesity among preschool children in Mexico City

    Science.gov (United States)

    2014-01-01

    Background Mexico has the highest adult overweight and obesity prevalence in the Americas; 23.8% of children obese. Creciendo Sanos was a pilot intervention to prevent obesity among preschoolers in Instituto Mexicano del Seguro Social (IMSS) clinics. Methods We randomized 4 IMSS primary care clinics to either 6 weekly educational sessions promoting healthful nutrition and physical activity or usual care. We recruited 306 parent-child pairs: 168 intervention, 138 usual care. Children were 2-5 years old with WHO body mass index (BMI) z-score 0-3. We measured children’s height and weight and parents reported children’s diet and physical activity at baseline and 3 and 6-month follow-up. We analyzed behavioral and BMI outcomes with generalized mixed models incorporating multiple imputation for missing values. Results 93 (55%) intervention and 96 (70%) usual care families completed 3 and 6-month follow-up. At 3 months, intervention v. usual care children increased vegetables by 6.3 servings/week (95% CI, 1.8, 10.8). In stratified analyses, intervention participants with high program adherence (5-6 sessions) decreased snacks and screen time and increased vegetables v. usual care. No further effects on behavioral outcomes or BMI were observed. Transportation time and expenses were barriers to adherence. 90% of parents who completed the post-intervention survey were satisfied with the program. Conclusions Although satisfaction was high among participants, barriers to participation and retention included transportation cost and time. In intention to treat analyses, we found intervention effects on vegetable intake, but not other behaviors or BMI. Trial registration ClinicalTrials.gov NCT01539070. Comisión Nacional de Investigación Científica del IMSS: 2009-785-120. PMID:24649831

  5. Evaluacion constante del virus de la enfermedad de Newcastle en aves silvestres de la laguna albufera de medio mundo

    National Research Council Canada - National Science Library

    Mendoza R., Luis; Icochea D., Eliana; Gonzalez Z., Armando; Gonzalez V., Rosa

    2012-01-01

    El estudio evaluo la presencia del virus de la Enfermedad de Newcastle en la laguna Albufera de Medio Mundo, situada al norte de Lima, y habitada por diversas especies de aves silvestres y migratorias...

  6. ZOONOSIS TRANSMITIDAS POR ANIMALES SILVESTRES Y SU IMPACTO EN LAS ENFERMEDADES EMERGENTES Y REEMERGENTES

    Directory of Open Access Journals (Sweden)

    Santiago Monsalve B

    2009-08-01

    Full Text Available Las enfermedades emergentes y reemergentes originadas desde animales de vida silvestre, pueden ser transmitidas a las poblaciones humanas por contacto directo o por vectores. Las zoonosis determinan una gran problemática social epidemiológica. La relación que tiene las enfermedades emergentes y reemergentes está ligada a la pérdida de la biodiversidad por factores antropogénicos, debido a la destrucción de hábitats naturales, el tráfico de fauna y a la pérdida de diversidad genética. Todos estos aspectos juegan un papel en la aparición de las patologías de origen infeccioso. Esta revisión intenta acercarse al conocimiento de las zoonosis transmitidas por animales silvestres y su impacto en las enfermedades emergentes y reemergentes.

  7. USO Y APROVECHAMIENTO DE LA FAUNA SILVESTRE EN LA SELVA ZOQUE, MÉXICO

    OpenAIRE

    Lira-Torres, Iván; Briones-Salas, Miguel; Fabián Ricardo GÓMEZ DE ANDA; Deyanira OJEDA-RAMÍREZ; Peláez Acero, Armando

    2014-01-01

    La cacería de subsistencia y la pérdida de hábitat son dos de las principales actividades humanas que tienen un efecto negativo sobre la fauna silvestre en las fronteras de colonización. En la presente investigación se estudió el uso consuntivo que se da a la fauna silvestre en varias comunidades de la Selva Zoque, México. Durante el año 2012 y principios del 2013 se realizó una serie de visitas a la región para conocer y listar la riqueza de especies y usos que los habitantes hacen de ella, ...

  8. [Reseñas Bibliográficas] Atlas de la flora vascular silvestre de Burgos

    Directory of Open Access Journals (Sweden)

    Iñaki Aizpuru

    2005-01-01

    Full Text Available Es una reseña bibliográfica de la obra, Atlas de la flora vascular silvestre de Burgos / Alejandre Sáenz, J.M. García-López, L. Marín Padellano, G. Mateo Sanz, E. Miguélez del coso, C. Molina Martín, G. Montamarta Prieto, S. Patino Sánchez, M.A. Pinto Cebrián 6 J. Valencia Janices.

  9. CARNE DE MONTE Y CONSUMO DE FAUNA SILVESTRE EN LA ORINOQUIA Y AMAZONIA ( COLOMBIA Y VENEZUELA)

    OpenAIRE

    2012-01-01

    Este taller regional estuvo dirigido al tema de carne de monte, consumo de fauna silvestre y procesos alternativos (cría de animales en cautiverio y piscicultura extensiva, entre otros), como elementos que aportan a la seguridad alimentaria de las comunidades locales (rurales e indígenas) en la Orinoquia y Amazonia (Colombia -­ Venezuela). Este evento tuvo como antecedente tres talleres realizados desde 2009 (talleres II, III, IV) y reuniones de expertos llevadas a cabo en 2002 para actual...

  10. DESTINO DOS ANIMAIS SILVESTRES RECEBIDOS PELO CRIADOURO CONSERVACIONISTA DA UNIVERSIDADE DO VALE DO PARAÍBA

    Directory of Open Access Journals (Sweden)

    Terezinha Fátima Oliveira

    2017-01-01

    Full Text Available A fauna silvestre vem sendo ameaçada pela constante retirada de animais da natureza. Como uma possibilidade de minimizar o problema foram criados empreendimentos que visam a conservação ex situ da fauna, fazendo a recepção, tratamento e reabilitação. O levantamento dos dados a respeito do recebimento e das reintroduções de animais silvestres foi realizado a partir da movimentação do plantel durante os anos de 2012 a 2014. No período amostrado o recebimento de animais totalizou em 3.270 exemplares, sendo 5,44% répteis, 83,42% aves e 11,14% mamíferos. No mesmo período foram reintroduzidos 2.798 animais, sendo 7,58% répteis,  82,02% aves  e 10,40% mamíferos.  Levando-se em consideração os dados apresentados observa-se que foram repatriados na natureza 85,56% dos animais recebidos de 2012 a 2014, indicando um sucesso das reabilitações e na colaboração da conservação das espécies de animais silvestres.

  11. Diagnóstico de animais ilegais recebidos no centro de triagem de animais silvestres de Belo Horizonte, Estado de Minas Gerais, no ano de 2011

    OpenAIRE

    Freitas,Ana Cláudia Parreiras de; Oviedo-Pastrana,Misael Enrique; Vilela,Daniel Ambrózio da Rocha; Pereira,Pedro Lúcio Lithg; Loureiro,Lucas de Oliveira Carneiro; Haddad,João Paulo Amaral; Martins,Nelson Rodrigo da Silva; Soares,Danielle Ferreira de Magalhães

    2015-01-01

    O centro de triagem de animais silvestres em Belo Horizonte (CETAS-BH) é um dos órgãos responsáveis pelo recebimento de animais silvestres em Minas Gerais (MG). O conhecimento da fauna mantida ilegal é ferramenta importante para a conservação dos animais silvestres, pois permite o aprimoramento da educação ambiental e das ações fiscalizadoras. Objetivou-se diagnosticar as espécies da fauna silvestre apreendidas ou entregues voluntari...

  12. Diagnóstico de animais ilegais recebidos no centro de triagem de animais silvestres de Belo Horizonte, Estado de Minas Gerais, no ano de 2011

    OpenAIRE

    Ana Cláudia Parreiras de Freitas; Misael Enrique Oviedo-Pastrana; Daniel Ambrózio da Rocha Vilela; Pedro Lúcio Lithg Pereira; Lucas de Oliveira Carneiro Loureiro; João Paulo Amaral Haddad; Nelson Rodrigo da Silva Martins; Danielle Ferreira de Magalhães Soares

    2015-01-01

    O centro de triagem de animais silvestres em Belo Horizonte (CETAS-BH) é um dos órgãos responsáveis pelo recebimento de animais silvestres em Minas Gerais (MG). O conhecimento da fauna mantida ilegal é ferramenta importante para a conservação dos animais silvestres, pois permite o aprimoramento da educação ambiental e das ações fiscalizadoras. Objetivou-se diagnosticar as espécies da fauna silvestre apreendidas ou entregues voluntariamente no CETAS-BH e analisar espacialmente sua distribuição...

  13. Estimativas de parâmetros populacionais e demográficos de Ozotoceros bezoarticus (Artiodactyla, Cervidae em Piraí do Sul, Paraná, sul do Brasil Estimates of population and demographic parameters of Ozotoceros bezoarticus (Artiodactyla, Cervidae in Piraí do Sul, Paraná, southern Brazil

    Directory of Open Access Journals (Sweden)

    Fernanda G. Braga

    2010-06-01

    Full Text Available Este estudo foi realizado em duas propriedades particulares, situadas no município de Piraí do Sul, sul do Brasil. Foram realizadas 16 fases de campo mensais, com três dias de duração, no período compreendido entre fevereiro de 2001 e maio de 2002, com o objetivo de obter informações sobre a biologia do veado-campeiro (Ozotoceros bezoarticus Linnaeus, 1758 e identificar os principais fatores de impacto sobre o mesmo. Foram computadas 1.065 observações, estimando-se 71,45 indivíduos na população, sendo o tamanho médio dos grupos de 2,29 (DV ± 0,55, e a razão sexual de 0,83. Indivíduos isolados corresponderam a 40% das observações, sendo o maior grupo composto por 10 indivíduos. Registrou-se um pico de nascimentos entre setembro e novembro, embora esses tenham acontecido ao longo de todo o estudo. Foram registrados 34 óbitos, correspondendo a uma mortalidade de 47,6%, sendo as principais causas a predação por Puma concolor (Linnaeus, 1771, a caça e os atropelamentos. A população estudada encontra-se severamente ameaçada, e não sobreviverá por muito tempo a menos que políticas que garantam a sua conservação sejam adotadas. Estas políticas devem incluir o manejo adequado das áreas e o controle dos vetores de pressão.This study was conducted in two private properties in the municipality of Piraí do Sul (Paraná state, southern Brazil. Sixteen monthly visits were made each one lasting three days between February 2001 and May 2002. The study aimed at the observation of pampas deer biology (Ozotoceros bezoarticus Linnaeus, 1758, and the evaluation of main impacts to this population. We computed 1,065 observations of estimated 71.45 individuals. The average size of the groups was 2.29 (SD ± 0.55 animals, and the sexual ratio was 0.83. Isolated deer accounted for 40% of the observations, whereas the largest group comprised 10 individuals. It was recorded a peack period of births between September and November, although

  14. ZOONOSIS TRANSMITIDAS POR ANIMALES SILVESTRES Y SU IMPACTO EN LAS ENFERMEDADES EMERGENTES Y REEMERGENTES

    OpenAIRE

    Santiago Monsalve B; Salim Mattar V.; Marco Gonzalez T.

    2009-01-01

    Las enfermedades emergentes y reemergentes originadas desde animales de vida silvestre, pueden ser transmitidas a las poblaciones humanas por contacto directo o por vectores. Las zoonosis determinan una gran problemática social epidemiológica. La relación que tiene las enfermedades emergentes y reemergentes está ligada a la pérdida de la biodiversidad por factores antropogénicos, debido a la destrucción de hábitats naturales, el tráfico de fauna y a la pérdida de diversidad genética. Todos es...

  15. UTILIZACIÓN DE MARCADORES MOLECULARES PARA EL ESTUDIO DE HONGOS BASIDIOMICETES SILVESTRES

    OpenAIRE

    Blanca Estela Gómez-Luna; Gerardo Vázquez-Marrufo; Carlos Hernán Herrera-Méndez; Alejandro Hernández-Morales; Víctor Olalde-Portugal

    2012-01-01

    Las técnicas de marcadores moleculares en el estudio de basidiomicetos silvestres, son cada vez más aplicadas a proyectos de ecología, con especial enfoque en análisis de la diversidad genética. Con frecuencia se requieren métodos especializados para la extracción del DNA de organismos de ambientes naturales, debido a los complejos compuestos que los constituyen (polímeros de carbohidratos) y los contaminantes del ambiente (partículas de suelo). Los materiales biológicos utilizados fueron bas...

  16. La Dánae burlesca de Pedro Silvestre: edición anotada

    OpenAIRE

    Fernandez López, Esther

    2016-01-01

    Ofrecemos en el presente trabajo la edición de un poema basado en el mito de Dánae que fue compuesto en el siglo xviii por un autor que firmaba bajo el seudónimo de Pedro Silvestre. El mayor interés de esta composición radica en el hecho de ser una de las escasas muestras que encontramos en la literatura española de una fábula burlesca que desarrolla este mito clásico. Nuestro trabajo ofrece la transcripción modernizada -basada en el único manuscrito existente- de este texto hasta ahora inédi...

  17. Formas de apropiación de las áreas silvestres protegidas de Costa Rica

    OpenAIRE

    Fournier Solano, Maria Elena

    2016-01-01

    En este ensayo se trata de denunciar algunas de las distintas formas de privatización de las Áreas Silvestres Protegidas (ASP) en especial de los parques nacionales en las últimas décadas en Costa Rica, en el marco de los intereses económicos de las políticas internacionales, en especial la establecida a través del Proyecto Mesoamericano (antes Plan Puebla Panamá) del Banco Mundial, (FMI) y los CAFTA, tratados de libre comercio con países como China, entre otros. Se destaca la participación d...

  18. Fauna silvestre y productos derivados decomisados durante el período 2000-2007, Lima – Perú

    OpenAIRE

    Quevans, Nathaly; Falcón, Néstor; Facultad de Medicina Veterinaria y Zootecnia, Universidad Peruana Cayetano Heredia. Lima.; Elías, Roberto; Facultad de Medicina Veterinaria y Zootecnia, Universidad Peruana Cayetano Heredia. Lima

    2014-01-01

    Objetivos: Describir las características del decomiso de animales silvestres y productos derivados realizado por la Administración Técnica Forestal y de Fauna Silvestre (ATFFS) durante el período 2000 – 2007 en la ciudad de Lima – Perú. Material y métodos: Para ello, se revisó la base de datos de decomisos de la ATFFS para el período de estudio. Resultados: se encontró 17 932 animales vivos y 81 564 productos derivados decomisados en el período 2000-2007. Entre los animales vivos, el 47,3% (8...

  19. CONOCIMIENTO TRADICIONAL SOBRE LOS HONGOS SILVESTRES EN LA COMUNIDAD OTOMÍ DE SAN PEDRO ARRIBA; TEMOAYA, ESTADO DE MÉXICO

    OpenAIRE

    Fidel Lara-Vázquez; Alejandro T. Romero-Contreras; Cristina Burrola-Aguilar

    2013-01-01

    Los hongos silvestres hoy en día constituyen, en diferentes comunidades campesinas, un recurso forestal no maderable en temporada de lluvias, debido a su gran importancia cultural, alimenticia y económica. La presente investigación se realizó con el objetivo de identificar el conocimiento tradicional y manejo familiar de las principales especies de hongos silvestres en la comunidad de San Pedro Arriba, Temoaya, Estado de México. En el tianguis de la cabecera municipal se aplicaron entrevistas...

  20. Diagnóstico de enfermedades en mamíferos, aves y salmónidos silvestres

    OpenAIRE

    anonymous

    2009-01-01

    Elaborado por el Área de Sanidad Animal (SERIDA - Gijón) El SERIDA y la Consejería de Medio Ambiente, Ordenación del Territorio e Infraestructuras del Principado de Asturias suscribieron en 2001 un convenio por el que el SERIDA asesora en el diagnóstico de las enfermedades de los mamíferos, aves y salmónidos silvestres de Asturias. Hasta el momento se realizaron, en lo que respecta a los mamíferos y aves silvestres, 502 necropsias, 1.334 análisis serológicos, 85 estudios histológicos y 56 ...

  1. Uso de la fauna silvestre del Lago de Tota. Peces, herpetos, aves y mamíferos.

    OpenAIRE

    Moncaleano Niño, Angela Margarita; Calvachi Zambrano, Byron Alonso

    2011-01-01

    En este estudio, se realiza una aproximación a la identificación de la fauna silvestre de Lago de Tota (Aquitania-Boyacá), particularmente de los grupos de peces, herpetos, aves y mamíferos. Además, se hacen aportes importantes para el conocimiento de la relación de las comunidades de habitantes aledañas con la fauna silvestre, en cuanto a su uso comercial o artesanal. Se realizaron los listados de las especies presentes en lago para cada uno de los grupos de la fauna, a partir de información...

  2. Métodos de estudio de la reproducción en hembras de ungulados silvestres

    Directory of Open Access Journals (Sweden)

    Riveros F., José Luis.

    2010-10-01

    Full Text Available ResumenEl presente trabajo tiene por objetivo describir el estado actual yproyecciones de las técnicas de estudio de la reproducción en hembras de ungulados silvestres. Inicialmente se caracteriza su estrategia reproductiva y las limitaciones en el conocimiento de su fisiología, dadas por las dificultades en la aplicación de las técnicas utilizadas en especies domésticas. Posteriormente, se describen las técnicas de estudio más utilizadas en ungulados silvestres, comenzando con estudios etológicos, que permiten caracterizar la estación reproductiva mediante la observación de frecuencias de cortejo, monta y partos.SummaryThe present review is focused on the recent advances and perspectives on female ungulates reproduction research techniques. First the reproductive strategy and the reproduction knowledge limitation given by application difficulties of techniques used in domestic species are characterized. Second the mean methods for studies on reproductive morphology and physiology are described beginning with behavior studies that allow reproductive season characterization by the observation of courtship, mate and birth frequencies.

  3. Uso tradicional de fauna silvestre por el grupo mayangna de Musawás en la Reserva de Biosfera Bosawas

    Directory of Open Access Journals (Sweden)

    Marlon José López González

    2001-08-01

    Full Text Available La presente investigación Se llevó a cabo en la comunidad de Musawás, municipio de Bonanza, Región Autónoma Atlántico Norte, en la Reserva Bosawas. Se realizó una descripción de los principales usos de la fauna silvestre por parte de los indígenas mayangnas. Se encontró que el 100% de los entrevistados hacen uso de la fauna silvestre para la alimentación, un 12% para artesanía, un 55% para el comercio, un 53% para medicina, un 20% para diversión y un gran porcentaje hace un uso mítico de la fauna silvestre. Esta gama de usos cobra una gran importancia en la preservación del recurso fauna. En los mitos se encontraron formas específicas de explicación y ordenamiento de los sucesos con la fauna silvestre; de esta manera responden y explican los fenómenos naturales y las actividades de sobrevivencia consideradas como sobrenaturales.

  4. Reproducción de cochinilla silvestre Dactylopius opuntiae (Homóptera: Dactylopiidae) Reproduction of wild cochineal Dactylopius opuntiae (Homoptera: Dactylopiidae)

    OpenAIRE

    2006-01-01

    Por sus características, la cochinilla silvestre ofrece perspectivas de aprovechamiento como fuente de carmín y para el mejoramiento genético de la grana fina. Por lo anterior, se estableció una multiplicación y crianza de cochinilla silvestre, proveniente de la zona árida del norte de México para caracterizarla, utilizando como hospedero a Opuntia megacantha Salm Dyck. Los resultados indican que la especie silvestre pertenece al género-especie Dactylopius opuntia. Se determinó la presencia d...

  5. Arbovírus Ilheus em aves silvestres (Sporophila caerulescens e Molothrus bonariensis

    Directory of Open Access Journals (Sweden)

    Pereira Luiz Eloy

    2001-01-01

    Full Text Available OBJETIVO: Relatar o isolamento do vírus Ilheus no Estado de São Paulo e avaliar o seu impacto para a saúde pública. MÉTODOS: O isolamento de vírus foi realizado em camundongos albinos Swiss, a partir de sangue de aves silvestres, capturadas com redes de espera tipo mist net, armadas no nível do solo, no Parque Ecológico do Tietê, São Paulo. A identificação das cepas isoladas foi feita pelos testes de inibição da hemaglutinação, fixação de complemento e neutralização em camundongos. Amostras de plasma de aves e de mamíferos silvestres foram submetidas à pesquisa sorológica para detecção de anticorpos inibidores de hemaglutinação. RESULTADOS: Foram isoladas duas cepas do vírus Ilheus em sangue de aves das espécies Sporophila caerulescens e Molothrus bonariensis e detectados anticorpos em aves das espécies Columbina talpacoti, Geopelia cuneata, Molothrus bonariensis e Sicalis flaveola, em sagüis das espécies Callithrix jacchus e Callithrix penicillata e no quati Nasua nasua. CONCLUSÕES: O isolamento do vírus Ilheus e a detecção de anticorpos específicos em aves residentes, migratórias e de cativeiro, em sagüis e quatis, comprovam a presença desse agente no Parque Ecológico do Tietê. O comportamento migratório de aves silvestres pode determinar a introdução do vírus em outras regiões. Considerando-se a patogenicidade para o homem e a confirmação da circulação desse agente viral em área urbana, freqüentada para atividade de lazer e de educação, o risco de ocorrência de infecção na população humana não pode ser descartado.

  6. Orientalismos peninsulares en el levante andaluz. Nombres y usos de algunas plantas silvestres

    Directory of Open Access Journals (Sweden)

    Torres Montes, Francisco

    2000-06-01

    Full Text Available The author describes sorne wild plants from the provinces of Almería, Granada and Jaén (Andalusia, Spain that have folk names from Eastern Iberia. For each plant he provides the scientific and folk name, the isoglottic line and the lexical arca. He also informs about the use of these plants in folk and household medecine, religious rites, animal husbandry, etc.En este estudio se presentan algunas plantas silvestres de Almería, Granada y Jaén cuyos nombres vulgares proceden del oriente peninsular. De cada planta se da, junto al nombre vulgar y científico, la isoglosa o límite de los orientalismos y sus correspondientes áreas léxicas. Al mismo tiempo se hace el estudio etnográfico de sus usos en la medicina popular o doméstica, ritos religiosos, ganadería, etc.

  7. Psychromicrobium silvestre gen. nov., sp. nov., a novel actinobacterium isolated from alpine forest soils.

    Science.gov (United States)

    Schumann, Peter; Zhang, De-Chao; Franca, Luís; Albuquerque, Luciana; da Costa, Milton S; Margesin, Rosa

    2016-11-21

    Two Gram-stain-variable, non-motile, catalase-positive and cytochrome c oxidase-negative bacteria, designated AK20-18T and AM20-54, were isolated from forest soil samples collected in the Italian Alps. Growth occurred at a temperature range of 5-30 °C, at pH 6-9 and in the presence of 0-5 % (w/v) NaCl. The 16S rRNA gene sequence similarity between strains AK20-18T and AM20-54 was 100 %. Phylogenetic analysis based on 16S rRNA gene sequence showed that AK20-18T had highest 16S rRNA gene sequence similarity with the type strain of Arthrobacter psychrochitiniphilus (96.9 %). The cell-wall peptidoglycan structure of strain AK20-18T was of the type A3alpha L-Lys - L-Thr - L-Ala2 (A11.27). The whole-cell sugars were galactose, ribose and lower amounts of mannose. The major respiratory quinone of the two strains was menaquinone 9(H2) (MK-9 [H2]), whereas MK-10(H2) was a minor component. The polar lipids were diphosphatidylglycerol, phosphatidylglycerol, phosphatidylinositol and unknown glycolipids. The major cellular fatty acids were anteiso-C15:0, iso-C15:0, iso-C16:0 and anteiso-C17:0. The genomic DNA G+C content was 59.9 mol%. Combined data of phylogenetic, phenotypic and chemotaxonomic analysis demonstrated that strains AK20-18T and AM20-54 represent a novel genus and species, for which the name Psychromicrobium silvestre gen. nov., sp. nov. is proposed. The type strain of Psychromicrobium silvestre is AK20-18T (DSM 102047T = LMG 29369 T).

  8. CARACTERIZACIÓN MOLECULAR DE ACCESIONES CULTIVADAS Y SILVESTRES DE FRIJOL COMÚN DE HONDURAS

    Directory of Open Access Journals (Sweden)

    Marcelino Santiago Guachambala-Cando

    2010-01-01

    Full Text Available Para determinar la diversidad genética de las accesiones de Phaseolus que se conservan en el Banco de Germoplasma, un grupo de 69 accesiones de frijol común (Phaseolus vulgaris L. y de P. coccineus de Honduras, fueron evaluadas con 30 cebadores mediante la técnica de marcadores moleculares RAPD (Polimorfismos de ADN Amplificados al Azar, generándose 341 fragmentos polimórficos de ADN. Las distancias genéticas fueron determinadas según el coeficiente (o índice de similaridad de Dice y el método UPGMA. Estos análisis moleculares identificaron dos grupos a partir de un coeficiente de Dice (CD de 0,48, uno perteneciente a P. vulgaris y el otro a P. coccineus. Las accesiones de P. vulgaris, mostraron una división marcada (CD de 0,64 entre las pertenecientes a los reservorios andino y mesoamericano. Por otro lado, las accesiones mesoamericanas se separaron (CD de 0,76 en cuatro grupos, correspondientes a las accesiones silvestres, las variedades de la raza Jalisco, y las variedades mejoradas y criollas de la raza Mesoamérica. Los resultados confirmaron las distancias genéticas esperadas, incluyendo mayor distancia entre las especies de Phaseolus, seguidas de la separación entre las accesiones del reservorio andino y el mesomericano de P. vulgaris. En el reservorio mesoamericano, las dos accesiones de la raza Jalisco presentaron menor similitud que las de la raza Mesoamérica, y dentro de la raza Mesoamérica, los silvestres separados de los cultivados; adicionalmente, las mejoradas relativamente diferentes a las criollas.

  9. Population viability of Alouatta palliata (Primates: Atelidae) and Cebus capucinus (Primates: Cebidae) at Refugio de Vida Silvestre Privado Nogal, Sarapiquí, Heredia, Costa Rica

    National Research Council Canada - National Science Library

    Rodríguez-Matamoros, Jorge; Villalobos-Brenes, Federico; Gutiérrez-Espeleta, Gustavo A

    2012-01-01

    .... The aim of this work was to study the effects of population fragmentation on the long term viability of Alouatta palliata and Cebus capucinus populations, at Refugio de Vida Silvestre Privado Nogal, Sarapiquí (RVSPN), Heredia...

  10. Composición proximal y perfil de ácidos grasos de juveniles silvestres y cultivados de Totoaba macdonaldi

    OpenAIRE

    L.M. López; E. Durazo; A. Rodríguez-Gómez; C. D. True; Viana,M.T.

    2006-01-01

    Se determinaron la composición proximal y el perfil de ácidos grasos en el tejido muscular y vísceras de juveniles silvestres y cultivados de Totoaba macdonaldi, encontrándose diferencias en composición debido al origen de sus dietas. El ácido graso 20:4n-6 y la razón n-3/n-6 en el músculo de las totoabas silvestres resultaron significativamente mayores que los encontrados en las totoabas cultivadas; además, el nivel del ácido graso 18:2n-6 en el tejido muscular y vísceras de los peces cultiv...

  11. Leishmaniose tegumentar alviericana na Ilha Grande, Rio de Janeiro: III. reservatórios silvestres e comensais

    Directory of Open Access Journals (Sweden)

    Nelson A. de Araújo Filho

    1981-12-01

    Full Text Available Em 203 animais silvestres e comensais examinados na Praia Vermelha, Ilha Grande, município de Angra dos fíeis, RJ, durante o estudo de um surto de Leishmaniose Tegumentar Americana, foram encontrados 2 exemplares de Proechimys dimidiatus, com lesões hipocrômicas nas extremidades das orelhas, e 1 exemplar de Rattus norvegicus norvegicus, com úlcera de dorso, cuja histopatologia revelou a presença de Leishmania sp. nos 3 exemplares.

  12. Aislamiento de Vibrio sp. a partir de órganos internos de Dormitator latifrons (Richarson, 1844 silvestres – Reporte preliminar

    Directory of Open Access Journals (Sweden)

    Raúl Mendoza-Rodríguez

    2006-09-01

    Full Text Available Se informa el hallazgo de Vibrio sp.utilizando medio de cultivo selectivoTCBS de muestras de tracto intestinal deejemplares de “monengue” Dormitatorlatifrons silvestres, especie que sealimenta principalmente de detritus enambientes inundados de zonas costeras.This report it shows the finding results ofVibrio sp. using selective culture TCBSfrom intestine samples of fishes “Pacificfat sleepers” Dormitator latifronssavages, species that is fed mainly ondetritus in flooded environments ofcoastal zones.

  13. Febre amarela silvestre: reemergencia de transmissao no estado de Sao Paulo, Brasil, 2009

    Directory of Open Access Journals (Sweden)

    Melissa Mascheretti

    2013-10-01

    Full Text Available OBJETIVO Descrever a investigação do surto de febre amarela silvestre e as principais medidas de controle realizadas no estado de São Paulo. MÉTODOS Estudo descritivo do surto de febre amarela silvestre na região sudoeste do estado, entre fevereiro e abril de 2009. Foram avaliados casos suspeitos e confirmados em humanos e primatas não humanos. A investigação entomológica, em ambiente silvestre, envolveu captura em solo e copa de árvore para identificação das espécies e detecção de infecção natural. Foram realizadas ações de controle de Aedes aegypti em áreas urbanas. A vacinação foi direcionada para residentes dos municípios com confirmação de circulação viral e nos municípios contíguos, conforme recomendação nacional. RESULTADOS Foram confirmados 28 casos humanos (letalidade 39,3% em áreas rurais de Sarutaiá, Piraju, Tejupá, Avaré e Buri. Foram notificadas 56 mortes de primatas não humanos, 91,4% do gênero Alouatta sp . A epizootia foi confirmada laboratorialmente em dois primatas não humanos, sendo um em Buri e outro em Itapetininga. Foram coletados 1.782 mosquitos, entre eles Haemagogus leucocelaenus , Hg. janthinomys/capricornii , Sabethes chloropterus , Sa. purpureus e Sa. undosus . O vírus da febre amarela foi isolado de um lote de Hg. leucocelaenus procedente de Buri. A vacinação foi realizada em 49 municípios, com 1.018.705 doses aplicadas e o registro de nove eventos adversos graves pós-vacinação. CONCLUSÕES Os casos humanos ocorreram entre fevereiro e abril de 2009 em áreas sem registro de circulação do vírus da febre amarela há mais de 60 anos. A região encontrava-se fora da área com recomendação de vacinação, com alto percentual da população suscetível. A adoção oportuna de medidas de controle permitiu a interrupção da transmissão humana em um mês, assim como a confirmação da circulação viral em humanos, primatas não humanos e mosquitos. Os isolamentos

  14. Isoenzymatic variability in wild potatoes Variabilidade isoenzimática em batata silvestre

    Directory of Open Access Journals (Sweden)

    Beatriz Helena Gomes Rocha

    2001-05-01

    Full Text Available Two species of wild potato Solanum commersonii, subspecies commersonii and malmeanum, and S. chacoense, subspecies muelleri occur in southern Brazil. Their rusticity and easy adaptation to extreme climatic conditions make them valuable for breeding programs. The objective of this work was to analyze the isoenzymatic variability of 113 clones of wild potato subspecies. They were collected and maintained at Embrapa-Centro de Pesquisa Agropecuária de Clima Temperado, at Pelotas, RS, Brazil. Enzymes involved in energetic (group I or in peripherical (group II metabolism constituted the material used. Polyacrylamide horizontal gel electrophoresis was used to analyze peroxidase, aspartate transaminase, phosphoglucomutase and isocitrate dehydrogenase isoenzymes. Solanum spp. has considerable genetic variability for isoenzymatic patterns. Cluster analysis classified the clones into 51 subgroups, based on electrophoretic variants of group I enzymes, and into 89, when group II enzyme variants were added. Genotypic differentiation of S. chacoense muelleri in relation to S. commersonii commersonii and S. commersonii malmeanum is evident when expressed through similarity and cluster analysis.No sul do Brasil ocorrem apenas duas espécies silvestres de batata, Solanum commersonii, com as subespécies commersonii e malmeanum, e S. chacoense, com a subespécie muelleri, de interesse aos programas de melhoramento, pela rusticidade e fácil adaptação a condições climáticas extremas. O objetivo deste trabalho foi analisar a variabilidade isoenzimática de 113 clones de batata silvestre. O material foi coletado e mantido na Embrapa-Centro de Pesquisa Agropecuária de Clima Temperado, em Pelotas, RS. Foram usadas enzimas envolvidas nos metabolismos energético (grupo I e periférico (grupo II. Eletroforese horizontal em gel de poliacrilamida foi empregada para análise de isoenzimas de peroxidase, aspartato transaminase, fosfoglucomutase e isocitrato

  15. Secuencia parcial de un fragmento de ADN de patos silvestres homologo al Complejo Mayor de

    Directory of Open Access Journals (Sweden)

    González-Guzmán Sofía

    2009-04-01

    Full Text Available ResumenLa variación individual de la respuesta inmune esta ligada a ladiversidad funcional y estructural del MHC (por sus siglas en inglesMajor Histocompatibility Complex, TcR (Receptores de células T,inmunoglobulinas (anticuerpos, citoquininas, TNF (por sus siglas eningles Tumor Necrosis Factor, entre otras proteínas. Estas proteínasestán codificadas por múltiples y polimórficos genes, la variabilidad de estos genes constituyen las principales bases, en las variaciones de la resistencia a determinada enfermedad o enfermedades. Estascaracterísticas se han documentado en la gallina doméstica, pero no enel pato. En el presente trabajo se amplifico por PCR un fragmento denucleótidos de ADN genómico de pato doméstico que compartió un100% de similitud con un fragmento del MHC clase II de pollo, quecorrespondió a una secuencia similar a DAB1 (Disabled 1.La secuencia DAB1 también fue amplificada en nueve especies de patos silvestres del género Anas que posterior a un análisis por el polimorfismo del largo de los fragmentos de restricción (PLFR con las enzimas RsaI, BsrI y HindIII, se observó que la especie Anas americana,Anas platyrhynchos diazi y Anas platyrhynchos domesticus fueronsutilmente diferentes a la especie Anas discors, Anas crecca, Anascyanoptera, Anas acuta, Anas streptera y Anas clypeata. Hasta dondesabemos, este es el primer reporte que indica la presencia desecuencias similares a DAB1 en patos silvestres. Este estudio podríaayudar a entender porque los patos podrían ser menos susceptibles apresentar neoplasias que en las gallinas.SummaryThe individual response of the immune system is linked to the functional and structural diversity of the MHC (Major Histocompatibility Complex, TcR (T cell receptor, inmunoglobulines (antibodies, citokines, TNF (Tumor Necrosis Factor, among other proteins. These proteins are coded for multiple and polymorphic genes, the variability of these genes constitutes the main bases, in the

  16. Diagnóstico da fauna silvestre em empresas florestais brasileiras Diagnosis of wild fauna in brazilian forest companies

    Directory of Open Access Journals (Sweden)

    Giovanna Debortoli Medeiros

    2009-02-01

    Full Text Available Com o objetivo de conhecer a situação atual da fauna silvestre em empresas florestais brasileiras, foram pesquisadas 42 razões sociais, entre Associadas e Co-Participantes da Sociedade de Investigações Florestais (SIF, as quais possuem plantios florestais próprios. As informações foram obtidas com base em questionário enviado às referidas empresas, via correio eletrônico, sendo as respostas obtidas também por esse mecanismo. Entre os vários resultados, destaca-se o fato de que 90,9% das empresas associadas já realizaram levantamentos qualitativos da fauna silvestre. No entanto, de modo geral há notória carência de infra-estrutura nas empresas pesquisadas para atender a trabalhos específicos de manejo e conservação da fauna silvestre.Forty-two companies, associates and co-participants of the Forest Investigation Society (SIF and owners of private forest plantations, were assessed to determine the current situation of wild fauna in Brazilian forest companies. Information was obtained through a questionnaire sent to and received from the companies by e-mail. One of the several results obtained was that 90.9% of the associate companies had already carried out qualitative surveys on wild fauna stands.. On the other hand, in general, there is a total lack of infrastructure in the surveyed companies, to specifically assist in the management and conservation of wild fauna.

  17. Augusto Boal en la educación social: del teatro del oprimido al psicodrama silvestre

    Directory of Open Access Journals (Sweden)

    Manuel F. Vieites García

    2015-02-01

    Full Text Available La obra de Augusto Boal Teatro del Oprimido se suele situar entre las aportaciones más transcendentales del teatro del siglo XX, en tanto sus dictados teóricos y sus propuestas metodológicas y prácticas han calado en ámbitos de la educación social y teatral relacionados con el desarrollo de la democracia cultural. Pasados cuarenta años desde sus primeras experiencias, en este trabajo se propone una genealogía del teatro del oprimido a partir de una lectura crítica de sus textos fundacionales y de alguna experiencia considerada paradigmática en su desarrollo, para mostrar su naturaleza, aportes, fortalezas y debilidades. Igualmente se muestra el tránsito entre una dimensión más educativa y teatral y otra más centrada en la terapia y el desarrollo personal, para concluir que las técnicas y recursos empleados en teatro del oprimido, que proceden de fuentes muy diversas, siguen teniendo potencialidades indudables en propuestas de intervención social, cultural y educativa propias de la pedagogía teatral y la pedagogía social.Cómo referenciar este artículoVieites García, M. F. (2015. Augusto Boal en la educación social: del teatro del oprimido al psicodrama silvestre. Foro de Educación, 13(18, pp. 161-179. doi: http://dx.doi.org/10.14516/fde.2015.013.018.009 

  18. Caracterización morfológica de accesiones silvestres de guayaba

    Directory of Open Access Journals (Sweden)

    Muñoz florez Jaime Eduardo

    2009-06-01

    Full Text Available Se realizó la caracterización morfológica de 22 accesiones silvestres de guayaba Psidium guajava L. 14 colectadas en el municipio de Restrepo (Valle del Cauca, seis en Armenia (Quindío y dos en Pereira (Risaralda. Se utilizaron 12 descriptores cuantitativos y 10 cualitativos de tallo, hojas y frutos; el análisis de agrupamiento se hizo mediante el coeficiente de Dice-Nei-Li y el promedio aritmético no ponderado (UPGMA. La mayor variabilidad se halló en los descriptores peso de la pulpa (CV = 55.92%, peso (CV = 45.23%, y acidez del fruto (CV = 44.75%. El análisis de agrupamientos con base en caracteres cuantitativos permitió establecer cuatro grupos: las accesiones del grupo A (Armenia, presentaron valores promedio de los descriptores de la calidad del fruto (grados Brix, acidez del fruto y relación grados Brix/acidez y valores altos de contenido de pulpa. La mayoría de accesiones del grupo C (Restrepo tuvieron altos valores de calidad del fruto y bajo contenido de pulpa. El grupo B, constituido por accesiones de Armenia y Pereira, se diferenció por valores bajos en los descriptores de rendimiento del fruto (peso del fruto, de la pulpa y diámetro de la cavidad seminal. Las accesiones del grupo D (Restrepo mostraron valores promedios en calidad y rendimiento del fruto. Los descriptores cuantitativos se reunieron en tres variables sintéticas para rendimiento y calidad del fruto que representaron 76.86% de la variabilidad total.

  19. Caracterización morfológica de accesiones silvestres de guayaba

    Directory of Open Access Journals (Sweden)

    Liliana Jiménez Lozano

    2009-04-01

    Full Text Available Se realizó la caracterización morfológica de 22 accesiones silvestres de guayaba Psidium guajava L. 14 colectadas en el municipio de Restrepo (Valle del Cauca, seis en Armenia (Quindío y dos en Pereira (Risaralda. Se utilizaron 12 descriptores cuantitativos y 10 cualitativos de tallo, hojas y frutos; el análisis de agrupamiento se hizo mediante el coeficiente de Dice-Nei-Li y el promedio aritmético no ponderado (UPGMA. La mayor variabilidad se halló en los descriptores peso de la pulpa (CV = 55.92%, peso (CV = 45.23%, y acidez del fruto (CV = 44.75%. El análisis de agrupamientos con base en caracteres cuantitativos permitió establecer cuatro grupos: las accesiones del grupo A (Armenia, presentaron valores promedio de los descriptores de la calidad del fruto (grados Brix, acidez del fruto y relación grados Brix/acidez y valores altos de contenido de pulpa. La mayoría de accesiones del grupo C (Restrepo tuvieron altos valores de calidad del fruto y bajo contenido de pulpa. El grupo B, constituido por accesiones de Armenia y Pereira, se diferenció por valores bajos en los descriptores de rendimiento del fruto (peso del fruto, de la pulpa y diámetro de la cavidad seminal. Las accesiones del grupo D (Restrepo mostraron valores promedios en calidad y rendimiento del fruto. Los descriptores cuantitativos se reunieron en tres variables sintéticas para rendimiento y calidad del fruto que representaron 76.86% de la variabilidad total.

  20. LAS CODORNICES DE BOSQUES Y SELVAS. RETOS DE MANEJO Y CONSERVACIÓN DE LA FAUNA SILVESTRE

    OpenAIRE

    Gilberto Chávez-León

    2014-01-01

    Las codornices que habitan en bosques y selvas representan un buen modelo para analizar los retos que representan tanto el manejo como la conservación de la fauna silvestre, debido a su estrecha dependencia hacia esos ecosistemas. Las políticas gubernamentales de uso y protección de los recursos naturales repercuten en las condiciones en las que se mantiene la vegetación como hábitat, por lo que aquí se examinan esos factores y su posible influencia en estas aves, como un caso de estudio. De ...

  1. IDENTIFICACIÓN Y FRECUENCIA DE PARÁSITOS GASTROINTESTINALES EN FÉLIDOS SILVESTRES EN CAUTIVERIO EN EL PERÚ

    OpenAIRE

    Aranda R., Carmen; Grupo SALUVET-UPCH, Facultad de Veterinaria y Zootecnia, Universidad Peruana Cayetano Heredia, Lima; Serrano-Martínez, Enrique; Grupo SALUVET-UPCH, Facultad de Veterinaria y Zootecnia, Universidad Peruana Cayetano Heredia, Lima; Tantaleán V., Manuel; Grupo SALUVET-UPCH, Facultad de Medicina Veterinaria y Zootecnia, Universidad Peruana Cayetano Heredia, Lima; Quispe H., Marco; Grupo SALUVET-UPCH, Facultad de Veterinaria y Zootecnia, Universidad Peruana Cayetano Heredia, Lima; Casas V., Gina; Grupo SALUVET-UPCH, Facultad de Veterinaria y Zootecnia, Universidad Peruana Cayetano Heredia, Lima

    2013-01-01

    El objetivo del presente trabajo fue identificar los parásitos gastrointestinales de felinos silvestres criados en cuatro parques zoológicos en el Perú, mediante la aplicación de cuatro técnicas parasitológicas convencionales (método directo, test de sedimentación en tubo, método de Sheather y tinción Ziehl-Nielsen). Se trabajó con 10 ejemplares de Panthera onca (4 machos y 6 hembras), 8 de Puma concolor (4 machos y 4 hembras), 6 de Leopardus pardalis (machos), 3 de Leopardus wiedii (1 macho ...

  2. CARACTERIZAÇÃO DAS APREENSÕES DE FAUNA SILVESTRE NO ESTADO DO AMAPÁ, AMAZÔNIA ORIENTAL, BRASIL

    Directory of Open Access Journals (Sweden)

    Miguel Benedito Ferreira Dias Junior

    2014-04-01

    Full Text Available Este artigo objetivou caracterizar as apreensões de fauna silvestre no estado do Amapá. Foram analisados registros constantes dos Autos de Infração Ambiental lavrados pelos órgãos de fiscalização ambiental (Instituto Brasileiro do Meio Ambiente e dos Recursos Naturais Renováveis, Secretaria de Estado do Meio Ambiente, Instituto de Meio Ambiente e Ordenamento Territorial do Amapá e Batalhão de Polícia Militar Ambiental no período de 2005 a 2009. Os resultados mostraram que foram apreendidos 1.986 animais silvestres que geraram R$ 694.937,00 em multas. As apreensões ocorreram em 13 dos 16 municípios amapaenses, com destaque para Macapá e Santana que concentraram 87% das autuações. As infrações mais cometidas foram a posse ou manutenção de animais em cativeiro e o transporte de carne e de animais vivos com 38,14% e 30,77%, respectivamente. Répteis e aves foram os mais apreendidos com 48% e 45%, enquanto os mamíferos foram os menos apreendidos com 7% das apreensões. Do total de espécimes apreendidos, 736 pertencem a nove espécies constantes da lista de espécies ameaçadas, das quais, sete constam simultaneamente nas listas da IUCN e da CITES. Concluiu-se que a fauna silvestre tem sido utilizada de forma indiscriminada para fins de criação e consumo alimentar nas áreas rurais e urbanas do Estado e, que deficiências na execução das atividades de fiscalização dificultam a coibição dessa atividade ilícita. Palavras-chave: Animais silvestres, espécies ameaçadas, fiscalização, órgãos ambientais. DOI: http://dx.doi.org/10.18561/2179-5746/biotaamazonia.v4n1p65-73

  3. CARACTERIZAÇÃO DAS APREENSÕES DE FAUNA SILVESTRE NO ESTADO DO AMAPÁ, AMAZÔNIA ORIENTAL, BRASIL

    OpenAIRE

    Miguel Benedito Ferreira Dias Junior; Helenilza Ferreira Albuquerque Cunha; Teresa Cristina Albuquerque de Castro Dias

    2014-01-01

    Este artigo objetivou caracterizar as apreensões de fauna silvestre no estado do Amapá. Foram analisados registros constantes dos Autos de Infração Ambiental lavrados pelos órgãos de fiscalização ambiental (Instituto Brasileiro do Meio Ambiente e dos Recursos Naturais Renováveis, Secretaria de Estado do Meio Ambiente, Instituto de Meio Ambiente e Ordenamento Territorial do Amapá e Batalhão de Polícia Militar Ambiental) no período de 2005 a 2009. Os resultados mostraram que foram apreendidos 1...

  4. Aplicaciones del Triage en la Medicina de Fauna Silvestre, Exótica y de Zoológico

    OpenAIRE

    Nestor Varela

    2012-01-01

    En este artículo el autor revisa los elementos conceptuales y metodológicos del triage como herramienta en la atención médica de animales silvestres y exóticos, con objeto de compendiar los aspectos esenciales para que el clínico veterinario realice la evaluación y categorización inicial de los pacientes que ingresan por emergencia a las clínicas, zoológicos, centros de rehabilitación, o que son atendidos en el campo durante accidentes naturales, así como la metodología para establecer las ne...

  5. Aspectos Generales de la Evaluación Hematológica en Fauna Silvestre y no Convencional

    OpenAIRE

    Martha Copete-Sierra

    2013-01-01

    El uso de la evaluación hematológica en animales silvestres y no convencionales es fundamental para la evaluación general del estado de salud de estas poblaciones. La estandarización de los procedimientos de laboratorio, el conocimiento y la experiencia del analista en la identificación de las diferencias morfológicas, son fundamentales para obtener resultados confiables que proporcionan la mayor utilidad clínica. El objetivo de este documento es recopilar información básica para la realizaci...

  6. Extracción con solventes de artemisinina y otros metabolitos de Artemisia annua L. silvestre

    OpenAIRE

    Cafferata, Lázaro F. R.; Jeandupeux, René; Servicio de Difusión de la Creación Intelectual (SeDiCI), Universidad Nacional de La Plata

    2007-01-01

    Se han llevado a cabo metodologías alternativas para la extracción de artemisinina de hojas e inflorescencias del comunmente denominado ajenjo dulce ("sweetwormwood", Artemisia annua L.), ya sea de ejemplares de crecimiento expontáneo (silvestre) como de aquellos expresamente cultivados en regiones ubicadas en las Provincias de Buenos Aires y de Entre Ríos de la República Argentina. Fueron experimentalmente ensayadas y al mismo tiempo optimizadas, las diferentes condiciones de extracción, alg...

  7. Contribución a la patología de los carnívoros silvestres.

    OpenAIRE

    Sobrino Menchero, Raquel

    2008-01-01

    España cuenta con una rica comunidad de carnívoros silvestres terrestres. Esta tesis parte de las siguientes hipótesis: (1) los carnívoros terrestres, por su ubicación en la cúspide de la pirámide trófica, pueden ser buenos indicadores de la presencia y frecuencia de enfermedades que afectan a distintos taxones animales. (2) la diversidad paisajística de la Península Ibérica, que se asocia con diferentes comunidades de carnívoros terrestres, podría determinar diferencias en la distribución y ...

  8. Interrelaciones entre hospedadores, vectores y parásitos sanguíneos en poblaciones de aves silvestres

    OpenAIRE

    Martínez de la Puente, Josué

    2011-01-01

    El parasitismo es una de las relaciones simbióticas más importantes en la naturaleza. Las aves, como la mayoría de los organismos silvestres, se encuentran con frecuencia afectadas por una enorme diversidad de parásitos, tanto endoparásitos como ectoparásitos. El estudio del parasitismo bajo un prisma ecológico-evolutivo es una de las principales vías de investigación mundial en el campo de la biología evolutiva por la importancia de estos organismos parásitos en la evolución de sus hospedado...

  9. Ecología de la fauna silvestre de la sierra nevada y la Sierra del Ajusco

    OpenAIRE

    M. A. Hernández García; Sánchez González, A; D. Granados Sánchez; G. F. López Ríos

    2004-01-01

    Se presenta un estudio sobre la fauna silvestre de la Sierra del Ajusco y la Sierra Nevada, localizadas dentro de la Faja Volcánica Transmexicana (FVT), en la porción oriental del límite meridional de la Cuenca de México. La enorme riqueza biológica de esta zona que rodea la zona metropolitana de la ciudad de México, uno de los mayores complejos urbanos del mundo, ha sobrevivido durante décadas al impacto de la urbanización de las áreas forestales, explotación de recursos naturales, contamina...

  10. Priorización de enfermedades virales zoonóticas en la interfaz de cerdos silvestres, cerdos domésticos y seres humanos

    OpenAIRE

    Diana Benavides-Arias; Diego Soler-Tovar

    2016-01-01

    Introducción. Para entender la ecología de las enfermedades es necesario comprender los agentes patógenos en la interfaz de vida silvestre y ganado. Los cerdos silvestres (Sus scrofa) constituyen un problema sanitario cuando se trata de prevenir y controlar las enfermedades zoonóticas, pues en ocasiones sus poblaciones son portadores de agentes infecciosos transmisibles a los cerdos domésticos y a otras especies animales, incluidos los seres humanos. Objetivo. Priorizar las enfermedades zo...

  11. PORCENTAJE DE HEMBRAS DEL GUACAMAYO CABECIAZUL Primolius couloni (Sclater, 1876) MANTENIDOS EN CAUTIVERIO EN CUATRO CENTROS DE MANEJO DE FAUNA SILVESTRE EN EL PERÚ

    OpenAIRE

    Cáceres, Aimy; Universidad Nacional Agraria La Molina (Perú).; Williams de Castro, Martha; Universidad Nacional Agraria La Molina (Perú).

    2006-01-01

    Se evaluó un total de 46 individuos de Primolius couloni en cuatro centros de manejo de fauna silvestre del Perú: Parque Zoológico Huachipa, Zoocriadero CIRES-Perú, Zoocriadero Jean De Conick y Zoocriadero Mundo Silvestre. El objetivo del estudio fue determinar el porcentaje de hembras de Primolius couloni mantenidas en cautiverio, con el fin de ayudar a los centros de manejo que los albergan a implementar futuros planes de manejo reproductivo. Los resultados muestran que el porcentaje de hem...

  12. DIAGNÓSTICO JURÍDICO SOBRE EL DECOMISO Y MANEJO POSTDECOMISO DE FAUNA SILVESTRE EN EL DEPARTAMENTO DEL CHOCÓ

    Directory of Open Access Journals (Sweden)

    Lisneider Hinestroza Cuesta

    2011-12-01

    Full Text Available En este artículo se presenta un estudio de carácter descriptivo sobre los decomisos y el manejo postdecomiso de fauna silvestre en el departamento del Chocó utilizado como corredor para el tráfico y comercialización ilegal; se analizan, a partir del marco jurídico colombiano, la definición de fauna silvestre, decomiso y sus consecuencias jurídicas. Entre el 2005 y marzo del 2011 se realizaron en el Chocó 904 decomisos: 316 aves, 321 reptiles y 264 de mamíferos, 1 anfibio, 1 arácnido y 1 pez. La tendencia ha sido el aumento. La principal opción de disposición de fauna decomisada es la Liberación. Se han impuesto solamente sanciones de tipo administrativo sin reporte en el Registro Único de Infractores Ambientales y no se ha adelantado ninguna investigación de tipo penal

  13. Elaboración y Aplicación de un Manual de Convivencia Familiar, Creciendo Juntos para Mejorar la Relación Intrafamiliar de los Estudiantes de Decimo Grado de Educación Básica de la Unidad Educativa "Juan Bautista Vasquez" del Cantón Azoguez Provincia del Cañar en el periodo 2013-2014

    OpenAIRE

    Quito Sánchez, Luis Alfredo

    2015-01-01

    Esta investigación está relacionada con el mejoramiento de las relaciones intrafamiliares a través de talleres de escuela para padres y la elaboración conjunta de un Manual de Convivencia Creciendo Juntos para los estudiantes del décimo año de Educación Básica y sus padres de la Unidad Educativa Juan Bautista Vásquez del Cantón Azogues Provincia del Cañar, manejando de manera adecuada técnicas grupales tanto con los estudiantes como con los padres de familia. En los talleres se promovió a la ...

  14. Efectividad del programa educativo“Creciendo Saludable”en los conocimientos, actitu- des y prácticas sobre lactancia materna exclusiva en las madres con niños menores de 6 meses, del Programa Integral de Nutrición del Hospital de Huaycán, Lima, 2011.

    OpenAIRE

    Callacondo Quispe, Juana Candelaria; Chanducas Lozano, Bertha

    2011-01-01

    Objetivo: El objetivo de esta investigación fue determinar la efectividad del Programa Educativo “Creciendo Sa- ludable” en conocimientos, actitudes y prácticas sobre lactancia materna exclusiva en las madres con niños menores de 6 meses. Metodología: El tipo de estudio empleado fue longitudinal pre-experimental con pre-test y post-test de un solo grupo. La intervención fue realizada a 35 madres con niños menores 6 meses de edad del Programa Integral de Nutrición del Hospital de Huaycán - Lim...

  15. [Suya es la radio : 50 aniversario de Radio Alcoy, entrevista a Mario Silvestre, Antonio Doménech y Tomás Gisbert

    OpenAIRE

    Radio Alcoy; Rubio Orsi, Lorenzo; Gallego Fernández, María Llanos; Gisbert, Tomás; Doménech, Antonio; Cremades Zaragoza, Remigio; Esplugues Jordá, Francisco; Silvestre Pons, Mario

    1981-01-01

    Grabación conmemorativa por el cincuentenario de la emisora EAJ-12, Radio Alcoy en base a los recuerdos de tres locutores históricos de la emisora: Mario Silvestre, Antonio Doménech y Tomás Gisbert

  16. Neonatal cannibalism in cage-bred wild rabbits (Oryctolagus cuniculus Canibalismo neonatal en conejos silvestres (Oryctolagus cuniculus alojados en jaula

    Directory of Open Access Journals (Sweden)

    P González-Redondo

    2008-01-01

    Full Text Available The aim of this study was to analyse the occurrence of neonatal cannibalism by individually outdoors cage-bred wild rabbit does (Oryctolagus cuniculus. Ninety eight parturitions that were gathered from 19 female cage-born wild rabbits during five consecutive years were monitored for cannibalism incidence. This alteration in maternal behaviour, which was exclusively limited to the peripartum period, had a high incidence (13.3% of parturitions and was significantly associated with inadequate maternal behaviour such as not using straw or hair in nestbuilding or giving birth outside the nest box. In 84.6% of the parturitions with occurrence of cannibalism the does did not introduce hair into the nest boxes, and in 92.3% of the parturitions with cannibalised kits the does did not introduce straw into the nest boxes. Cannibalism was also associated with a large proportion of rabbits that gave birth outside the nest boxes (53.8%. It is discussed that cannibalism practiced by wild rabbit does in captivity is a manifestation of the failure of maternal behaviour, a consequence of the stress they experience in captivity.El objetivo de este estudio fue analizar la práctica de canibalismo neonatal por conejas silvestres (Oryctolagus cuniculus alojadas individualmente en jaulas ubicadas al aire libre. Se controló la incidencia de canibalismo en 98 partos producidos durante cinco años consecutivos por 19 conejas silvestres nacidas en jaula. Esta alteración de la conducta maternal, que estuvo limitada exclusivamente al periparto, tuvo una elevada incidencia (13,3% de los partos y estuvo asociada significativamente con una inadecuada conducta maternal, tal como la no introducción de pelo y paja en los nidales por parte de las conejas o los partos fuera del nidal. En el 84,6% de los partos en los que ocurrió canibalismo las conejas no introdujeron pelo en los nidales, y en el 92,3% de los partos con gazapos canibalizados las conejas no introdujeron paja en

  17. Los Hongos Comestibles Silvestres De Santa Catarina Del Monte, Estado De México

    Directory of Open Access Journals (Sweden)

    B. Arteaga Martínez

    2006-01-01

    Full Text Available Se realizó un estudio sobre la producción de hongos comestibles silvestres en el bosque de coníferas de Santa Catarina del Monte, Estado de México. La fase experimental se llevó a cabo en cinco parcelas de 1 ha cada una, ubicadas en un bosque de pino (Pinus hartwegii Lindl. y en un bosque de oyamel (Abies religiosa (Schl. et Cham. H.B.K.. Se determinó la fenología de aparición de las especies fúngicas, la producción por unidad de superficie, el valor económico por hectárea y las condiciones ecológicas del bosque, donde se desarrollan los hongos. La producción media mensual para cada tipo de vegetación se analizó en función de la variación de la temperatura, precipitación y humedad relativa durante el año. Por el método de correlación se determinó el grado de asociación entre la producción de hongos y las variables: número de especies de hongos, cobertura arbórea, edad promedio del arbolado, diámetro promedio del arbolado, temperatura media mensual y precipitación. Siguiendo el procedimiento del análisis de regresión múltiple y utilizando el método de Stepwise, se identificó qué características ecológicas se relacionan con la producción de hongos, resultando que la temperatura media mensual, diámetro promedio del arbolado, precipitación mensual y edad promedio del arbolado fueron las variables que tuvieron mayor influencia en la producción de hongos. Se encontró en el bosque un total de 24 especies, de las cuales tres fueron exclusivas del bosque de Pinus hartwegii y nueve del bosque de Abies religiosa y 12 especies fueron comunes a ambos tipos de bosques. Asimismo, se observó en el bosque de Pinus un total de 15 especies, cuya producción promedio fue de -107.3 kg·ha-1, con un valor económico de $5,962.00·ha·año-1. En el bosque de Abies se encontraron un total de 21 especies, con una producción total de 214.10 kg·ha-1·año-1, y un valor económico de $9,744. 50·ha·año-1, a precios de 1987.

  18. Aves Silvestres Atendidas No Hospital Veterinário Do Centro Universitário De Maringá - CESUMAR

    OpenAIRE

    Carniatto, Caio Henrique de Oliveira; Universidade de São Paulo (USP); Leonardo, Jussara Maria Leite Oliveira; Centro Universitário de Maringá - CESUMAR

    2013-01-01

    Animais silvestres são classificados segundo sua distribuição geográfica. Animais endêmicos são aqueles pertencentes às espécies nativas, migratórias ou não, terrestres ou aquáticas, que ocorrem naturalmente em biótipos naturais. Logo, são espécies que não convivem naturalmente e não são ecologicamente dependentes do homem. Animais exóticos pertencem às espécies que não ocorrem naturalmente em determinada região, bioma ou ecossistema. São consideradas então, se comparadas às espécies locais, ...

  19. Epidemiología de la Sarna Sarcóptica en fauna silvestre del Principado de Asturias.

    OpenAIRE

    Oleaga, Álvaro

    2016-01-01

    El interés sobre las enfermedades emergentes ha aumentado durante los últimos años, y situaciones con múltiples hospedadores resultan cada vez más relevantes para la gestión y conservación de fauna silvestre. La sarna sarcóptica, una enfermedad parasitaria provocada por el ácaro excavador Sarcoptes scabiei, ha sido confirmada en más de 100 especies de mamíferos incluyendo al ser humano. Esta parasitosis afecta de forma endémica en la Península Ibérica al zorro, y tras su aparición en 1993 a m...

  20. Diagnóstico del Refugio Nacional de Vida Silvestre Caño Negro, Arenal - Huetar Norte, Costa Rica

    OpenAIRE

    Caño Negro (Grup de recerca)

    2009-01-01

    Se ha elaborado un diagnóstico a partir de un exhaustivo análisis del Refugio Nacional de Vida Silvestre Caño Negro. Esta zona pertenece al Área de Conservación Arenal Huetar Norte, situado al norte de Costa Rica. El refugio forma parte de la cuenca de río Frío y consiste en un sistema de humedales continentales. El diagnóstico contiene la descripción de los aspectos biofísicos, socioeconómicos y administrativo-institucionales del área. La metodología utilizada se basa en un estudio de la bib...

  1. Febre amarela silvestre no Brasil: um desafio nos últimos anos - YELLOW FEVER IN BRAZIL: A CHALLENGE IN RECENT YEARS

    OpenAIRE

    Menezes, Thiago Vinicius Neves de; Sisley Neves de Menezes e Ailton Lopes de Menezes; Pereira, Sirlene de F.; Enfermeira, Ministério da Saúde/Secrvetaria de Vigilância de Saúde/DEVEP; Costa, Zouraide Guerra Antunes

    2009-01-01

    A febre amarela silvestre é uma doença infecciosa viral aguda, de curta duração cujo agente etiológico é um Flavivírus presente principalmente entre os primatas não-humanos que são os principais hospedeiros do vírus amarílico. O desmatamento causa desequilíbrio na interação entre patógeno e seu ambiente, proporciona a proliferação de vetores e parasitas e cria oportunidade para as epidemias. Este estudo teve por base a análise de dados de morbimortalidade por febre amarela, dados de vacinação...

  2. Una bola de nieve está creciendo en los servicios sanitarios: los pacientes supervivientes de cáncer The growing snowball in health services: long-term cancer survivors

    Directory of Open Access Journals (Sweden)

    Tàrsila Ferro

    2011-06-01

    Full Text Available Una de las consecuencias del progreso en el diagnóstico y el tratamiento del cáncer es el aumento de la supervivencia observado en las últimas décadas en Europa y en España. El número de nuevos casos de cáncer continúa aumentando principalmente debido al envejecimiento de la población, por lo que es previsible que el número de personas que viven años tras un diagnóstico de cáncer continúe creciendo. Este hecho supone un elemento de presión a los sistemas sanitarios, que muestran sus limitaciones para atenderlos con el modelo actual de seguimiento. Deben plantearse nuevos escenarios asistenciales, tanto desde la perspectiva de la gestión sanitaria como de la clínica. A pesar de no haber suficiente evidencia científica sobre cómo sistematizar el seguimiento de los casos, se están impulsando diversas estrategias, sobre todo en otros países, para lograr una mayor adecuación en la provisión de servicios a estos pacientes. En España tales experiencias son muy escasas, pero dada la situación emergente, que bien puede ser comparada a un efecto en bola de nieve, se requiere la revisión y la reformulación del modelo actual para ofrecer una respuesta más efectiva y ajustada a la realidad. El propósito de este artículo es identificar las prioridades de atención de estos pacientes desde el punto de vista sanitario, revisar los modelos organizativos que se ensayan en otros países y proponer un marco de referencia, basado en la integración de niveles asistenciales, incluyendo atención primaria de la salud, que es la Cenicienta en este problema, como aproximación a un modelo que permita evaluar las mejores opciones asistenciales para estos pacientes en nuestro entorno sanitario.One of the consequences of diagnostic and therapeutic progress in cancer is the increased survival observed in the last few decades in Spain and elsewhere in Europe. New cancer cases are increasing steadily due to population aging, among other factors

  3. Ecología de la fauna silvestre de la sierra nevada y la Sierra del Ajusco

    Directory of Open Access Journals (Sweden)

    D. Granados Sánchez

    2004-01-01

    Full Text Available Se presenta un estudio sobre la fauna silvestre de la Sierra del Ajusco y la Sierra Nevada, localizadas dentro de la Faja Volcánica Transmexicana (FVT, en la porción oriental del límite meridional de la Cuenca de México. La enorme riqueza biológica de esta zona que rodea la zona metropolitana de la ciudad de México, uno de los mayores complejos urbanos del mundo, ha sobrevivido durante décadas al impacto de la urbanización de las áreas forestales, explotación de recursos naturales, contaminación, cacería, incendios y pastoreo. A pesar de esto, se desconocen muchos de los factores que regulan la dinámica de los ecosistemas en esta región. Con relación a la fauna silvestre la carencia de información es mucho más evidente, aspectos elementales como la diversidad de especies, las interacciones ecológicas, la función de los organismos en el ecosistema, las condiciones de estrés a que están sometidos, han sido poco explorados. En esta investigación se recurrió a observaciones de campo y a la consulta de diferentes fuentes bibliográficas para estimar la riqueza de especies de mamíferos, aves, reptiles y anfibios; las relaciones ecológicas entre los mismos y las consecuencias de la modificación de su hábitat producto de las actividades humanas.

  4. Are camouflaged seeds less attacked by wild birds? Sementes camufladas são menos atacadas por aves silvestres?

    Directory of Open Access Journals (Sweden)

    Alexandre de Almeida

    2010-04-01

    Full Text Available Wheat, corn and rice crops in Brazil use seeds treated with systemic insecticide/nematicide carbofuran, mixed to rhodamine B red dye. Carbofuran is toxic and rhodamine B is attractive to wild birds that eat up these seeds, resulting in notable mortality during planting. A field experiment was performed in southeast Brazil to evaluate if camouflaged seeds would be less consumed by wild birds in comparison to commercial seeds with red-colored rhodamine B and aposematic blue seeds. Camouflaged seeds were less removed than seeds with rhodamine B and natural colors. The camouflaging was more effective in the presence of irregularities and litter. There was no removal of blue-colored seeds. As legislation requires treated seeds to receive a different color to avoid accidents with humans, camouflaging may be used as replacement of rhodamine B to reduce mortality rates of wild birds.Plantações de trigo milho e arroz no Brasil utilizam sementes tratadas com o inseticida e nematicida sistêmico carbofuran, associado ao corante vermelho rodamina B. O carbofuran é tóxico e a rodamina B é atrativa às aves silvestres, as quais consomem estas sementes, resultando em notável mortalidade durante o plantio. Um experimento realizado em campo agrícola no sudeste do Brasil mostrou que sementes camufladas foram menos removidas por aves silvestres do que sementes com rodamina B. A camuflagem foi potencializada em presença de irregularidades e serrapilheira no solo. Não houve remoção de sementes de cor azul, mas a formulação granular de cor azul tem causado mortalidade de aves nos USA e Canadá. Como sementes tratadas com agrotóxicos devem, de acordo com a legislação, receber coloração diferenciada para evitar acidentes com humanos, a camuflagem pode ser utilizada, substituindo a rodamina B.

  5. Ácidos grasos y parámetros de calidad del aceite de semilla de uva silvestre (Vitis spp.

    Directory of Open Access Journals (Sweden)

    O. Franco-Mora

    2015-01-01

    Full Text Available México es centro de origen de varias especies de Vitis. La gran mayoría de ellas no son empleadas en la agricultura e industrias derivadas. Como parte de la exploración de su potencial agroindustrial se identificó y cuantificó a los ácidos grasos del aceite de semilla de vid silvestre (Vitis spp. de frutos de Temascaltepec, México y de la accesión E-201, cultivada en Zumpahuacán, México. El contenido promedio de aceite en la semilla fue de 16,7%, encontrando ácido linoleico (71,5%, oleico (17,2%, palmítico (6,6% y esteárico (4,3%. En el aceite obtenido en vides de Temascaltepec se determinó índice de yodo (57,9 g/100 g, índice de saponificación (170,7 mg/g e índice de peroxidos (30 mEq/kg, valores relacionados posiblemente al contenido de ácidos grasos insaturados. Sin embargo, ese mismo grado de insaturación no concordó con el punto de humeo observado (211 °C, lo cual posiblemente está relacionado con el contenido de ácidos palmítico y esteárico. El aceite de semilla de vid silvestre cumple parcialmente con los estándares establecidos para el aceite de semilla de V. vinifera, lo cual implica su potencial culinario, agroindustrial y cosmetológico.

  6. Veinte años de seguimiento poblacional de ungulados silvestres de Aragón

    Directory of Open Access Journals (Sweden)

    Marco, J.

    2011-12-01

    Full Text Available The remarkable increase of wild ungulates populations in Aragon during the last 50 years, both in numbers and distribution, has made population monitoring a need for effective management of these species. In parallel to their raising numbers, problems related to crop damage and collisions with vehicles are growing. In this situation there has been a shift in the management goals from conservation to population control. Different methods have been used in the surveys: postal enquiries for distribution, battues, distance sampling, night spotlight surveys and indirect ones based on transect and plot counts of pellet groups. Surveys started in 1985 for red deer, 1990 for wild boar and Iberian wild goat, 1995 for chamois and 2002 for roe deer, gradually becoming a population monitoring program. The surveys are carried out by rangers and wildlife consultants under the coordination and supervision of the Fish and Game Service of the Aragon Government. The ungulate populations are still growing (wild boar, wild goat, red and roe deer, are relatively stabilised (fallow deer, feral goat, fluctuate due to diseases (chamois or show small populations limited to fenced states (Barbary sheep, mouflon. Hunting bags went from 1,100 to 36,000 during an eleven-year period (1990-2009: 303 chamois, 1,173 wild goats, 2,141 roe deer, 2,424 red deer and 29,595 wild boars, showing a trend which is still increasing. The main tool is therefore hunting quota and its verification through hunting bags declarations, damages to crops and car crashes, and population trend and abundance.

    La importante expansión de las poblaciones de ungulados silvestres en Aragón desde los años 50 del siglo XX hasta la actualidad, tanto en superficie ocupada como en abundancia de ejemplares, ha hecho necesario el seguimiento de las mismas para su adecuada gestión. Su incremento en las dos últimas décadas, junto con el importante aumento de daños agrícolas y colisiones con veh

  7. Aproximación al uso y tráfico de fauna silvestre en Puerto Carreño, Vichada, Colombia.

    OpenAIRE

    Cruz Antía, Daniel; Gomez, Juan Ricardo

    2011-01-01

    El tráfico ilegal de vida silvestre es un problema que enfrentan los países de alta diversidad biológica, como es el caso de Colombia. La extracción directa de individuos causa disminuciones en las poblaciones naturales y, en algunos casos, llevan a las especies a estados críticos e incluso a la extinción. Una de las regiones, en Colombia, donde es común encontrar una relación directa de extracción-uso y tráfico de vida silvestre, es en la región de la Orinoquia. Este estudio presenta los res...

  8. Distribución, ecología y caracterzación in situ de la vid silvestre en la Reserva de la Biosfera de Urdaibai (Bizkaia

    Directory of Open Access Journals (Sweden)

    Aranburu Albizuri, A., Gallardo Cano, A., López Martínez, M.A., Pérez Izquierdo, M.A., Ocete Rubio, R.

    2009-01-01

    Se incide sobre la necesidad de la conservación in situ y ex situ de este recurso fitogenético. Como Urdaibai ha sido una zona tradicional de producción de chacolí, se señalan posibles lineas de investigación, tanto filogenéticas como para el empleo de material silvestre en la mejora de las variedades cultivadas.

  9. Estudio preliminar de especies de micobacterias en primates colombianos no humanos en cautiverio en dos centros de rescate de fauna silvestre de Bogotá

    Directory of Open Access Journals (Sweden)

    Barragán Fonseca Karol Bibiana

    2005-07-01

    Full Text Available Se determinó la presencia de diferentes especies de micobacterias en 83 primates colombianos en cautiverio en dos centros de rescate de fauna silvestre de Bogotá. Se evaluaron 166 muestras de sangre y lavado gástrico mediante amplificación por PCR-spoligotyping para micobacterias del
    complejo tuberculosis y Hsp65-PRA para micobacterias no  tuberculosas (MNT. Se obtuvo una prevalencia del 2,4% para micobacterias del complejo Mycobacterium tuberculosis, encontrando un Saimiri sciureus infectado con Mycobacterium microti tipo vole y un Saguinus leucopus infectado con
    Mycobacterium africanum, siendo el primer reporte de estas micobacterias para primates del Nuevo Mundo. La prevalencia para MNT fue de 7,2% perteneciendo a las especies Mycobacterium phlei, M. terrae, M. vaccae, M. flavescens, M. flavescens y M. zsulgaii, algunas de estas, patógenos oportunistas. No existe una diferencia a nivel descriptivo en cuanto a la edad, al sexo y al tipo de entrega de los individuos infectados con MNT y micobacterias tuberculosas con respecto a los individuos que no las presentaron. Los primates del Nuevo Mundo pueden ser portadores sanos de micobacterias tuberculosas lo que representa un riesgo para la salud humana, y con ciertas especies de micobacterias, podría ser un riesgo para las poblaciones de primates silvestres en caso de que estos primates sean liberados en el medio silvestre. Este estudio es relevante para el país, ya que integra conceptos médicos tanto epidemiológicos como microbiológicos, con aspectos relacionados con la conservación de la fauna silvestre.

  10. Tráfico y tenencia ilegal de fauna silvestre en el departamento de Boyacá

    Directory of Open Access Journals (Sweden)

    Alejandro Cabrejo Bello

    2010-10-01

    Full Text Available Con el fin de establecer cuáles son los principales grupos taxonómicos, suparticipación y las ciudades con mayores índices de tráfico y tenencia ilegal de vida silvestre en el departamento de Boyacá, jurisdicción de la Corporación Autónoma Regional de Boyacá- Corpoboyacá, se tomaron reportes de la base de datos de dicha entidad entre los años 2004 y 2008. Se hallaron registros de 398 individuos decomisados por parte de la autoridad ambiental y otros por entregas voluntarias. El grupo con mayor incidencia fue el de las aves con 58%,seguido por los reptiles con 26% y en tercer lugar los mamíferos con el 16% de los registros. Se observó que las tres principales ciudades del departamento (Tunja, Duitama y Sogamoso reportan las frecuencias más elevadas de incautaciones. Puerto Boyacá, también registra un número elevado de decomisos. Dentro de los tres grupos mencionados, las especies más afectadas correspondena los órdenes Psitaciformes, Primates y Testudínata, por lo cual merecen principal atención. Se recomienda además, implementar planes de conservación y emprender actividades de educación ambiental encaminadas a la utilización sostenible de la fauna en general.

  11. Optimización del proceso de obtención de biodiesel a partir de colza silvestre (Brassica Campestris

    Directory of Open Access Journals (Sweden)

    Héctor Ramírez

    2012-01-01

    Full Text Available Los objetivos de esta investigación fueron , optimizar el rendimiento de biodiesel a partir del aceite de colza silvestre en función de la relación molar metanol/aceite, la concentración de catalizadores homogéneos NaOH y KOH, te mperatura y tiempo de transesterificación a través de la metodología de superficie respuesta, y determinar las características fisicoquímicas del biodiesel obtenido en condiciones optimizadas. Fue aplic ado un diseño de Plackett y Burman (PB12 para la etap a d e screening y un diseño compuesto central rotacional (DCCR para la optimización final. Las condiciones que maximizan el r endimiento de biodiesel (77.8 % se obtuvieron a concentraciones de 0 – 0.2 % de NaOH y de 0.4 a 0.6 % de KOH , con tiempos de 77 a 81 minutos, manteniendo constante la relación molar metanol/aceite en 6/1 y una temperatura de 60ºC. Las propiedades fisicoquímicas del biodiesel obtenido en condiciones optimizadas cumplen con las especificaciones técnicas dadas por la ASTM D6751 – 07 y EN14214.

  12. Reflexiones sobre el impacto y manejo de la caza de mamíferos silvestres en los bosques tropicales

    Directory of Open Access Journals (Sweden)

    J.E. Fa

    2013-01-01

    Full Text Available comunidades autóctonas de las selvas en América, África y Asia, la fauna es una fuente importante de proteína animal y también de ingresos deri- vados de la venta de los animales cazados. La caza comercial de fauna selvática, junto con las demandas impuestas por el intenso crecimiento de la población humana en estos ecosistemas, supone sin embargo una amenaza para la viabilidad de muchas poblaciones de mamíferos silvestres. Este impacto pone en riesgo la biodiversidad de estos ecosistemas y puede reducir las fuentes de proteínas para las poblaciones rurales. En este trabajo se presenta un análisis del volumen de carne de monte extraída en selvas tropicales a escala mundial, y se examina su importancia en las dietas y economías de las comunidades rurales y urbanas en estas regiones. Se realiza una breve revisión sobre el estado de conservación de aquellas especies afectadas por la caza, y de los procesos que han contribuido a su situación actual. Se concluye con un análisis de las soluciones propuestas para minimizar el conflicto entre la protección de la biodiversidad y las necesidades de las poblaciones humanas dependientes de ella en las selvas tropicales.

  13. MAMÍFEROS INVASORES EN LA PATAGONIA ARGENTINA: EL CONEJO SILVESTRE EUROPEO COMO CASO EMBLEMÁTICO

    Directory of Open Access Journals (Sweden)

    Never Antonio Bonino Vassallo

    2010-04-01

    Full Text Available Se brinda una reseña de los estudios biológicos y ecológicos realizados sobre el conejo silvestre europeo (Oryctolagus cuniculus, tal vez el más emblemático de los mamíferos exóticos introducidos en Argentina. En el sector continental argentino el conejo se encuentra establecido, y en proceso de dispersión, principalmente en las provincias de Mendoza y Neuquén (NO de la Patagonia. En esta región, el conejo ha demostrado tener un efecto negativo sobre la economía regional, especialmente en áreas ganaderas y en plantaciones comerciales de árboles frutales y maderables. No existen programas oficiales para controlar la dispersión geográfica y/o el impacto de esta especie exótica. La gente que se siente perjudicada por el conejo recurre a intentos individuales para controlar sus efectos negativos. Es necesario implementar monitoreos regulares de la dispersión del conejo para la detección temprana y el manejo de poblaciones recién establecidas; además, se requieren estudios comparativos tendientes a determinar los métodos más adecuados para controlar el impacto del conejo.

  14. Diagnóstico del tráfico ilegal y del manejo post decomiso de fauna silvestre en nueve corporaciones autónomas regionales de Colombia

    Directory of Open Access Journals (Sweden)

    Montenefgro Olga Lucía

    2007-12-01

    Full Text Available La fauna silvestre siempre ha estado relacionada con el hombre sirviéndole de diferentes maneras, ya sea como fuente de alimento, como compañía, como materia prima para la fabricación de accesorios (pieles y otros productos o como diversión. Una de las causas más importantes de pérdida de diversidad la constituye el aprovechamiento no sostenible de especies de fauna y flora tanto para el consumo directo como para el comercio, lo que conlleva a la reducción en el tamaño de las poblaciones silvestres y por tanto una mayor vulnerabilidad a la extinción. El tráfico ilegal de especies silvestres es considerado a nivel mundial como una de las principales causas de disminución de las poblaciones naturales y como uno de los mercados ilegales que mayores sumas de dinero moviliza anualmente, con el fin de surtir la demanda de los mercados mundiales de la moda, las excentricidades de pequeños grupos, las investigaciones biomédicas y comportamentales, la novedad causada a turistas y las prácticas culturales o religiosas de muchas poblaciones humanas. En Colombia uno de los problemas de conservación más complejos lo representa el manejo de aquellos especímenes de fauna silvestre que son objeto de decomiso por parte de las autoridades ambientales regionales. Para lograr una adecuada disposición de la gran cantidad de animales silvestres confiscados o entregados voluntariamente en Colombia, el Ministerio del Medio Ambiente y las demás autoridades ambientales acordaron poner en marcha nueve centros regionales para el manejo de fauna decomisada o
    Centros de Atención y Valoración (CAV. Esta disposición tenía el propósito de implementar parámetros y protocolos que faciliten tomar decisiones que tanto las instituciones como los profesionales encargados enfrentan a diario. Sin embargo, el manejo de la fauna postdecomiso continua siendo uno de los problemas más complejos debido a la gran cantidad de animales decomisados y a la poca

  15. ANÁLISIS DEL CRECIMIENTO DE UN GENOTIPO SILVESTRE DE Carica papaya L. CULTIVADO EX SITU Y CV. `MARADOL ROJA ́´

    Directory of Open Access Journals (Sweden)

    Jesús Rodríguez Cabello

    2015-01-01

    Full Text Available La especie Carica papaya L., es nativa del trópico americano y uno de los frutales más cultivados a nivel mundial. En Cuba existen problemas que afectan la producción de este frutal, considerados los más importantes el reducido número de cultivares explotados comercialmente y la baja diversidad genética presente en el banco de germoplasma. Sin embargo, existen genotipos silvestres que constituyen una fuente importante de genes para los programas de mejoramiento y explotación local, los cuales aún no se han caracterizado. Estudios de análisis del crecimiento permiten comprender su comportamiento en diferentes periodos de siembra en condiciones ex situ eidentificar caracteres de crecimiento inicial que posibiliten el aumento del rendimiento y favorezcan los trabajos de mejoramiento en busca de genotipos más productivos. Debido a lo antes señalado, el objetivo de la presente investigación fue realizar estudios del crecimiento del genotipo papaya silvestre de la cuenca Almendares-Vento. Las semillas para los experimentos se obtuvieron de frutos colectados in situ. Las medidas directas en la planta fueron área foliar y peso seco. Para la determinación de la superficie foliar se empleó una cámara digital y un software. El análisis computarizado de las imágenes de hojas obtenidas con la cámara digital permitió estimar el área foliar de forma simple, rápida y económica. La mayor producción de área foliar del genotipo silvestre y similar comportamiento en la masa seca y resto de los indicadores evaluados, indica la disponibilidad de recursos durante toda la fase de crecimiento, lo cual se asocia con su rendimiento

  16. Viabilidad fitoclimática de las repoblaciones de pino silvestre (Pinus sylvestris L. en la Sierra de los Filabres (Almería

    Directory of Open Access Journals (Sweden)

    A. Fernández Cancio

    2011-01-01

    Full Text Available La variabilidad climática actual se caracteriza por provocar cambios bruscos en los cursos fitoclimáticos, lo que está desencadenando procesos de mortalidad de especies forestales. El objetivo de este trabajo es analizar la adecuación fitoclimática de las masas artificiales de Pinus sylvestris L. en la Sierra de los Filabres (Almería, para lo cual se analizaron 35 variables fitoclimáticas que determinan la estabilidad climática de la especie. El estudio de los valores interanuales de las variables climáticas indica que entre 1970 y 1980 comenzó una perturbación climática amplia, modificando la estacionalidad y la variabilidad de las precipitaciones y de las temperaturas. Como rasgos más significativos tenemos el aumento de las temperaturas, sobre todo de las máximas, el aumento de la oscilación térmica y de los extremos diarios, la disminución global de precipitación, el aumento grave de la aridez primaveral y el deterioro de todas las variables ómbricas. El estudio de las estaciones con masas repobladas de pino silvestre en Andalucía oriental indica que las estaciones están fuera de la nube de puntos de las masas de pino silvestre establecidas en España. Las masas de pino silvestre de la Sierra de los Filabres están notablemente fuera de estación en todas sus características fitoclimáticas y pueden desaparecer progresiva o bruscamente, sobre todo si se implanta un cambio climático.

  17. Fauna silvestre asociada a ganado vacuno doble propósito en sistema de silvopastoreo, Pinto, Magdalena, Colombia

    Directory of Open Access Journals (Sweden)

    Jaime De La Ossa V.

    2011-12-01

    Full Text Available Objetivo. Evaluar la biodiversidad faunística asociada a ganadería vacuna de doble propósito en dos potreros estructurados con Botriochloa pertusa (colosoana como herbácea dominante, uno de ellos plantado con Crescentia cujete (Bignoniaceae como fuente de alimento adicional y otro con escaso y disperso arbolado. Materiales y métodos. El área de estudio está ubicada en el municipio de Pinto, Magdalena. Cada potrero evaluado fue de 10 ha, se mantuvo en cada uno un lote de quince vacas (½ Cebú, ¼ Pardo y ¼ Costeño con Cuernos, la separación entre las áreas muestreadas fue de 500m. Los registros de fauna se condujeron mediante punto fijo de conteo, en diez sitios de avistamiento, durante 20 días continuos, con cubrimiento visual amplio. Al ganado vacuno adulto presente en las dos áreas de trabajo se le realizó un pesaje individual al inicio del trabajo y al final del mismo, con el fin de determinar posibles diferencias entre ellos. Resultados. Estadísticamente el número de individuos y el número de especies presentaron diferencias significativas, siendo mayor la diversidad biológica para el potrero que poseía la plantación de C. cujete, mientras que el peso corporal de las vacas sometidas a pastoreo en las dos áreas no presentó diferencias significativas. Conclusiones. Se demuestra la importancia de este modelo pecuario como promotor de la conservación faunística local al convertirse enrefugio de variadas especies silvestres, al tiempo que mantiene la productividad existente sin alterar el ambiente sustancialmente.

  18. ANÁLISIS DEL MARCO REGULATORIO EN EL APROVECHAMIENTO DE LOS HONGOS SILVESTRES COMESTIBLES EN MÉXICO

    Directory of Open Access Journals (Sweden)

    Griselda Benítez-Badillo

    2013-01-01

    Full Text Available La recolección y venta de hongos silvestres comestibles, junto con la de otros productos forestales no maderables, constituyen una estrategia alimentaria y de subsistencia para los productores rurales. A pesar de la importancia social, económica, ecológica y cultural, dichas actividades todavía son de las más aisladas y poco conocidas del sector primario nacional. Esto trae como consecuencia la ausencia de políticas, esquemas de apoyo y estrategias de desarrollo para tales actividades. Por lo anterior, el objetivo de este trabajo fue exponer la necesidad de generar estadísticas oficiales en la recolección de hongos y establecer la relación entre la investigación científica, políticas públicas y el marco legal vigente, con el fin de conocer el estado actual de esta actividad y sus perspectivas a futuro. Se observa que el desconocimiento de la recolección de hongos ocasiona que no se le considere y excluya de las políticas de desarrollo del gobierno y de los sectores social y privado. De la misma manera, la falta de información, gestión y vinculación causa el rezago de la recolección y, con ello, su eventual sustitución o reemplazo por otras actividades. Sin embargo, existen ciertas potencialidades que debidamente manejadas pueden representar una alternativa real en el manejo sustentable de los bosques de México.

  19. Hongos comestibles silvestres: especies exóticas de Suillus (Boletales, Basidiomycota y Lactarius (Russulales, Basidiomycota asociados a cultivos de Pinus elliottii del nordeste argentino

    Directory of Open Access Journals (Sweden)

    Nicolás Niveiro

    2009-01-01

    Full Text Available Los hongos silvestres comestibles son un recurso económico importante que permite obtenerun producto deshidratado que puede comercializarse fácilmente. En el presente trabajo, y conel objeto de dar a conocer este recurso, se ilustran y describen dos especies de hongosmicorrícicos asociadas a cultivos de Pinus elliottii en el nordeste argentino que no han sidomencionadas anteriormente para la región: Lactarius deliciosus para la provincia de Misionesy Suillus granulatus para las provincias de Corrientes y Misiones

  20. Detección de Rickettsia spp. en Suero y Garrapatas de Mamíferos Silvestres en Cautiverio en Montería, Córdoba -resumen-

    OpenAIRE

    Dave Wehdeking-Hernández; Laura Hernández-Fernández; César Rojano-Bolaño; J Ruíz-Rodríguez

    2014-01-01

    Las rickettsiosis transmitidas por garrapatas son causadas por bacterias intracelulares pertenecientes al grupo de las fiebres manchadas del género Rickettsia. Estas zoonosis son algunas de las enfermedades transmitidas por vectores de más antiguo conocimiento‚ e incluyen dentro de su ciclo de transmisión diversas especies de mamíferos. No obstante‚ en Colombia existen pocos trabajos enfocados a conocer la dinámica de las rickettsiosis en animales silvestres. El objetivo de este estudio fue d...

  1. Técnica de Necropsia, Interpretación de Hallazgos Macroscópicos y Toma de Muestras en Mamíferos Silvestres

    OpenAIRE

    Jahnier Caicedo; Ospina, J. C.; Avila, J.

    2012-01-01

    La correcta realización de necropsias y toma de muestras en los animales silvestres de los diferentes sistemas de conservación del país es una herramienta de alta importancia en el manejo epidemiológico de muchas enfermedades. La falta de entrenamiento en las técnicas de necropsia de estos animales dificulta la elaboración de propuestas diagnósticas y de control que repercutan en los problemas sanitarios; por lo cual, se presenta una guía de técnica de necropsia general para mamíferos silvest...

  2. Análisis de la acumulación de azúcares en pericarpios de dos genotipos silvestres de jitomate (lycopersicon esculentum)

    OpenAIRE

    Eleazar Martínez Barajas

    2003-01-01

    Para determinar las bases bioquímicas de la acumulación de azúcares en frutos maduros de jitomates silvestres, se analizaron dos genotipos que acumulan hexosas y que presentan grandes diferencias en el contenido de azúcares. La acumulación de hexosas se inició al principio del período de maduración. Los fotosintatos generados por la planta durante el período de maduración fueron muy importantes para determinar los niveles de azúcares en los frutos maduros. El pericarpio del genotipo que acumu...

  3. Revisión del concepto biológico desarrollado en la legislación colombiana relacionada con la fauna silvestre vertebrada terrestre

    Directory of Open Access Journals (Sweden)

    Maldonado Chaparro Adriana A.

    2004-12-01

    Full Text Available En el trabajo se presenta un panorama general del estado actual de la legislación en materia de fauna silvestre vertebrada terrestre en Colombia, el cual es complementado con algunas actividades de conservación y aprovechamiento del recurso faunístico, que han sido adelantadas por
    las autoridades ambientales. Además, se exponen y analizan conceptos biológicos usados dentro de la normatividad, que son considerados claves desde el punto de vista biológico para la aplicación de las normas.

  4. Diagnóstico de animais ilegais recebidos no centro de triagem de animais silvestres de Belo Horizonte, Estado de Minas Gerais, no ano de 2011

    Directory of Open Access Journals (Sweden)

    Ana Cláudia Parreiras de Freitas

    2015-01-01

    Full Text Available O centro de triagem de animais silvestres em Belo Horizonte (CETAS-BH é um dos órgãos responsáveis pelo recebimento de animais silvestres em Minas Gerais (MG. O conhecimento da fauna mantida ilegal é ferramenta importante para a conservação dos animais silvestres, pois permite o aprimoramento da educação ambiental e das ações fiscalizadoras. Objetivou-se diagnosticar as espécies da fauna silvestre apreendidas ou entregues voluntariamente no CETAS-BH e analisar espacialmente sua distribuição. As espécies foram identificadas e classificadas de acordo com a chave taxonômica e o risco de extinção. Na análise descritiva espacial, foram identificadas as coordenadas geográficas dos municípios dos animais para a construção dos mapas de distribuição e de densidade de Kernel. No ano de 2011, foram recebidos 7.426 animais vivos, dos quais 91,5% eram aves, 7% répteis e 1,5% mamíferos. Verificou-se ampla variedade de espécies (166, correspondendo às aves a maioria (79,5%. As espécies mais recebidas foram Sicalis flaveola e Saltator similis. Do total de espécies recebidas, 15% estavam ameaçadas de extinção. A principal procedência foi apreensão (82,7% e, delas, 79% foram realizadas pela Polícia Militar do Meio Ambiente. Os animais eram de 94 municípios de MG. A análise espacial identificou a Região Metropolitana de BH como o local de maior concentração de ocorrências. A partir dos resultados obtidos, espera-se o aprimoramento e a intensificação das ações de educação ambiental e de fiscalização para essas áreas específicas

  5. Conocimiento tradicional y aprovechamiento de los hongos comestibles silvestres en la región de Amanalco, Estado de México

    OpenAIRE

    Cristina Burrola-Aguilar; Orlando Montiel; Roberto Garibay-Orijel; Lilia Zizumbo-Villarreal

    2012-01-01

    Se registró el conocimiento micológico tradicional para el municipio de Amanalco, Estado de México a partir de la recolección de macromicetos tanto en los bosques de Amanalco como en el tianguis de su cabecera municipal, de entrevistas informales a vendedoras de hongos en el tianguis y de entrevistas dirigidas a personas integrantes de 102 sistemas rurales familiares. Se registraron 56 especies de hongos comestibles silvestres de las cuales 38 soncomercializadas en el tianguis y que la poblac...

  6. Caracterización de sitios de percha del guajolote silvestre (Meleagris gallopavo mexicana) en Sierra Fría, Aguascalientes, México

    OpenAIRE

    Marcelo Márquez Olivas; Edmundo García Moya; Carlos González Rebeles Islas; Humberto Vaquera Huerta

    2007-01-01

    Entre octubre y noviembre del año 2001 y mayo de 2002 se localizaron 16 sitios de percha de guajolote silvestre (Meleagris gallopavo mexicana) en la Sierra Fría de Aguascalientes. El 87.5% de los sitios se encontraron en bosques de pino-encino (en rodales de pinos), en altitudes de 2500 a 2650 m. En la parte alta (2/3) de la cuesta se localizaron 8 de los sitios y 7 sobre laderas de exposición noreste, en una pendiente promedio de 38.9 ± 12.6%. El 62.5% de los sitios se usaron durante todo el...

  7. Priorización de enfermedades virales zoonóticas en la interfaz de cerdos silvestres, cerdos domésticos y seres humanos

    Directory of Open Access Journals (Sweden)

    Diana Benavides-Arias

    2016-08-01

    Conclusión. Los métodos semicuantitativos de priorización son una fuente de información para la toma de decisiones, pero su utilización es poco frecuente en los países en desarrollo por la falta de datos de vigilancia en salud pública. El control de las enfermedades que afectan tanto a los seres humanos como a los animales silvestres, requiere el desarrollo de estrategias que reduzcan la transmisión de patógenos de estos a los animales domésticos y a los seres humanos.

  8. La regeneración natural del pino silvestre (Pinus sylvestris L.) en el Valle del Lozoya (Madrid): germinación y supervivencia inicial

    OpenAIRE

    Aroca Fernández, Pepa

    2016-01-01

    La fase de establecimiento del regenerado es un proceso crítico para el desarrollo posterior de la masa tanto por las elevadas tasas de mortalidad que habitualmente lleva asociadas, como por proporcionar el material de partida del que van a disponer las fases subsiguientes. Las restricciones a la germinación y establecimiento de la regeneración del pino silvestre varían enormemente entre las distintas regiones de su extensa área de distribución geográfica. La región Mediterránea constituye un...

  9. Acumulación de cromo en setas silvestres comestibles: factores que influyen en su captación y repercusiones toxicológicas

    OpenAIRE

    MA García; Alonso, J.; AJ Martín; MJ Melgar

    2008-01-01

    La polución metálica medioambiental ha incrementado notablemente el interés por los hongos por ser captadores de metales pesados. Nutricionalmente, el cromo puede considerarse incluso un oligoelemento, pero en dosis excesivas es nocivo para la salud. Los objetivos planteados son la determinación del contenido de cromo en setas comestibles silvestres, el análisis estadístico de factores que influyen en su captación, y finalmente la evaluación del riesgo toxicológico deriva...

  10. Aphyllophorales de Sonora, México, I. Algunas Especies de la Reserva Forestal Nacional y Refugio de Fauna Silvestre Ajos-Bavispe

    OpenAIRE

    Alma Montaño; Ricardo Valenzuela; Alfonso Sánchez; Martha Coronado; Martín Esqueda

    2006-01-01

    Se estudiaron 57 especies de Aphyllophorales para la Reserva Forestal Nacional y Refugio de Fauna Silvestre Ajos-Bavispe, localizada en Sonora, México. Treinta y siete taxones son nuevas citas para la micobiota sonorense y cinco se registran por primera vez para México: Inonotus texanus, Phellinus arctostaphyli, Meruliopsis ambigua, Perenniporia fraxinophila e Hyphodontia apacheriensis. El mayor número de especies se presentó en bosque de pino-encino (32), seguido por bosque de pino-encino bo...

  11. Nuevas cepas de duganella aisladas de la rizosfera de olivo silvestre y cultivado y su uso en la producción de violaceína

    OpenAIRE

    Landa, Blanca B.; Aranda Ocampo, Sergio; Montes Borrego, Miguel; Castillo,Pablo

    2010-01-01

    [ES] La presente invención se refiere a unas cepas bacterianas de Duganella spp. obtenidas de la rizosfera de olivos silvestres y cultivados. Preferentemente las cepas son CECT 7779, CECT 7780 y CECT 7781 y más preferentemente la cepa bacteriana es CECT 7780. Además, la presente invención se refiere a sus combinaciones con otros microorganismos y a las composiciones que comprenden los productos anteriores, así como a un procedimiento para la producción de violaceína y a la violaceína produ...

  12. Nuevas cepas de duganella aisladas de la rizosfera de olivo silvestre y cultivado y su uso en la producción de violaceína

    OpenAIRE

    Landa, Blanca B.; Aranda Ocampo, Sergio; Montes Borrego, Miguel; Castillo Castillo, Miguel

    2010-01-01

    La presente invención se refiere a unas cepas bacterianas de Duganella spp. obtenidas de la rizosfera de olivos silvestres y cultivados. Preferentemente las cepas son CECT 7779, CECT 7780 y CECT 7781 y más preferentemente la cepa bacteriana es CECT 7780. Además, la presente invención se refiere a sus combinaciones con otros microorganismos y a las composiciones que comprenden los productos anteriores, así como a un procedimiento para la producción de violaceína y a la violaceína producida par...

  13. Contribución de los animales domésticos y silvestres a la contaminación de aguas superficiales por Cryptosporidium y Giardia

    OpenAIRE

    García Presedo, Ignacio

    2013-01-01

    Se ha establecido con mayor precisión la extensión de la cryptosporidiosis y la giardiosis en animales domésticos –bovinos y ovinos– y silvestres –corzos y jabalíes– en diferentes zonas y estaciones del año en Galicia. Se ha valorado también la contribución de estos animales a la contaminación de aguas superficiales por Cryptosporidium spp. y G. duodenalis. Además, se ha determinado el grado de contaminación de las aguas –residuales, potables y superficiales– con formas infectantes de ambos e...

  14. Relación específica de las proteínas de reserva en el maíz (Zea mays) y sus parientes silvestres

    OpenAIRE

    Magoja, J. L.; Nivio, A. A.

    1982-01-01

    p.255-263 En los maíces normales, el patrón proteico del endosperma es relativamente constante, es decir, entre ellos hay una razonable similitud. Como resultado de ello, este carácter puede ser considerado específico y útil para distinguir al maíz de sus parientes silvestres. Mediante la técnica de Landry-Moureaux se fraccionaron las proteínas de reserva del endosperma en maíz (Zea Mays), teosinte diploperenne (Zea diploperennis) teosinte perenne (Euchlaena perennis igual Zea perennis) y ...

  15. Dieta del perro (canis familiaris) y sus interacciones con la fauna silvestre de la cuenca alta del Río Otún-Risaralda (Colombia)

    OpenAIRE

    2015-01-01

    El perro (Canis familiaris) interactúa con la fauna silvestre principalmente por medio de la depredación, competencia y transmisión de enfermedades. Sin embargo, no se conoce con mucha claridad cómo se presentan estas interacciones. Para responder a este interrogante, en este trabajo se identificó la dieta del perro y la presencia de la enfermedad de Parvovirus (CPV). A partir de esta información, contrastada con el conocimiento de los pobladores del área de estudio, se determinaron las posib...

  16. Diagnóstico del tráfico ilegal y del manejo post decomiso de fauna silvestre en nueve corporaciones autónomas regionales de Colombia

    OpenAIRE

    Montenefgro Olga Lucía; Mendivelso Gamboa Diego Andrés

    2007-01-01

    La fauna silvestre siempre ha estado relacionada con el hombre sirviéndole de diferentes maneras, ya sea como fuente de alimento, como compañía, como materia prima para la fabricación de accesorios (pieles y otros productos) o como diversión. Una de las causas más importantes de pérdida de diversidad la constituye el aprovechamiento no sostenible de especies de fauna y flora tanto para el consumo directo como para el comercio, lo que conlleva a la reducción en el tamaño de las poblaciones sil...

  17. Opciones de gestión para reducir la cacería ilegal: El caso de la Reserva de Vida Silvestre Amazónica Manuripi, Bolivia

    Directory of Open Access Journals (Sweden)

    S. Espinoza

    2013-01-01

    Full Text Available La cacería ilegal representa una amenaza para la conservación de la vida silvestre. Las motivaciones y efectos que puede tener son variables y aún no han sido ampliamente estudiados. Aplicando un enfoque teórico-conceptual económico analizamos los diferentes factores que pueden motivar la cacería ilegal y discutimos las implicaciones de gestión. Basándonos en el caso de la cacería ilegal que ocurre durante la recolección de castaña (Bertholletia excelsa en la Reserva de Vida Silvestre Amazónica Manuripi, Bolivia, analizamos los resultados de un extensivo estudio de incumpli- miento. En base a la revisión de fuentes primarias y secundarias de información y al marco conceptual referido a modelos económicos de disuasión, identificamos que la probabilidad de detección y sanción, la moralidad, la legitimidad y la influencia social pueden afectar el cumplimiento de la pro- hibición de caza en la Reserva Manuripi. Adicionalmente, consideramos que el conocimiento de la regulación también puede afectar la decisión de cazar y señalamos evidencia empírica que sugiere que el hábito de consumir carne silvestre y la no-disponibilidad de alternativas a la carne silvestre motivan la cacería ilegal en Manuripi. Bajo este análisis, las recomendaciones para disminuir el riesgo de cacería ilegal durante el periodo de reco- lección de castaña se enfocan en mejorar los esfuerzos de fiscalización, monitoreo y control por parte de la Autoridad Ambiental, paralelamente a la implementación de procesos de concientización dirigidos a modificar los valores éticos y hábitos culturales entre los recolectores.

  18. Análise nutricional de espécies de cogumelos silvestres do género Boletus: Boletus porosporus e Boletus regius

    OpenAIRE

    Leal, Ana Raquel; Barros, Lillian; Martins, Anabela; Isabel C. F. R. Ferreira

    2013-01-01

    Existem milhares de espectes de cogumelos na natureza, no entanto, apenas algumas delas são consideradas como alimento e somente um número reduzido destas são comercializadas. Os cogumelos silvestres têm vindo a ser cada vez mais importantes na dieta alimentar devido ao seu valor nutricional e às suas características organoléticas. Em particular, a grande popularidade dos cogumelos na região de Trás-os-Montes e o aumento da sua exportação para países como a Espanha, França e...

  19. Estudio preliminar de especies de micobacterias en primates colombianos no humanos en cautiverio en dos centros de rescate de fauna silvestre de bogotá

    OpenAIRE

    Barragán Fonseca Karol Bibiana; Guerrero Martha I.; Brieva Rico Claudia I.

    2011-01-01

    Se determinó la presencia de diferentes especies de micobacterias en 83 primates colombianos en cautiverio en dos centros de rescate de fauna silvestre de Bogotá. Se evaluaron 166 muestras de sangre y lavado gástrico mediante amplificación por PCR-spoligotyping para micobacterias del
    complejo tuberculosis y Hsp65-PRA para micobacterias no  tuberculosas (MNT). Se obtuvo una prevalencia del 2,4% para micobacterias del complejo Mycobacterium tuberculosis, encontrando un Saimiri sciure...

  20. La investigación en torno a la concepción de vida silvestre: Una aproximación al estado del arte en el contexto educativo.Pág 51-87

    Directory of Open Access Journals (Sweden)

    Luis Juan Rubiano O.

    2011-07-01

    Full Text Available Se hace una revisión sobre el origen de la concepción de vida silvestre, rastreando su significado desde el siglo XIV hasta el presente. Aunque existen en Inglaterra referencias muy antiguas sobre la concepción de vida silvestre, es en Estados Unidos donde nace y evoluciona dicho término. Al comparar las concepciones de la vida silvestre en los Estados Unidos respecto a los países latinoamericanos, se evidencia la enorme importancia cultural, educativa, política y social dada a tales concepciones en el continente norteamericano en contraste con Latinoamérica, particularmente Colombia, en donde no se dan tales manifestaciones. Igualmente, la historia de la educación e investigación en educación sobre la vida silvestre en los Estados Unidos revela una notoria inserción de esta temática tanto en los textos divulgativos (educación no formal como en la literatura científica y en los currículos de educación básica y universitaria. En dicho país es posible conjeturar un cambio evolutivo en la concepción de vida silvestre que, de acuerdo con nuestra investigación, se inicia a finales del siglo XIX con un significado de fauna de caza deportiva y culmina, hacia la década de 1970 con la inclusión de todos los reinos de la naturaleza así como su hábitat e interrelaciones. En nuestro país, y en general para Suramérica, es muy escasa la literatura especializada sobre vida silvestre, no existiendo facultades o carreras con dicha temática a pesar de la enorme biodiversidad de este continente. Algunas de las razones aducidas por el autor, que explican esta situación, son la influencia de la visión taxonómica de la naturaleza, privilegiada en Colombia por la Expedición Botánica, y la dificultad para incorporar la educación ambiental en el contexto académico universitario. Se concluye igualmente la escasa investigación en vida silvestre y el potencial que existe para desarrollarla en el campo de las ciencias naturales y sociales

  1. Natural infection by endoparasites among free-living wild animals Infecção natural por endoparasitas em animais silvestres de vida-livre

    Directory of Open Access Journals (Sweden)

    Luciane Holsback

    Full Text Available The objective of this study was to investigate the frequency of occurrence and variety of intestinal parasites among free-living wild animals. Fecal samples from wild mammals and birds at rehabilitation centers in the states of Mato Grosso do Sul and São Paulo were analyzed by sedimentation and flotation-centrifugation methods. Parasite eggs, oocysts, cysts and/or trophozoites were found in 71% of the samples. Cryptosporidium sp. oocysts were detected in fecal samples from oncillas (Leopardus tigrinus and scaly-headed parrots (Pionus maximiliani. Giardia cysts were identified in the feces of a gray brocket (Mazama gouazoubira. Among the most common parasites found, there were eggs from Toxocara cati, Toxascaris leonina and Ancylostoma tubaeforme, and from Cestoda. Several Enterobius sp. eggs were found in the feces of red howler monkeys (Alouatta seniculus. It can be concluded from this study that despite the small number of samples, the diversity of parasites found was noteworthy. Additional information about parasite endofauna in wild animals is needed, since their presence might suggest that there could be proximity to and interactions with domestic animals and/or humans. In addition, further studies on parasites from free-living wild animals are of prime importance for understanding the intensity of anthropic changes in wild environments.O objetivo deste trabalho foi pesquisar a frequência de ocorrência e a variedade de parasitas intestinais de animais silvestres de vida livre. Amostras de fezes de mamíferos e aves silvestres de centros de reabilitação dos Estados do Mato Grosso do Sul e São Paulo, foram analisadas pelos métodos de sedimentação e de centrífugo-flutuação. Foram encontrados ovos, oocistos, cistos e/ou trofozoítos de parasitas em 71% das amostras. Oocistos de Cryptosporidium sp. foram detectados em amostras de fezes de gato-do-mato-pequeno (Leopardus tigrinus e maritacas (Pionus maximiliani. Cistos de Giardia

  2. PARÁMETROS HEMATOLÓGICOS EN POLLUELOS DE PSITÁCIDOS EN CAUTIVERIO DE ORIGEN SILVESTRE

    Directory of Open Access Journals (Sweden)

    J. A. Herrera

    2013-01-01

    Full Text Available El objetivo de este estudio fue describir los parámetros hematológicos en 69 polluelos en cautiverio de origen silvestre, clínicamente sanos, menores de tres meses de edad, en cuatro especies de psitácidos: Pionus senilis (n = 18, Amazona albifrons (n = 15, Amazona autumnalis (n = 25 y Amazona oratrix (n = 11, procedentes de la región central de México. Para determinar dichos parámetros, de cada ejemplar se obtuvieron 500 μl de sangre por punción de la vena braquial. En las cuatro especies citadas, el porcentaje del hematocrito fue de 56,4 ± 3,36; 51 ± 6,52; 47,6 ± 6,47 y 53,8 ± 9,26; el VCM en fl fue de 184,6 ± 13,4; 142,0 ± 25,4; 106,3 ± 11,7 y 162,3 ± 71,9; la cuenta eritrocítica fue de 4,7 ± 2,1 x10 6 /μl; 6,1 ± 8,2 x10 6 /μl; 6,9 ± 1,2 x10 6 /μl y 5,4 ± 1,1 x10 6 /μl; y la cuenta leucocitaria de 3,06 ± 0,15 x10 3 /μl; 3,62 ± 0,24 x10 3 /μl; 4,48 ± 0,36 x10 3 /μl y 3,56 ± 0,71 x10 3 /μl respectivamente para P. senilis , A. albifrons , A. autumnalis y A. oratrix . Se constató tendencia a la heterofilia en A. albifrons y A. oratrix , lo cual puede ser de gran utilidad para un diagnóstico cada vez más preciso en la clínica de aves en cautiverio.

  3. Inheritance of malate dehydrogenase in wild pepper Herança da malato desidrogenase em pimenta-silvestre

    Directory of Open Access Journals (Sweden)

    ADILSON RICKEN SCHUELTER

    1999-01-01

    Full Text Available Leaf extracts from wild pepper (Capsicum flexuosum Sendt were analysed for the presence of malate dehydrogenase (E.C. 1.1.1.37; MDH isozymes using starch gel electrophoresis. Seven phenotypes for MDH isozymes were observed in the genitors. Genetic analysis in F1 progenies revealed five loci coding for MDH. Isozyme banding patterns of hybrids indicated that MDH-3 and MDH-4 genes code for monomeric enzymes, while MDH-5 for a dimeric isoform. In MDH-2 loci, one particular F1 progeny showed a significant deviation from the expected isozyme pattern. It is possible that other genes are controlling the expression of MDH-2 in pepper. Also, there are two alleles coding for MDH-2 isozyme. On the other hand, MDH-1 was monomorphic for all genotypes used in the experiment.Extratos de folhas de pimenta silvestre (Capsicum flexuosum Sendt foram analisados para a presença do sistema isoenzimático malato desidrogenase (E.C. 1.1.1.37; MDH, usando a técnica eletroforese em gel de amido hidrolisado. Sete fenótipos de malato desidrogenase foram observados entre os genitores. As análises de segregação em progênies F1 revelaram que cinco locos gênicos estavam envolvidos na codificação de MDH. Os padrões de bandeamento dos híbridos indicaram que os genes MDH-3 e MDH-4 codificavam para enzimas monoméricas, enquanto o MDH-5, para uma isoforma dimérica. Para o loco MDH-2, detectou-se desvio significativo para proporção de segregação esperada. Outros genes podem estar controlando a expressão de MDH-2 em pimenta. Como nos outros locos MDH, detectaram-se dois alelos codificando para MDH-2. Por outro lado, o MDH-1 foi monomórfico para todos os genótipos avaliados no experimento.

  4. PO.EX em EXPO (ou POesia EXperimental em EXPOsição: Ernesto Melo e Castro, António Barros e Silvestre Pestana na Casa da Escrita

    Directory of Open Access Journals (Sweden)

    Manaíra Aires Athayde

    2013-07-01

    Full Text Available Review of three exhibitions: Ernesto MELO E CASTRO, Do Leve à Luz (3 october - 2 november 2012; António BARROS, Progestos_Obgestos (30 november - 21 december 2012; Silvestre PESTANA, Povo Novo Virtual (8 february - 1 march 2013. Ciclo NAS ESCRITAS PO.EX, Casa da Escrita, Coimbra, Portugal.

  5. Teste de ELISA indireto para diagnóstico sorológico de leishmaniose visceral em canídeos silvestres

    Directory of Open Access Journals (Sweden)

    Paulo R.B. Ferreira

    2013-04-01

    Full Text Available Na América do Sul, alguns canídeos silvestres são considerados reservatórios naturais da Leishmania chagasi. A resposta imunológica desses animais à Leishmania é pouco conhecida, havendo a necessidade de métodos diagnósticos adequados para esse fim. No presente estudo, é descrita a padronização do ensaio imunoenzimático indireto (ELISA para o diagnóstico sorológico de leishmaniose visceral em canídeos silvestres brasileiros. Foram estudadas amostras de soro e plasma de 12 canídeos cativos: sete lobos-guará (Chrysocyon brachyurus, três raposinhas (Lycalopex vetulus e dois cachorros-do-mato (Cerdocyon thous. As amostras de um C. brachyurus e uma L. vetulus, cativos em área endêmica para LV, que apresentavam doença clínica e positividade em testes de Imunofluorescência Indireta e Reação em Cadeia de Polimerase, foram utilizadas como controles positivos. Foram comparados os conjugados anti-IgG de cão e proteína A, ambos ligados a peroxidase, cujos testes detectaram quatro (04/12 e três (03/12 C. brachyurus soropositivos para anticorpos anti-Leishmania sp., respectivamente. As médias das densidades ópticas (DOs das amostras negativas foram nitidamente mais baixas do que as médias das DOs dos positivos tanto no ELISA com anti-IgG de cão (4,8 vezes como com proteína A (15,5 vezes. Os soros de três C. brachyurus positivos no ELISA indireto foram avaliados por Western blotting e identificaram 22 bandas, sendo imunodominantes as de peso molecular de 19, 22, 24, 45 e 66 kDa. Os testes ELISA com a proteína A e o conjugado anti-IgG de cão apresentaram respectivamente concordância excelente (Kappa = 1; p<0,001 e moderada (Kappa = 0,8; p<0,0015, com o Western blotting. Ambos foram, portanto, considerados adequados a avaliações de triagem de animais cuja resposta humoral de anticorpos indica contato com o parasito, úteis para subsidiar estudos para adequação de metodologias específicas para os canídeos silvestres.

  6. Mitigación de daños provocados por fauna silvestre en cultivos agrícolas en un bosque montano de Bolivia

    Directory of Open Access Journals (Sweden)

    Eddy Pérez L.

    2014-12-01

    Full Text Available El daño causado por fauna silvestre en cultivos agrícolas es una de las causas principales de conflicto dentro y fuera de áreas protegidas. Para un adecuado manejo del conflicto se requieren evaluaciones del daño y de la aplicación de distintos métodos de mitigación. El objetivo del trabajo fue evaluar la efectividad de prácticas agroculturales y cacería de control, para reducir daños por vertebrados silvestres en cultivos agrícolas anuales en el PN ANMI Cotapata. Se trabajó en siete parcelas con prácticas agroculturales, cuatro parcelas con cacería de control y cinco parcelas control, registrándose el tipo y densidad de cultivo, frecuencia de visitas de especies dañinas a huelleros, plantación perdida, especies responsables y biomasa de cosecha. Los resultados muestran que las especies más frecuentes fueron: Dasyprocta sp. y Dasypus novemcinctus, siendo estas 1.6 veces más frecuentes en parcelas con prácticas agroculturales. En promedio se perdió 7.3% de la plantación en parcelas agroculturales, 4.6% en parcelas sujetas a cacería de control, y 27.6% en parcelas control. Las principales especies responsables de las pérdidas fueron: P. tajacu, seguido por Dasyprocta sp. y S. apella. A través de estas estrategias de manejo, redujo las pérdidas en >50%, con lo cual se considera que los métodos puestos a prueba son útiles y se recomienda utilizarlos a gran escala con la consideración de que podría ser necesario innovar cada cierto tiempo, pues los animales silvestres tienden a acostumbrarse a los métodos de ahuyentamiento en ejecución.

  7. Caracterización morfológica de accesiones silvestres de guayaba Morphologic characterization of wild accesions of guava

    Directory of Open Access Journals (Sweden)

    Liliana Jiménez Lozano

    2009-04-01

    Full Text Available Se realizó la caracterización morfológica de 22 accesiones silvestres de guayaba Psidium guajava L. 14 colectadas en el municipio de Restrepo (Valle del Cauca, seis en Armenia (Quindío y dos en Pereira (Risaralda. Se utilizaron 12 descriptores cuantitativos y 10 cualitativos de tallo, hojas y frutos; el análisis de agrupamiento se hizo mediante el coeficiente de Dice-Nei-Li y el promedio aritmético no ponderado (UPGMA. La mayor variabilidad se halló en los descriptores peso de la pulpa (CV = 55.92%, peso (CV = 45.23%, y acidez del fruto (CV = 44.75%. El análisis de agrupamientos con base en caracteres cuantitativos permitió establecer cuatro grupos: las accesiones del grupo A (Armenia, presentaron valores promedio de los descriptores de la calidad del fruto (grados Brix, acidez del fruto y relación grados Brix/acidez y valores altos de contenido de pulpa. La mayoría de accesiones del grupo C (Restrepo tuvieron altos valores de calidad del fruto y bajo contenido de pulpa. El grupo B, constituido por accesiones de Armenia y Pereira, se diferenció por valores bajos en los descriptores de rendimiento del fruto (peso del fruto, de la pulpa y diámetro de la cavidad seminal. Las accesiones del grupo D (Restrepo mostraron valores promedios en calidad y rendimiento del fruto. Los descriptores cuantitativos se reunieron en tres variables sintéticas para rendimiento y calidad del fruto que representaron 76.86% de la variabilidad total.Quantitative and qualitative morphologic characterization of 22 wild accessions of guava Psidium guajava L. collected in Restrepo (Valle del Cauca, Armenia (Quindío and Pereira (Risaralda was done. Twelve (12 quantitative and ten (10 qualitative descriptors of stem, leaves and fruits were used. The Dice- Nei Li coefficient and the UPGMA was used for the cluster analysis. Dendrograms and principal components analysis were used. The highest variability was associated with fruit descriptors, pulp weight (CV = 55

  8. Determinación estructural de los metabolitos Secundarios triterpenoidales en búsqueda de Antimicrobianos de un hongo silvestre Aphyllophoral colombiano

    OpenAIRE

    Mora Correa, Miguel Antonio

    2010-01-01

    Se realizó el estudio químico del extracto crudo metanólico y de la partición en diclorometano del mismo, del cuerpo fructífero del hongo Basidiomiceto silvestre Colombiano Fomitopsis sp., en busca de compuestos triterpenoidales con posible acción antimicrobiana. Los resultados arrojaron como componentes grasos no esterólicos ésteres metílicos de ácidos grasos saturados e insaturados, así como también la presencia de ácidos grasos C16:0 y C18:1 9 e hidrocarburos alifáticos saturados C16, C18 ...

  9. Intoxicaciones intencionadas y accidentales de fauna silvestre y doméstica en España: diferencias entre Comunidades Autónomas

    OpenAIRE

    IS Sánchez-Barbudo; PR Camarero; Mateo, R

    2012-01-01

    En este estudio se han analizado 1.157 casos sospechosos de intoxicación de fauna silvestre y doméstica en el medio natural (1.800 animales y 340 cebos) procedentes de diversas Comunidades Autónomas (CCAA) españolas durante el periodo 2004-2010. Se ha detectado un 41,2% de casos positivos (40,8% de animales y 52,6% de cebos). En los carnívoros domésticos la detección del tóxico llegó al 71,4%, lo que indica su utilidad como centinelas del uso de veneno en el medio natural. El 78,3% de los ani...

  10. Reproducción de cochinilla silvestre Dactylopius opuntiae (Homóptera: Dactylopiidae Reproduction of wild cochineal Dactylopius opuntiae (Homoptera: Dactylopiidae

    Directory of Open Access Journals (Sweden)

    Arnoldo Flores-Hernández

    2006-06-01

    Full Text Available Por sus características, la cochinilla silvestre ofrece perspectivas de aprovechamiento como fuente de carmín y para el mejoramiento genético de la grana fina. Por lo anterior, se estableció una multiplicación y crianza de cochinilla silvestre, proveniente de la zona árida del norte de México para caracterizarla, utilizando como hospedero a Opuntia megacantha Salm Dyck. Los resultados indican que la especie silvestre pertenece al género-especie Dactylopius opuntia. Se determinó la presencia de partenogénesis en hembras. La duración de los estadios biológicos depende del sexo del insecto; el adulto hembra permaneció durante 38.4 días y 4.2 días para machos, los primeros estadios ninfales fueron similares en duración (18.1-19.8 días. El ciclo biológico de las hembras fue de 77 días mientras que el de los machos fue de 43 días. Para las hembras se estimó un periodo de preoviposición de 18.8 días, manteniéndose en oviposición durante 21 días con un promedio de 131 insectos por hembra. La proporción sexual hembras: machos fue 1:1. El tipo de reproducción fue predominantemente sexual, aunque hubo hembras partenogénicas. Este es el primer reporte de Dactylopius opuntiae como cochinilla silvestre asociada a la zona árida del noreste de México, específicamente en el Bolsón de Mapimí, Durango, México.Wild cochineal has characteristics that offer advantage as a source of carmine and for fine cochineal improvement. To characterize wild cochineal, we initiated a breeding effort raising wild cochineal from the arid zone of the north oh Mexico, using as a host organism Opuntia megacantha Salm dick. The results indicate that the wild specie is Dactylopius opuntiae. The presence of parthenogenesis in females was determined. The duration of ontogenetic stages depends on the sex of the insect. The adult female lasted 38.4 days and 4.2 days for males, the first stage nymphs were similar in duration (18-19.8 days. The complete

  11. Fauna triatominae do Estado da Bahia Brasil III - notas sobre ecótopos silvestres e o gênero Psammolestes

    Directory of Open Access Journals (Sweden)

    Ítalo A. Sherlock

    1974-01-01

    Full Text Available No estado da bahia na investigação de 531 biótopos silvestres para triatomíneos foram encontrados 12 exemplares de Triatoma lenti e Triatoma pessoai coletados em locas de mocós, e 1.043 exemplares de Psammolestes tertius coletados em ninhos de aves. É feita uma redescrição morfológica de P. tertius e mostrado a sua destribuição geográfica no Estado da Bahia.During a search of 531 natural biotopes for sylvatic triatominae bugs in the State of Bahia, Brazil, 12 specimens of Triatoma lenti and Triatoma pessoai were found in caves in which lived wild rock cavies; 1.043 specimens of Psammolestes tertius were fuond in birds nests. A morphological description of P. tertius is given, with data on its distribution in the State of Bahia.

  12. Epidemiologia da Leptospirose em animais silvestres na Fundação Parque Zoológico de São Paulo

    Directory of Open Access Journals (Sweden)

    Sandra Helena Ramiro Corrêa

    2004-06-01

    Full Text Available A Leptospirose é uma doença bacteriana de caráter zoonótico que afeta os animais domésticos, silvestres e o homem. Levantamentos sorológicos têm demonstrado o envolvimento de diferentes espécies sinantrópicas e silvestres na epidemiologia da doença. Com o objetivo de conhecer melhor a epidemiologia da Leptospirose dentro da Fundação Parque Zoológico de São Paulo, foi realizado um estudo sorológico nos animais silvestres mantidos em cativeiro, no período de 1996 a 1999. Foram colhidas amostras de sangue de 302 animais atendidos na rotina da Divisão de Veterinária, das quais 59 apresentaram resultado positivo (19.5% para a prova de Soroaglutinação Microscópica. Os sorovares mais prováveis para o conjunto total de resultados foram : copenhageni (15/59=25.4%, pomona (13/59=22% e castellonis (10/59=16.9%. Entre os animais silvestres examinados os sorovares mais prováveis foram : Família Callithrichidae : castellonis (3/3=100%, Família cebidae : copenhageni : (13/21=65%, grippotyphosa (2/21=9.5% e castellonis (1/21=44.7%. Família felidae : pomona (12/17=70.5%, icterohaemorrhagiae (2/17=11.7% e grippotyphosa (1/17=5.8%, Família canidae : castellonis (2/4=50%, cynopteri (1/4=25% e mini (1/4=25%, Família cervidae : mini (1/1=100%, Família bovidae : copenhageni (2/3=66.6%, pomona (1/3=33.3%, Família dasyproctidae : castellonis (2/3=66.6%, Família macropodidae: sentot (1/1=100%, família giraffidae : castellonis (1/1=100%. Animais de vida livre como ratos (Rattus norvegicus e gambás (Didelphis marsupialis também foram submetidos a prova de soroaglutinação necroscópica e cultura bacteriológica. Foram encontrados testes positivos para o sorovar icterohaemorrhagiae em 42,8% dos ratos e 40% dos gambás estudados. As freqüências de positivos quando analisadas do ponto de vista da localização espacial dos recintos destes animais, permitiram a verificação da existência de áreas críticas para exposição à leptospira

  13. Viabilidad poblacional de Alouatta palliata (Primates: Atelidae y Cebus capucinus (Primates: Cebidae en el Refugio de Vida Silvestre Privado Nogal, Sarapiquí, Heredia, Costa Rica

    Directory of Open Access Journals (Sweden)

    Jorge Rodríguez-Matamoros

    2012-06-01

    Full Text Available La destrucción del hábitat conlleva a la fragmentación de poblaciones de especies silvestres y se considera como uno de los principales factores en la extinción de especies A medida que las poblaciones se vuelven más pequeñas, surgen amenazas hacia su estabilidad y persistencia, como resultado de factores estocásticos demográficos, ambientales y genéticos. El objetivo de este trabajo fue estudiar los efectos de la fragmentación de poblaciones en la viabilidad de Alouatta palliata y Cebus capucinus en el Refugio de Vida Silvestre Privado Nogal (RVSPN, Sarapiquí, Heredia. Para esto se uso el programa VORTEX para correr un análisis de viabilidad de poblaciones (PVA para ambas especies. La información utilizada en el PVA proviene de la estructura demográafica de las poblaciones del RVSPN, literatura sobre la historia natural de las especies y artículos relacionados con PVA. Los resultados sugieren que tanto A. palliata como C. capucinus pueden sobrevivir en fragmentos boscosos aislados. Sin embargo, si se incorporan factores como depresión por endogamia, catástrofes o perdida de hábitat, las pequeñas poblaciones fragmentadas se vuelven inestables y aumenta el riesgo de que desaparezcan. Las poblaciones continuas fueron más robustas ante las amenazas incorporadas, por lo que se recomienda continuar con la reforestación para unir los fragmentos boscosos. Es importante darle seguimiento a las poblaciones de ambas especies y tener un manejo de su hábitat para disminuir los efectos negativos de diferentes eventos estocásticos provocados por el ambiente.

  14. Antioxidant Capacity, Anthocyanins, and Total Phenols of Wild and Cultivated Berries in Chile Capacidad Antioxidante, Antocianinas y Fenoles Totales de Berries Silvestres y Cultivados en Chile

    Directory of Open Access Journals (Sweden)

    Jaime Guerrero C

    2010-12-01

    ón fue determinar la capacidad antioxidante (AC, antocianinas totales (TA y el contenido de fenoles totales (TP, de berries silvestres y cultivados en diferentes localidades de la Región de La Araucanía y Región de Los Ríos (Chile. Para evaluar estos parámetros se utilizó el método de radicales libres 2,2-difenil-2- picrilhidrazilo (DPPH, pH diferencial y Folin-Ciocalteu, respectivamente. Los porcentajes de decoloración del DPPH estuvieron comprendidos entre 67,8% para zarzaparrilla roja y 95,3% para rosa mosqueta. El maqui presentó un contenido de AT significativamente mayor (2240,2 y 1445,3 mg L-1 cianidina 3-glucósido que el resto de los berries, el promedio de AT fue de 335,5 mg L-1. En cuanto al contenido FT los mayores niveles se obtuvieron en los dos cultivares de saskatoon (773,9 y 1001,9 mg L-1 ácido gálico y en rosa mosqueta silvestre (1457,0 y 1140,4 mg L-1 de ácido gálico. En este estudio se concluye que existen diferencias significativas en la capacidad antioxidante de frutos silvestres y cultivados en Chile, observándose una fuerte correlación entre el CA y el contenido de FT.

  15. Arbovírus Ilheus em aves silvestres (Sporophila caerulescens e Molothrus bonariensis Ilheus arbovirus in wild birds (Sporophila caerulescens and Molothrus bonariensis

    Directory of Open Access Journals (Sweden)

    Luiz Eloy Pereira

    2001-04-01

    Full Text Available OBJETIVO: Relatar o isolamento do vírus Ilheus no Estado de São Paulo e avaliar o seu impacto para a saúde pública. MÉTODOS: O isolamento de vírus foi realizado em camundongos albinos Swiss, a partir de sangue de aves silvestres, capturadas com redes de espera tipo mist net, armadas no nível do solo, no Parque Ecológico do Tietê, São Paulo. A identificação das cepas isoladas foi feita pelos testes de inibição da hemaglutinação, fixação de complemento e neutralização em camundongos. Amostras de plasma de aves e de mamíferos silvestres foram submetidas à pesquisa sorológica para detecção de anticorpos inibidores de hemaglutinação. RESULTADOS: Foram isoladas duas cepas do vírus Ilheus em sangue de aves das espécies Sporophila caerulescens e Molothrus bonariensis e detectados anticorpos em aves das espécies Columbina talpacoti, Geopelia cuneata, Molothrus bonariensis e Sicalis flaveola, em sagüis das espécies Callithrix jacchus e Callithrix penicillata e no quati Nasua nasua. CONCLUSÕES: O isolamento do vírus Ilheus e a detecção de anticorpos específicos em aves residentes, migratórias e de cativeiro, em sagüis e quatis, comprovam a presença desse agente no Parque Ecológico do Tietê. O comportamento migratório de aves silvestres pode determinar a introdução do vírus em outras regiões. Considerando-se a patogenicidade para o homem e a confirmação da circulação desse agente viral em área urbana, freqüentada para atividade de lazer e de educação, o risco de ocorrência de infecção na população humana não pode ser descartado.OBJECTIVE: To report the first Ilheus arboviruses isolated from wild birds and analyze its public health impact. METHODS: Wild birds and mammals were captured using mist nets and Tomahawk traps, respectively. Blood samples were drawn from these animals and inoculated intracerebrally in Swiss suckling mice found in the Parque Ecológico do Tietê, Brazil. The isolates were

  16. Ecología de enfermedades infecciosas emergentes y conservación de especies silvestres Ecology of emerging infectious diseases and wild species conservation

    Directory of Open Access Journals (Sweden)

    G Medina-Vogel

    2010-01-01

    Full Text Available Las recientes publicaciones científicas respecto de enfermedades infecciosas emergentes en especies silvestres están aumentando la preocupación internacional en el deterioro de la salud del ecosistema de los océanos, ambientes terrestres y límnicos. Se estudiaron investigaciones publicadas en los últimos 25 años. Los objetivos de este estudio fueron: 1 determinar la importancia del hábitat y la introducción de especies alóctonas, dentro del contexto de la contaminación y el cambio climático, en el surgimiento de enfermedades infecciosas, y 2 evaluar el riesgo de extinción de especies con problemas de conservación. La evaluación de los casos escogidos, más importantes, permite concluir que los patógenos responsables de las enfermedades infecciosas en especies silvestres pueden transmitirse rápidamente entre huéspedes pudiendo llegar a producir en corto tiempo epizootias que pueden poner en peligro poblaciones vulnerables en declinación. La destrucción del hábitat y la introducción de especies alóctonas son variables ambientales que significativamente afectan la ecología de las enfermedades infecciosas emergentes. En cambio la contaminación y el cambio climático actúan como variables ambientales que favorecen la transmisión y la creación de nuevos huéspedes. Esta multicausalidad en el origen de las enfermedades genera la necesidad de un enfoque transdisciplinario para enfrentarlas. El riesgo creciente de epizootias debido a las variables ambientales y biológicas estudiadas, fuerza incluir en los planes de conservación y rescate de especies silvestres la ecología de las enfermedades infecciosas.Recent literature on emerging infectious diseases in wild species raises international concerns about ocean, terrestrial and freshwater ecosystem health. Reports documenting infectious diseases in wild species from the last 25 years were investigated. The goals of the study were to: 1 assess the importance of habitat and

  17. Variación del tamaño de frutos y semillas en 38 poblaciones silvestres de Phaseolus lunatus (Fabaceae del Valle Central de Costa Rica

    Directory of Open Access Journals (Sweden)

    Elida M Vargas

    2003-09-01

    Full Text Available Se estudió la diversidad morfológica de frutos y semillas de 38 poblaciones silvestres de Phaseolus lunatus var. lunatus (frijol lima en el Valle Central de Costa Rica. Para ello se determinó la variación en el largo y ancho de vaina, el largo, ancho y grosor de las semillas, la razón entre estas variables y el peso promedio de 100 semillas. En términos generales, se puede afirmar que existen diferencias significativas entre las poblaciones analizadas para todas estas variables. Cuando se agruparon las 38 poblaciones en ocho regiones geográficas dentro del área de estudio, se encontró que existían diferencias significativas entre distintas regiones, pero la variación entre las poblaciones de cada región era mayor que aquella encontrada entre regiones. Estos resultados sugieren que no existe asociación entre estas variables y la región geográfica. Se analizó la utilidad de estos resultados para el desarrollo de estrategias para la conservación in situ de las poblaciones silvestres de Phaseolus lunatusWe studied the morfological diversity in fruits and seeds in 38 wild populations of Phaseolus lunatus var. lunatus (lima beans in the central valley of Costa Rica. In order to do so, measured the lenght and width of the fruits and the lenght, width and thickness of seeds. We also calculated the ratio between these traits and determined the weight of 100 seeds. In general, we found significant variation between populations for all variables. When we grouped the 38 populations into eight geographical regions within the study area, we found significant differences between regions. However, the levels of variation between populations within geographical regions was larger than that found between geographical regions. These findings suggested that there is no clear relationship between these variables and the geographical grouping established in this study. The implications of these findings for the establishment of strategies for in situ

  18. Viabilidad poblacional de Alouatta palliata (Primates: Atelidae y Cebus capucinus (Primates: Cebidae en el Refugio de Vida Silvestre Privado Nogal, Sarapiquí, Heredia, Costa Rica Population viability of Alouatta palliata (Primates: Atelidae and Cebus capucinus (Primates: Cebidae at Refugio de Vida Silvestre Privado Nogal, Sarapiquí, Heredia, Costa Rica

    Directory of Open Access Journals (Sweden)

    Jorge Rodríguez-Matamoros

    2012-06-01

    Full Text Available La destrucción del hábitat conlleva a la fragmentación de poblaciones de especies silvestres y se considera como uno de los principales factores en la extinción de especies A medida que las poblaciones se vuelven más pequeñas, surgen amenazas hacia su estabilidad y persistencia, como resultado de factores estocásticos demográficos, ambientales y genéticos. El objetivo de este trabajo fue estudiar los efectos de la fragmentación de poblaciones en la viabilidad de Alouatta palliata y Cebus capucinus en el Refugio de Vida Silvestre Privado Nogal (RVSPN, Sarapiquí, Heredia. Para esto se uso el programa VORTEX para correr un análisis de viabilidad de poblaciones (PVA para ambas especies. La información utilizada en el PVA proviene de la estructura demográafica de las poblaciones del RVSPN, literatura sobre la historia natural de las especies y artículos relacionados con PVA. Los resultados sugieren que tanto A. palliata como C. capucinus pueden sobrevivir en fragmentos boscosos aislados. Sin embargo, si se incorporan factores como depresión por endogamia, catástrofes o perdida de hábitat, las pequeñas poblaciones fragmentadas se vuelven inestables y aumenta el riesgo de que desaparezcan. Las poblaciones continuas fueron más robustas ante las amenazas incorporadas, por lo que se recomienda continuar con la reforestación para unir los fragmentos boscosos. Es importante darle seguimiento a las poblaciones de ambas especies y tener un manejo de su hábitat para disminuir los efectos negativos de diferentes eventos estocásticos provocados por el ambiente.Population viability of Alouatta palliata (Primates: Atelidae and Cebus capucinus (Primates: Cebidae at Refugio de Vida Silvestre Privado Nogal, Sarapiquí, Heredia, Costa Rica. Habitat destruction may cause wildlife population fragmentation and is considered an important factor in small population species extinction. As wildlife populations become smaller, threats to their stability

  19. Endoparasitos (Nemathelminthes y Platyhelminthes de animales de vida silvestre de la Reserva de Biósfera del Manu, Perú

    Directory of Open Access Journals (Sweden)

    Manuel Tantaleán

    2013-06-01

    Full Text Available Durante el año 2001, se recolectaron 8 géneros de helmintos de mamíferos y aves silvestres del Perú, en la Reserva Biosfera del Manu (Departamentos de Cusco y Madre de Dios, desde los 470 a 3780 m. Los parásitos fueron fijados con alcohol etílico en el campo y transportados al laboratorio para estudiarlos; los nemátodos se diafanizaron y los céstodos y tremátodos se colorearon con carmín de acuerdo a técnicas convencionales. La identificación específica de algunos helmintos fue imposible por el estado en que se encontraban, pero se dan a conocer por ser material de gran importancia y ser algunos de ellos algunos registros nuevos para el Perú. Nuestros hallazgos son los siguientes: Rhopalias caballeroi Kifune y Uyema, 1982, Rhopalias sp. (probable n. sp., Taenia pisiformis Bloch, 1780 (cisticerco, Mesocestoides sp. (tetratyridia, Aprocta sp., Evaginuris branicki Mc Clure, 1932, Haematospiculum sp., Protospirura sp., Diplotriaena sp., Thelazia sp. 1, Thelazia sp. 2, Thelazia sp. 3 y Subulura sp.

  20. Desenterrado os mortos: A reconstrução do passado político brasileiro na obra de Edney Silvestre

    Directory of Open Access Journals (Sweden)

    Gabriela Antunes

    2014-07-01

    Full Text Available Este artigo tem como objetivo analisar a trilogia de estreia de Edney Silvestre, composta por Se eu fechar os olhos agora (2009, A felicidade é fácil (2011, e Vidas provisórias (2013. Pretende-se fazer um breve balanço da contribuição do autor para a reabertura de um debate sobre o recente passado histórico-político brasileiro, e, relacionando os fatos abordados no romance com temas contemporâneos, ressaltar a relevância e a atualidade desse debate. Para isso, os textos serão analisados cronologicamente, o que visa mostrar o desenvolvimento do tratamento do sujeito histórico no conjunto de obras do autor.   This paper aims to analyse Edney Silvestre’s trilogy composed by If I close my eyes now (2009, Happiness is easy (2011, and Temporary lives (2013, as well as to review the author’s contribution in reopening a debate on Brazilian’s recent historical and political past. By pointing out the relationship between the facts mentioned in thenovels and contemporary Brazil, it aims to stress the importance and up-to-dateness of this discussion. In order to achieve these goals, the novels will be analysed chronologically, which also intends to reveal the development of the way the author deals with Brazilian history throughout his oeuvre.

  1. Híbridos somáticos obtenidos por fusión de protoplastos entre Solanum tuberosum L. subsp. tuberosum y la especie silvestre Solanum circaeifolium Bitter

    Directory of Open Access Journals (Sweden)

    Rosa Espejo

    2013-03-01

    Full Text Available Con la finalidad de obtener híbridos somáticos interespecíficos, se fusionaron protoplastos de la especie tetraploide Solanum tuberosum y de la especie silvestre diploide Solanum circaeifolium utilizando polietilenglicol. Los productos de fusión fueron cultivados en el medio V-KM suplementado con albúmina de suero bovino. Las primeras divisiones celulares ocurrieron a los 3 a 4 días de cultivo. Después de la formación de colonias se observó una rápida proliferación de callos, a partir de los cuales se regeneraron 19 plantas. El análisis molecular usando RAPD, confirmó que los regenerantes presentaban segmentos de ADN de ambos parentales, sugiriendo su posible naturaleza de híbridos somáticos. Las observaciones del número de cromosomas indicaron que todos los híbridos fueron aneuploides. En condiciones de invernadero, los regenerantes derivados de la fusión de protoplastos, mostraron características morfológicas intermedias entre las líneas parentales. Este estudio muestra la producción de híbridos somáticos de papa con el método de fusión presentado.

  2. Efecto del fotoperiodo y la temperatura sobre la composición bioquímica en reproductores silvestres de cabrilla sardinera, Mycteroperca rosacea (Streets, 1877

    Directory of Open Access Journals (Sweden)

    José Antonio Estrada-Godínez

    2014-03-01

    Full Text Available Se estimó el factor de condición (K, el índice gonadosomático (IGS, hepatosomático (IHS y de grasa visceral (IGV, así como la composición bioquímica en diferentes tejidos de reproductores silvestres de cabrilla sardinera, Mycteroperca rosacea, para evaluarlos a lo largo de un ciclo reproductivo y ver la relación que presentan los cambios con respecto a la temperatura del agua y fotoperiodo de la zona de muestreo. Se capturaron 187 reproductores, 146 hembras y 41 machos en el golfo de California, México. Se observaron diferencias significativas (P < 0,005 en los IGS, IHS e IGV; en el caso de K no se encontraron diferencias. También, se observaron variaciones significativas (P < 0,05 en la mayoría de los parámetros bioquímicos, encontrándose los valores más altos durante la etapa de desove, mientras que los más bajos durante la etapa de reposo. Todos los índices estimados y los parámetros bioquímicos determinados, se correlacionaron significativamente (P < 0,05 con el fotoperiodo, mientras que solo se encontraron correlaciones significativas (P < 0,05 entre el IGS e IGV con respecto a la temperatura del agua.

  3. Ecología trófica del jabalí europeo (Sus scrofa silvestre en Chile Trophic ecology of the wild boar (Sus scrofa in Chile

    Directory of Open Access Journals (Sweden)

    ÓSCAR SKEWES

    2007-09-01

    Full Text Available Documentamos la dieta del jabalí silvestre en el centro-sur de Chile basados en el examen de 20 estómagos colectados en los faldeos de volcán Mocho-Choshuenco (39°54' S, 72°02' O y en el Parque Nacional Vicente Pérez Rosales (41°03' S, 71°54' O. La dieta está representada por animales, vegetales y hongos. Entre los vegetales y hongos son consumidas tanto las partes epígeas como hipógeas, lo mismo que frutos y semillas. Hongos y rizomas de Gunnera tinctoria constituyen ítemes vegetales cuantitativamente importantes en la alimentación. El jabalí forrajea en general en ambiente boscoso, pero las especies vegetales más frecuentes en la dieta se encuentran en espacios abiertos o fuera del bosque. El ambiente dominado por Chusquea spp. constituye un importante sitio de alimentación. Los roedores de la familia Muridae dominan entre los animales determinados en la dieta del jabalí. Esta situación, sin embargo, parece obedecer a la ocurrencia de una ratada producto de la semillación masiva de Chusquea spp. durante la época de muestreo. Las aves de la familia Rhinocryptidae e invertebrados (en especial larvas del coleóptero Chiasognathus grantii constituyen parte frecuente de los ítemes animales de la dieta del jabalí. En comparación a estudios en otras partes del mundo, el jabalí silvestre en Chile consume hongos en porcentaje de ocurrencia similar (65 % a su dieta en Estados Unidos de América pero bastante más alta que su dieta en Europa (5-32 %. En relación al volumen del componente animal, el jabalí en Chile consume más (16,1 % que en Estados Unidos de América (6 % y que en Europa (7-13 %We document the diet of wild boar in south-central Chile based on analysis of 20 stomachs collected on the outskirts of Mocho-Choshuenco volcano (39°54' S, 72°02' W and of Vicente Pérez Rosales National Park (41°03' S, 71°54' W. The diet incorporates animals, plants and fungi. Among the latter two, both epigeal and hypogeal parts

  4. Frutos tropicais silvestres e polpas de frutas congeladas: atividade antioxidante, polifenóis e antocianinas Wild fruits and pulps of frozen fruits: antioxidant activity, polyphenols and anthocyanins

    Directory of Open Access Journals (Sweden)

    Eugenia Marta Kuskoski

    2006-08-01

    Full Text Available Os sucos de frutas tropicais conquistam cada vez mais o mercado consumidor, sendo o Brasil um dos principais produtores. Existe grande diversidade de produtos derivados de frutos e constante inserção de novos produtos no mercado de consumo, os quais, na maioria das vezes, ainda não foram devidamente pesquisados com respeito às suas propriedades e atividades benéficas à saúde. Neste trabalho, objetiva-se determinar algumas propriedades de frutos tropicais silvestres in natura e polpas de frutos comercializados congelados. Para determinar a atividade antioxidante, utilizou-se o método do radical 2,2-difeniL-1-picrilhidrazilo (DPPH·; para determinar os polifenóis totais, o método de Folin-Ciocalteu e, para as antocianinas, o método da diferença de pH. As polpas de frutas analisadas foram de amora, uva, açaí, goiaba, morango, acerola, abacaxi, manga, graviola, cupuaçu e maracujá; e os frutos silvestres, jambolão e baguaçu. Representada em TEAC (atividade antioxidante equivalente a Trolox, a atividade antioxidante global das polpas oscila entre mínimos e máximos 0,5 e 53,2mimol g-1, enquanto que, representada em VCEAC (atividade antioxidante equivalente a vitamina C, entre mínimos e máximos de 64,8 e 1198,9mg100g-1. Para os extratos de polpa dos frutos in natura, a atividade antioxidante oscila entre 13,3 e 111,2mimol g-1 (TEAC e entre 42,8 e 2533,1mg 100g-1 (VCEAC. Em ordem decrescente de capacidade antioxidante, encontra-se: acerola> manga> morango> uva> açaí> goiaba> amora> graviola> maracujá> cupuaçu> abacaxi. Os frutos de baguaçu apresentam maior atividade antioxidante que os de jambolão.The tropical fruit juices are gaining ever greater space in the consumer market, and Brazil is one of the main producer countries in this market. There is a great diversity of products derived from fruits and new products for consumption are launched constantly, often without the necessary research into their active properties and

  5. Análisis de la dinámica de poblaciones silvestres de Chigüiros Hydrochaeris hydrochaeris (Linnaeus, 1766 como herramienta de manejo hacia el aprovechamiento sostenible y la conservación

    Directory of Open Access Journals (Sweden)

    López Arévalo Hugo Fernando

    2006-06-01

    Full Text Available Se analizó el comportamiento de la dinámica de poblaciones silvestres de chigüiros bajo diferentes condiciones del hábitat y presiones antrópicas, y se formuló una herramienta técnica para apoyar la gestión de manejo que realiza la autoridad ambiental regional relacionada con el aprovechamiento sostenible y la conservación de la especie. Se generó un modelo de simulación determinístico que representa la dinámica de poblaciones silvestres de chigüiros, como resultado de procesos biológicos de natalidad y mortalidad, y del aprovechamiento extractivo anual de individuos en hatos de los municipios de Paz de Ariporo y Hato Corozal (Casanare, Colombia. Una interfase fue diseñada para facilitar el uso del modelo y construir escenarios para simular diferentes alternativas de manejo. El modelo fue usado para evaluar el efecto a largo plazo de la cosecha o extracción de individuos mediante la caza comercial, la cosecha selectiva de adultos por sexos, la presencia de adecuaciones y la variación del área de hábitat adecuado disponible sobre la tendencia de abundancia de tres poblaciones silvestres de chigüiros en la zona de estudio. Las simulaciones realizadas bajo los diferentes escenarios permitieron establecer las distintas respuestas de cada población a los cambios realizados en la tasa de cosecha y el área de hábitat y así recomendar acciones de manejo. Los escenarios evaluados destacan la importancia de hacer una extracción selectiva de adultos por sexos para realizar un aprovechamiento sostenible de la población y garantizarsu conservación. Así mismo, se destaca la importancia de mantener mayores áreas con hábitat adecuado.

  6. Associação entre isoenzimas e matéria seca em batata silvestre Isoenzymes and dry matter content in wild potato

    Directory of Open Access Journals (Sweden)

    BEATRIZ HELENA GOMES ROCHA

    2000-12-01

    Full Text Available Clones de batata silvestre (Solanum spp. foram analisados quanto aos teores de matéria seca em tubérculos e isoenzimas de aspartato transaminase e isocitrato desidrogenase em folhas, com o objetivo de identificar associação entre estas características. Os resultados obtidos em uma amostra de 50 clones indicam grande variabilidade do teor de matéria seca. Clones de S. commersonii malmeanum apresentaram maior teor que os de S. commersonii commersonii, S. chacoense muelleri e de outros cuja espécie não foi identificada. Os padrões isoenzimáticos de folhas de 38 clones da amostra mostraram 15 variantes eletroforéticas de aspartato transaminase e sete de isocitrato desidrogenase. Comparações efetuadas através de tabelas de contingência 2 x 2, usando o teste de chi², com correção para continuidade, permitiram concluir que existe associação significativa entre o teor de matéria seca e as bandas de mobilidade relativa 1,00 de aspartato transaminase e de isocitrato desidrogenase.Wild potato clones (Solanum spp. were analysed for tuber dry matter content, leaf aspartate transaminase and leaf isocitrate dehydrogenase isoenzymes in order to identify association between these characteristics. The results indicate that there is great variability for dry matter content among 50 clones analysed. S. commersonii malmeanum clones had higher dry matter levels than S. commersonii commersonii, S. chacoense muelleri and the clones whose species were not identified. Fifteen aspartate transaminase and seven isocitrate dehydrogenase bands were observed in the gels of 38 clones. Tests of chi², using 2 x 2 contingency table, revealed a significant association between dry matter content and the bands of relative mobility 1.00 of both aspartate transaminase and isocitrate dehydrogenase isoenzymes.

  7. Diversidad y aspectos biológicos de abejas silvestres de un ambiente urbano y otro natural de la región central de Santa Fe, Argentina

    Directory of Open Access Journals (Sweden)

    Milagros DALMAZZO

    2010-01-01

    Full Text Available El objetivo del presente trabajo fue relevar el elenco de abejas silvestres en la región central de Santa Fe y comparar la diversidad de especies y aspectos biológicos en dos ambientes de una misma región. Las abejas fueron colectadas en el estrato herbáceo de la Reserva Universitaria “Escuela Granja” de la localidad Esperanza, y en la zona urbana de la localidad Susana, ambas ubicadas dentro de la Provincia Fitogeográfica del Espinal. La colecta se realizó en octubre, noviembre y diciembre de 2004 y en enero, febrero y marzo de 2005, registrando las especies vegetales sobre las que se capturaron. Se colectaron 277 ejemplares en total, de los cuales se identificaron 62 especies (27 géneros en 5 familias. Las curvas de rarefacción indican una tasa de acumulación de especies mayor para la Reserva Ecológica, los índices de diversidad de Shannon son 3,25 para la Reserva Ecológica y 2,64 para la Zona Urbana. Para la comparación de las comunidades en ambos sitios, las abejas fueron clasificadas en tres categorías según la especialización en el uso del recurso floral, sustrato de nidificación y comportamiento social. Se observó una asociación entre los grupos especialistas y de nidificación en el suelo con el ambiente natural, y por otro lado, las especies generalistas y de nidificación en cavidades con el ambiente urbano. No se identificaron diferencias, en cuanto al tipo de comportamiento social de las especies, entre ambos sitios.

  8. Epidemiología molecular de la rabia urbana en Colombia, 1994-2004. La rabia en ecosistemas silvestres como amenaza para la población humana

    Directory of Open Access Journals (Sweden)

    Jorge Boshell

    2004-03-01

    Full Text Available

    En Colombia la rabia ocurre en dos ciclos epidemiológicos principales: la rabia urbana con el perro como principal reservorio y transmisor principalmente a humanos, y la rabia silvestre con especies animales de la vida silvestre como los quirópteros y zorros entre otros, como reservorios y transmisores principalmente a especies ganaderas y eventualmente a humanos que se convierten en víctimas accidentales. Durante los últimos años la rabia silvestre en Colombia ha cobrado mayor relevancia como problema de salud pública que la rabia urbana, a juzgar por el número de víctimas humanas. Con el fin de perfeccionar el diagnóstico y la tipificación del virus de la rabia en Colombia, el Laboratorio Nacional de Referencia del Instituto Nacional de Salud estandarizó técnicas para amplificar y secuenciar un fragmento de ADN complementario (cADN a una fracción de 902 nucleótidos seleccionados del ARN del virus, con el fin de adelantar estudios de epidemiología molecular. La fracción mencionada contiene secuencias que codifican para los aminoácidos 447-525 de la glicoproteína y 1-35 de la proteína L. Además contiene la región intergénica no codificante conocida como Pseudogen Psi.

    Las técnicas estandarizadas fueron las siguientes: a extracción de ARN total a partir de cerebro de ratón infectado. b amplificación molecular por transcripción reversa y reacción en cadena de la polimerasa. c secuenciación del fragmento amplificado.

    Mediante estas técnicas de epidemiología molecular viral se determinó que durante 1994-2004, la rabia urbana se concentró en tres regiones geográficas definidas, con epizootias en el antiplano cundiboyacense, departamento de Arauca y la región Caribe. Las dos primeras se controlaron

  9. Parásitos gastrointestinales y ectoparásitos de ungulados silvestres en condiciones de vida libre y cautiverio en el trópico mexicano

    Directory of Open Access Journals (Sweden)

    José Manuel Mukul-Yerves

    2014-01-01

    Full Text Available Se identificaron los parásitos gastrointestinales y ectoparásitos presentes en venados cola blanca ( Odocoileus virginianus , pecarí de collar ( Pecari tajacu y venado temazate ( Mazama americana en condiciones de vida libre y cautiverio en el trópico mexicano. Se obtuvieron muestras fecales y ectoparásitos de 12 ungulados de vida libre que se cazaron para fines de subsistencia y de 55 ungulados en condiciones de cautiverio. Las muestras de excremento se analizaron mediante las pruebas de Flotación Centrifugada y McMaster para conocer los géneros y órdenes de parásitos que afectan a los ungulados; así como la excreción de huevos y ooquistes por gramo de excremento. Los ectoparásitos encontrados se identificaron taxonómicamente. Las muestras positivas a nematodos del orden Strongylida y protozoos del orden Eucoccidiorida se cultivaron para su identificación taxonómica a nivel de géneros. En venados cola blanca y temazate en cautiverio se identificaron los géneros Strongyloides, Trichuris, Capillaria, Mammomonogamus y Eimeria; mientras que en los pecaríes de collar los géneros Oesophagostomun, Eimeria e Isospora . En los tres ungulados de vida libre se identificó el género Strongyloides. Sólo se encontraron ectoparásitos en ungulados de vida libre, identificándose la pulga Pulex irritans y el piojo Gliricola porcelli en venados temazate y pecaríes de collar, mientras que la mosca Lipoptena sp se colectó en los venados cola blanca. La garrapata Amblyomma cajennese se encontró parasitando a las tres especies de ungulados estudiados. Se concluye que los ungulados silvestres del presente estudio estuvieron parasitados con nematodos gastrointestinales, protozoos del orden Eucoccidiorida, pulgas, piojos, moscas y garrapatas.

  10. Observações sobre calazar em Jacobina, Bahia. VI - Investigações sobre reservatórios silvestres e comensais

    Directory of Open Access Journals (Sweden)

    I. A. Sherlock

    1988-03-01

    Full Text Available Durante os anos de 1982 a 1986, a investigação sobre mamíferos comensais e silvestres, da periferia da cidade de Jacobina, Bahia, mostrou, ao lado do escasso número de exemplares, uma reduzida variedade específica dessa fauna. Capturou-se apenas 11 espécies, entre as quais, predominou o Didelphis albiventris, que abrangeu 44% dos 213 espécimens capturados. Entre os 193 com exames já concluídos, 84 eram exemplares de D. albiventris e 2 estavam infectados pela Leishmania donovani senso lato, 1 por L. mexicana amazonensis, 1 por L. braziliensis, subespécie e 3 por Trypanosoma cruzi Também foram observadas formas suspeitas de serem amastigotas de leishmanics, nos esfregaços de órgãos de 3 exemplares de Dasyprocta aguti, 1 Cercomys cunicularius - e 1 Oryzomys eliurus. 0 restante dos exemplares, inclusive 14 de Lycalopex vetulus, estava negativo para flagelados. Apesar de reforçado por outros indicadores epidemiológicos, como a predominância específica, a freqüência domiciliar, a atratividade para a vetora Lutzomyia longipalpis, e a concomitância com casos humanos nos mesmos locais, o índice de 2,3% de infecção natural do Didelphis albiventris, não autoriza a conclusão definitiva de ser o marsupial o mais importante reservatório natural da leishmaniose visceral em Jacobina.

  11. Santuario de fauna silvestre cuevas de Paraguaná, Venezuela: lineamientos técnicos para su diseño

    Directory of Open Access Journals (Sweden)

    Pedro Delfín

    2011-01-01

    Full Text Available En este trabajo, se describen los lineamientos técnicos utilizados para el diseño del Santuario de Fauna Silvestre Cuevas de Paraguaná, estado Falcón, Venezuela, cuyo objetivo contempla la protección de un conjunto de cavernas o simas que actúan como refugios y sitios de reproducción de colonias de murciélagos insectívoros y nectarívoros; estos animales desempeñan un papel clave en la ecología y socioeconomía de ambientes xerofíticos en el norte de Venezuela y otras regiones vecinas. La figura incluye cuatro núcleos, cada uno representado por una caverna circundada por una zona de amortiguamiento de forma cuadrada; dos de estas cavernas se ubican en el sector oriental de la península de Paraguaná y el resto en el lado occidental. Se discuten los principales aspectos ecológicos vinculados con la quiropterofauna que habita el Santuario (los cuales fundamentan su decreto, así como los instrumentos legales que sustentan la propuesta y el escenario socioeconómico que caracteriza al área de estudio; adicionalmente, se describen algunos procedimientos seguidos para la incorporación de actores locales en un programa de sensibilización y educación que sirvió como plataforma para la creación de la figura, presentada en un documento técnico, que fue sometido a consideración de las instituciones gubernamentales con competencia en esta materia

  12. Prevalencia y distribución de los principales agentes etiológicos que afectan los langostinos silvestres en Tumbes, Perú

    Directory of Open Access Journals (Sweden)

    Rubén Alfaro Aguilera

    2011-05-01

    Full Text Available Se determinó la prevalencia y distribución de diferentes agentes patógenos en langostinos silvestres, en la zona de esteros de la Región Tumbes - Perú, entre marzo y diciembre de 2009. Los canales de marea considerados en este estudio fueron: Boca del Río Tumbes, El Alcalde, Jelí, El Bendito, Envidia, Soledad y Algarrobo. Se colectó un total de 1926 langostinos entre juveniles y pre-adultos de las especies Litopenaeus vannamei, L. stylirostris y Farfantepenaeus californiensis. Utilizando la técnica de la PCR, se detectó la presencia de los patógenos NHPB (0,62%, IHHNV (0,31%, BP (1,61% y WSV (2,75%; no se encontró infección por TSV. Las tres especies en estudio fueron positivas a WSV y BP, presentándose la mayor prevalencia de infección por WSV (2,98% en la especie L. stylirostris y por BP (2,66% en L. vannamei. La NHPB fue detectada en las especies L. vannamei y L. stylirostris con 0,77% y 0,43% de prevalencia respectivamente. Se obtuvo una prevalencia de 0,52% para IHHNV en L. vannamei. Las más altas prevalencias de las infecciones por WSV, BP, NHPB e IHHNV se registraron en los canales de marea El Alcalde (10,79%, Algarrobo (4,51%, Envidia (2,26% y Jelí (5,05%. Los datos señalan la presencia constante de diversos patógenos virales y bacterianos en diferentes especies de peneidos y su amplia distribución a lo largo del litoral tumbesino, lo que constituye un riesgo potencial para el desarrollo de la acuicultura en la región, y podría afectar las poblaciones naturales de langostinos.

  13. Intoxicación por munición de plomo en aves silvestres en España y medidas para reducir el riesgo

    Directory of Open Access Journals (Sweden)

    R. Mateo

    2013-01-01

    Full Text Available La intoxicación por ingestión de munición de plomo en aves silvestres es conocida en España desde finales del siglo pasado. Elevadas densidades de perdigones de plomo en diversos humedales de importancia internacional producen tasas de ingestión de perdigones cercanas al 70 % en es- pecies como el ánade rabudo (Anas acuta y el plumbismo llega a ser una de las principales causas de mortalidad de la amenazada malvasía ca- beciblanca (Oxyura leucocephala. El plumbismo también ha sido descrito en diversas especies de aves rapaces y se ha comprobado que la exposición al plomo es elevada en las especies más carroñeras y oportunistas. La contaminación de la carne de caza también ha sido objeto de es- tudio, debido a que en España se da la particularidad de cocinarla en escabeche, lo que incrementa la transferencia de plomo de la munición a la carne. Por el momento, la única acción llevada a cabo para reducir el riesgo de exposición al plomo de la munición en aves y humanos ha sido la prohibición desde 2001 del uso de perdigones de plomo en humedales protegidos. En esta revisión se hace un repaso a los estudios llevados a cabo en España sobre la contaminación por el plomo de la munición y el efecto que están teniendo las medidas hasta el momento adoptadas para reducir este riesgo.

  14. Ocorrência de anticorpos anti-Toxoplasma gondii em aves silvestres de três Unidades de Conservação Federais da Paraíba e da Bahia

    Directory of Open Access Journals (Sweden)

    Leontina H.M. Andrade

    2016-02-01

    Full Text Available Resumo: A vigilância e monitoramento de doenças em animais silvestres são imprescindíveis no contexto ambiental e de saúde pública, pois estes animais agem como sentinelas, refletindo alterações ambientais precocemente, o que proporciona maior eficácia no monitoramento ambiental e permite o acesso rápido a informações sobre as condições da área. Neste contexto, as aves são importantes no ciclo biológico do Toxoplasma gondii e na epidemiologia da toxoplasmose, principalmente porque seus tecidos representam importantes fontes de proteína na alimentação de felídeos e humanos. Objetivou-se detectar anticorpos anti-T. gondii, por meio do teste de aglutinação modificada em aves silvestres de três Unidades de Conservação (UC Federais dos Estados da Paraíba e Bahia. No período de dezembro de 2011 a outubro de 2013 foram capturadas com redes de neblina 222 aves silvestres pertencentes a 67 espécies, 27 famílias e 12 ordens. Após a captura, foi colhido sangue de cada animal e separado o soro, que foi submetido ao Teste de Aglutinação Modificada (MAT≥1:25 utilizando taquizoítos inativados na formalina e 2-mercaptoetanol. Dentre as 222 amostras analisadas, três (1,3% foram sororreagentes: 1 de 16 (6,2% pipira-preta Tachyphonus rufus (título 50, 1 de 5 (20% juriti-gemedeira Leptotila rufaxilla (título 50 e 1 de 1 (100% caneleiro-enxofre Casiornis fuscus (título 25. Este é o primeiro relato da ocorrência de anticorpos anti-T. gondii nas referidas espécies de aves silvestres de vida livre nas duas UC Federais estudadas.

  15. Espesura crítica y regeneración en un pinar natural de silvestre de elevada complejidad estructural (monte “Cabeza de Hierro”, Rascafría, Madrid)

    OpenAIRE

    Rubio Cuadrado, Álvaro; Vivar Sanz, Alejandro; Sadornil Arenas, Enrique; Aroca Fernández, Mª José; Serrada Hierro, Rafael; Bravo Fernandez, Jose Alfredo

    2009-01-01

    El monte privado “Cabeza de Hierro” (Rascafría, Madrid), con 2.016,5 ha de superficie total y 1.886,4 ha de superficie arbolada, presenta una masa de pino silvestre de origen natural con abundante melojo, de elevado valor económico y ecológico, sobre la que se realizan aprovechamientos maderables desde hace al menos 150 años. La mayor parte del monte está incluido en la Zona Periférica de Protección del Parque Natural de la Cumbre, Circo y Lagunas de Peñalara. Ordenado desde 1957, se si...

  16. Caracterización de sitios de percha del guajolote silvestre (Meleagris gallopavo mexicana) en Sierra Fría, Aguascalientes, México Roost sites characteristics of wild turkey (Meleagris gallopavo mexicana) in Sierra Fria, Aguascalientes, Mexico

    OpenAIRE

    Marcelo Márquez-Olivas; Edmundo García-Moya; Carlos González-Rebeles Islas; Humberto Vaquera-Huerta

    2007-01-01

    Entre octubre y noviembre del año 2001 y mayo de 2002 se localizaron 16 sitios de percha de guajolote silvestre (Meleagris gallopavo mexicana) en la Sierra Fría de Aguascalientes. El 87.5% de los sitios se encontraron en bosques de pino-encino (en rodales de pinos), en altitudes de 2500 a 2650 m. En la parte alta (2/3) de la cuesta se localizaron 8 de los sitios y 7 sobre laderas de exposición noreste, en una pendiente promedio de 38.9 ± 12.6%. El 62.5% de los sitios se usaron durante todo el...

  17. Conocimiento hortícola y de recolección de recursos silvestres en comunidades rurales y semi-rurales del Noroeste de la Patagonia: Saber-cómo (know-how) y resiliencia

    OpenAIRE

    Eyssartier, Cecilia

    2011-01-01

    En la presente tesis estudiamos el conocimiento ecológico tradicional, ligado a la horticultura y recolección de plantas silvestres, en cuatro comunidades locales del Noroeste patagónico. Dado que la actividad de cultivar y recolectar implica procesos cognitivos asociados a patrones de percepción-acción, íntimamente imbricados en contextos ecológicos y socio-culturales dinámicos, abordamos esta temática considerando el marco teórico de la cognición corporizada y la resiliencia. Se indagó sobr...

  18. Estudio Retrospectivo del Ingreso de Animales Provenientes del Tráfico Ilegal a la Unidad de Rescate y Rehabilitación de Animales Silvestres (URRAS), entre febrero de 1996 y agosto de 2006

    OpenAIRE

    Sandra Milena Lamprea-Maldonado; P A Moreno; O. SÁNCHEZ; Ximena Gómez; Nelson Jurado

    2009-01-01

    Este estudio da a conocer las cifras de animales provenientes del  tráfico y tenencia ilegal que ingresaron a la Unidad de Rescate y Rehabilitación de Animales Silvestres  (URRAS) de la Facultad de Medicina Veterinaria y Zootecnia de la Universidad Nacional de Colombia, en el período comprendido entre Febrero de 1996 y Agosto de 2006. A partir de la información recopilada en la base de datos y actas de ingreso, se establecieron las principales taxas afectadas por el ilícito, tipos de ingreso ...

  19. Epidemiovigilância das infeções por Leishmania spp. no efetivo cinotécnico da Guarda Nacional Republicana e em mesocarnívoros silvestres

    OpenAIRE

    Rocha, Hugo Manuel Bernardo

    2013-01-01

    Dissertação apresentada na Faculdade de Ciências e Tecnologia da Universidade Nova de Lisboa para obtenção do Grau de Mestre em Genética Molecular e Biomedicina As leishmanioses são um grupo de doenças de transmissão essencialmente vetorial, causadas por protozoários intracelulares do género Leishmania, que afetam humanos, animais domésticos e silvestres. A leishmaniose canina tem elevada incidência e distribuição alargada em Portugal continental, onde a espécie Leishmania infantum é o age...

  20. Genetic Relationships of Common Bean (Phaseolus vulgaris L. Race Chile with Wild Andean and Mesoamerican Germplasm Relaciones Genéticas entre el Germoplasma de Poroto (Phaseolus vulgaris L. Raza Chile y Silvestres Andinos y Mesoamericanos

    Directory of Open Access Journals (Sweden)

    Viviana Becerra V

    2011-03-01

    Full Text Available The Chilean common bean (Phaseolus vulgaris L. belongs to the cultivated race Chile and its origin is presumably Andean. The objective of this study was to identify the origin of a group of Chilean accessions based on their genetic relationship with wild material from the Mesoamerican and Andean common bean gene pool. To achieve this objective, universal primers of chloroplast DNA (cpDNA and mitochondrial DNA (mtDNA were used to detect polymorphism using Polymerase Chain Reaction - Restriction Fragment Length Polymorphism (PCR-RFLP. Thirty-two genotypes were analyzed, including wild material from Mexico, Ecuador, Peru, Bolivia, and Argentina, as well as Chilean cultivated genotypes belonging to endemic Chilean accession types (Tórtola, Coscorrón, and Cuyano and naturalized commercial lines (Frutilla, Bayo, Manteca, and Blanco grande. Results showed a low level of polymorphism for cpDNA (23% and mtDNA (24% in wild and cultivated Chilean common bean accessions. Some universal primers and restriction enzyme combinations were more efficient than others in detecting polymorphism. The Chilean materials were closely related to wild accessions collected in Argentina, Bolivia, and Peru indicating their Andean origin. The wild accessions from Ecuador were located in a intermediate position between the Mesoamerican and Andean accessions.El poroto chileno (Phaseolus vulgaris L. pertenece a la raza Chile, cuyo origen es desconocido y presumiblemente andino. El objetivo del trabajo fue identificar el origen de un grupo de genotipos chilenos basado en sus relaciones genéticas con material silvestre perteneciente a los acervos genéticos mesoamericano y andino. Para lograr este objetivo se usaron partidores universales de ADNcp y ADNmt con la metodología de la Reacción en Cadena de la Polimerasa-Fragmentos de Restricción Polimórficos. (PCR-RFLP. Se analizó un total de 32 genotipos de P. vulgaris, los cuales incluyeron materiales silvestres de M

  1. Estudio de la composición en ácidos grasos del aceite de las semillas en algunas plantas silvestres españolas

    Directory of Open Access Journals (Sweden)

    Vioque, J.

    1994-06-01

    Full Text Available The fatty acid composition of 34 species of plants from a variety of families that grow wild in the Iberian Peninsula was analysed. The aim to the survey was to indentify oils that contain a mix of fatty acids that from a qualitative or quantitative point of view have a commercial value. Because of the diverse taxonomic origin of the samples, the oil content between species was very variable, fluctuating between an average value of 3.4% in the Caryophyllaceae and 31.1% in Euphorbiaceae. Like the oil content, the fatty acid composition was quite variable, but, in general, the main fatty acids were palmitic, oleic, linoleic and linolenic acid, while in the Brassicaceae and in the Apiaceae erucic acid and petroselinic acid were the principal fatty acids respectively.

    Se ha estudiado la composición en ácidos grasos del aceite de las semillas en 34 plantas silvestres de la Península Ibérica. Se pretende la obtención de aceites con una composición en ácidos grasos que cualitativa o cuantitativamente puedan resultar de interés desde un punto de vista comercial. Debido al origen taxonómico tan diverso de las muestras, el contenido en aceite resulta muy variable, oscilando entre un valor medio del 3.4% en las Caryophyllaceae y el 31.1% de media en las Euphorbiaceae. Como el contenido en aceite, la composición en ácidos grasos es también bastante Variable, pero en general los principales ácidos grasos son palmítico, oleico, linoleico y linolénico, mientras que en las Brassicaceae domina el ácido erúcico y en las Apiaceae el ácido petroselínico.

  2. Dispersión endozoócora de leguminosas silvestres: desde la recuperación hasta el establecimiento en campo

    Directory of Open Access Journals (Sweden)

    María Eugenia Ramos-Font

    2015-01-01

    Full Text Available Dispersión endozoócora de leguminosas silvestres: desde la recuperación hasta el establecimiento en campoLa dispersión de semillas mediante el tracto digestivo de los animales constituye un mecanismo esencial para la colonización de nuevos nichosecológicos, el mantenimiento de poblaciones vegetales, y para evitar la fragmentación de hábitats. Este trabajo evalúa la capacidad real de dispersiónendozóoora por ganado ovino de Adenocarpus decorticans (AD, A. telonensis (AT, Cytisus fontanesii (CF, C. striatus (CS, Genista florida (GF yG. versicolor (GV mediante el análisis de: recuperación de semillas en heces, germinación en cámara, emergencia en invernadero y establecimientoy supervivencia en campo durante dos años. Nuestros resultados sugieren que el ganado ovino es un agente de dispersión efectivo para la mayoríade las especies, excepto para CF. La recuperación de semillas osciló entre el 32% (AT y GV y el 3.4% (CS. Se observó que el paso por el tractodigestivo estimulaba o no afectaba a la germinación de las semillas en laboratorio. En invernadero, la mayoría de las especies incrementaban oigualaban su emergencia en las heces respecto a las semillas control. Sin embargo, el estiércol dificultó la germinación de la mitad de las especiesen condiciones naturales. A pesar de ello, la probabilidad de reclutamiento de las semillas dispersadas fue similar o superior a la de semillas intactas,excepto para CF. En conclusión, la oveja puede ser un dispersador eficaz de la mayoría de las especies estudiadas y esta capacidad podría utilizarseen planes de gestión y/o restauración forestal.

  3. Fenología de la floración en tomate cultivado y especies silvestres relacionadas Flowering phenology in cultivated tomato and related wild species

    Directory of Open Access Journals (Sweden)

    Edwin Fernando Restrepo Salazar

    2008-06-01

    Full Text Available En un diseño experimental de bloques completos al azar se comparó la fenología de la floración de doce accesiones silvestres de Solanum sección Lycopersicum con la del tomate cultivado tipo “chonto”. Los tratamientos se repitieron tres veces. Se evaluó la aparición de las 12 primeras inflorescencias y el tipo de inflorescencia. Las fenologías de las accesiones de la variedad glabratum de S. habrochaites (PI 134417, PI134418 y PI126449, las accesiones LA1624, LA2092 de la variedad typicum de S. habrochaites y la accesión LA 444-1 de S. peruvianum coincidieron con la del tomate “chonto”. No se presentaron diferencias significativas en la variable días a inicio de floración entre las accesiones de la variedad glabratum y el tomate cultivado. Las accesiones de la variedad glabratum de S. habrochaites y el tomate cultivado presentaron inflorescencias simples; mientras que las accesiones de la variedad typicum de S. habrochaites y de la especie S. peruvianum presentaron inflorescencias bifurcadas.The flowering phenology of twelve wild accesions of Solanum section Lycopersicum were compared with those of the cultivated tomato type of “chonto” by using the randomized complete block design. The treatments were repeated three times. The appearance initiate of the first twelve inflorescences and kind of inflorescence were evaluated. The phenologies of the accesions of the glabratum variety from S. habrochaites (PI 134417, PI134418 y PI126449, LA1624 y LA2092 of the typicum variety from S. habrochaites and LA 444-1 from S. peruvianum coincided with those of the “chonto” tomato. There were no significant differences between the glabratum variety accessions and cultivated tomato in the starting days of flowering variable. The accesions of the glabratum variety from S. habrochaites and the cultivated tomato presented simple inflorescences; while the accesions of the typicum variety from S. habrochaites and S. peruvianum specie showed

  4. Comportamento reológico de méis de florada de silvestre Rheological behavior of honey from Serjania glabrata flowers

    Directory of Open Access Journals (Sweden)

    Alexandre J. de M. Queiroz

    2007-04-01

    Full Text Available Estudou-se o comportamento reológico de méis de Apis mellifera produzidos no estado do Piauí, no semi-árido brasileiro, elaborados com florada predominante de silvestre (Serjania glabrata. As amostras foram coletadas ao longo do ano 2000, a partir de coletas realizadas por apicultores, associações e cooperativas de apicultura da região abrangida pelos municípios de Picos, Itainópolis, Vera Mendes e Isaías Coelho. Após as coletas as amostras passaram pelos processos de centrifugação, filtragem e decantação. As medidas reológicas foram feitas nas temperaturas de 20 a 40 ºC utilizando-se um viscosímetro Brookfield, modelo RVT. As leituras de velocidade de rotação e torque foram transformadas em valores de taxa de deformação e tensão de cisalhamento. Os dados de taxa de deformação e tensão de cisalhamento foram ajustados pelas equações da Lei-da-Potência e de Herschel-Bulkley. As amostras apresentaram comportamento pseudoplástico. As equações se ajustaram adequadamente aos resultados experimentais de tensão de cisalhamento em função da taxa de deformação. O aumento de temperatura reduziu a viscosidade aparente em níveis próximos de 80%. Os valores de viscosidade aparente foram bem ajustados por uma equação do tipo Arrhenius.The rheological behavior of Apis mellifera honey produced in the State of Piauí, in the Brazilian semi-arid, obtained with predominance of Serjania glabrata flowers was studied. The samples were collected in the year 2000 by beekeepers and associations and cooperatives of beekeepers in the area covered by the municipal districts of Picos, Itainópolis, Vera Mendes and Isaías Coelho. The samples were centrifuged, filtered, decanted and the rheological measures at temperatures of 20 to 40 ºC using a Brookfield Viscometer RVT model were made. The readings of rotation speed and torque were transformed in shear rate and shear stress values. The data of shear rate and shear stress were fitted

  5. Dynamic behavior of sylvatic yellow fever in Brazil (1954-2008 Comportamento dinâmico da febre amarela silvestre no Brasil (1954-2008

    Directory of Open Access Journals (Sweden)

    Fernando Portela Câmara

    2011-06-01

    Full Text Available INTRODUCTION: Sylvatic yellow fever (SYF is enzootic in Brazil, causing periodic outbreaks in humans living near forest borders or in rural areas. In this study, the cycling patterns of this arbovirosis were analyzed. METHODS: Spectral Fourier analysis was used to capture the periodicity patterns of SYF in time series. RESULTS: SYF outbreaks have not increased in frequency, only in the number of cases. There are two dominant cycles in SYF outbreaks, a seven year cycle for the central-western region and a 14 year cycle for the northern region. Most of the variance was concentrated in the central-western region and dominated the entire endemic region. CONCLUSIONS: The seven year cycle is predominant in the endemic region of the disease due the greater contribution of variance in the central-western region; however, it was possible identify a 14 cycle that governs SYF outbreaks in the northern region. No periodicities were identified for the remaining geographical regions.INTRODUÇÃO: A febre amarela silvestre (FAS é enzoótica no Brasil, causando surtos periódicos em humanos que vivem próximos às áreas florestais ou em áreas rurais. Neste estudo, foram analisados os padrões de periodicidade desta arbovirose. MÉTODOS: Utilizamos a análise espectral de Fourier para capturar os padrões de periodicidades da FAS em séries temporais. RESULTADOS: Os surtos de FAS aparentemente não aumentaram em frequência, mas em número de casos. Há dois ciclos dominantes na FAS, um de sete anos predominando na região centro-oeste, e um de 14 anos predominando na região norte. A maior parte da variância concentrou-se na região centro-oeste e dominava toda região endêmica. CONCLUSÕES: O ciclo de sete anos é predominante para a região endêmica da doença devido a maior contribuição da variância do centro-oeste. No entanto, foi possível identificar um ciclo de 14 que rege a FAS na região norte. Não foram detectadas periodicidades nas demais

  6. Intoxicaciones intencionadas y accidentales de fauna silvestre y doméstica en España: diferencias entre Comunidades Autónomas

    Directory of Open Access Journals (Sweden)

    IS Sánchez-Barbudo

    2012-01-01

    Full Text Available En este estudio se han analizado 1.157 casos sospechosos de intoxicación de fauna silvestre y doméstica en el medio natural (1.800 animales y 340 cebos procedentes de diversas Comunidades Autónomas (CCAA españolas durante el periodo 2004-2010. Se ha detectado un 41,2% de casos positivos (40,8% de animales y 52,6% de cebos. En los carnívoros domésticos la detección del tóxico llegó al 71,4%, lo que indica su utilidad como centinelas del uso de veneno en el medio natural. El 78,3% de los animales que fueron positivos a los análisis toxicológicos han sido considerados como intoxicaciones intencionadas. Las aves rapaces diurnas fueron el grupo más afectado por las intoxicaciones (43,6% del total de animales positivos, seguido de los mamíferos carnívoros (27,1%. Los tóxicos más frecuentemente detectados fueron insecticidas anticolinesterásicos (cebos/animales: 80,4%/65,8%, seguidos de rodenticidas anticoagulantes (5%/19,6%, estricnina (2,2%/6,5% y arsénico (4,5%/2,3%. De las diferencias observadas entre CCAA destaca la preponderancia en el uso de estricnina en Asturias, rodenticidas anticoagulantes en Castilla y León, insecticidas organofosforados en Aragón, insecticidas carbamatos en Castilla-La Mancha y Madrid, y la aparición de otros venenos, como á-cloralosa o barbitúricos, en Cataluña. En resumen, el 82,3% de las intoxicaciones intencionadas fueron debidas a anticolinesterásicos y el 85,5% de las accidentales a rodenticidas anticoagulantes. En futuras regulaciones de plaguicidas y biocidas se debería tener en cuenta el riesgo del uso ilegal en la preparación de cebos envenenados que comporta la comercialización de formulados con alta riqueza de ingredientes activos con baja DL .

  7. Ocorrência de linhagens humana e silvestre de Schistosoma mansoni, na pré-amazônia: I - estudo em moluscos Occurrence of wild and human strains of Schistosoma mansoni in lower Amazonia: I - study in moluscs

    Directory of Open Access Journals (Sweden)

    Othon de Carvalho Bastos

    1982-10-01

    Full Text Available Foram isoladas na região da Baixada Maranhense (Brasil, linhagens humana (H e silvestre(S de Schistosoma mansoni a partir de miracídios eclodidos de ovos encontrados em fezes de doentes humanos autóctones da Região e de fígados de roedores silvestres naturalmente infectados. Biomphalaria glabrata, descentes de caramujos coletados no campo, foram expostos, isoladamente, aos miracídios H e S, mantidos isolados em moluscário e observados durante 100 dias. Moluscos normais foram mantidos nas mesmas condições de ambiente em que foram submetidos os infectados e tomados como controle da experiência. Foram anotados os indices de infecção dos moluscos, as datas da eliminação de cercárias, quantidade de larvas eliminadas e mortalidade dos moluscos. Os dados sugeriram melhor adaptação do esquistossomo da linhagem H à B. glabrata. A linhagem S, por sua vez, foi três vezes mais virulenta do que a linhagem H. Estes dados foram comparados com os encontrados na literatura especializada e verificado diversidades nos comportamentos parasitológicos das linhagens em estudo, quando comparados com os encontrados nas linhagens H e S oriundas do Vale do Rio Paraíba do Sul, no Estado de São Paulo (Brasil.The wild (W and human (H strains of Schistosoma mansoni were isolated in the Lowland Region of the Maranhão State (Brazil. The snail progenies from Biomphalaria glabrata collected from that region were exposed to the W miracidia, obtained from livers of wild rodents, and H miracidia from eggs in human stools. A control gruop of normal snails was kept in the same conditions as the infected one. The date of the elimination of cercariae, the quantity of eliminated larvae, the infection index of the moluscs and the mortality rate of the snails were recorded. These data suggested better adaptation of the H strain to B. glabrata. The W strain presented three times more virulence to snails than the H strain. These results were compared with published

  8. VARIABILIDADE GENÉTICA PARA TEOR DE AÇÚCARES REDUTORES EM BATATAS SILVESTRES QUE OCORREM NO SUL DO BRASIL GENETIC VARIABILITY FOR REDUCING SUGAR CONTENT IN WILD POTATOES THAT OCURR IN SOUTHERN BRAZIL

    Directory of Open Access Journals (Sweden)

    Carla Simone de Almeida Chalá

    2001-02-01

    Full Text Available Açúcares redutores e matéria seca são características muito importantes em batata para processamento. Duas espécies de batata silvestre, Solanum commersonii, subespécies commersonii e malmeanum, e S. chacoense, subespécie muelleri, ocorrem no Sul do Brasil. Essas espécies são importantes para programas de melhoramento, pois apresentam variabilidade para diversas características importantes, tais como, tolerância à seca e geada, resistências a doenças e insetos e teor de matéria seca. Os objetivos deste trabalho foram verificar a variabilidade genética e estimar a herdabilidade para teor de açúcares redutores em clones de batata silvestre, que ocorrem no Sul do Brasil. Cinqüenta clones de batata silvestre, tomados ao acaso, da coleção mantida na EMBRAPA - Clima Temperado foram cultivados, sob telado, no outono e na primavera de 1996. No outono, 30 e, na primavera, 40 clones produziram tubérculos para análise de açúcares redutores. Os teores de açúcares redutores dos tubérculos foram determinados pelo método de Lane Enyon e identificados pelo método de Somogyi, modificado por NELSON (1944. Os resultados indicaram que as espécies estudadas apresentam variabilidade para teor de açúcares redutores, com alta herdabilidade, principalmente no outono.Reducing sugar and dry matter are very important traits in potatoes for processing. Two wild potato species, Solanum commersonii, subspecies commersonii and malmeanum, and S. chacoense, subspecie mu, occur in the South of Brazil. These species are important for breeding programs, since they have variability for several important traits, such as drought and frost resistance, disease and insect resistance, and dry matter content.. The objectives of this research were to verify the genetic variability for reducing sugar content in wild potato clones of species that occur in this region and to estimate its heritability. Fifty wild potato clones, aleatorily chosen, of Embrapa

  9. Procedencia y uso de madera de pino silvestre y pino laricio en edificios históricos de Castilla y Andalucía

    Directory of Open Access Journals (Sweden)

    Rodríguez Trobajo, Eduardo

    2008-12-01

    Full Text Available The productive cycle of Scots pine (Pinus sylvestris L. and black pine (Pinus nigra Arn. within the medieval Castilian and Andalusian carpentry is here analysed. New criteria to identify both timbers and its dendrochronological date are shown as previous facts to determine their geographical origin. Historical names of these species and other names, such as alerce, with a vague allocation are also studied. Main historical areas of resource and river ways of Tajo and Guadalquivir used to transport the wood (black pine to interior cities (Sevilla, Toledo, Madrid … are thus identified. On the other hand, wood’s diversification and its selective use is analysed regarding its resistance value. Availability also determines that a sort of wood becomes fossil-guide (especie-guía, which is proposed as chronological indicator for several periods and constructive contexts. Some timber remains dating to the first millennium are studied in detail. They belong to the Mosque of Cordoba and four early medieval churches sited in the Duero valley (La Nave, Baños, Quintanilla and Barriosuso. The empiric dating and analysis of this material offer a post quem chronology for the building of these churches and new facts about the distribution of theses wood’s species in the north-western Iberian peninsula.Se realiza un recorrido a través del ciclo constructivo de las maderas de pino silvestre (Pinus sylvestris L. y pino laricio (Pinus nigra Arn. en el ámbito de la carpintería medieval de Castilla y Andalucía. Nuevos criterios para diferenciar las dos especies de madera y su datación dendrocronológica, son aportados como datos previos para determinar el origen geográfico del material. Son objeto de discusión los nombres históricos de estas especies y otras voces, como alerce, que tienen una imprecisa asignación. Se identifican así las principales áreas históricas de aprovechamiento y las vías fluviales del Tajo y Guadalquivir utilizadas para el

  10. Flowering phenology in cultivated tomato and related wild species Fenología de la floración en tomate cultivado y especies silvestres relacionadas

    Directory of Open Access Journals (Sweden)

    Lobo Arias Mario

    2008-06-01

    Full Text Available The flowering phenology of twelve wild accesions of Solanum section Lycopersicum were compared with those of the cultivated tomato type of “chonto” by using the randomized complete block design. The treatments were repeated three times. The appearance initiate of the first twelve inflorescences and kind of inflorescence were evaluated. The phenologies of the accesions of the glabratum variety from S. habrochaites (PI 134417, PI134418 y PI126449, LA1624 y LA2092 of the typicum variety from S. habrochaites and LA 444–1 from S. peruvianum coincided with those of the “chonto” tomato. There were no significant differences between the glabratum variety accessions and cultivated tomato in the starting days of flowering variable. The accesions of the glabratum variety from S. habrochaites and the cultivated tomato presented simple inflorescences; while the accesions of the typicum variety from S. habrochaites and S. peruvianum specie showed compound inflorescences.Key words: Solanum lycopersicum; S. habrochaites; S. peruvianum; kind of inflorescence.En un diseño experimental de bloques completos al azar se comparó la fenología de la floración de doce accesiones silvestres de Solanum sección Lycopersicum con la del tomate cultivado tipo “chonto”. Los tratamientos se repitieron tres veces. Se evaluó la aparición de las 12 primeras inflorescencias y el tipo de inflorescencia. Las fenologías de las accesiones de la variedad glabratum de S. habrochaites (PI 134417, PI134418 y PI126449, las accesiones LA

  11. Observações sobre calazar em Jacobina, Bahia. VI - Investigações sobre reservatórios silvestres e comensais

    Directory of Open Access Journals (Sweden)

    I. A. Sherlock

    1988-03-01

    Full Text Available Durante os anos de 1982 a 1986, a investigação sobre mamíferos comensais e silvestres, da periferia da cidade de Jacobina, Bahia, mostrou, ao lado do escasso número de exemplares, uma reduzida variedade específica dessa fauna. Capturou-se apenas 11 espécies, entre as quais, predominou o Didelphis albiventris, que abrangeu 44% dos 213 espécimens capturados. Entre os 193 com exames já concluídos, 84 eram exemplares de D. albiventris e 2 estavam infectados pela Leishmania donovani senso lato, 1 por L. mexicana amazonensis, 1 por L. braziliensis, subespécie e 3 por Trypanosoma cruzi Também foram observadas formas suspeitas de serem amastigotas de leishmanics, nos esfregaços de órgãos de 3 exemplares de Dasyprocta aguti, 1 Cercomys cunicularius - e 1 Oryzomys eliurus. 0 restante dos exemplares, inclusive 14 de Lycalopex vetulus, estava negativo para flagelados. Apesar de reforçado por outros indicadores epidemiológicos, como a predominância específica, a freqüência domiciliar, a atratividade para a vetora Lutzomyia longipalpis, e a concomitância com casos humanos nos mesmos locais, o índice de 2,3% de infecção natural do Didelphis albiventris, não autoriza a conclusão definitiva de ser o marsupial o mais importante reservatório natural da leishmaniose visceral em Jacobina.From 1982 to 1986, investigations on the natural infection with leishmanias of the sylvatic and commensal mammals were carried out around the city of Jacobina, Bahia, one of the oldest endemic foci of visceral leishmaniasis in Brazil. The species of Marsupialia Didelphis albiventris predominated, with the rate of 44%, over the total of 213 specimens belonging to only 11 different species of mammals collected there. Among the 84 specimens of D. albiventris examined, 2(2.3% were infected with Leishmania donovani sensu lato; 1 with L. mexicana amazonensis, 1 with L. braziliensis sub species, and 3 with Trypanosoma cruzi. Also, amastigote suspected bodies were

  12. Las abejas silvestres de Colombia: Por qué y cómo conservarlas The Colombian wild bees: Why and how to preserve them

    Directory of Open Access Journals (Sweden)

    González Víctor Hugo

    2000-06-01

    Full Text Available Las abejas silvestres de Colombia, al igual que las del resto del mundo, están sufriendo los rigores de las actividades desarrolladas por el hombre y así se catalogan como organismos en peligro. El conocimiento actual de las abejas en nuestro país, como muchos otros insectos, todavía se encuentra en una fase muy incipiente; es fragmentado, local y carece de una síntesis. Tan sólo se conoce racionalmente 5% de las abejas del país, especialmente las especies corbiculadas de la familia Apidae. Muy poco trabajo taxonómico ha sido realizado por investigadores colombianos y prácticamente no existen trabajos por autores extranjeros enfocados en la fauna colombiana. La carencia de especialistas, las dificultades para el envío de material al exterior y la falta de recursos han dificultado la tarea. Sin embargo, la alta riqueza de especies que creemos se encuentra en el país representa una razón más para avanzaren el conocimiento y entendimiento de la biodiversidad de éste grupo. En esta revisión se analizan las principales causas que ponen en riesgo las poblaciones y especies de la apifauna nativa: deforestación, pastoreo, la abeja africanizada y la explotación irracional de las abejas, entre otras. Se proponen algunas acciones a ser emprendidas conjuntamente con centros académicos, agricultores, campesinos, indígenas y la sociedad en general que permitan proteger las especies, teniendo en cuenta que median-te la polinización, se tornan en eslabones esenciales dentro de los ecosistemas permitiendo la conservación de muchas especies vegetales y otras comunidades.The Colombian wild bees, as well as those in the rest of the whole world are undergoing the rigor of human activities and so are considered to be under threat of extinction. The current knowledge about Colombian bees, like other insects, is still in its beginnings, is fragmentated and a synthesis is desirable. Only 5% of the Colombian bees are well known, especially the

  13. Gramíneas (Poaceae da Área de Relevante Interesse Ecológico (ARIE "Santuário de Vida Silvestre do Riacho Fundo", Distrito Federal, Brasil

    Directory of Open Access Journals (Sweden)

    Rodrigues-da-Silva Robson

    2003-01-01

    Full Text Available Neste trabalho relata-se o levantamento florístico das espécies de Poaceae da Área de Relevante Interesse Ecológico (ARIE "Santuário de Vida Silvestre do Riacho Fundo", Distrito Federal, Brasil. Foram encontradas 107 espécies, distribuídas em 41 gêneros, sendo 82 nativas e 25 exóticas. São apresentadas chaves analíticas para gêneros e espécies, além de ilustrações para os táxons identificados. Coelorachis aurita (Steud. A. Camus é citada pela primeira vez para a flora do Distrito Federal.

  14. Characterization of rust, early and late leaf spot resistance in wild and cultivated peanut germplasm Caracterização da resistência à ferrugem, mancha preta e mancha castanha em germoplasma silvestre e cultivado de amendoim

    Directory of Open Access Journals (Sweden)

    Alessandra Pereira Fávero

    2009-02-01

    Full Text Available Groundnut (Arachis hypogaea has an AB genome and is one of the most important oil crops in the world. The main constraints of crop management in Brazil are fungal diseases. Several species of the genus Arachis are resistant to pests and diseases. The objective of our experiments was to identify wild species belonging to the taxonomic section Arachis with either A or B (or " non-A" genomes that are resistant to early leaf spot (Cercospora arachidicola, late leaf spot (Cercosporidium personatum and rust (Puccinia arachidis. For the identification of genotypes resistant to fungal diseases, bioassays with detached leaves were done in laboratory conditions, with artificial inoculation, a controlled temperature of 25ºC and a photoperiod of 10 h light/14 h dark, for 20-42 days, depending on the fungi species. Most of the accessions of wild species were more resistant than accessions of A. hypogaea for one, two or all three fungi species studied. Arachis monticola, considered to be a possible tetraploid ancestor or a derivative of A. hypogaea, was also more susceptible to Cercosporidium personatum and Puccinia arachidis, as compared to most of the wild species. Therefore, wild germplasm accessions of both genome types are available to be used for the introgression of resistance genes against three fungal diseases of peanut.O amendoim (Arachis hypogaea possui genoma AB e é uma das mais importantes culturas oleaginosas em todo o mundo. Os principais problemas da cultura no Brasil são as doenças fúngicas. Várias espécies do gênero Arachis são resistentes a pragas e doenças. Este trabalho visou a identificar espécies silvestres pertencentes à seção Arachis associadas aos genomas A ou B (ou " não-A" do amendoim que são resistentes à mancha castanha (Cercospora arachidicola, mancha preta (Cercosporidium personatum e ferrugem (Puccinia arachidis. Para a identificação de genótipos resistentes a doenças fúngicas, bioensaios utilizando

  15. Composição química e propriedades antioxidantes de duas espécies silvestres de camomila do Nordeste de Portugal: camomila-alemã e camomila-romana

    OpenAIRE

    Guimarães, Rafaela; Barros, Lillian; Carvalho, Ana Maria; Queiroz, Maria João R. P.; FERREIRA, ISABEL C.F.R.

    2012-01-01

    As plantas são uma fonte importante de compostos bioativos e um exemplo de diversidade molecular, com potencial documentado para a descoberta e desenvolvimento de nutracêuticos e fármacos [1]. A camomila-alemã (Matricaria recutita L.) e a camomila-romana (Chamaemelum nobile L.) são duas espécies silvestres existentes na região de Trás-os-Montes (Nordeste de Portugal) e que têm ações etnofarmacológicas descritas. As decocções e infusões da primeira são utilizadas para constipações, bronquite, ...

  16. Variacion estacional de una población silvestre de Rhodnius Pallescens Barber 1932 (Heteroptera: triatominae en la costa caribe colombiana

    Directory of Open Access Journals (Sweden)

    1998-01-01

    Full Text Available VARIATION SAISONNIERE D’UNE POPULATION SAUVAGE DE RHODNIUS PALLESCENS BARBER, 1932 (HETEROPTERA:TRIATOMINAE SUR LA COTE CARAÏBE COLOMBIENNE. Dans le cadre du programme franco-colombien “Écologie des triatomes sauvages (Triatominae du département de Sucre (Colombie et évaluation de l’efficacité d’une biopréparation insecticide à partir du champignon entomopathogène Beauveria bassiana (Hyphomycetes” (1994-1996, les auteurs ont étudié la dynamique de population de l’insecte hématophage Rhodnius pallescens dans une palmeraie de l’espèce Attalea butyracea (Arecaceae dans le municipio (cf. nota 1 de San Onofre (côte caraïbe colombienne. Au cours de la saison sèche et de la saison des pluies, un total de 71 palmiers ont été disséqués et 1 356 insectes capturés (163 adultes et 1 196 individus de tous les stades larvaires. 86% des palmiers étaient infestés (83% pendant la saison sèche et 91% pendant la saison des pluies la moyenne d’insectes retrouvés par palmier était de 19,5 (23,6 lors de la saison sèche et 17,6 pendant la saison des pluies. L’analyse des données permet de conclure que l'élément saison n’influe pas sur les variations des densités des insectes mais agit sur les compositions d’âge des populations de R. pallescens et que, même si l’évaluation du bioinsecticide peut se faire pendant toute l’année, il est recommandé de l’effectuer en novembre, au début de la saison des pluies. En el marco del programa colombo-francés “Ecología de triatominos silvestres (Triatominae del Departamento de Sucre (Colombia y evaluación de la eficacia de una biopreparación insecticida en base al hongo entomopatógeno Beauveria bassiana (Hyphomycetes” (1994-1996, los autores estudiaron la dinámica poblacional del insecto hematófago Rhodnius pallescens en un palmeral de la especie Attalea butyracea (Arecaceae en el municipio (1 de San Onofre (costa caribe colombiana. Se realizaron un total de 71 disecciones

  17. Morfologia e viabilidade de grãos de pólen de acessos silvestres de abacaxi Morphology and viability of pollen grains from wild varieties of pineapple

    Directory of Open Access Journals (Sweden)

    Taliane Leila Soares

    2011-10-01

    Full Text Available O objetivo do trabalho foi avaliar a viabilidade de grãos de pólen de acessos silvestres de abacaxi mediante a percentagem de germinação in vitro, crescimento do tubo polínico em duas temperaturas de incubação e uso de carmim acético. Além disso, o trabalho busca reconhecer os padrões da morfologia polínica de algumas variedades de abacaxi. Foram utilizadas amostras de pólen coletadas de seis acessos de abacaxi: Silvestre-25, I-26/803 (Ananas macrodontes, Igor (A. comosus var. erectifolius, Ananás Santo Amaro, FRF-22 e FRF-32 (A. comosus var. bracteatus. Os grãos de pólen foram inoculados em meio de cultura contendo 10% de sacarose, 0,01% H3BO3, 0,01% KNO3, 0,03% Ca(NO32.4H2O, solidificado com 1% de ágar e pH ajustado para 6,5. Foram testadas as temperaturas de incubação de 25°C e 30°C. A viabilidade do pólen foi avaliada pela coloração com carmim acético a 2%. Todas as variedades de A. comosus apresentaram grãos de pólen de tamanho médio, simetria radial, âmbito ovalado a esferoidal, 2-porados, subprolatos, exina eutectada, reticulada, heterobrocada, lumens variando de arredondados a poligonais, sem granulações, com exceção dos dois acessos de A. macrodontes que apresentaram tamanho grande. Melhores taxas de germinação foram obtidas para A. macrodontes em comparação com o erectifolius e bracteatus. A maioria dos acessos apresentou viabilidade com carmim acético acima de 76%.The aim of this research was to evaluate the pollen grains viability from accessions of wild pineapple using in vitro pollen germination and the growth of the polinic tube in two different temperatures and acetic carmine. In addition, the study aimed to recognize the pattern of pollen morphology of some pineapple varieties. Samples from six pineapple's accessions: Silvestre-25, I-26/803 (Ananas macrodontes, Igor (A. comosus var. erectifolius, Ananás Santo Amaro, FRF-22 and FRF-32 (A. comosus var. bracteatus were used. The pollen grains

  18. Storage protein profile and amino acid content in wild rice Oryza glumaepatula Perfil da proteína de reserva e conteúdo de aminoácidos no arroz silvestre Oryza glumaepatula

    Directory of Open Access Journals (Sweden)

    Karina Freire D'eça Nogueira Santos

    2013-01-01

    Full Text Available - The objective of this work was to determine the total protein profile and the contents of the four major protein fractions (albumin, globulin, prolamin and glutelin and of the amino acids in the endosperm of the rice wild species Oryza glumaepatula. The experiment was performed with 29 accessions of this species, collected from 13 Brazilian locations, and two commercial cultivars. Protein samples were prepared using dried, polished, and ground grains to obtain homogeneous, dry flour used in the preparation of extracts. Oryza glumaepatula accessions were identified with the highest levels of total protein, albumin and glutelin protein fractions, and amino acids (with the exception of tryptophan in comparison to the two analized rice cultivars. The albumin and glutelin profiles in SDS-Page were distinct between rice cultivars and O. glumaepatula. This wild species has the potential to increase the nutritional quality of rice storage protein through interspecific crosses.- O objetivo deste trabalho foi determinar os perfis de proteína total e o conteúdo das quatro principais frações proteicas (albumina, globulina, prolamina e glutelina e de aminoácidos no endosperma da espécie de arroz silvestre Oryza glumaepatula. O experimento foi realizado com 29 acessos dessa espécie, coletados em 13 locais no Brasil, e duas cultivares comerciais. Amostras de proteínas foram preparadas com grãos secos, polidos e moídos, para obtenção de uma farinha seca e homogênea, usada no preparo dos estratos. Acessos de O. glumaepatula foram identificados com os maiores níveis de proteína total, frações proteicas de albumina e glutelina, e aminoácidos (com exceção do triptofano, em comparação às duas cultivares de arroz avaliadas. Os perfis de albumina e glutelina em SDS-PAGE foram distintos entre as cultivares de arroz e O. glumaepatula. Essa espécie silvestre tem o potencial de aumentar a qualidade nutricional da proteína de reserva do arroz por

  19. Migraciones en el chaco semiárido de salta: su relación con la ganadería, la explotación forestal y el uso de la fauna silvestre en el departamento rivadavia

    Directory of Open Access Journals (Sweden)

    F. Barbar\\u00E1n

    2001-01-01

    Full Text Available Considerando que la Colonia Rivadavia se fundó en 1862, con el objetivo principal de aprovechar los pastizales del Chaco Semiárido para exportar ganado al Norte de Chile, analizamos desde una perspectiva histórica y demográfica, la relación existente entre las migraciones humanas y las principales actividades económicas del Departamento Rivadavia. Usando el método residual, se calcularon los saldos migratorios entre los censos nacionales de población y vivienda de 1914, 1947, 1960, 1970, 1980, 1991 y la población proyectada a 1998, resultando todos negativos. La expulsión constante de población, obedece al retroceso de la actividad ganadera por sobrepastoreo, lo que condujo a la degradación del ecosistema y la caída del ingreso, induciendo a los pobladores locales a presionar mas sobre el bosque y la fauna silvestre. La pobreza, consecuencia directa de un problema ambiental, obligó a emigrar de Rivadavia. Esta conclusión se sustenta en la evolución de distintos indicadores socio-económicos que se comparan para distintos períodos de los últimos treinta años: necesidades básicas insatisfechas, desnutrición infantil y el fracaso de distintos proyectos de desarrollo dirigidos principalmente a aborígenes en el período 1969 – 1992

  20. Contribución de Graells a la posición de España en el primer convenio internacional para la protección de ciertas especies de la fauna silvestre (1902

    Directory of Open Access Journals (Sweden)

    Ferrero-García, J. J.

    2012-12-01

    Full Text Available The process followed by Spain to decide whether it should subscribe the International Convention for the Protection of Birds Useful to Agriculture, signed in 1902 is described. The fundamental role played by Mariano de la Paz Graells, one of the foremost Spanish naturalists of the 19th century, in the technical review and acceptance of the draft agreement, drawn up in 1895, is highlighted. Furthermore, a critical analysis of Graells’s position in relation to this so-called first international convention for the conservation of certain wildlife species, has been carried out.

    Se describe el proceso que siguió España para decidir si debía suscribir el Convenio Internacional para la Protección de las Aves Útiles a la Agricultura, firmado en 1902. Se pone de manifiesto el papel fundamental que tuvo Mariano de la Paz Graells, uno de los más importantes naturalistas españoles del siglo XIX, en el examen técnico y aceptación del proyecto de dicho convenio, redactado en 1895. Además, se ha realizado un análisis crítico de la postura de Graells en relación con la que puede calificarse como la primera convención internacional para la conservación de ciertas especies de la fauna silvestre.

  1. DIAGNÓSTICO PARTICIPATIVO DE LAS CONDICIONES SOCIOCULTURALES ASOCIADAS A LA CONSERVACIÓN DE LOS CHILES SILVESTRES (Capsicum spp. EN LA DEPRESIÓN CENTRAL DE CHIAPAS, MÉXICO

    Directory of Open Access Journals (Sweden)

    R. A. A. Bran

    2007-01-01

    Full Text Available Los recursos fitogenéticos son la base de la seguridad alimentaria de la población mundial. México constituye uno de los centros de origen y diversidad de varias especies vegetales, entre ellas diversos tipos de Capsicum. Sin embargo, el mal manejo de ellos está afectando su conservación, fundamentalmente por la acción depredadora del hombre, el uso excesivo de agroquímicos y la deforestación; todo esto explica el esfuerzo de las instituciones científicas y gubernamentales por su cuidado y conservación. El trabajo se realizó en cinco municipios de la región Frailesca de la Depresión Central de Chiapas, México. Se inició con la aplicación de una encuesta a 386 pobladores de la región rural. La información fue evaluada mediante el análisis de frecuencia. Los resultados demostraron que la población rural tiene conocimientos sobre la utilización de los chiles silvestres y semisilvestres como alimento y condimento, no así en los aspectos relacionados con su conservación, la cual es realizada por los campesinos en pequeños huertos.

  2. Bases para la elaboración del plan de ordenamiento territorial de la reserva de fauna silvestre Hueque-Sauca, municipio Píritu, estado Falcón

    Directory of Open Access Journals (Sweden)

    Miguel Antonio Flores

    2010-01-01

    Full Text Available En el presente trabajo se propone una zonificación para el ordenamiento territorial de la reserva de fauna silvestre Hueque-Sauca, ubicada en el Municipio Píritu del Estado Falcón. La misma se basó en el estudio de las potencialidades y limitaciones del medio físico-natural las cuales fueron expresadas en un atlas cartográfico de 22 mapas temáticos realizado en ARCGIS a escala 1: 25.000. Mediante la superposición y análisis de los mapas temáticos, se identificaron los usos y actividades realizados actualmente por los habitantes del RFS Hueque- Sauca y se contrastaron con los determinados por la potencialidad del área y por lo establecido en la legislación ambiental; a fin de elaborar una propuesta de zonificación que sirva de base para la elaboración de los instrumentos normativos para la gestión, conservación y manejo de esta área protegida.

  3. Jungle yellow fever: clinical and laboratorial sudies emphasizing viremia on a human case Febre amarela silvestre: estudo clínico e laboratorial, enfatizando a viremia, de um caso humano

    Directory of Open Access Journals (Sweden)

    Elza da S. Nassar

    1995-08-01

    Full Text Available The authors report the clinical, laboratorial and epidemiological aspects of a human case of jungle yellow fever. The patient suffered from fever, chills, sweating, headaches, backaches, myalgia, epigastric pains, nausea, vomiting, diarrhea and prostration. He was unvaccinated and had been working in areas where cases of jungle yellow fever had been confirmed. Investigations concerning the yellow fever virus were performed. Blood samples were collected on several days in the course of the illness. Three of these samples (those obtained on days 5,7 and 10 were inoculated into suckling mice in attempt to isolate virus and to titrate the viremia level. Serological surveys were carried out by using the IgM Antibodies Capture Enzyme Linked Immunosorbent Assay (MAC-ELISA, Complement Fixation (CF, Hemagglulinalion Inhibition (HI and Neutralization (N tests. The yellow fever virus, recovered from the two first samples and the virus titration, showed high level of viremia. After that, specific antibodies appeared in all samples. The interval between the end of the viremia and the appearance of the antibodies was associated with the worsening of clinical symptoms, including bleeding of the mucous membrane. One must be aware of the risk of having a urban epidemics in areas where Aedes aegypti is found in high infestation indexes.Os autores estudaram um caso humano de febre amarela silvestre, sob os aspectos clínico, laboratorial e epidemiológico. O paciente apresentava febre (39ºC, calafrios, sudorese, cefaléia, dor lombar, mialgia, dor abdominal em epigástrio, náuseas, vômitos, diarréia e prostração. Relatava permanência em área onde foram constatados casos de febre amarela silvestre e não havia histórico de vacinação anterior. Frente às suspeitas que levaram à investigação do vírus da febre amarela, foram colhidas várias amostras de sangue no curso da doença. As amostras do 5º, 7º e 10º dias foram submetidas a provas de

  4. Caracterización de sitios de percha del guajolote silvestre (Meleagris gallopavo mexicana en Sierra Fría, Aguascalientes, México Roost sites characteristics of wild turkey (Meleagris gallopavo mexicana in Sierra Fria, Aguascalientes, Mexico

    Directory of Open Access Journals (Sweden)

    Marcelo Márquez-Olivas

    2007-06-01

    Full Text Available Entre octubre y noviembre del año 2001 y mayo de 2002 se localizaron 16 sitios de percha de guajolote silvestre (Meleagris gallopavo mexicana en la Sierra Fría de Aguascalientes. El 87.5% de los sitios se encontraron en bosques de pino-encino (en rodales de pinos, en altitudes de 2500 a 2650 m. En la parte alta (2/3 de la cuesta se localizaron 8 de los sitios y 7 sobre laderas de exposición noreste, en una pendiente promedio de 38.9 ± 12.6%. El 62.5% de los sitios se usaron durante todo el periodo de estudio y el resto, de manera ocasional. La mayoría de los dormideros se encontraron cerca de comederos o cebaderos y de parcelas agrícolas. Se contabilizaron de 1 a 23 árboles de percha utilizados por sitio, distribuidos a una distancia promedio de 24.4 ± 17.8 metros. El 81.2% de los árboles (n=170 fueron pinos (Pinus teocote, P. durangensis, P. leiophylla y P. michoacana, 17.6% encinos (Quercus laurina, Q. grisea y Q. eduardii y 1.2% madroños (Arbutus arizonica. La altura promedio de los árboles fue de 16.6 ± 4.4 m y el diámetro 43.2 ± 11.5 cm. La preferencia del guajolote silvestre por utilizar pinos como dormideros en lugar de otras especies arbóreas, se debe posiblemente a que son árboles de mayor porte o a la conformación de su dosel; sin embargo, se ha observado que en lugares donde hay pocos pinos, los guajolotes utilizan para dormir otros árboles de características semejantes, como encinos, madroños o sicomoros.Sixteen roosting sites of Gould's wild turkey (Meleagris gallopavo mexicana were found between October and November of 2001 and May of 2002 in Sierra Fría, Aguascalientes. A large percentage (87.5% of the roost sites was located in oak-pine forest (in pine stands, at an elevation range of 2500 to 2650 meters. Eight roost sites were on the upper portion (2/3 of the ridge, and 7 at northeast exposures with an average slope of 38.9 ± 12.6%. Most (81.2% of the roost trees (n =170 were pines (Pinus teocote, P

  5. Aspectos do ciclo silvestre do Trypanosoma cruzi em regiões de cerrado (Município de Formosa, Estado de Goiás Aspects of the sylvatic cycle of Trypanosoma cruzi in the region of cerrado (Formosa municipality, State of Goias

    Directory of Open Access Journals (Sweden)

    D. A. Mello

    1981-09-01

    Full Text Available Neste trabalho estão apresentados resultados de estudos sobre roedores, marsupiais e triatomíneos do norte do municipio de Formosa,Estado de Goiás, e sua importância no ciclo silvestre do T.cruzi. A região estudada esta localizada do ponto de vista geográfico, na "Provincia do Cerrado". Foram coletados 963 roedores, 11 marsupiais e 766 triatomíneos silvestres. O índice de infecção pelo T. cruzi entre os roedores foi de 0,1% e entre os marsupiais 36,3%, enquanto todos os triatomíneos estavam negativos. Face aos aspectos ecológicos estudados, discute-se o papel desempenhado por roedores e marsupiais na manutenção e circulação do T. cruzi em ambiente silvestre. Alguns aspectos epidemiológicos no ambiente doméstico foram também abordados.Studies were carried out on the role of rodents, marsupials and triatoma bugs in the wild cycle of Trypanosoma cruzi. The area studied, located in the county of formosa, State of Goiás, Brasil, belongs to the "Província do Cerrado". The following animals were collected and examined: 963 rodents, 11 marsupials and 766 wild triatomid bugs. The infection rates for T. cruzi were as follow: 36.3% for the marsupials, 0.1% for the rodents, while all the triatomids were negative. The role of the collected mammals in the maintenance and circulation of T. cruzi in the wild environment is discussed. In addition, some epidemiological aspects of the domestic environment were also studied.

  6. Evaluación y valorización económica de la fauna silvestre en el río Algodón, Amazonía peruana

    Directory of Open Access Journals (Sweden)

    Rolando Aquino

    2013-04-01

    Full Text Available El presente trabajo informa sobre los hábitats, abundancia cuantitativa y valorización económica de la fauna silvestre que habitan en la cuenca del río Algodón. El estudio está basado en la diferenciación de hábitats, entrevistas a cazadores y censos por transecto. En 7 de los 10 tipos de hábitats diferenciados fueron realizados censos, donde ocurrieron en total 327 avistamientos directos de mamíferos, aves y reptiles. Entre los mamíferos, el pecarí labiado (Tayassu pecari Link y el choro (Lagothrix lagotricha Humboldt fueron los más abundantes con 9,8 individuos/km2, equivalente a 323,4 kg/km2 de biomasa, y 18,4 individuos/km2 equivalente a 202,4 kg/km2 de biomasa, respectivamente. En aves, la mayor densidad correspondió a la pucacunga (Penelope jacquacu Spix con 5,4 individuos/km2, equivalente a 6,9 kg/km2 de biomasa. Sin considerar las especies nocturnas y algunas diurnas, en el área de estudio se estiman alrededor de 31891 animales de caza entre mamíferos y aves, cuyo valor económico fue estimado en US$ 349374. De ellos, 3479 individuos tienen el valor de comercial y pertenecen a cuatro especies de ungulados y uno de aves, el resto tienen el valor de subsistencia.

  7. Evaluación de poblaciones segregantes producidas a partir de cruzamientos entre tomate cultivado y la accesión silvestre PI134418 de Solanum habrochaites var. glabratum resistente al pasador del fruto.

    Directory of Open Access Journals (Sweden)

    Edwin F. Restrepo S.

    2008-01-01

    Full Text Available Se realizó la evaluación de poblaciones segregantes producidas a partir de cruzamientos entre tomate S. lycopersicum L. cv. maravilla y la accesión silvestre PI134418 de S. habrochaites var. glabratum resistente al pasador del fruto N. elegantalis. Se encontró que hay dominancia de los alelos que disminuyen la expresión del caraacute;cter peso promedio de fruto. El método del retrocruzamiento resultó maacute;s eficiente que el de la autofecundación, para contrarrestar la dominancia de los alelos que codifican por el tamaño pequeño del fruto. Los tricomas y el número promedio de frutos por racimo no ejercieron ningún efecto sobre el ataque de los frutos por parte del pasador; mientras que el peso promedio de fruto sí tuvo efecto importante sobre dicho ataque, de tal manera que el insecto tiende a producir mayor daño a medida que se incrementa el peso promedio de fruto. Las poblaciones RC1 y RC2 se comportaron como las típicas segregantes para los caracteres evaluados y exhibieron amplia variabilidad en los mismos. El método del retrocruzamiento fue efectivo para romper la asociación negativa entre el peso promedio de fruto y la resistencia al insecto. El peso promedio de algunos de los frutos en los recombinantes RC2 fluctuó entre 45.1 y 68.6 g y mostraron resistencia al pasador.

  8. Conducta alimenticia, supervivencia y crecimiento de juveniles silvestres de Graus nigra Philippi, 1887 en cautiverio (Perciformes: Kyphosidae Feeding behavior, survival, and growth of wild Graus nigra Philippi, 1887 juveniles in captivity (Perciformes: Kyphosidae

    Directory of Open Access Journals (Sweden)

    Héctor Flores

    2011-11-01

    Full Text Available Se colectaron juveniles silvestres de Graus nigra, que fueron aclimatados durante 30 días en estanques con flujo de agua abierto y a temperatura ambiente, siendo alimentados con alimento formulado. Los peces fueron separados en seis grupos que se mantuvieron en experimentación por 196 días. La supervivencia promedio fue de 80%. El crecimiento en longitud total mostró un incremento promedio del 93,3% para los juveniles grandes (grupos 4, 5 y 6 y 125% para los pequeños (grupos 1, 2 y 3. El crecimiento en peso total mostró un incremento promedio de 434% para los peces grandes (grupos 4, 5 y 6 y de 707% para los pequeños (grupos 1, 2 y 3. Se concluyó que G. nigra toleró el cautiverio y el manejo, con una supervivencia relativamente alta, lo que hace de ella una especie atractiva para la acuicultura chilena.Wild juveniles of Graus nigra were collected and acclimated for 30 days in ponds with open-water flow and ambient temperature; the specimens were given a formulated feed. Fish individuals were separated into six groups that were studied for 196 days. The average survival was 80%. The total length increased an average of 93.3% for large individuals (groups 4, 5, 6 and 125% for small ones (groups 1, 2, 3. The total weight showed an average increase of 434% for large fishes (groups 4, 5, 6 and 707% for small ones (groups 1, 2, 3. Graus nigra was found to tolerate captivity and handling, with a relatively high survival rate, making it an attractive species for aquaculture in Chile.

  9. EVALUACIÓN In Situ DE LA VARIABILIDAD GENÉTICA DE LOS CHILES SILVESTRES (Capsicum spp. EN LA REGIÓN FRAILESCA DEL ESTADO DE CHIAPAS, MÉXICO

    Directory of Open Access Journals (Sweden)

    R. A. Alonso

    2008-01-01

    Full Text Available Se realizó un estudio con el objetivo de hacer la evaluación in situ de la variabilidad genética de los chiles silvestres en la región Frailesca del estado de Chiapas. La muestra experimental se constituyó con el 10 % de las comunidades y productores de cada municipio. La unidad de muestreo fue el sitio donde se encontraron las plantas. La evaluación in situ se basó en las características cuantitativas y cualitativas contenidas en el descriptor de Capsicum. La variabilidad se midió utilizando los índices de diversidad de Margalef, Simpson y Sorensen. Los caracteres cuantitativos con mayor valor discriminante fueron: número de flores por axila, longitud del filamento, diámetro, longitud y peso de los frutos, longitud de la placenta, número y peso de 1000 semillas. Como resultado del análisis discriminante, se formaron tres grupos: el grupo 1, donde predominan los Capsicum annuum, con seis accesiones que poseen características de C. frutescens; el grupo 2, integrado por las accesiones de Capsicum frutescens, y el grupo 3, con los C. annuum cultivados. Se evidenció la existencia de altos niveles de variabilidad en las muestras de chile evaluadas, las cuales integraron tres grupos con características que identifican las especies: Capsicum frutescens L., Capsicum annuum L. y 12 accesiones cultivadas de Capsicum annuum. La mayor variabilidad se encontró en los municipios La Concordia y Villaflores, existiendo condiciones para la conservación de la variabilidad in situ.

  10. Presença do vírus da síndrome da mancha branca em crustáceos decápodes silvestres em lagoas costeiras no Sul do Brasil

    Directory of Open Access Journals (Sweden)

    S.W. Costa

    2012-02-01

    Full Text Available A presença do vírus da síndrome da mancha branca (em inglês WSSV nas principais espécies de camarões, siris e caranguejos de cinco lagoas que recebem o efluente de fazendas afetadas pela enfermidade foi detectada por nested PCR, e inclusões virais nos camarões por histologia. Pela nested PCR encontrou-se a presença de WSSV em 13 de 16 (81,2% amostras de camarões da espécie Farfantepenaeus paulensis, em 13 de 14 (92,8% de Litopenaeus schmitti, em uma de duas de Farfantepenaeus brasiliensis (50%, em 13 de 15 (86,6% de siri da espécie Callinectes danae e em 11 de 12 (91,6% de Callinectes sapidus, e não foi detectada no caranguejo Chasmagnathus granulata em 10 amostras. Inclusões características de WSSV foram observadas em três amostras histológicas de 50 (6,0% no epitélio gástrico e cuticular e nas brânquias de dois exemplares de F. paulensis e um de L. schmitti. É o primeiro relato da presença de WSSV em camarões L. schmitti e no siri C. danae silvestres. As principais espécies de camarões e siris dos ambientes de entorno das fazendas foram contaminadas pelo WSSV, constituindo-se em vetores potenciais do vírus.

  11. Preferencias en la anidación de tortugas carey (Eretmochelys imbricata y baulas (Dermochelys coriacea en el Refugio Nacional de Vida Silvestre Gandoca Manzanillo, Limón, Costa Rica

    Directory of Open Access Journals (Sweden)

    Lilliana Piedra-Castro

    2015-09-01

    Full Text Available El Caribe costarricense es importante como sitio de alimentación, copulación, anidación y desove de las tortugas marinas, por lo que el presente trabajo pretendió actualizar el patrón de anidación en las tortugas marinas Dermochelys coriacea y Eretmochelys imbricata en el sector Gandoca, del Refugio Nacional de Vida Silvestre Gandoca Manzanillo, Limón, Costa Rica, para proponer medidas de manejo. Se realizaron recorridos nocturnos entre las 8:00 p. m. y 4:00 a. m., la playa se dividió en cinco sectores, en estos se realizaron observaciones directas y de rastros, de las tortugas que elaboraron el nido, entre febrero y agosto del 2011 y 2012. Se registraron tres especies de tortugas marinas, Dermochelys coriacea, Eretmochelys imbricata y Chelonia mydas. La anidación de tortugas baula tuvo su punto máximo entre marzo y julio; por su parte, las carey, entre mayo y junio (2011, y junio hasta agosto en el 2012. Se observó preferencia en la posición de la playa utilizada para construir sus nidos; la baula utiliza principalmente la parte media, mientras que la carey utilizó mayormente la parte baja para anidar (t = 17.2525. Se observó que la baula utilizó frecuentemente el sector C; sin embargo, no se encontraron diferencias en el uso de los sectores. Se concluye que ambas especies tienen preferencias en la selección de la zona de playa en que anidan; la carey en la parte baja cerca de la línea de costa y la baula en la parte media. Además, las tortugas baula utilizan indistintamente los diferentes sectores de la playa estudiada.

  12. Distribución de "coxiella burnetii" en los rumiantes domésticos y en la fauna silvestre de la Comunidad Atutónoma Vasca. Evaluacióndel efecto del tratamiento antibiótico y de la vacunación en el control de la fiebre Q en rebaños ovinos naturalmente infectados

    OpenAIRE

    Astobiza Pérez, Janire

    2014-01-01

    243 p. : il. [ES]La fiebre Q es una zoonosis de distribución mundial causada por Coxiella burnetii, una bacteria intracelular capaz de infectar tanto a animales domésticos como silvestres, y que da lugar a abortos y problemas reproductivos. Las principales fuentes de infección a los humanos son el ganado ovino, caprino y bovino, que cuando están infectados eliminan esta bacteria a través de sus productos del parto, de sus fluidos vaginales, leche y heces, generando aeroso...

  13. Pesquisa de anticorpos contra Leptospira spp. em animais silvestres e em estado feral da região de Nhecolândia, Mato Grosso do Sul, Brasil: utilização da técnica de imuno-histoquímica para detecção do agente

    OpenAIRE

    Girio,Raul José Silva; Pereira,Fernando Lúcio Garcia; Marchiori Filho,Moacir; Mathias,Luís Antônio; Herreira,Rita de Cássia Pereira; Alessi, Antônio Carlos; Girio,Thaís Marino Silva

    2004-01-01

    Foram examinadas 315 amostras de soros sangüíneos de diversas espécies de animais que vivem em estado feral ou silvestre na região de Nhecolândia, Corumbá, MS, por meio da prova de soroaglutinação microscópica para leptospirose. Dessas amostras, 67 foram de bois baguás (Bos taurus indicus), 39 de porcos-monteiros (Sus scrofa), 39 de búfalos (Bubalus bubalis), nove de quatis (Nasua nasua), 41 de veados-campeiros (Ozotoceros bezoarticus), 10 de veados-mateiros (Mazama americana) e 110 amostras ...

  14. Contenido de alimento y metabolismo ceco-cólico en el tracto digestivo de poblaciones silvestres de iguana negra (Ctenosaura pectinata) en Morelos, México Cecum-colic content of food and metabolism in the digestive tract of wild population black lizard (Ctenosaura pectinata) in Morelos, Mexico

    OpenAIRE

    L Vélez-Hernández; MA Cobos-Peralta; JL Arcos-García

    2012-01-01

    Se colectaron cinco tractos digestivos de iguana negra (Ctenosaura pectinata) en estado silvestre en el estado de Morelos, México, para conocer la composición botánica de la dieta y el metabolismo ceco-cólico. Se observaron frotis realizados del contenido ceco-cólico para registrar la presencia de protozoarios, bacterias y parásitos intestinales existentes. Se obtuvo la media y desviación estándar de las características evaluadas. En el contenido ceco-cólico se identificaron las especies vege...

  15. Análise cromatográfica de ácidos orgânicos em cogumelos silvestres comestíveis do Nordeste de Portugal: validação de uma técnica de UFLC-PDA

    OpenAIRE

    Barros, Lillian; Pereira, Carla; FERREIRA, ISABEL C.F.R.

    2012-01-01

    Na Península Ibérica as verduras (silvestres ou tradicionalmente cultivadas) têm sido alimentos importantes na dieta humana. O valor nutricional de verduras e os seus benefícios para a saúde têm sido reconhecidos como importantes alvos de investigação. Os grelos, inflorescências da couve-nabo (Brassica napus L. var. napus) e os espigos, inflorescências da couve-tronchuda (Brassica oleracea L. var. costata DC.) são exemplos de espécies tradicionalmente cultivadas e amplamente consumidas nas re...

  16. Estudio de las interacciones entre venados de las pampas (Ozotoceros bezoarticus) y ungulados introducidos (ganado vacuno y chanchos cimarrones) en el Refugio de Vida Silvestre Bahía Samborombón, Argentina: implicancias para su conservación

    OpenAIRE

    Perez Carusi, Lorena Cynthia

    2015-01-01

    El venado de las pampas (Ozotoceros bezoarticus) es un cérvido nativo de Sudamérica que se encuentra seriamente amenazado en Argentina. En particular, en la provincia de Buenos Aires el último núcleo poblacional de la especie se encuentra en el Refugio de Vida Silvestre Bahía Samborombón (RVSBS). Dicha población se halla en retroceso desde hace al menos 30 años y, al respecto, se ha propuesto entre las principales causas de su declinación a las interacciones negativas entre el venado y especi...

  17. Capítulo V: evaluación de especies silvestres de Lycopersicon sp. como fuente de resistencia al insecto plaga Scrobipalpula absoluta (Meyrick y su intento de transferencia a Lycopersicon esculentum Mill

    Directory of Open Access Journals (Sweden)

    Vallejo Cabrera Franco Alirio

    1994-12-01

    Full Text Available

    En condiciones de campo, se evaluaron 32 introducciones silvestres de Lycopersicon sp. y una de la especie cultivada, L. esculentum Mill, con el fin de determinar la resistencia a Scrobipalpula absoluta (Meyrick. Se utilizó el diseño experimental bloques completos al azar con 4 repeticiones. Como bordes se colocaron tres variedades comerciales susceptibles al insecto (Chonto "Mata Verde", Napoli Y Chonto "Santa Cruz Kada" con el fin de tener una fuente de infestación natural y permanente del cogollero dentro del experimento. Se evaluaron los caracteres número de cogollos afectados, número de hojas dañadas, número de ampollas e intensidad de daño. Todas las introducciones de L. hirsutum y L. peruvianum fueron altamente resistentes. Las introducciones 1406 y 1407 de L. pimpinellifolium también fueron altamente resistentes. La introducción 1759 de L. esculentum y L. esculentum var. ceraciforme fueron muy susceptibles. Las introducciones de L. pimpinellifolium y L. hirsutum no tuvieron dificultad para hibridarse con L. esculentum var. Tropic. El cruzamiento L. esculentum x L. peruvianum no presentó semilla híbrida y se requirió efectuar cultivo de embriones inmaduros, in vitro, utilizando el medio Murashige & Skoog pero sin lograrse resultados positivos.

    Thirty two (32 wild accessions of Lycopersicon sp. and one (1 cultivated accession of Lycopersicon esculentum Mill were evaluated to determinate the resistance to Scrobipalpula absoluta (Meyrick. The experiment was conducted with a complete random design and four repetitions. Three (3 susceptibles cultivated accessions of L. esculentum (Chonto "Mata Verde", Napoli and Chonto "Santa Cruz Kada" were sowed to have natural infestation of S. absoluta. Damage intensity, number of buds damaged, number of leaves demaged and number of "blister" in the leaves were evaluated, All evaluated accessions of L. peruvianum showed heigh resistence. 1406 and 1407 accessions of L. pimpinellifolium

  18. Animales silvestres como reservorios de leptospirosis en Chile: Una revisión de los estudios efectuados en el país Wild animals as reservoirs of leptospirosis in Chile.: Revision of studies in the country

    Directory of Open Access Journals (Sweden)

    J. ZAMORA

    1999-01-01

    Full Text Available Se entrega información sobre ratas y ratones capturados en laprovincia de Valdivia que actúan como reservorios de serovares deLeptospirainterrogans y Leptospira borgpeterseni, así como tambiénse dan a conocer resultados de otras especies animales capturados en lazona central del país. Se analizan los porcentajes de positividaddetectados por especie animal y el consecuente riesgo que significan estosreservorios animales para los animales domésticos y para el hombre. Se completa la información sobre los huéspedes de mantenimientode esta espiroquetosis en animales de vida libre, de acuerdo a una revisiónde la literatura especializada del exterior sobre el tema. Todo ello, enun intento de entregar documentación que alerte sobre los eventualesportadores existentes en nuestro medio y, por ende, ser una posible fuentede infección de enfermedades transmisibles a la especie humana ya diferentes especies de animales domésticos, Por último, se concluye que es del todo conveniente y necesarioque las autoridades correspondientes se preocupen de incentivar y fomentarestudios no sólo sobre leptospirosis, sino que también deotras enfermedades infecciosas y del estado sanitario en general de lafauna silvestre del país, financiando y licitando proyectos de investigación.La información que se logre de los trabajos que se realicen seráde considerable valor en la conservación del equilibrio ecológico,en medicina veterinaria preventiva y en salud públicaInformation is given regarding rats and mice captured in the provinceof Valdivia as reservoirs of serovars of Leptospira interrogansand Leptospira borgpeterseni; results obtained from other wild animalscaptured in the central area of the country are also included. The percentagesof positiveness detected by animal species as well as the consequent riskof these reservoirs for domestic animals and humans are analysed. Additional information on the subject in relation to reservoirs of leptospirasin

  19. Characterization and cultivation of a wild mushroom species isolated in Brazil Caracterização e cultivo de uma espécie de cogumelo silvestre isolado no Brasil

    Directory of Open Access Journals (Sweden)

    Luzia Doretto Paccola-Meirelles

    2002-11-01

    Full Text Available Wild mushrooms were collected close to cattle manure in pasture areas in Tamarana (Paraná/Brazil, with the objective of finding and domesticating new non-exploited basidiomycetes. An edible basidiomycete of the Agaricales order was classified as belonging to the Macrolepiota bonaerensis species (=Lepiota procera, form bonaerensis (Speg. Rick or M. procera (Scop.:Fr Sing.. The mycelia was isolated and characterized for growth rate in different culture media. A vigorous growth was observed in PDA Medium (pH 5, ±25°C. The oat culture medium was the most appropriate for cultivation submersed. M. bonaerensis mycelia secretes lipase, cellulase and protease exoenzyme types. Cytological analyses confirmed the bi-nucleated condition of the mycelia, the presence of septa and clamp connections in the hypha. The fructification occurred in the substrate composed of sterilized humus + soil (1:9 plus casing layer with active carbon. Visando a busca e a domesticação de basidiomicetos ainda inexplorados, coletou-se cogumelos silvestres em regiões de pastagens e próximos a esterco de gado no município de Tamarana, PR. Um basidiomiceto comestível da ordem Agaricales foi classificado como pertencente à espécie Macrolepiota bonaerensis (=Lepiota procera, forma bonaerensis (Speg. Rick ou M. procera (Scop.:Fr. Sing.. O micélio foi isolado e caracterizado em relação à taxa de crescimento em diferentes meios de cultura. Observou-se um crescimento vigoroso em meio BDA (pH 5, ±25°C. O meio de aveia foi o mais adequado para cultivo submerso. O micélio de M. bonaerensis secreta enzimas dos tipos lipase, celulase e protease, e as análises citológicas confirmaram a condição binucleada do micélio, a presença de septos e de grampos de conexão nas hifas. A frutificação dos cogumelos ocorreu no substrato constituído de húmus + terra (1:9 esterilizados, acrescido de terra de cobertura e carvão ativado.

  20. Microbiologia de swabs retais e otológicos em carnívoros silvestres do zoológico do Parque Estadual de Dois Irmãos, Pernambuco

    Directory of Open Access Journals (Sweden)

    Débora Costa Viegas de Lima

    2012-02-01

    Full Text Available O estudo epidemiológico de patógenos em populações selvagens no ambiente in situ e ex situ é fundamental para implementação de programas de prevenção, controle e monitoramento de enfermidades e para elaboração de políticas públicas de saúde pública e animal. O estudo foi realizado no zoológico do Parque Estadual de Dois Irmãos no período de janeiro a julho de 2011 onde foram coletados swabs anais e otológicos referentes a 29 carnívoros silvestres cativos do zoológico. Dos swabs otológicos analisados, 1/29 (3,4% foi positivo para Malassezia pachy dermatis no exame direto. No exame microbiológico dos swabs otológicos, observou-se maior freqüência para bactérias do gênero Bacillus 16/29 (55,2%, seguida de Sta phylococcus 15/29 (51,7%, Escherichia coli 7/29 (24,1%, Streptobacillus 1/29 (3,4%, Micrococcus 1/29 (3,4% e Klebsiella 1/29 (3,4%. Com relação ao exame presuntivo para o gênero Salmonella a partir das amostras de swab retal, observou-se positividade para seis raposas (Cerdocyon thous e um guaxinim (Procyon cancrivorus. O isolamento de Salmonella spp. em C. thous e em P. cancrivorus indica um risco à saúde pública, principalmente para os profissionais do zoológico que trabalham diretamente com esses animais. Essa pesquisa reforça a importância da criação de estratégias de vigilância epidemiológica voltadas para a prevenção, controle e monitoramento de potenciais reservatórios de agentes etiológicos de doenças infecciosas e parasitárias no ambiente dos zoológicos.

  1. Early Book Stages, 0-5 Years [and] Creciendo con Libros (Growing [up] with Books). [Videotape.

    Science.gov (United States)

    Holguin, Roxanna

    Using a lighthearted and simple approach, this 23-minute videotape in English and Spanish versions presents interactions between parents and children while reading books. The children in the videotape range in age from 0 to 5 years. The video is introduced by scenes of children enjoying books while narration discussing the impact of reading to…

  2. Early Book Stages, 0-5 Years [and] Creciendo con Libros (Growing [up] with Books). [Videotape.

    Science.gov (United States)

    Holguin, Roxanna

    Using a lighthearted and simple approach, this 23-minute videotape in English and Spanish versions presents interactions between parents and children while reading books. The children in the videotape range in age from 0 to 5 years. The video is introduced by scenes of children enjoying books while narration discussing the impact of reading to…

  3. Creciendo emocionalmente. Desarrollo de las competencias socioemocionales en el 1r Ciclo de Primaria

    OpenAIRE

    Olmedo-Fernández, Eva

    2013-01-01

    Este trabajo propone una propuesta de intervención para mejorar las competencias socioemocionales de los alumnos de Primer Ciclo de Educación Primaria. Su objetivo es aportar una visión general de los beneficios de la educación emocional en el desarrollo de la personalidad del alumnado. Se inicia con un breve repaso de aspectos teóricos clave en esta materia, definiendo conceptos tales como emoción, inteligencia emocional, educación emocional y habilidades sociales. A continuación, se inci...

  4. Diazotrophic bacteria isolated from wild rice Oryza glumaepatula (Poaceae in the Brazilian Amazon Bacterias diazotróficas aisladas de arroz silvestre Oryza glumaepatula (Poaceae en la Amazonia brasileña

    Directory of Open Access Journals (Sweden)

    Paulo Ivan Fernandes Júnior

    2013-06-01

    . The growth- promoting ability was confirmed for at least five isolates. For these bacteria, the root and shoot growing results showed higher increases when compared to those observed in plants inoculated with the evaluated reference strains. These results indicate that O. glumaepatula is colonized by a high diverse diazotrophic community in the Brazilian Amazon. Further investigations are now being carried out to determine the taxonomic positions of these isolates and their growth promoting mechanisms.La asociación de gramíneas silvestres con bacterias diazotróficas en los biomas brasileños es poco conocida. El aislamiento y caracterización de las bacterias asociadas con gramíneas silvestres puede contribuir a entender la ecología de las diazotróficas y bacterias con aplicaciones biotecnológicas. En este estudio, caracterizamos aislamientos bacterianos de diazotróficas de Oryza glumaepatula recolectadas en Cerrado y zonas boscosas de la Amazonía en el estado de Roraima, Brasil. Plantas sanas de O. glumepatula fueron recolectadas en cinco zonas boscosas y siete en Cerrado. Las plantas de Cerrado fueron recolectadas en septiembre 2008, mientras que las del bosque en Junio 2008 y Abril 2009. Las plantas y el suelo adherido a las raíces se transfirieron a macetas y se cultivaron durante 35 días en condiciones de invernadero. Durante la cosecha, los brotes y las raíces se trituraron por separado en una solución salina, la suspensión se diluyó en serie y se inocularon en placas Petri que contenían medio Dyg. Todas las colonias de bacterias se purificaron en el mismo medio. Se evaluó la capacidad diazotrófica de cada bacteria en condiciones microaerofílicas en medio semisólido BMGM. Además, los aislamientos bacterianos que formaron películas se evaluaron también mediante amplificación por PCR para el gen nifH. La diversidad de bacterias nifH+ se analizó por Huella Genética utilizando la Reacción en Cadena de la Polimerasa. Para las cepas

  5. Identificación, establecimiento in vitro y análisis fitoquímico preliminar de especies silvestres de ñame (Dioscorea spp. empleadas con fines medicinales

    Directory of Open Access Journals (Sweden)

    Víctor Andrés Ramos Duarte

    2015-05-01

    Full Text Available Título en ingles: Identification, in vitro establishment and preliminary phytochemical analysis of wild yam (Dioscorea spp. used for medicinal purposesTítulo corto: Identificación, establecimiento in vitro y análisis fitoquímico preliminar de especies silvestres de ñameResumen:  Tubérculos del género Dioscorea comercializados con fines medicinales, fueron recolectados con el propósito de lograr su establecimiento a condiciones in vitro. Previamente se lograron identificar taxonómicamente las especies y por medio de análisis fitoquímicos demostrar su potencial farmacéutico. El material recolectado fue identificado como Dioscorea coriacea, D. lehmannii, D. meridensis, D. polygonoides y una especie comestible D. trifida. Tubérculos recolectados de centros de acopio y traídos de campo fueron lavados, desinfectados, asperjados con Ácido Giberélico (AG3 y sembrados en sustrato BM-2®, en invernadero a 18°C día y 10°C noche. Los tubérculos completos o por secciones fueron almacenados en bolsas herméticas a temperatura ambiente. Posteriormente se desinfectó material vegetal de las especies D. coriacea, D. lehmannii, D. meridensis y D polygonoides, seleccionando explantes de brotes sanos (D. coriacea / laboratorio para su establecimiento. Se evaluaron tres medios de cultivo para establecimiento, el que presentó los mejores resultados fue Medio Murashige & Skoog (1962 suplementado con BAP 1 mL/L, AG3 1 mL/L y Putrescina 2 mL/L. Para la extracción y análisis de metabolitos secundarios se utilizaron tubérculos de D. coriacea, D. lehmannii y D. polygonoides, empleando como solvente de extracción metanol. Se  encontró mayor concentración de extracto vegetal en D. coriacea (54%, y mediante cromatografía en capa delgada (CCD, se confirmó la presencia de saponinas, que resultó mayor en comparación con D. polygonoides especie reconocida por su alto contenido de saponinas. Estos resultados permitirán realizar análisis m

  6. Teste de ELISA indireto para diagnóstico sorológico de leishmaniose visceral em canídeos silvestres Indirect ELISA for the serological diagnosis of visceral leishmaniasis in wild canids

    Directory of Open Access Journals (Sweden)

    Paulo R.B. Ferreira

    2013-04-01

    Full Text Available Na América do Sul, alguns canídeos silvestres são considerados reservatórios naturais da Leishmania chagasi. A resposta imunológica desses animais à Leishmania é pouco conhecida, havendo a necessidade de métodos diagnósticos adequados para esse fim. No presente estudo, é descrita a padronização do ensaio imunoenzimático indireto (ELISA para o diagnóstico sorológico de leishmaniose visceral em canídeos silvestres brasileiros. Foram estudadas amostras de soro e plasma de 12 canídeos cativos: sete lobos-guará (Chrysocyon brachyurus, três raposinhas (Lycalopex vetulus e dois cachorros-do-mato (Cerdocyon thous. As amostras de um C. brachyurus e uma L. vetulus, cativos em área endêmica para LV, que apresentavam doença clínica e positividade em testes de Imunofluorescência Indireta e Reação em Cadeia de Polimerase, foram utilizadas como controles positivos. Foram comparados os conjugados anti-IgG de cão e proteína A, ambos ligados a peroxidase, cujos testes detectaram quatro (04/12 e três (03/12 C. brachyurus soropositivos para anticorpos anti-Leishmania sp., respectivamente. As médias das densidades ópticas (DOs das amostras negativas foram nitidamente mais baixas do que as médias das DOs dos positivos tanto no ELISA com anti-IgG de cão (4,8 vezes como com proteína A (15,5 vezes. Os soros de três C. brachyurus positivos no ELISA indireto foram avaliados por Western blotting e identificaram 22 bandas, sendo imunodominantes as de peso molecular de 19, 22, 24, 45 e 66 kDa. Os testes ELISA com a proteína A e o conjugado anti-IgG de cão apresentaram respectivamente concordância excelente (Kappa = 1; pIn South America, some wild canids are considered natural reservoirs of Leishmania chagasi. The immunological response of wild canids to Leishmania is not well understood, and the development of diagnostic methods is necessary for such purpose. In the present study, the standardization of an enzyme-linked immunosorbent

  7. Papá Noel en la pira (Father Christmas on the Pyre

    Directory of Open Access Journals (Sweden)

    Claude Lévi-Strauss

    2010-05-01

    Full Text Available En “Papá Noel en la pira”, Lévi-Strauss desdobla la aproximación al noble anciano en una pesquisa histórica y en otra etnológica. La primera lo lleva a leyendas medievales en las que sobreviven festividades del Imperio Romano y oscuras celebraciones en las que niños y muertos se confunden. La segunda sumerge al lector en una especulación acerca de la relación entre los vivos y los muertos que toma por excusa las katchina de los indios de Norteamérica. Al cabo, constata que esta figura mediadora enmascara la presencia de la muerte y tiende a negarla.

  8. Arte funerario y astrología: La Pira de Luis I

    OpenAIRE

    Sebastián López, Santiago

    1991-01-01

    LOS FUNERALES DE EPOCAS ANTIGUAS TENDIERON A USAR ELOCUENTES IMAGENES ASTROLOGICAS QUE HACEN REFERENCIA AL MAS ALLA. EL ARTICULO ANALIZA EL CATAFALCO DE LUIS I (1724), PRIMERA EXHIBICION COMPLETA DE IMAGENES ASTROLOGICAS EN EL ARTE EFIMERO DEL MEXICO COLONIAL. (A.B.C./ L.A.G.)

  9. Entomological investigation of a sylvatic yellow fever area in São Paulo State, Brazil Investigação entomológica em área de ocorrência de febre amarela silvestre no Estado de São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Vera L. F. de Camargo-Neves

    2005-08-01

    Full Text Available Following reports of two autochthonous cases of sylvatic yellow fever in the State of São Paulo, Brazil, in 2000, entomological surveys were conducted with the objective of verifying the occurrence of vector species in forest environments close to or associated with riparian areas located in the western and northwestern regions of the State. Culicidae were captured in 39 sites distributed in four regions. Haemagogus leucocelaenus and Aedes albopictus were the most abundant species and were captured in all the regions studied. H. leucocelaenus was the most abundant species in the municipalities of Santa Albertina and Ouroeste, where the two cases of sylvatic yellow fever had been reported. Mosquitoes from the janthinomys/capricornii group were only found at eight sites in the São José do Rio Preto region, while Sabethes chloropterus was found at one site in Ribeirão Preto. H. leucocelaenus showed its capacity to adapt to a secondary and degraded environment. Our results indicate a wide receptive area for yellow fever transmission in the State of São Paulo, with particular emphasis on the possibility of H. leucocelaenus being involved in the maintenance of this sylvatic focus of the disease.O registro de dois casos autóctones de febre amarela silvestre no Estado de São Paulo, Brasil, em 2000, desencadeou investigações entomológicas com o objetivo de verificar a ocorrência das espécies vetoras em ambientes florestais próximos ou associados às zonas ribeirinhas, situados nas regiões oeste e noroeste do Estado. As capturas foram realizadas em 39 localidades distribuídas por quatro regiões do Estado. Haemagogus leucocelaenus e Aedes albopictus foram as espécies mais abundantes e capturadas em todas as regiões. H. leucocelaenus foi a espécie mais abundante nos municípios de Santa Albertina e Ouroeste, onde os casos de febre amarela silvestre foram registrados. Mosquitos do grupo janthinomys/capricornii foram encontrados em oito

  10. Diversidade de helmintos intestinais em mamíferos silvestres e domésticos na Caatinga do Parque Nacional Serra da Capivara, Sudeste do Piauí, Brasil Diversity of wild and domestic mammal's intestinal helminths from the Caatinga of the Parque Nacional Serra da Capivara, Southeast of Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Brandão Martha Lima

    2009-12-01

    Full Text Available Estudos sobre biodiversidade permitem avaliações ecossistêmicas e monitoramentos de impactos e mudanças ambientais. A diversidade parasitária pode refletir o processo coevolutivo entre parasitos e hospedeiros, e mudanças ambientais que permitem a perda, ganho ou a manutenção das espécies nesse processo. O presente trabalho utilizou espécies/morfotipos de ovos de helmintos encontrados em fezes de sete mamíferos silvestres (os grupos Dasypodidae e grandes felinos, e as espécies: Tamandua tetradactyla, Cebus apella, Alouatta caraya, Cerdocyon thous, Pecari tajacu e dois domésticos (Canis familiaris e Sus scrofa, que cohabitam o Parque Nacional Serra da Capivara (PNSC e seu entorno, para analisar a diversidade dos helmintos intestinais desses mamíferos. Neste trabalho, utilizou-se achados da fauna helmintológica de mamíferos silvestres e domésticos, para avaliar um possível fluxo de helmintos entre estes dois grupos hospedeiros usando Unweighted Pair Group Method with Arithmetic Mean (UPGMA dos hospedeiros com base na composição de suas faunas helmintológicas. Os resultados indicam que a região do PNSC, ainda mantém condições ambientais que ainda propiciam a manutenção da composição da fauna de helmintos de mamíferos silvestres, diferente da encontrada nos animais domésticos.Biodiversity studies allow ecosystem assessment and monitoring of environmental changes and impacts. Parasite diversity could reflect the host/ parasite coevolutionary process and the environment changes that permit the loss, gain or maintenance of species. This survey used species/morphotypes of helminths eggs found in feces from seven wild mammal species (the groups Dasypodidae and Large Cats, and Tamandua tetradactyla, Cebus apella, Alouatta caraya, Cerdocyon thous, Pecari tajacu and from two domestic species (Canis familiaris and Sus scrofa, which occur within the Serra da Capivara National Park (PNSC and surrounding areas in order to analise

  11. Caracterización de micorrizas establecidas entre dos hongos comestibles silvestres y pinos nativos de México Characterization of mycorrhizas established between two wild edible mushrooms and native pines of Mexico

    Directory of Open Access Journals (Sweden)

    Violeta Carrasco-Hernández

    Full Text Available Las especies forestales dependen de la simbiosis que realizan con los hongos ectomicorrízicos, para un crecimiento óptimo. Adicionalmente México es un importante reservorio cultural y biológico de especies de hongos silvestres comestibles a nivel mundial. A pesar de la gran importancia ecológica, antropológica y práctica, existen escasas descripciones de las ectomicorrizas formadas entre hongos ectomicorrizicos comestibles y plantas nativas de México. En el presente trabajo, se realizó la descripción morfológica de las ectomicorrizas de los hongos comestibles Laccaria bicolor y L. proxima en asociación con Pinus patula y P. pseudostrobus. La síntesis de las micorrizas estudiadas se efectuó mediante la inoculación con esporas en un sustrato estéril, bajo condiciones de invernadero. Se describen las ectomicorrizas formadas en plantas 397 días después de la siembra de pinos y de la inoculación con las especies fúngicas. Se observaron diferencias en la micromorfología de las ectomicorrizas de ambas especies fúngicas, siendo los principales caracteres distintivos, la longitud de la ectomicorriza, el tipo de ramificación, la forma de las puntas no ramificadas y el color de los ápices. Ambas especies presentaron el mismo arreglo anatómico de la capa externa del manto. Se adiciona también la descripción de las esporomas de Laccaria bicolor y L. proxima. Este estudio se realizó en el laboratorio de micorrizas del Programa de Edafología del Colegio de Postgraduados en Ciencias Agrícolas (CP en 2009.For an optimum growth, forest species depend on the symbiosis with ectomycorrhizal mushrooms. Additionally, Mexico is an important cultural and biological reserve of species of wild edible mushrooms at world level. In spite of huge ecological, anthropological and practical importance, there are scarce descriptions of ectomycorrhizas formed between edible ectomycorrhizal mushrooms and native plants of Mexico. In this work was done

  12. Comportamiento de lombriz roja californiana y lombriz silvestre en bosta bovina y rumia bovina como sustrato Behavior of californian red earthworm and wild earthworm in bovine dung and bovine rumination as substrate

    Directory of Open Access Journals (Sweden)

    Manuel Loza Murguía

    Full Text Available En los Yungas del departamento de La Paz, Bolivia se ubica la comunidad Carmen Pampa, fuente de recursos naturales y biodiversidad exquisita, últimamente está siendo afectada por los chaqueos y actividades agrícolas convencionales, dado que no existen datos suficientes en la región para poder desarrollar alternativas agrícolas sostenibles que cuiden el medio ambiente, de ahí que este trabajo tiene como propósito estudiar el comportamiento de la lombriz roja californiana (Eisenia spp. y la lombriz silvestre (Lumbricus spp. en dos sustratos a fin mejorar la calidad del vermicompost producido por estos anélidos. El trabajo se ha realizado en el módulo de Microbiología Ambiental, en instalaciones de la Unidad Académica Campesina Carmen Pampa (UACCP, Campus Leahy, ubicado en Coroico Nor Yungas del Departamento de La Paz-Bolivia. Se ha estudiado su comportamiento en dos sustratos bosta bobina (estiércol y rumia bovina (rumia en 40 unidades experimentales de 0.2 m de ancho*0.25 m de largo*0.4 m de profundidad, cada unidad presentaba una densidad de 5, 10, 15, 20 y 25 individuos con dos repeticiones de cada una en 1 000 g de sustrato. Se determinó el número de cocones, número de individuos a las 8 semanas, porcentaje de degradación del sustrato. Los resultados indican que los sustratos estiércol son mejores en la dinámica poblacional de Eisenia spp., en comparación con Lumbricus spp. Posiblemente las características físicas y químicas del estiércol y la rumia influyeron en este tipo de comportamiento de Eisenia spp.In Yungas of department of La Paz, Bolivia is located the community Carmen Pampas, source of natural resources and exquisite biodiversity, lately is being affected by the chaqueos and conventional agricultural activities, due there is not enough data in the region to develop sustainable agricultural alternatives that take care of environment. Taking this into account this work has as purpose to study the behavior of the

  13. The ecology of Triatoma sordida in natural environments in two different regions of the state of Minas Gerais, Brazil Ecologia do Triatoma sordida no ambiente silvestre de duas diferentes regiões do estado de Minas Gerais, Brasil

    Directory of Open Access Journals (Sweden)

    L. Diotaiuti

    1993-06-01

    Full Text Available A study was undertaken about T. sordida in the natural environment in two different regions of the state of Minas Gerais: Itapagipe (Triângulo, an area of cerrado modified by the formation of fields of pasture and agriculture, and Mato Verde (north an area of transition between caatinga and cerrado with profound deforestation in the last years due to the expansion of cotton cultivation. In both regions the principal ecotopes identified were hollow trees and the bark of live or dead trees, where the occurrence of a food source is not frequent. In this environment, the triatomines utilize various food sources; opposums appear to represent an important source of infection. In the north of Minas, a greater concentration of reservoirs and vectors was observed than in the Triángulo which could explain the higher level of infection of the triatomines in the north. Close attention to the process of domiciliation of T. sordida in the north of Minas is recommended where an extensive intervention by man in the natural environment has occurred and where a rise in the population of triatomines in the peridomestic environment has been observed in recent years.Foi realizado um estudo sobre o T. sordida em ambiente silvestre em duas diferentes regiões do estado de Minas Gerais: Itapagipe (Triângulo, área de cerrado modificado para formação de campos de pastagem e agricultura, e Mato Verde (norte uma área de transição entre a caatinga e o cerrado, profundamente desmatada nos últimos anos com a finalidade de expansão do cultivo de algodão. Em ambas as regiões, os principais ecotopos identificados corresponderam a buracos e cascas de árvores vivas ou mortas, onde a ocorrência de fontes de alimentação não é frequente. Neste ambiente, os triatomíneos utilizam-se de variadas fontes de alimentação; gambás parecem representar urna importante fonte de infecção. No norte de Minas, observou-se urna maior concentração de reservatórios e vetores

  14. Enraizamento de espécies silvestres de maracujazeiro utilizando cinco doses de ácido indolilbutírico Rooting of wild species of passionfruit using five doses of indolebutyric acid

    Directory of Open Access Journals (Sweden)

    Carolina de Faria Vaz

    2009-09-01

    Full Text Available Este trabalho teve como objetivo avaliar em casa de vegetação o potencial de enraizamento de diferentes espécies silvestres de maracujá, utilizando diferentes doses de ácido indolilbutírico. Estacas herbáceas de plantas adultas de Passiflora setacea, P. coccinea, P. amethystina, P. edulis, P. edulis x P. setacea e P. coccinea x P. setacea foram coletadas e tratadas com doses de 0; 250; 500; 750 e 1.000 mgL-1 de IBA, sendo em seguida plantadas em bandejas com substrato umedecido e mantidas sob nebulização intermitente. O delineamento experimental adotado foi o de blocos ao acaso, com 5 repetições, em arranjo fatorial de 6 x 5 (seis espécies e cinco níveis de regulador vegetal e 6 estacas úteis por unidade experimental. As variáveis analisadas foram estaca viva com raiz e com broto (EVCRCB, estaca viva com raiz e sem broto (EVCRSB, estaca viva com calo (EVCC, estaca viva sem calo (EVSC, total de estacas enraizadas (TER, estaca morta com raiz (EMCR, estaca morta com calo (EMCC, estaca morta sem calo (EMSC, total de estaca morta (TEM, estaca com broto (ECB, média de estacas com broto (MEB, massa seca da raiz (MSRA, massa seca do broto (MSBRO e massa seca total (MSTOTAL. A espécie P. amethystina apresentou o melhor desenvolvimento, destacando-se entre as outras espécies e mostrando potencial para enraizamento, tendo 88,67% de estacas enraizadas e brotadas. O uso do IBA foi eficiente à medida que se aumentavam as doses, proporcionando bom desenvolvimento às estacas das espécies estudadas.The aim of this work was to evaluate under greenhouse conditions, the rooting potential of different wild species of passion fruit using different doses of indolebutyric acid. Herbaceous cuttings of adult plants of Passiflora setacea, P. coccinea, P. amethystina, P. edulis, P. edulis x P. setacea and P. coccinea x P. setacea were collected and treated with doses of 0, 250, 500, 750 and 1000 mgL-1 of IBA, and then planted in trays with moistened

  15. Distribución geográfica de las especies cultivadas de Amaranthus y de sus parientes silvestres en México Geographical distribution of cultivated species of Amaranthus and their wild relatives in Mexico

    Directory of Open Access Journals (Sweden)

    Eduardo Espitia-Rangel

    Full Text Available La presente investigación tuvo como objetivo obtener los patrones de distribución de Amaranthus cruentus, Amaranthus hypochondriacus y sus parientes silvestres, mediante el uso de Sistemas de Información Geográfica, además de realizar un patrón de variación geográfica de las zonas donde se localizan. El género Amaranthus está distribuido a lo largo de México. A. cruentus y A. hypochondriacus se distribuyen en la parte centro sur del país, mientras que A. powellii está distribuido del centro al norte de México. Por otro lado, A. hybridus se puede cultivar prácticamente en todo México, por lo que fue la especie que presentó la mayor adaptación en comparación a las otras tres especies que mostraron una distribución más limitada. De acuerdo con la hipótesis que A. hybridus puede ser el ancestro más probable de A. cruentus y según los resultados obtenidos en este estudio, esta hipótesis podría ser cierta debido que en toda la distribución de A. cruentus está presente A. hybridus. Cabe mencionar, sobre la hipótesis que A. hypochondriacus puede ser un híbrido entre A. cruentus y A. powellii, se puede concluir que es cierta ya que A. hypochondriacus presentó un patrón de variación latitudinal parecido a A. powellii y un patrón de variación altitudinal similar a A. cruentus; además que todas ellas convergen en el Valle de México.The aim of this work was to obtain the distribution patterns of Amaranthus cruentus, Amaranthus hypochondriacus and its wild relatives using Gorgraphic Information Systems, as well as creating a geographic variation pattern of the areas in which they are found. The genus Amaranthus is distributed throughout Mexico. A. cruentus and A. hypochondriacus are distributed in the south-central area of the country, whereas A. powellii is found in the center and north of Mexico. On the other hand, A. hybridus can be cultivated in practically any part of the country, making it the species with the

  16. Composición de especies y diversidad de peces en un cuerpo de agua temporal en el Refugio Nacional de Vida Silvestre Caño Negro, Costa Rica

    Directory of Open Access Journals (Sweden)

    Idania Sáenz Sánchez

    2006-06-01

    Full Text Available Se evaluó la diversidad, el dominio y la equidad de la ictiofauna en un cuerpo de agua temporal en el río Frío, sector Playuela, Refugio Nacional de Vida Silvestre Caño Negro, según tres categorías del nivel de agua (baja [menor a 1.5 m], media [entre 1.5 y 3.0 m] y alta [mayor de 3.0 m]. Se recolectaron 10 264 individuos, pertenecientes a nueve familias, 18 géneros y 21 especies. Las especies que aportaron el mayor número de individuos fueron Poecilia gillii (37% y Astyanax aeneus (19%; mientras que las menos abundantes fueron Ophisternon aenigmaticum (0.06% y Rhamdia nicaraguensis (0.05%. El valor más alto en la diversidad de especies se registró en la categoría alta (H’=2.07; coincidiendo con los valores más altos en el inverso del índice de Simpson (1/D=6.2 y de Berger- Parker (1/d=4.2. De acuerdo con su diversidad, todas las categorías consideradas para el nivel de agua, mostraron diferencias estadísticas altamente significativas entre sí (pSpecies richness and diversity of a fish community in a temporal water body at Caño Negro National Wildlife Refuge, Costa Rica. We evaluated fish community, species richness and diversity in a temporal water body of Río Frío, Caño Negro National Wildlife Refuge. These evaluations were done for three categories of water levels: low (below 1.5 m, intermediate (between 1.5 and 3.0 m and high (deeper than 3 m. A total of 10 264 individuals were collected (nine families, 18 genera and 21 species. The most abundant species were Poecilia gillii (37% and Astyanax aeneus (19% and the least abundant were Ophisternon aenigmaticum (0.06% and Rhamdia nicaraguensis (0.05%. The highest values in diversity (H’= 2.07, in the inverse of the Simpson index (1/D=6.2 and of the Berger-Parker (1/d= 4.2, were recorded in the deepest water category. Diversity differed clearly among water levels (p<0.001. The high and intermediate categories were the most similar (conglomerate analysis: 72.9%. Out of the

  17. Behavioral experiments in a wild passerine cause short-term reductions in parental provisioning and nestling mass Experimentos conductuales en un ave paserina silvestre causan reducciones de corto plazo en el cuidado parental y peso de pichones

    Directory of Open Access Journals (Sweden)

    WOUTER F.D VAN DONGEN

    2009-06-01

    Full Text Available Research on wild animals often involves the capture and temporary removal of individuals from their territory. Although the acute effects of such procedures are well understood in terms of stress hormone profiles, their effect on the behaviour of captured individuals after release is poorly known. Additionally, for socially-monogamous individuals captured whilst breeding, little is known regarding whether the remaining individual compensates for the temporary loss of its partner and whether offspring condition or survival ultimately decreases due to any reductions in parental provisioning. We investigated the influence of field-based experiments requiring temporary adult removal on adult provisioning behaviour and nestling mass in the thorn-tailed rayadito (Aphrastura spinicauda, a Chilean furnariid species with equal parental effort between sexes. During the absence of the removed individual, remaining individuals did not increase nestling provisioning rates while, upon their release, removed individuals did not return to nestling feeding for at least 38 minutes and typically much longer. This drastic reduction in combined parental provisioning negatively affected nestling mass, while average nestling mass increased during a control period, nestlings failed to gain weight during and subsequent to parental removal. Finally, our experiments did not affect fledging probability. Overall, our results indicate that the temporary removal of rayaditos from their territories can cause short-term reductions in parental provisioning and nestling weight, but is unlikely to lead to any long-term effects on nestling survival.Las investigaciones en animales silvestres frecuentemente requieren la captura y remoción de individuos de sus territorios. Si bien se conocen los efectos a nivel hormonal de tales métodos, sus efectos sobre la conducta de los individuos después de la liberación son escasamente conocidos. Además, para individuos de especies mon

  18. Malófagos (Phthiraptera recolhidos de aves silvestres no Zoológico de São Paulo, SP, Brasil Chewing lice (Phthiraptera from wild birds in the São Paulo Zoo, State of São Paulo, SP, Brazil

    Directory of Open Access Journals (Sweden)

    Michel P. Valim

    2005-12-01

    Full Text Available Vinte e oito espécies de malófagos foram recolhidas de aves silvestres no acervo do Zoológico de São Paulo durante o ano de 2003. Vinte e três foram identificadas ao nível de espécie e cinco ao nível genérico. Os relatos de novas espécies no Brasil e novas associações parasitárias para a literatura são discutidos.Twenty-eight species of chewing lice were recovered from wild birds in the São Paulo Zoo during 2003. Twenty-three were identified to species level and five to the generic level. New species records for Brazil and new host-lice associations are discussed.

  19. El veterinario forense. Caza clandestina en fauna silvestre. Análisis forense y situacional de dos casos en el municipio de Tandil, Argentina (The Forensic Veterinary. Clandestine hunt in wild fauna. Forensic and situational studies in two cases. Tandil county. Argentina

    Directory of Open Access Journals (Sweden)

    Schettino, D.M.

    2007-04-01

    Full Text Available ResumenDos casos de caza clandestina de fauna silvestre ocurren con diferencia de meses en el municipio de Tandil, en los años2005 y 2006. Ambos afectaron a ciervos dama (Dama dama que fueron cazados en diferentes circunstancias. La utilización de perros entrenados para matar como también el uso de armas de guerra en áreas suburbanas está tácitamente prohibida en la legislación actual. Ambos casos son peritados en la FCV-UNCPBA y se analizan las condiciones de cada situación, el respaldo legal y los resultados obtenidos en amboscasos.

  20. Comparison of Pollen Production and Quality Characteristics of Cultivated and Wild Almond Species Comparación de Producción y Características de Calidad del Polen de Especies de Almendro Cultivadas y Silvestres

    Directory of Open Access Journals (Sweden)

    Safder Bayazit

    2011-12-01

    breeding programs.Hay varias especies de almendros silvestres en Turquía incluidas Amygdalus orientalis (Mill., Amygdalus turcomanica (Lincz., Amygdalus fenzliana (Fritsch Lipsky, Amygdalus trichamygdalus (Hand.-Mazz. Woronow, Amygdalus arabica (Olivier, y Amygdalus webbii (Spach. Estas especies ofrecen un gran valor para mejoramiento del almendro; se estudió la viabilidad del polen, tasa de germinación, y producción de polen para siete genotipos de A. orientalis y siete genotipos de A. turcomanica cultivados en condiciones naturales en el sudeste de Anatolia (Gaziantep and §anhurfa provinces, Turkey. También se estudiaron cultivares de almendros (Prunus dulcis [Mill.] D.A. Webb obtenidos desde Pozanti Agricultural Experimental Station, Universidad de Cukurova. Las viabilidades de polen de los diversos genotipos se determinaron por las pruebas 2,3,5-trifeniltetrazolium cloruro (TTC y fluoresceína diacetato (FDA. Las tasas de germinación de polen se establecieron en condiciones de placas Petri (1% agar + 0, 10, 15, y 20% sucrosa mientras la producción de polen se estimó con métodos hemocitométricos. Las tasas de viabilidad de polen fueron cercanas entre ambos métodos para los genotipos de A. orientalis y A. turcomanica. Las tasas de germinación de polen fueron dependientes del contenido de sucrosa y del genotipo. Los cultivares mostraron tasas de germinación de polen similares en todas las concentraciones de sucrosa mientras el polen de los genotipos A. orientalis y A. turcomanica mostraron mayores tasas de germinación en 10% sucrosa. El número de anteras por flor fue mayor en los cultivares mientras el número de granos de polen fue menor en otras especies de almendro. Mientras el número de granos de polen por flor fue relativamente alto en genotipos de A. orientalis, la calidad del polen fue alta en las tres especies en investigación. Los resultados sugirieron que estas dos especies, A. orientalis y A. turcomanica, podrían ser usadas para futuros

  1. Parasites of domestic and wild canids in the region of Serra do Cipó National Park, Brazil Parasitos de canídeos domésticos e silvestres na região do Parque Nacional da Serra do Cipó - Brasil

    Directory of Open Access Journals (Sweden)

    Juliana Lúcia Costa Santos

    2012-09-01

    Full Text Available Over recent decades, diseases have been shown to be important causes of extinctions among wild species. Greater emphasis has been given to diseases transmitted by domestic animals, which have been increasing in numbers in natural areas, along with human populations. This study had the aim of investigating the presence of intestinal helminths in wild canids (maned wolf, Chrysocyon brachyurus, and crab-eating fox, Cerdocyon thous in the Serra do Cipó National Park (43-44º W and 19-20º S and endo and ectoparasites of domestic dogs in the Morro da Pedreira Environmental Protection Area (an area surrounding the National Park. The Serra do Cipó is located in the state of Minas Gerais, Brazil. Among the enteroparasites found in domestic and wild canids, the following taxons were identified: Ancylostomidae, Trichuridae, Toxocara sp., Spirocerca sp., Physaloptera sp., Strongyloides sp., Cestoda, Dipylidium caninum, Diphyllobothriidae, Hymenolepidae, Anoplocephalidae, Trematoda, Acanthocephala and Isospora sp. Domestic dogs were positive for leishmaniasis and Babesia canis in serological tests. Among the ectoparasites, Rhipicephalus sanguineus, Amblyomma cajennense and Ctenocephalides felis felis were observed in domestic dogs. Variations in the chaetotaxy of the meta-episternum and posterior tibia were observed in some specimens of C. felis felis.Nas últimas décadas, as doenças têm sido apontadas como importantes causas de extinção de espécies silvestres. Maior ênfase tem sido dada às doenças transmitidas por animais domésticos que crescem em número, bem como as populações humanas, em áreas naturais. O presente estudo objetivou verificar a presença de helmintos intestinais de canídeos silvestres (lobo-guará - Chrysocyon brachyurus e cachorro-do-mato - Cerdocyon thous do Parque Nacional da Serra do Cipó (43-44º W e 19-20º S e endo e ectoparasitos de cães domésticos da Área de Proteção Ambiental Morro da Pedreira (entorno do

  2. Evidence of hantavirus infection in wild rodents captured in a rural area of the state of São Paulo, Brazil Evidência de infecção por hantavírus em roedores silvestres capturados em uma área rural do estado de São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Elba Regina S. de Lemos

    2004-06-01

    Full Text Available Hantaviruses are the etiological agents of the Hantavirus Cardio-Pulmonary Syndrome, a serious rodent-borne disease in Brazil. In order to investigate the occurrence of hantavirus infection in wild rodents, a survey was conducted in three different suburban areas of the municipality of Pedreira, State of São Paulo, Brazil. Of the 145 wild animals captured belonging to 12 different species identified by morphology and karyological analysis, 107 were rodents of the following species: Akodon montensis, Bolomys lasiurus, Calomys tener, Oligoryzomys nigripes, Oligoryzomys flavescens, and Myocastor coypus. Blood samples from these rodents were assayed for the presence of antibodies against hantavirus by IgG ELISA using Andes recombinant nucleocapsid antigen. Antibody reactive to Andes virus was found in two different species, O. nigripes and O. flavescens. These results indicate a potential risk for hantavirus transmission to humans in this area, where reservoir rodents are present in peridomestic settings.Hantavírus é o agente etiológico da síndrome cardio-pulmonar por hantavirus (SCPH, uma importante doença transmitida por roedores no Brasil. Com o objetivo de se conhecer a ocorrência de infecção por hantavírus em pequenos roedores silvestres, uma análise sorológica foi conduzida em três diferentes áreas do subúrbio da cidade de Pedreira, São Paulo. Dos 145 animais silvestres capturados, pertecentes a 12 diferentes espécies identificadas por morfologia e por análise cariológica, 107 eram roedores das seguintes espécies: Akodon montensis, Bolomys lasiurus, Calomys tener, Oligoryzomys nigripes, Oligoryzomys flavescens, e Myocastor coypus. Amostras de sangue desses roedores foram testadas para a presença de anticorpos IgG contra o antígeno do nucleocapsídeo do vírus Andes através do teste ELISA. Reatividade sorológica ao vírus Andes foi observada em duas espécies diferentes, O. nigripes and O. flavescens. Estes resultados

  3. Flebotomíneos coletados em matas remanescentes e abrigos de animais silvestres de zoológico no perímetro urbano de Maringá, sul do Brasil. Estudo preliminar Phlebotomines collected in remaining florests and wild animal shelters in zoological garden in the urban area of Maringá, Paraná State, shoutern Brazil. Preliminary study

    Directory of Open Access Journals (Sweden)

    Ueslei Teodoro

    1998-12-01

    Full Text Available Um caso de leishmaniose tegumentar com provável infecção em uma das áreas de matas remanescentes no perímetro urbano de Maringá, Paraná, Brasil, o desconhecimento da fauna e do comportamento de flebotomíneos nestas matas despertaram o interesse desta investigação. Os flebotomíneos foram coletados com armadilhas de Falcão instaladas em matas remanescentes do Parque do Ingá, Bosque Dois e Horto Florestal, de junho a setembro de 1995, no período noturno. Nestas áreas coletaram-se 3.532 flebotomíneos, prevalecendo Lutzomyia (Nyssomyia whitmani (Antunes & Coutinho, 1939 com 3.395 (96,1% exemplares. No Parque do Ingá, onde as coletas também foram feitas em abrigos de animais silvestres, mantidos em zoológico, foram coletados 2.907 flebotomíneos, dos quais 1.723 nestes abrigos. Os resultados mostram melhor adaptação de Lutzomyia whitmani nas matas remanescentes no perímetro urbano de Maringá e sua freqüência nos abrigos dos animais silvestres mantidos em cativeiro.The present study was undertaken after the detection of one case of cutaneous leishmaniasis with presumed infection in one of the three remaining wooded areas in the urban area of the city of Maringá, Southern Brazil; also in view of the lack of knowledge about sand flies and their behavior. From June to September, 1995, sand flies were caught with Falcão traps during the night in the remaining wooded areas (Parque do Ingá, Bosque Dois and Horto Florestal. A total of 2,907 sand flies were caugth in Parque do Ingá; 1,723 of them were aught in forest traps and 1,184 in wild animal shelter traps at the zoo. The results show that Lutzomyia whitmani is better adapted to the three areas under study and that it frequently occurs in wild animal shelters within the urban perimeter of Maringá.

  4. Alguns dados sobre o comportamento parasitológico das linhagens humana e silvestre do Schistosoma mansoni, no Vale do Rio Paraíba do Sul, SP (Brasil Some data on the parasitological behaviour of human (H and wild (S strains of S. mansoni, in the Paraiba do Sul River Valley, State of São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Othon de Carvalho Bastos

    1978-06-01

    Full Text Available Verificou-se ser elevada a percentagem de animais parasitados por S. mansoni em roedores silvestres, de diferentes gêneros e espécies, capturados no Vale do Rio Paraíba do Sul, SP, Brasil onde se encontram com freqüência, casos humanos de esquistossomose mansônica. A partir de fígados de roedores naturalmente infectados foram obtidos miracídios para o isolamento da linhagem silvestre (S. Para o isolamento da linhagem humana (H, foram utilizados miracídios procedentes de fezes de doentes comprovadamente autóctones do Vale do Rio Paraíba. Estudou-se, comparativamente, o comportamento das duas linhagens em B. tenagophila que é o hospedeiro intermediário natural na região e em camundongo albino, utilizado como hospedeiro definitivo. Verificou-se que: a taxa de mortalidade de B. tenagophila infectadas com a linhagem "S" não é, estatisticamente, diferente da dos moluscos utilizados para controle; é significativa a diferença entre a taxa de mortalidade verificada nos moluscos infectados com a linhagem "S" e com a linhagem "H", a qual é consideravelmente maior nos moluscos infectados com a linhagem "H"; nos camundongos infectados com a linhagem "H" verificou-se ser significativo o coeficiente de correlação entre o número de granulomas hepáticos e o de trematódeos adultos; nos camundongos infectados com a linhagem ''S" não houve possibilidade do estabelecimento de tal correleção.Human (H and wild (S Schistosoma mansoni strains were obtained; the H strain from eggs colected in human feces and the S strain having its source in livers of several species of wild rodents. Results of the behaviour of these strains in Biomphalaria tenagophila and in albino Mus musculus are exposed in this work, summarized as follows: the mortality rate, statistically, did not differ in the group of infected snails and in the group of control snails; however, the difference between the mortality rates in snails infected with "H" strain and with "S

  5. Whitefly species (Hemiptera: Aleyrodidae on wild and cultivated plants in the horticultural region of Rosario, Santa Fe, Argentina Especies de moscas blancas (Hemiptera: Aleyrodidae sobre plantas silvestres y cultivadas en la región hortícola de Rosario, Santa Fe, Argentina

    Directory of Open Access Journals (Sweden)

    Gustavo G. Gonsebatt

    2012-06-01

    Full Text Available Whiteflies of economic importance are polyphagous, being able to develop on a large number of cultivated and spontaneous plants. We recorded the whitefly species on vegetable and flower crops and the wild plants associated, under greenhouse and field conditions, for two years. We observed two species: Trialeurodes vaporariorum (Westwood and the Bemisia tabaci complex (Gennadius. T vaporariorum was recorded on 24 plant species (11 families, 12 and 8 of which are new hosts in Argentina and in the world, respectively. The B. tabaci complex was recorded only on flower production systems, on 19 plant species (11 families, 14 and 7 of which are new hosts in Argentina and in the world, respectively. The crops Glycine max (L. and Chrysanthemum morifolium Ramat., the wild species Amaranthus blitum L., Amaranthus quitensis Kunth, Conyza bonariensis (L., Galinsoga parviflora Cav., Sonchus oleraceus L. and Wedelia glauca (Ortega O. Hoffm. ex Hicken were hosts of both species. The only parasitoid recorded was Eretmocerus californicus near corni Haldeman (Hymenoptera: Aphelinidae from T. vaporariorum. This study, which is the first systematic survey of host plants in the region, intends to provide a better knowledge of the range of whiteflies host plants in Argentina.Las moscas blancas de importancia económica son polífagas y capaces de desarrollarse sobre numerosas plantas cultivadas y espontáneas. Registramos las especies de moscas blancas sobre cultivos hortícolas y de flores, y sobre las plantas silvestres asociadas. Observamos dos especies: Trialeurodes vaporariorum (Westwood y el complejo Bemisia tabaci (Gennadius. T. vaporariorum fue registrada sobre 24 especies de plantas (11 familias, 12 y 8 de las cuales son hospedantes nuevos para Argentina y a nivel mundial, respectivamente. El complejo B. tabaci fue registrado solo en sistemas de producción de flores, sobre 19 especies de plantas (11 familias, 14 y 7 de las cuales son nuevos hospedantes para

  6. Estudo da infecção esquistossomótica produzida pelas linhagens humana e silvestre do Vale do Rio Paraíba do Sul, SP (Brasil, em camundongos isogênicos Some results of schistosomiasis mansoni in inbred mice infected with human and wild rodent strains from the Paraiba do Sul River Valley, S. Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Othon de Carvalho Bastos

    1979-12-01

    Full Text Available Foi estudada a influência da isogenicidade de camundongos de laboratório na capacidade de penetração de cercárias de Schistosoma mansoni de linhagem humana do Vale do Rio Paraíba do Sul, SP. Foram estudados, comparativamente, aspectos da biologia e da patogenia das linhagens humana e silvestre do S. mansoni do Vale do Rio Paraíba do Sul, SP (Brasil em camundongos isogênicos. Foi vantajoso o uso de camundongos isogênicos devido a maior homogeneidade dos resultados e a maior penetração de cercárias pelo tegumento da cauda dos roedores.The behavior of a human S. mansoni strain was studied in infected, outbred mice. A comparative study was carried out to evaluate the effects of the infection in inbred mice, employing human and wild rodent strains of S. mansoni. The use of inbred mice was advantageous in that it allowed greater uniformity in the results as well as greater penetration of surrounding areas through the caudal tegmentum.

  7. Geographical distribution and intra-domiciliary capture of sylvatic triatomines in La Convención province, Cusco, Peru Distribuição geográfica e captura intra-domiciliar de triatomíneos silvestres na província de La Convención, Cusco, Peru

    Directory of Open Access Journals (Sweden)

    Dina Beatriz Torres V.

    2010-06-01

    Full Text Available The geographical distribution and intra-domiciliary capture of sylvatic triatomines in three districts of the province of La Convención, Cusco, Peru are presented. In the district of Vilcabamba, eight adults of Rhodnius pictipes and five adults of Panstrongylus geniculatus were found. In the district of Ocobamba, 19 adults, 14 nymphs, and eggs of P. rufotuberculatus were found. In the district of Echarate, six adults and 10 nymphs of Eratyrus mucronatus, an adult of R. pictipes and P. geniculatus, and a nymph of P. rufotuberculatus were also found. The geographical distribution of E. mucronatus has extended to Cusco. This is the first report in Peru of household colonization by this triatomine.Apresenta-se a distribuição geográfica e captura intra-domiciliar de triatomíneos silvestres em três distritos da província de La Convención, Cusco, no Peru. Foram encontrados oito adultos de Rhodnius pictipes e cinco adultos de Panstrongylus geniculatus, no distrito de Vilcabamba, 19 adultos, 14 ninfas e ovos de P. rufotuberculatus no distrito de Ocobamba. Também foram encontrados seis adultos e 10 ninfas de Eratyrus mucronatus, um adulto de R. pictipes e P. geniculatus, e uma ninfa de P. rufotuberculatus no distrito de Echarate. A distribuição de E. mucronatus amplia-se geograficamente a Cusco. Este é o primeiro relato de domiciliação por este triatomíneo no Peru.

  8. Edible wild mushrooms: exotic species of Suillus (Boletales, Basidiomycota and Lactarius (Russulales, Basidiomycota associated to culture of Pinus elliottii in northeastern Argentina HONGOS COMESTIBLES SILVESTRES: ESPECIES EXÓTICAS DE SUILLUS (BOLETALES, BASIDIOMYCOTA Y LACTARIUS (RUSSULALES, BASIDIOMYCOTA ASOCIADAS A CULTIVOS DE PINUS ELLIOTTII DEL NORDESTE ARGENTINO

    Directory of Open Access Journals (Sweden)

    Nicolás Niveiro

    2010-07-01

    Full Text Available Wild edible mushrooms are a promising economic resource, since they are easily commercialized as a dehydrated product. In the present work, two species of mycorrhizal fungus associated to Pinus elliottii, cultivated in the NE of Argentina, are described and illustrated. Lactarius deliciosus is a new record from Misiones province whereas Suillus granulatus is a new record from provinces of Corrientes and Misiones

    Los hongos silvestres comestibles son un recurso económico importante que permite obtener
    un producto deshidratado que puede comercializarse fácilmente. En el presente trabajo, y con
    el objeto de dar a conocer este recurso, se ilustran y describen dos especies de hongos
    micorrícicos asociadas a cultivos de Pinus elliottii en el nordeste argentino que no han sido
    mencionadas anteriormente para la región: Lactarius deliciosus para la provincia de Misiones
    y Suillus granulatus para las provincias de Corrientes y Misiones

  9. Determinación del impacto de competencia de diferentes cohortes de avena silvestre (Avena fatua sobre los rendimientos en un cultivo comercial de trigo (Triticum aestivum Assessment of competition impact from different cohorts of wild oats (Avena fatua on the yields of a commercial wheat crop (Triticum aestivum

    Directory of Open Access Journals (Sweden)

    Márquez M. Javier

    1996-06-01

    Full Text Available El objetivo de este trabajo fue determinar el comportamiento de la avena silvestre (Avena fatua L. sobre el cultivo de trigo (Triticum aestívum LO.. Estainvestigaciónfue desarrollada en el Centro Agropecuario , Universidad Nacional de Colombia del municipio de Mosquera, Cundinamarca, principalmente para determinar la variación de las poblaciones de la avena silvestre mediante el establecimiento de 8 cohortes a intervalos de 15 días cada una. Se evaluaron los cambios fenológicos en cada cohorte dos veces por semana. También, fue evaluado el impacto de la competencia a través del peso seco de las plantas. El trabajo se desarrolló
    con diseño experimental de bloques completos al azar, con cuatro replicas y cada tratamiento se acompañó con dos testigos: una parcela siempre limpia y otra siempre enmalezada. Se realizó la prueba de Duncan para las variables significativas. La emergencia de plantas de avena se presentó durante todo el ciclo del cultivo. Las plantas de las primeras cohortes de avena fueron tan altas como las plantas de cultivo. La densidad de plantas y el peso seco de estas primeras 5 cohortes fueron superiores a los de las
    3 cohortes finales. Las plantas de las cohortes 6 a, 7 a y e-. presentaron menor número de tallos y menor peso seco por planta. Estas diferencias hacen que las plantas de las primerascohortes presentaran mayor capacidad de competencia.The objective of this study was to determine the behaviour of wild oats (Avena fatua L. in a wheat crop (Tritícum aestivum LO.. This research was conducted at the Centro Agropecuario "Marengo" , Universidad Nacional de Colombia, near the town of Mosquera, Cundinamarca. In order to determine the variation of Avena fatua populations, 8 succesive cohorts were established with intervals of 15 days. The experimental design used was randomized complete blocks with tour replications. In addition to the the eight treatments (cohorts there were two check plots

  10. Absconding and migratory behaviors of feral Africanized honey bee (Apis mellifera L. colonies in NE Brazil = Comportamentos de abandono e migração de colônias silvestres da abelha melífera africanizada (Apis mellifera L. no nordeste do Brasil

    Directory of Open Access Journals (Sweden)

    Breno Magalhães Freitas

    2007-10-01

    Full Text Available We investigated the annual movements of feral Africanized honey bee (Apis mellifera L. colonies in the state of Ceará, Brazil, aiming to understand seasonal variations in their population. Arrival and absconding of Africanized honey bee (AHB colonies in the semiaridmunicipality of Canindé and the coastal humid city of Fortaleza (120 km apart were recorded weekly from January 1999 to December 2001, and the data compared to rainfall records in both areas. Results showed that AHB colonies only nest in the semiarid during the rainy season and abscond during the dry season, the opposite from observations taken in Fortaleza. Only 5% of colonies remained in the semiarid area for the entire year due to ant (Camponotus sp. attacks and shortage of nectar and water during the dry season, with most colonies migrating to coastal areas where the weather is milder and many plant species bloom at that time of year. Excessive rainfallprobably pushes AHB colonies back to the semiarid during the rainy season. We concluded that absconding and migration are strategies that allow AHB colonies to survive in the semiarid NE of Brazil, contrary to European honeybees, which have never succeeded in establishing wild colonies in the region.Os movimentos de colônias silvestres da abelha melífera africanizada (Apis mellifera L. no Estado do Ceará, Brasil, foram investigados com o objetivo de compreender variações anuais em sua população. A chegada e a partida de colônias de abelhas africanizadas (AHB,no município semi-árido de Canindé e na úmida cidade litorânea de Fortaleza (separadas por 120 km, foram monitoradas semanalmente, de janeiro de 1999 a dezembro de 2001, e comparados com os dados pluviométricos de chuvas em ambas as áreas. Os resultadosdemonstraram que as abelhas africanizadas somente nidificaram no semi-árido durante a estação chuvosa e o abandonaram na estação seca, ao contrário do observado em Fortaleza. Apenas 5% das col

  11. Impactos de atropelamentos de animais silvestres no trecho da rodovia SP-215 confrontante ao Parque Estadual de Porto Ferreira – Porto Ferreira, SP (Nota Científica. Impacts roadkills mortality of wild animals in the area of SP-215 highway alongside Porto Ferreira State Park – Porto Ferreira, SP (Scientific Note.

    Directory of Open Access Journals (Sweden)

    Sonia Aparecida de SOUZA

    2010-12-01

    Full Text Available No presente trabalho foi realizado o monitoramento dos atropelamentos de animais silvestres na rodovia SP–215 no trecho confrontante ao Parque Estadual de Porto Ferreira. Em seis anos foram registrados 72 indivíduos, sendo 17 espécies de mamíferos, 10 de aves, quatro de répteis, uma de anfíbio e três indivíduos não identificados. Dentre esses, lobo-guará Chrysocyon brachyurus, jaguatirica Leopardus pardalis e cuíca-lanosa Caluromys lanatus se encontram na lista das espécies ameaçadas de extinção do Estado de São Paulo. A partir do conhecimento das espécies atingidas, faz-se necessário o desenvolvimento de estudos e propostas de implantação de medidas mitigadoras à presença da rodovia SP–215 para a conservação da fauna.This paper presents the data collected through the monitoring of roadkills on SP–215 highway in the area alongside Porto Ferreira State Park. During six years, 72 roadkills were recorded, including 17 species of mammals, 10 of birds, five of reptiles, one of amphibians and three unidentified individuals. Among those species, maned wolf Chrysocyon brachyurus, ocelot Leopardus pardalis, and Western woolly opossum Caluromys lanatus are included in the threatened species list of the state of São Paulo. After finding out which species are affected, it is necessary to develop studies and proposals for implementing effective mitigation measures for the presence of SP–215 highway in the area in order to preserve the local fauna.

  12. Creciendo Sin Drogas: Guia de Prevencion para Padres (Growing Up Drug-Free: A Parent's Guide to Prevention).

    Science.gov (United States)

    Office of Elementary and Secondary Education (ED), Washington, DC. Safe and Drug Free Schools Program.

    This publication is part of the Department of Education's ongoing effort to provide information to emerging populations in their native language on how to create and maintain drug-free and safe schools across the nation. Throughout the publication are personal stories and artwork of elementary and secondary school students that promote the message…

  13. Diseño de un proceso estratégico para la empresa New Care – Creciendo Saludable

    OpenAIRE

    Murillo Agudelo, Jessica Alexandra; Caballero Montaño, Luis Ferney

    2015-01-01

    En este trabajo de grado se elabora una breve presentación de propuestas, modelos y teorías de organizaciones saludables desde diferentes perspectivas, con el fin de lograr un análisis y aplicación de un modelo en una pequeña empresa del sector cosmetico para lograr la propuesta y formulacion estrategica de un modelo aplicable. En este ejercicio se logra un diagnóstico, evaluación y direccionamiento estrategico de la compañía para la elaboración de una propuesta que le permita a la compañía c...

  14. Pesquisa de anticorpos contra Leptospira spp. em animais silvestres e em estado feral da região de Nhecolândia, Mato Grosso do Sul, Brasil: utilização da técnica de imuno-histoquímica para detecção do agente Investigation of antibodies to Leptospira spp. in wild and feral animals from the region of Nhecolândia, Mato Grosso do Sul, Brazil: use of the immunohistochemistry technique for the agent detection

    OpenAIRE

    Raul José Silva Girio; Fernando Lúcio Garcia Pereira; Moacir Marchiori Filho; Luís Antônio Mathias; Rita de Cássia Pereira Herreira; Antônio Carlos Alessi; Thaís Marino Silva Girio

    2004-01-01

    Foram examinadas 315 amostras de soros sangüíneos de diversas espécies de animais que vivem em estado feral ou silvestre na região de Nhecolândia, Corumbá, MS, por meio da prova de soroaglutinação microscópica para leptospirose. Dessas amostras, 67 foram de bois baguás (Bos taurus indicus), 39 de porcos-monteiros (Sus scrofa), 39 de búfalos (Bubalus bubalis), nove de quatis (Nasua nasua), 41 de veados-campeiros (Ozotoceros bezoarticus), 10 de veados-mateiros (Mazama americana) e 110 amostras ...

  15. Biology and conservation status of Piraja’s Lancehead Snake Bothrops piraña Amaral, 1923 (Serpentes: Viperidae, Brazil

    Directory of Open Access Journals (Sweden)

    M.A.D. Freitas

    2014-09-01

    Full Text Available The venomous snake Bothrops pirajai (Amaral, 1923 is endemic to Brazil. Despite being described almost a century ago, very little is known about this species, which has never been studied in situ. Here, we present new data on the biology and natural history of B. pirajai based on a review of existing museum specimens and a field study (1504 man hours carried out throughout the species range. The distribution of B. pirajai was found to be restricted to the eastern Atlantic forest of the state of Bahia, Brazil, between Todosos Santos Bay, Itabuna and Ilhéus (12050’S-14050’S, 88-835 m. We recommend the species be uplisted to Endangered in the International Union for the Conservation of Nature’s global Red List of Threatened Species as its estimated extent of occurrence is under 5000km2. The effective conservation of B. pirajai will rely on addressing two key issues: improving our knowledge of the species and successfully mitigating habitat loss and fragmentation.

  16. Biology and conservation status of Piraja’s Lancehead Snake Bothrops piraña Amaral, 1923 (Serpentes: Viperidae, Brazil

    Directory of Open Access Journals (Sweden)

    M.A.D. Freitas

    2014-09-01

    Full Text Available The venomous snake Bothrops pirajai (Amaral, 1923 is endemic to Brazil. Despite being described almost a century ago, very little is known about this species, which has never been studied in situ. Here, we present new data on the biology and natural history of B. pirajai based on a review of existing museum specimens and a field study (1504 man hours carried out throughout the species range. The distribution of B. pirajai was found to be restricted to the eastern Atlantic forest of the state of Bahia, Brazil, between Todosos Santos Bay, Itabuna and Ilhéus (12050’S-14050’S, 88-835 m. We recommend the species be uplisted to Endangered in the International Union for the Conservation of Nature’s global Red List of Threatened Species as its estimated extent of occurrence is under 5000km2. The effective conservation of B. pirajai will rely on addressing two key issues: improving our knowledge of the species and successfully mitigating habitat loss and fragmentation.

  17. Primeiro caso autóctone de tripanossomíase americana no Estado do Acre (Brasil e sua correlação com as cepas isoladas do caso humano e de triatomíneos silvestres da área The first autochthonous case of American trypanosomiasis in the State of Acre, Brazil, and its correlation with the strains identified in the human case and the sylvatic triatomines in the area

    Directory of Open Access Journals (Sweden)

    José Maria Soares Barata

    1988-10-01

    Full Text Available São apresentados os resultados obtidos na investigação entorno-epidemiológica realizada no estudo do primeiro caso humano autóctone de tripanossomíase americana no Estado do Acre (Brasil. A investigação demonstrou ausência de domiciliação triatomínea, ficando descartada totalmente a possibilidade de transmissão congênita ou transfusional. Não foi possível verificar se a transmissão foi metaxênica através da invasão domiciliar de barbeiro silvestre, ou se por via digestiva através de alimentos contaminados. Foram isoladas duas cepas de Trypanosoma cruzi, uma do caso humano chamada Acre-Humana (AH e outra de Rhodnius robustus coletados em palmeiras uricuri (Attalea sp nas proximidades da casa, chamada Acre-Silvestre (AS. Ficou comprovada a existência de correlação entre os caracteres morfobiológicos e patogênicos das duas amostras estudadas: mostraram-se patogênicas para camundongos, infectando 100% dos animais, quer com formas metacíclicas de triatomíneos, quer com formas sanguícolas de doadores em fase aguda. A infecção dos camundongos nas duas amostras é grave com curto período pré-patente, parasitemia elevada e taxa de letalidade alta. Em ambas as cepas, em fase aguda, são abundantes ninhos de amastigotas, principalmente no coração e fígado. As amostras AH e AS conferem aos animais que sobrevivem boa resistência contra infecções pela amostra Y. Cultivaram-se facilmente em meios líquidos e semi-sólidos e infectaram experimentalmente seis espécies de triatomíneos. Os resultados comprovam mais uma vez a presença de focos naturais desta parasitose na região.Results of entomological and epidemiological investigations on the first autochthonous human case of American trypanosomiasis in the State of Acre, Brazil are presented. There are no synanthropic triatomine vectors in the area. Possibility of congenital or transfusional transmission is completely excluded. However, it is not possible to establish

  18. La educación e interpretación ambiental en las áreas silvestres protegidas del estado: La experiencia del Parque Nacional Conguillío (Región de La Araucanía para fomentar la conservación en los visitantes.

    Directory of Open Access Journals (Sweden)

    M. González

    2014-03-01

    Full Text Available Dentro de las Áreas Silvestres protegidas de la Región de la Araucanía, sur de Chile, se destaca el Parque Nacional Conguillío inserto en la precordillera andina. Considerado un área de gran importancia ecosistémica dada la diversidad de ambientes que presenta producto de la acción vulcanológica propia de esta cordillera, ésta unidad conforma parte del selecto grupo de Reserva de la Biosfera del país. En él es posible encontrar ecosistemas de bosque primario de Araucaria, humedales (incluyendo ríos, lagos y esteros, escoriales y altas cumbres como es el Volcán LLaima y Sierra Nevada, todas de importante valor científico, geológico, geomorfológico y turístico. Su alta concurrencia por sus atractivos escénicos, flora y fauna, generan una importante llegada de visitantes, nacionales y extranjeros especialmente en época estival dado las mejores condiciones metereológicas y la temporada de vacaciones. Es por ésta razón, que el programa de educación e interpretación ambiental creado pioneramente hace 37 años y actualmente vigente como actividades para sus visitantes adultos y niño(as, cobra un mayor sentido de pertenencia para el visitante a través de una experiencia en un ASPE. Las actividades como experiencia, buscan la generación de nuevas actitudes que involucren una conducta del visitante orientada a la sostenibilidad del parque y la apreciación del entorno natural como parte fundamental en el desarrollo del ser humano. En este contexto, el programa actual muestra un crecimiento sostenido de un 7% en número de visitantes entre temporada 2013-2014, siendo objetivo de este trabajo el mostrar antecedentes generales del parque, los senderos más visitados, las especies de flora y fauna más atractivas y/o con problemas de conservación, así como el programa en cuanto a las actividades y sus proyecciones de mejora.

  19. Serologic survey for hantavirus infections among wild animals in rural areas of São Paulo State, Brazil Inquérito sorológico para infecções por arbovírus em animais silvestres de áreas rurais do Estado de São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Nicolina Silvana ROMANO-LIEBER

    2001-12-01

    Full Text Available A serosurvey was conducted in wild animals captured close to two areas where hantavirus cardiopulmonary syndrome (HCPS occurred in São Paulo State, Brazil. Serum samples from a total of 43 mammals were tested for antibodies reactive with Sin Nombre (SN hantavirus using a strip immunoblot assay. RNAs from the blood clots of the positive samples were submitted to reverse transcriptase-polymerase chain reaction (RT-PCR. Two rodents of the genus Oligoryzomys were positive for hantavirus antibodies. These animals were captured in the Iguape region and represented 16.7% (2/12 of the sera from rodents and 100.0% (2/2 of the Oligoryzomys captured in that area. RT-PCR failed to amplify any viral cDNA. These results are in agreement with other data that suggest that members of this genus are important reservoirs of hantaviruses in Brazil.Realizou-se inquérito sorológico em animais silvestres capturados em áreas próximas a duas regiões do Estado de São Paulo, Brasil, onde ocorreram casos de Síndrome Cardiopulmonar por Hantavírus (HCPS. Pesquisou-se a presença de anticorpos para o vírus Sin Nombre (SNV em amostras de soro de 43 mamíferos, utilizando-se a técnica de Strip Immunoblot Assay (SIA. Empregou-se a técnica de reação em cadeia de polimerase - transcriptase reversa (RT-PCR nos coágulos sangüíneos dos espécimes positivos. Dois roedores do gênero Oligoryzomys apresentaram anticorpos para hantavírus. Esses animais foram capturados na região de Iguape e representavam 16,7% (2/12 dos roedores e 100,0% dos Oligoryzomys capturados naquela área. O RT-PCR não detectou cDNA viral nas amostras. Os resultados estão de acordo com outros trabalhos que sugerem que membros desse gênero são importantes reservatórios de hantavírus no Brasil.

  20. Phytochemical Evaluation of Wild and Cultivated Pepper (Capsicum annuum L. and C. pubescens Ruiz & Pav. from Oaxaca, Mexico Evaluación Fitoquímica en Chile (Capsicum annuum L. and C. pubescens Ruiz & Pav. Silvestre y Cultivado en Oaxaca, México

    Directory of Open Access Journals (Sweden)

    Araceli Minerva Vera-Guzmán

    2011-12-01

    Full Text Available Reports of the last decade show that some types of food and spices included in the human diet, such as pepper (Capsicum annuum L. can have a positive effect on human health. The Mexican pepper germplasm is poorly documented with regard to variety and the amount of phytochemical compounds that it contains. In the present study, the variation of phytochemical compounds was evaluated in nine fruit variants (morphotypes of wild and cultivated pepper grown in Oaxaca. ANOVA detected significant differences among pepper morphotypes and ripeness stages of fruits; vitamin C, total phenols, flavonoids, P-carotene, coordinated chromatic of color, and capsaicinoids. The highest values of vitamin C were found in 'Tabaquero', 'Guero' and 'Costeño' morphotypes (151.6 to 183.2 mg 100 g-1. With regard to total phenols and flavonoids, 'Piquín' and 'Solterito' had the highest levels. Coordinates of color a* and b*, and chroma presented a positive correlation with phenol and flavonoid contents. The evaluated morphotypes differed in capsaicin and dihydrocapsaicin; C. annuum had higher capsaicin content (4.9 to 142 /En la última década, se reportó que el consumo de ciertos alimentos y especias, como el chile (Capsicum annuum L., pueden tener un efecto positivo en la salud. Particularmente, los acervos genéticos mexicanos de chile están poco documentados en relación a la diversidad desde la perspectiva fitoquímica. En este trabajo se evaluó la variación de compuestos fitoquímicos en nueve morfotipos de chile silvestres y cultivados de Oaxaca. El ANDEVA detectó diferencias significativas entre morfotipos y estados de madurez en vitamina C, fenoles, flavonoides, P-caroteno, color, y capsaicinoides. Los valores más altos de vitamina C se determinaron en 'Tabaquero', 'Guero' y 'Costeño' (151.6 a 183.2 mg 100 g-1. En fenoles y flavonoides sobresalieron los tipos 'Piquin' y 'Solterito'. Las coordenadas cromáticas a* y b*, y los tonos (C* se correlacionaron

  1. Comparação de métodos de laboratório e de campo para a estimativa da área foliar em fruteiras silvestres Comparison of laboratory and field methods for the estimation of leaf area of wild fruit species

    Directory of Open Access Journals (Sweden)

    M.S. Mielke

    1995-04-01

    Full Text Available Foi realizado um trabalho com o objetivo de estudar diferentes métodos de laboratório e de campo para a estimativa da área foliar de fruteiras silvestres, pertencentes à família Myrtaceae, a saber: uvalheira (Eugenia uvalha Camb., aracazeiro (Psidium cattleyanum Sabine, goiabeira serrana (Feijoa sellowiana Berg. e pitangueira (Eugenia uniflora DC. Entre os métodos de laboratório, também utilizados como "padrão", bons resultados foram obtidos utilizando-se um medidor automático de área foliar, planímetro ou através do método gravimétrico (fotocópia ou papel filtro. Dentre os métodos de campo, os melhores resultados foram obtidos por regressão linear. As estimativas das áreas foliares (y para as quatro espécies estudadas podem ser tomadas a partir das equações: y = 2,658 + 0,554X, para o araçazeiro; y = 0.75X ou y = 0,856X - 2,115, para a goiabeira serrana; y = 0.68X, para a uvalheira e y = 0,69X ou y = 0,503 + 0,643X, para a pitangueira, sendo X = comprimento x largura da folha.This work was carried out in order to study different laboratory and field methods for estimating leaf area of wild fruit species, belonging to the Myrtaceae: "uvalha" plant (Eugenia uvalha Camb., cattley guava plant (Psidium cattleyanum Sabine, feijoa plant (Feijoa sellowiana Berg and Surinam cherry plant (Eugenia uniflora DC. Among the laboratory' methods utilized as "standard methods", good results were obtained with the use of an automatic leaf area meter, planimeter or by the gravimetric method (photocopy or Whatman paper. Among field methods, best results were obtained with linear regression. The estimation of leaf area y for all studied species could be obtained through the equations: y = 2,658 + 0,554 x for cattley guava plant; y = 0,75 x or y = 0,856 x - 2,115 for feijoa plant; y = 0,68 x for "uvalha" plant and y = 0,69 x or y = 0,503 + 0,643 x for Surinam cherry plant, where x = leaf length x leaf width.

  2. La finalidad del presente artículo es establecer la fuerte vinculación que existe entre el conocimiento y los activos intangibles, siendo que estos son los grandes desconocidos en la valoración de las empresas y en el cálculo de las cuentas nacionales, en especial el PIB y la productividad. Fue el investigador Robert Solow, en 1956, uno de los primeros en señalar la importancia del conocimiento en el crecimiento económico, expresando que este es una función de capital, trabajo y conocimiento. Desde la década de 1990 viene creciendo la inquietud sobre la necesidad de analizar y medir los diferentes tipos de activos intangibles para incluirlos, con su justo valor, tanto en las cuentas nacionales como en los estados financieros de las empresas. Pero dichos activos tienen unas características muy especiales, las cuales hacen de su valoración monetaria una difícil tarea. Es impostergable profundizar su análisis y estudio para que no sigan siendo ignorados o minimizados en las prácticas cotidianas de las empresas y los mercados.

    Directory of Open Access Journals (Sweden)

    Leonidas Torres Citraro

    2014-12-01

    Full Text Available La finalidad del presente artículo es establecer la fuerte vinculación que existe entre el conocimiento y los activos intangibles, siendo que estos son los grandes desconocidos en la valoración de las empresas y en el cálculo de las cuentas nacionales, en especial el PIB y la productividad. Fue el investigador Robert Solow, en 1956, uno de los primeros en señalar la importancia del conocimiento en el crecimiento económico, expresando que este es una función de capital, trabajo y conocimiento. Desde la década de 1990 viene creciendo la inquietud sobre la necesidad de analizar y medir los diferentes tipos de activos intangibles para incluirlos, con su justo valor, tanto en las cuentas nacionales como en los estados financieros de las empresas. Pero dichos activos tienen unas características muy especiales, las cuales hacen de su valoración monetaria una difícil tarea. Es impostergable profundizar su análisis y estudio para que no sigan siendo ignorados o minimizados en las prácticas cotidianas de las empresas y los mercados.

  3. Peumus boldus (Monimiaceae, Magnoliopsida) una especie silvestre promisoria de Chile

    OpenAIRE

    San Martín Acebedo, José; Doll, Ursula

    1998-01-01

    Se organiza y sintetiza la información relacionada con la botánica, ecología y el contenido químico de extraíbles de hojas, corteza y madera de Peumus boldus (Monimiaceae, Magnoliopsida), árbol siempreverde, autóctono, endémico y termófilo de los bosques y matorrales esclerófilos naturales del área mediterránea de Chile. La popularidad y conocimiento de la especie tiene arraigo en la medicina popular empírica, dado el efecto farmacológico atribuible fundamentalmente, al alcaloide boldina, pre...

  4. Peumus boldus (Monimiaceae, Magnoliopsida) una especie silvestre promisoria de Chile

    OpenAIRE

    San Martín Acebedo, José; Doll, Ursula

    1998-01-01

    Se organiza y sintetiza la información relacionada con la botánica, ecología y el contenido químico de extraíbles de hojas, corteza y madera de Peumus boldus (Monimiaceae, Magnoliopsida), árbol siempreverde, autóctono, endémico y termófilo de los bosques y matorrales esclerófilos naturales del área mediterránea de Chile. La popularidad y conocimiento de la especie tiene arraigo en la medicina popular empírica, dado el efecto farmacológico atribuible fundamentalmente, al alcaloide boldina, pre...

  5. Novo transmissor silvestre do "Trypanosoma (Schizotrypanum cruzi" (Chagas, 1909

    Directory of Open Access Journals (Sweden)

    F. Nery Guimarães

    1943-06-01

    Full Text Available In nests of opossum (Didelphis aurita, localized in palm-trees of the species Attalea indaya Dr., the authors found a new tritatoma, the description of which is being made by Dr. H. LENT. They verified that this triatoma had been naturally infected by Trypanosoma (Schizotrhypanum cruzy. Two guinea-pigs were subsequently infected by peritoneal inoculation of excrements of this new triatoma. The xenodiagnosis of these guinea-pigs, made with normal nymphas of. T. megistus and T. infestans resulted positive after 25 days. Evidence was obtained of being the opossum (Didelphis one of the sources infection of the new vector, because several specimens of them were found infected, and also a specimen of D. aurita, which contained trypanosomes with the morphology of T. (S. cruzy in the peripheral blood.

  6. Diversidad y aspectos biológicos de abejas silvestres de un ambiente urbano y otro natural de la región central de Santa Fe, Argentina Diversity and biological aspects of wild bees in an urban and a natural environment in the central region of Santa Fe, Argentina

    Directory of Open Access Journals (Sweden)

    Milagros Dalmazzo

    2010-06-01

    Full Text Available El objetivo del presente trabajo fue relevar el elenco de abejas silvestres en la región central de Santa Fe y comparar la diversidad de especies y aspectos biológicos en dos ambientes de una misma región. Las abejas fueron colectadas en el estrato herbáceo de la Reserva Universitaria "Escuela Granja" de la localidad Esperanza, y en la zona urbana de la localidad Susana, ambas ubicadas dentro de la Provincia Fitogeográfica del Espinal. La colecta se realizó en octubre, noviembre y diciembre de 2004 y en enero, febrero y marzo de 2005, registrando las especies vegetales sobre las que se capturaron. Se colectaron 277 ejemplares en total, de los cuales se identificaron 62 especies (27 géneros en 5 familias. Las curvas de rarefacción indican una tasa de acumulación de especies mayor para la Reserva Ecológica, los índices de diversidad de Shannon son 3,25 para la Reserva Ecológica y 2,64 para la Zona Urbana. Para la comparación de las comunidades en ambos sitios, las abejas fueron clasificadas en tres categorías según la especialización en el uso del recurso floral, sustrato de nidificación y comportamiento social. Se observó una asociación entre los grupos especialistas y de nidificación en el suelo con el ambiente natural, y por otro lado, las especies generalistas y de nidificación en cavidades con el ambiente urbano. No se identificaron diferencias, en cuanto a la sociabilidad de las especies, entre ambos sitios.The purpose of this contribution is to present a survey of wild bees in the central region of Santa Fe, and to compare the diversity and biological aspects of the bee communities at two different environments of the same region. Bees were surveyed at the ecological reserve Reserva Universitaria "Escuela Granja" in the locality of Esperanza, and at an urban area in the locality of Susana, both in the Espinal Phytogeographic Province. Bees were sampled from October to December 2004 and from January to March 2005

  7. Roadkill of wild vertebrates along the GO-060 road between Goiânia and Iporá, Goiás State, Brazil = Atropelamento de vertebrados silvestres na rodovia GO-060 entre Goiânia e Iporá Estado de Goiás, Brasil

    Directory of Open Access Journals (Sweden)

    Hélida Ferreira da Cunha

    2010-07-01

    Full Text Available Roadkill of wild vertebrates along GO-060, Brazil. Roads represent an old and constant cause of accidental death of wildlife. From May 2004 to November 2005, we recorded the roadkills of vertebrates in the GO-060 road between Goiânia and Iporá. For each road-killed animal we wrote down the species and location along the road. We found 308 animals roadkilled from at least 25 vertebrate species: 86% mammals, 11% birds and 3% reptiles. Tamandua tetradactyla, Cerdocyon thous and Myrmecophaga tridactyla were, in decreasing order, the species withthe largest number of road-killed individuals. Among mammals, the number of road-killed individuals was not related to species weight. The number of species and road-killed animals was constant throughout the 17 months of the research. The average frequency of animal roadkills in the dry season (April to September is slightly higher than the frequency in the rainy season (October to March. The average frequency of species victim to accidents, however, is constantthroughout the dry and rainy seasons. The incidence of species and individuals of road-killed animals per 10 km was not influenced by the number of forest fragments along the sides of the road. We suggest that speed reducers could decrease the number of animals killed on the road. As rodovias representam uma antiga e constante causa de mortalidade acidental da fauna silvestre. Entre maio/2004 e novembro/2005, registramos os vertebrados atropelados às margens da rodovia GO-060, entre Goiânia e Iporá. Para cada animal atropelado anotamos a espécie e a localização ao longo da estrada. Foram registrados 308 animaisatropelados de pelo menos 25 espécies de vertebrados: 86% de mamíferos, 11% de aves e 3% de répteis. Tamandua tetradactyla, Cerdocyon thous e Myrmecophaga tridactyla foram em ordem decrescente as espécies com maior número de indivíduos atropelados. Entre os mamíferos, o número de animais atropelados não esteve relacionado a

  8. Efeito de extratos de plantas silvestres da família Solanaceae sobre o controle de Brevicoryne brassicae em couve (Brassica oleracea var. acephala Extracts effect of wild plants of the Solanaceae family on Brevicoryne brassicae control in cabbage (Brassica oleracea var. acephala

    Directory of Open Access Journals (Sweden)

    Patrícia Braga Lovatto

    2004-08-01

    Full Text Available O objetivo principal deste trabalho foi testar o efeito de extratos de plantas silvestres da família Solanaceae disponíveis na região do Vale do Rio Pardo, RS, sobre o pulgão-da-couve (Brevicoryne brassicae, praga agrícola de significativa importância. Nove espécies tóxicas de Solanaceae estão disponíveis na região de estudo: seis pertencem ao gênero Solanum, uma ao gênero Brugmansia e duas são cultivadas e pertencem ao gênero Nicotiana e Capsicum. A fim de determinar a capacidade de repelência e o efeito inseticida, foram testadas as seguintes espécies: B. suaveolens (trombeteira, C. annuum var. variegated (pimenta-de-jardim, N. tabacum var. virginia (fumo, S. aculeatissimum (joá-bravo, S. americanum (erva-moura, S. diflorum (tomatinho, S. fastigiatum var. acicularium (jurubeba, S. fastigiatum var. fastigiatum (jurubeba e S. sisymbriifolium (arrebenta-cavalo. Para obtenção dos extratos foram utilizadas folhas, flores e frutos aplicando-se duas técnicas distintas de elaboração: decocção do material fresco e extração a frio do material seco. Quanto à capacidade de repelência dos extratos, os tratamentos utilizando material fresco de S. fastigiatum var. acicularium (frutos verdes e maduros, 2,5% e 5% de concentração e S. diflorum (frutos verdes e maduros, 2,5% e 5% de concentração demonstraram maior eficácia. Nos testes sobre a biologia do inseto os tratamentos mais eficazes como inseticida foram S. fastigiatum var. fastigiatum e var. acicularium (folhas a 10% de concentração.The objective of this study was to test the effect of plant extracts from Solanaceae available in Vale do Rio Pardo region, RS, on the aphid Brevicoryne brassicae, agricultural pest of significant importance. Nine toxic Solanaceae species are available in the area of study: six are wild belonging to the genus Solanum, one to the genus Brugmansia, and two are cultivated and belong to the genus Nicotiana and Capsicum. To determine the

  9. Parámetros hematológicos de la comadreja overa, Didelphis albiventris (Lund, 1841, de poblaciones silvestres del centro de la Argentina Haematological parameters of the White-eared Opossum, Didelphis albiventris (Lund, 1841, wild populations of central Argentina

    Directory of Open Access Journals (Sweden)

    E.L. Tarragona

    2011-12-01

    Full Text Available El objetivo de este trabajo fue obtener parámetros hematológicos en poblaciones silvestres de comadreja overa Didelphis albiventris de la región centro de la Argentina. Se capturaron 39 individuos, a todos ellos se les realizó un recuento total y diferencial de células sanguíneas. Los valores promedio (± desvío estándar obtenidos fueron: eritrocitos 5,01 (±2,4 × 10(6µL-1; leucocitos 27.097 (±14.313 µL-1; neutrófilos 7.600 (±7.097 µL-1 (incluye inmaduros, 794 (±2.738 µL-1; linfocitos 13.110 (±7.541 µL-1; basófilos 1.218 (±1.441 µL-1; eosinófilos 1.983 (±2.458 µL-1; y monocitos 2.321 (±2.818 µL-1. La existencia de asociaciones entre estos parámetros y factores ambientales (estación y del animal (sexo y edad fue evaluada mediante regresión lineal multivariable. Se estableció que los neutrófilos estuvieron significativamente asociados a sexo (p=0.006. Los machos tenían la mitad de los niveles de neutrófilos que las hembras. Los eosinófilos estuvieron asociados a la estación. En verano hubo significativamente más eosinófilos que en invierno (p=0.042. En los extendidos sanguíneos se observaron alteraciones morfológicas de eritrocitos en aproximadamente 55% de las muestras analizadas, las más habituales fueron pilas en monedas y estomatocitos. También se visualizó un tipo celular no descripto anteriormente para esta especie, leucocito anular.The objective of this study was to assess haematological parameters in free-ranging white-bellied opossums (Didelphis albiventris in the central region of Argentina. Total and differential blood cell counts were conducted in thirty-nine captured individuals. The mean (± standard deviation values obtained were: erythrocytes 5.01 (±2.4 x 106µL-1, leukocytes: 27,097 (±14,313 µL-¹; neutrophils 7,600 (±7,097 µL-1 (including immature neutrophils: 794 (±2,738 µL-1; lymphocytes: 13,110 (±7,541 µL-1; basophils: 1,218 (±1,441 µL-1; eosinophils: 1,983 (±2,458 µL-1

  10. Evaluación de poblaciones segregantes producidas a partir de cruzamientos entre tomate cultivado y la accesión silvestre PI134418 de Solanum habrochaites var. glabratum resistente al pasador del fruto. Evaluation of segregating populations from crosses between cultivated tomato and PI134418 wild accession of Solanum habrochaites var. glabratum with resistance to the fruit borer.

    Directory of Open Access Journals (Sweden)

    Edwin F. Restrepo S.

    2008-01-01

    Full Text Available Se realizó la evaluación de poblaciones segregantes producidas a partir de cruzamientos entre tomate S. lycopersicum L. cv. maravilla y la accesión silvestre PI134418 de S. habrochaites var. glabratum resistente al pasador del fruto N. elegantalis. Se encontró que hay dominancia de los alelos que disminuyen la expresión del caraacute;cter peso promedio de fruto. El método del retrocruzamiento resultó maacute;s eficiente que el de la autofecundación, para contrarrestar la dominancia de los alelos que codifican por el tamaño pequeño del fruto. Los tricomas y el número promedio de frutos por racimo no ejercieron ningún efecto sobre el ataque de los frutos por parte del pasador; mientras que el peso promedio de fruto sí tuvo efecto importante sobre dicho ataque, de tal manera que el insecto tiende a producir mayor daño a medida que se incrementa el peso promedio de fruto. Las poblaciones RC1 y RC2 se comportaron como las típicas segregantes para los caracteres evaluados y exhibieron amplia variabilidad en los mismos. El método del retrocruzamiento fue efectivo para romper la asociación negativa entre el peso promedio de fruto y la resistencia al insecto. El peso promedio de algunos de los frutos en los recombinantes RC2 fluctuó entre 45.1 y 68.6 g y mostraron resistencia al pasador.Evaluation of segregating populations from crosses between cultivated tomato S. lycopersicum L. cv. maravilla and PI134418 wild accession of Solanum habrochaites var. glabratum with resistance to the fruit borer N. elegantalis was made. There was dominance of alleles that decrease the expression of the character mean fruit weight. The backcrossing method was more efficient than selfing in order to counteract the dominance of alleles that encode by small fruit size. The thrichomes and the mean number of fruit per bunch did not produce any effect on the fruit attack by the fruit borer; while that mean fruit weight had important effect on this attack

  11. Evaluation of segregating populations from crosses between cultivated tomato and PI134418 Evaluación de poblaciones segregantes producidas a partir de cruzamientos entre tomate cultivado y la accesión silvestre PI134418 de Solanum habrochaites var. glabratum resistente al pasador del fruto.

    Directory of Open Access Journals (Sweden)

    Vallejo Cabrera Franco Alirio

    2008-03-01

    Full Text Available Evaluation of segregating populations from crosses between cultivated tomato S. lycopersicum L. cv. maravilla and PI134418 wild accession of Solanum habrochaites var. glabratum with resistance to the fruit borer N. elegantalis was made. There was dominance of alleles that decrease theexpression of the character mean fruit weight. The backcrossing method was more efficient than selfing in order to counteract the dominance of alleles that encode by small fruit size. The thrichomes and the mean number of fruit per bunch did not produce any effect on the fruit attack by the fruit borer; while that mean fruit weight had important effect on this attack, therefore, the insect tends to produce more damage with the increasing in the mean fruit weight. The RC1 and RC2 populations showed segregating typical behavior for evaluated characters, presenting high variability in all of them. The backcrossing method was effective to break the negative association between mean fruit weight and the resistance to the insect. The mean fruit weight in the RC2 recombinant was between 45.1 and 68.6 g and showed resistance to the fruit borer.

    Se realizó la evaluación de poblaciones segregantes producidas a partir de cruzamientos entre tomate S. lycopersicum L. cv. maravilla y la accesión silvestre PI134418 de S. habrochaites var. glabratum resistente al pasador del fruto N. elegantalis. Se encontró que hay dominancia de los alelos que disminuyen la expresión del carácter peso promedio de fruto. El método del retrocruzamiento resultó más eficiente que el de la autofecundación, para contrarrestar la dominancia de los alelos que codifican por el tamaño peque

  12. OPTIMIZACIÓN DEL RENDIMIENTO Y CONTENIDO DE TIMOL DE ACEITE ESENCIAL DE ORÉGANO SILVESTRE OBTENIDO POR ARRASTRE CON VAPOR OPTIMIZAÇÃO DO RENDIMENTO E CONTEÚDO DE TIMOL DO ÓLEO ESSENCIAL DO ORÉGANO SELVAGEM OBTIDO POR ARRASTRE À VAPOR OPTIMIZATION OF YIELD AND THYMOL CONTENT OF WILD OREGANO ESSENTIAL OIL OBTAINED BY STEAM DISTILLATION PROCESS

    Directory of Open Access Journals (Sweden)

    OSCAR ARANGO B

    2012-12-01

    Full Text Available Se estudió el proceso de extracción por arrastre con vapor a escala de planta piloto del aceite esencial de orégano silvestre (Lippia origanoides H.B.K de la región del Alto Patía (Colombia utilizando la metodología de superficie de respuesta. Los factores estudiados fueron el tiempo de extracción (1-3 horas, la densidad del lecho (60-100 g/L y la presión de extracción (1-3 psi. Las variables de respuesta fueron el rendimiento de extracción y el contenido de timol del aceite esencial. La composición de los aceites esenciales fue determinada mediante cromatografía de gases. Con respecto al rendimiento se obtuvo que solamente la densidad del lecho presentó un efecto estadísticamente significativo (PO processo de extração do óleo essencial de orégano silvestre (Lippia origanoides H.B.K por arraste a vapor foi estudado a escala piloto na região do Alto Patía (Colômbia, utilizando a metodologia de superfície resposta. Os fatores estudados foram o tempo de extração (1-3 horas, a densidade do leito (60-100 g/L e a pressão de extração (1-3 psi. As variáveis de resposta foram: o rendimento da extração e o conteúdo de timol do óleo essencial. A composição dos óleos essenciais foi determinada mediante cromatografia de gases. Com respeito ao rendimento, foi obtido que somente a densidade do leito apresentou um efeito estatisticamente significativo (PThe extraction process by steam distillation on pilot plant of essential oil from wild oregano (Lippia origanoides H.B.K from Alto Patía region (Colombia was studied using surface response methodology. Factors studied were the extraction time (1-3 hours, the density of the bed (60-100 g/L and the extraction pressure (1-3 psi. The response variables were the extraction yield and the content of thymol in the essential oil. The composition of essential oils was determined by gas chromatography. Regarding yield only the bed density presented a statistically significant effect (P

  13. Contenido de alimento y metabolismo ceco-cólico en el tracto digestivo de poblaciones silvestres de iguana negra (Ctenosaura pectinata en Morelos, México Cecum-colic content of food and metabolism in the digestive tract of wild population black lizard (Ctenosaura pectinata in Morelos, Mexico

    Directory of Open Access Journals (Sweden)

    L Vélez-Hernández

    2012-01-01

    Full Text Available Se colectaron cinco tractos digestivos de iguana negra (Ctenosaura pectinata en estado silvestre en el estado de Morelos, México, para conocer la composición botánica de la dieta y el metabolismo ceco-cólico. Se observaron frotis realizados del contenido ceco-cólico para registrar la presencia de protozoarios, bacterias y parásitos intestinales existentes. Se obtuvo la media y desviación estándar de las características evaluadas. En el contenido ceco-cólico se identificaron las especies vegetales guamúchil (Phitecellobium dulce y huizache (Acacia farnesiana. Se estimó en base a materia seca la porción vegetal que conforma la dieta, la cual se distribuyó en frutos (62,9%, hojas (30,6%, rebrotes (2,9% y flores (3,5%. La región ceco-cólica se caracterizó por la concentración (mmol de los ácidos grasos acético (68,9 ± 10,6, butírico (11,98 ± 5,7, propiónico (9,04 ± 1,5 y total (89,9 ± 15, con pH de 7,45 y concentración de nitrógeno amoniacal (7,4 ± 2,8 mg/dl. La microbiota que se observó fue el protozoario Nyctotherus spp. Las bacterias totales oscilaron en concentraciones 7 x 10 a 9 x 10/g, siendo las celulolíticas de 9,2 x 10 hasta 3,5 x 10/g de contenido cecal. Los parásitos encontrados son nematodos identificados como miembros de la superfamilia Oxyuroidea con 655 ± 265/g huevos y 6,300 ± 329 adultos/iguana. Se concluye que la fermentación de la región ceco-cólica de la iguana negra en estado adulto se comporta de manera similar como en las especies herbívoras, en las cuales la fermentación se manifiesta de acuerdo con el alimento consumido. La concentración dietaria de proteína cruda fue de 14,5% y energía de 2,193 Mcal/kg y son animales parasitados con oxiuros.Five digestive tracts of black lizards (Ctenosaura pectinata from a wild population were collected in Morelos State, México, in order to identify the plant composition in the diet and the cecum-colic metabolism. Smears obtained from cecum

  14. PREVALÊNCIA DE ENDOPARASITAS EM AMOSTRAS FECAIS DE AVES SILVESTRES E EXÓTICAS EXAMINADAS NO LABORATÓRIO DE ORNITOPATOLOGIA E NO LABORATÓRIO DE ENFERMIDADES PARASITÁRIAS DA FMVZ-UNESP/BOTUCATU-SP PREVALENCE OF ENDOPARASITES IN FECAL SAMPLES OF EXOTIC AND WILD BIRDS EXAMINED IN THE LABORATORY OF ORNITOPATOLOGY AND LABORATORY OF PARASITICS DISEASES OF THE FMVZ – UNESP/BOTUCATU, SP

    Directory of Open Access Journals (Sweden)

    Raimundo de Souza Lopes

    2009-04-01

    Full Text Available Dos vários problemas sanitários que afetam as aves, as enfermidades parasitárias estão entre as mais frequentes. Analisou-se no presente trabalho a prevalência de endoparasitas das 207 amostras fecais de aves silvestres e exóticas atendidas no Laboratório de Ornitopatologia e no Laboratório de Enfermidades Parasitárias do Hospital Veterinário da Faculdade de Medicina Veterinária e Zootecnia da Universidade Estadual Paulista (FMVZ-UNESP, campus de Botucatu, SP. As amostras foram inicialmente analisadas através do exame direto a fresco e, após a constatação da presença de ovos, cistos ou oocistos nas fezes, as mesmas amostras foram submetidas à Técnica de Faust e ao Método de Willis.  No estudo encontraram-se ovos de três gêneros de nematoídes e cistos de quatro gêneros de protozoários em cinco de doze ordens aviárias, sendo Passeriformes a que apresentou o maior número de indivíduos parasitados.

    PALAVRAS-CHAVES: Aves, ornitopatologia, parasitologia. Among the various sanitary problems affecting birds, parasitic diseases are some of the most common ones. This study analyses the prevalence of endoparasites in 20 fecal samples of wild and exotic birds attended at the Ornitopathology and Parasitic Diseases Laboratories of the Veterinary Hospital, Faculty of Veterinary Medicine and Zootecnics, São Paulo State University (FMVZ-UNESP, campus Botucatu. After confirmation of eggs, cysts or oocysts through direct fecal test, Faust technique and Willis Method were performed on feces. Eggs of three genera of nematodes as well as cysts of four genera of protozoaries were found in five of 12 avian orders, with the order Passeriformes representing the most of the parasited individuals.

    KEY WORDS: Birds, ornitopathology, parasitology.

  15. Caracterización fenotípica de Bordetella pertussis creciendo en biofilm : Desde la proteómica al reconocimiento molecular de factores de virulencia

    OpenAIRE

    Arnal, Laura

    2014-01-01

    En este trabajo de tesis doctoral y bajo la hipótesis de la utilización por parte la bacteria de Bordetella pertussis del desarrollo en biofilm como un posible mecanismo de persistencia en el hospedador se evaluó la capacidad de formación de biofilm por parte de aislados clínicos de Bordetella pertussis obtenidos de pacientes infectados y tratados en el Hospital Sor María Ludovica de la ciudad de La Plata. Todos los aislados clínicos estudiados, incluyendo cepas aisladas entre los años 2001 y...

  16. Risk factors for diarrhea in a cohort of dairy heifer calves reared in individual outdoor hutches in Piraí, Rio de Janeiro, Brazil

    National Research Council Canada - National Science Library

    Thais Ferreira Fagundes; Letícia Gabriela Poblete Vidal; Pedro Afonso Moreira Alves; Wagner de Souza Tassinari; Rita de Cássia Alves Alcântara de Menezes; Adevair Henrique da Fonseca; Maria Julia Salim Pereira

    2016-01-01

    This study aimed to evaluate the association between diarrhea and risk factors potentially related to diarrhea incidence, such as Cryptosporidium, Giardia, Eimeria and nematode infection, animal age...

  17. Chlorofluorocarbons (CFC's): Regulation and replacement. (Latest citations from the PIRA Ppackaging, Paper, Printing, and Publishing, and Nonwovens abstracts database). Published Search

    Energy Technology Data Exchange (ETDEWEB)

    1993-11-01

    The bibliography contains citations concerning chlorofluorocarbons (CFC's), and efforts to find substitute materials in response to the need to lessen the environmental impact of CFC on the ozone layer, as agreed to in the international Montreal Protocol. CFC alternatives are expected to be used as aerosol propellants, blowing agents, refrigerants, fire extinguishants, and solvents. References to the effects of CFC on ozone are found in separate bibliographies. (Contains 250 citations and includes a subject term index and title list.)

  18. “Sou caipira pira pora...”: representations of the provincial, from the parasite of the land to the paradigm of national reality (1889-1945“Sou caipira pira pora...”: representações sobre o caboclo, do parasita da terra a paradigma da realidade nacional (1889-1945

    Directory of Open Access Journals (Sweden)

    Jonathan de Oliveira Molar

    2009-04-01

    Full Text Available This paper is aimed at discussing the representations about the hillbilly, the national peasant based on visions of two intellectuals: writer Monteiro Lobato and painter José Ferraz de Almeida Jr. Therefore, both literature and iconographic sources will support an analysis of the living standards of the rustic, as found in the historical period covered – 1889 until 1945. Contributions from authors who work with image analysis will be used as method, such as Henry Silva’s and Ana M. Mauad’s, and authors who work with the said period and the provincial issue: Lilia Schwarcz, Glauco Barsalini and Antonio Candido. O presente trabalho se propõe a discutir as representações elaboradas acerca do caboclo, do caipira nacional a partir das visões de dois intelectuais: o escritor Monteiro Lobato e o pintor José Ferraz de Almeida Júnior. Desse modo, analisar tanto na literatura quanto no conjunto iconográfico o ir e vir que perpassa as considerações sobre o modo de vida do caboclo, de acordo com o período histórico abordado – de 1889 até 1945. Para tanto, utiliza-se de autores que trabalham com análise de imagens, tais como: Henrique Silva e Ana M. Mauad; e, autores que trabalham com o citado período e a questão cabocla: Lilia Schwarcz, Glauco Barsaline e Antônio Cândido.

  19. Bacterias diazotroficas aisladas de arroz silvestre Oryza glumaepatula en la Amazonia brasilena

    National Research Council Canada - National Science Library

    Ivan Fernandes, Paulo, Jr; Duarte Pereira, Gilmara Maria; Perin, Liamara; Mesquita da Silva, Luana; Cardoso Barauna, Alexandre; Muniz Alves, Francilene; Ribeiro Passos, Samuel; Edson Zilli, Jerri

    2013-01-01

    ... de O. glumepatula fueron recolectadas en cinco zonas boscosas y siete en Cerrado. Las plantas de Cerrado fueron recolectadas en septiembre 2008, mientras que las del bosque en Junio 2008 y Abril 2009...

  20. Análisis químico de antocianinas en frutos silvestres colombianos

    OpenAIRE

    Santacruz Cifuentes, Liliana Andrea

    2011-01-01

    En este estudio se realizó el análisis químico y cuantificación de pigmentos antocianicos en cuatro frutas tropicales colombianas: uva de árbol (Myrciaria aff cauliflora (Mart.)D.Bery), coral (Hyeronima macrocarpa Mull.Arg), mora pequeña (Rubus megalococcus Focke) y motilón (Hyeronima sp), por cromatografía líquida acoplada a espectrometría de masas con interfase electrospray (LC/MS-ESI) y LC-UV-Vis, respectivamente. / Abstract. This study was carried out chemical analysis and quantification ...

  1. Evaluación de la actividad antihipertensiva de nutraceuticos de fresa silvestre y comercial

    OpenAIRE

    Chávez Ramos, Ma. Guadalupe

    2013-01-01

    La fresa es una frutilla que contiene compuestos nutracéuticos tales como: compuestos fenólicos, flavonoides y antocianinas, los cuales presentan una gran gama de actividades biológicas, incluyendo la actividad antioxidante, anticancerígena, antiinflamatoria, antihipertensiva, entre otras. Recientemente se ha reportado que la capacidad antioxidante de los compuestos nutracéuticos de diferentes bayas puede estar involucrada en la reducción de la presión arterial. La hipertensión...

  2. Relación del Virus del Oeste del Nilo con las Aves Silvestres

    OpenAIRE

    Diego Soler-Tovar; Victor J Vera

    2009-01-01

    El Virus del Oeste del Nilo (VON) es un Flavivirus que produce una encefalomielitis y puede afectar aves y mamíferos; los efectos varían desde poco notorios hasta la muerte, y en su difusión es importante la participación de especies animales como las aves donde es transmitido a través de mosquitos vectores. El VON se conoce de Uganda desde 1937 y está ampliamente distribuido en África, el oriente y la región sur y tropical de Eurasia. En el Hemisferio Occidental, el VON fue la primera causa ...

  3. Plantas silvestres utiles y prioritarias identificadas en La Mixteca Poblana, Mexico

    National Research Council Canada - National Science Library

    Martinez-Perez, Aniceto; Lopez, Pedro Antonio; Gil-Munoz, Abel; Cuevas-Sanchez, Jesus Axayacatl

    2012-01-01

    ... del conocimiento tradicional local. El objetivo de este trabajo fue contribuir a la elaboracion de un inventario de plantas utiles y, mediante valoracion socioeconomica y ecologica, determinar prioridades de conservacion en la Mixteca Poblana, Mexico...

  4. COMPOSICIÓN ELEMENTAL DE ALGUNAS ESPECIES DE PLANTAS SILVESTRES MEXICANAS

    Directory of Open Access Journals (Sweden)

    J. C. Raya Pérez

    2009-01-01

    Full Text Available El conocer la composición elemental de las plantas puede ser útil desde varios puntos de vista, como el saber sus necesidades nutricionales y tener una idea del tipo de mantillo que se podría formar en un momento dado. En el caso específico del silicio, las plantas que lo acumulan pueden formar fitolitos, muy útiles en paleoecología y arqueología. Se recolectaron especies de plantas de varias partes del centro-occidente de México y se determinó su composición elemental mediante sonda dispersiva de rayos X acoplada a un microscopio electrónico de barrido. Las plantas semiparásitas (plantas que fotosintetizan pero que toman sus nutrientes de la planta que parasitan acumulan cantidades considerables de iones como potasio y cloro para usarlos como osmolitos. Tillandsia recurvata, a pesar de ser epífita, acumula una buena cantidad de silicio, lo mismo que Cyperus sp., registrada como acumuladora de este elemento. Otras especies como Tagetes micrantha, de uso en la cocina mexicana, podrían contribuir en alguna medida al aporte de micronutrientes como potasio y magnesio.

  5. Evaluación de la actividad antihipertensiva de nutraceuticos de fresa silvestre y comercial

    OpenAIRE

    Chávez Ramos, Ma. Guadalupe

    2013-01-01

    La fresa es una frutilla que contiene compuestos nutracéuticos tales como: compuestos fenólicos, flavonoides y antocianinas, los cuales presentan una gran gama de actividades biológicas, incluyendo la actividad antioxidante, anticancerígena, antiinflamatoria, antihipertensiva, entre otras. Recientemente se ha reportado que la capacidad antioxidante de los compuestos nutracéuticos de diferentes bayas puede estar involucrada en la reducción de la presión arterial. La hipertensión...

  6. Caracterización morfológica de accesiones silvestres de guayaba

    National Research Council Canada - National Science Library

    Liliana Jiménez Lozano; Martha Isabel Almanza Pinzón; Jaime Eduardo Muñoz Flórez

    2009-01-01

    .... 14 colectadas en el municipio de Restrepo (Valle del Cauca), seis en Armenia (Quindío) y dos en Pereira (Risaralda). Se utilizaron 12 descriptores cuantitativos y 10 cualitativos de tallo, hojas y frutos...

  7. Notas preliminares sobre hábitos alimenticios de palomas silvestres colombianas

    OpenAIRE

    Borrero H., José Ignacio

    2012-01-01

    El factor alimento es posiblemente la causa de que algunas aves tropicales emigren regionalmente en mayor o menor escala y con cierta regularidad.  Los investigadores que se han ocupado de ellas han hecho estudios principalmente de índole taxonómica. Por consiguiente, son pocos  los datos consignados en la literatura zoológica respecto a migración o hábitos alimenticios. El constante estudio de las aves colombianas me ha llevado a concluir que las aves tropicales son generalmente sedentarias;...

  8. Ciutat de Mallorca, 31 de desembre del 1229: Sant Silvestre, Sant Jordi i Jaume I

    Directory of Open Access Journals (Sweden)

    Xavier Renedo Puig

    2014-07-01

    The words that the king employs when relating the possible miraculous intervention of Saint George in that episode have been interpreted as a sample of the prudence of the monarch in inserting wonderful elements in his chronicle. This article proposes a different interpretation of the passage, while taking into account several chronistic sources that aim towards a revision of the role that the Crusade plays in the imaginary world of king James the First.

  9. Paracoccidioidomycosis in wild and domestic animals/ Paracoccidiodomicose em animais silvestres e domésticos

    Directory of Open Access Journals (Sweden)

    Mario Augusto Ono

    2006-06-01

    Full Text Available Paracoccidiodomycosis is the most prevalent systemic mycosis in Latin América, mainly in Brazil. Although many studies have been done about the pathology and diagnosis of this mycosis little is known about the eco-epidemiology of the etiological agent Paracoccidioides brasiliensis. The fungus habitat also is unknown although is thought that the fungus lives as a saprobe in soil. The participation of other animal species in P. brasiliensis ecology is poorly understood and fungus isolation from animals as bat and penguin were not reproducible. The armadillos Dasypus novencinctus probably play a role in the fungus eco-epidemiology taking into account that several isolates were obtained from these animals. Seroepidemiologic studies have shown that dogs are infected by P. brasiliensis mainly in rural areas and recently was reported the first case o natural paracoccidioidomycosis in dogs. The role of other animal species in the eco-epidemiology of P. brasiliensis remains doubtful.A paracoccidioidomicose é a micose sistêmica mais prevalente na América Latina, principalmente no Brasil. Apesar de existirem vários estudos sobre o diagnóstico e patologia dessa micose, pouco se conhece sobre a ecologia do agente etiológico Paracoccidioides brasiliensis. Seu habitat ainda não foi determinado, mas provavelmente o fungo vive saprofiticamente no solo. Há também pouca informação quanto a participação de outras espécies de animais na eco-epidemiologia do fungo e os isolamentos obtidos de animais como morcego e pingüim não foram reprodutíveis. Até o presente, o fungo tem sido isolado com maior freqüência do tatu, Dasypus novencinctus. Estudos soroepidemiológicos demonstraram que a infecção é freqüente em cães, principalmente da área rural e recentemente foi relatado o primeiro caso de paracoccidiodomicose natural em cão. O papel de outras espécies de animais na eco-epidemiologia do fungo ainda não está esclarecido.

  10. Surveillance of arbovirus infections in the atlantic forest region, State of São Paulo, Brazil: I. detection of hemagglutination-inhibition antibodies in wild birds between 1978 and 1990 Vigilância de infecções por arbovírus na Região da Mata Atlântica, Estado de São Paulo, Brasil.: I. Detecção de anticorpos inibidores de hemaglutinação em aves silvestres entre 1978 e 1990

    Directory of Open Access Journals (Sweden)

    Ivani B. Ferreira

    1994-06-01

    Full Text Available We report data related to arbovirus antibodies detected in wild birds periodically captured from January 1978 to December 1990 in the counties of Salesópolis (Casa Grande Station, Itapetininga and Ribeira Valley, considering the different capture environments. Plasmas were examined using hemagglutination-inhibition (HI tests. Only monotypic reactions were considered, except for two heterotypic reactions in which a significant difference in titer was observed for a determined virus of the same antigenic group. Among a total of 39,911 birds, 269 birds (0.7% belonging to 66 species and 22 families were found to have a monotypic reaction for Eastern equine encephalitis (EEE, Venezuelan equine encephalitis (VEE, Western equine encephalitis (WEE, Ilheus (ILH, Rocio (ROC, St. Louis encephalitis (SLE, SP An 71686, or Caraparu (CAR viruses. Analysis of the data provided information of epidemiologic interest with respect to these agents. Birds with positive serology were distributed among different habitats, with a predominance of unforested habitats. The greatest diversity of positive reactions was observed among species which concentrate in culture fields.Apresentam-se os resultados referentes a anticorpos para arbovírus em aves silvestres capturadas, periodicamente, de janeiro de 1978 a dezembro de 1990, nos municípios de Salesópolis (Estação de Casa Grande; Itapetininga e municípios do Vale do Ribeira, considerando-se os diferentes ambientes de captura. Plasmas foram examinados, por testes de Inibição de Hemaglutinação (IH. Considerou-se apenas as reações monotípicas, com exceção de duas reações heterotípicas, onde ocorreu uma diferença de título significativa para um determinado vírus de um mesmo grupo antigênico. Em um total de 39.911 aves, foram encontradas 269 aves pertencentes a 66 espécies e 22 famílias, com reação monotípica para os vírus Encefalite Equina do Leste (EEE, Encefalite Equina Venezuelana (VEE

  11. Pesquisa de anticorpos contra Leptospira spp. em animais silvestres e em estado feral da região de Nhecolândia, Mato Grosso do Sul, Brasil: utilização da técnica de imuno-histoquímica para detecção do agente Investigation of antibodies to Leptospira spp. in wild and feral animals from the region of Nhecolândia, Mato Grosso do Sul, Brazil: use of the immunohistochemistry technique for the agent detection

    Directory of Open Access Journals (Sweden)

    Raul José Silva Girio

    2004-02-01

    Full Text Available Foram examinadas 315 amostras de soros sangüíneos de diversas espécies de animais que vivem em estado feral ou silvestre na região de Nhecolândia, Corumbá, MS, por meio da prova de soroaglutinação microscópica para leptospirose. Dessas amostras, 67 foram de bois baguás (Bos taurus indicus, 39 de porcos-monteiros (Sus scrofa, 39 de búfalos (Bubalus bubalis, nove de quatis (Nasua nasua, 41 de veados-campeiros (Ozotoceros bezoarticus, 10 de veados-mateiros (Mazama americana e 110 amostras de ovinos (Ovis aries. Em 12 animais que vieram a óbito, seis porcos-monteiros, quatro veados-campeiros e dois ovinos, foram realizadas tentativas de isolamento de Leptospira do fígado e dos rins por cultura em meio semi-sólido. Fragmentos desses órgãos foram submetidos a exame histopatológico e também a exame para detecção das Leptospiras pela técnica de imuno-histoquímica. Os resultados dos exames sorológicos mostraram que 64 (20,3% das amostras foram reagentes para, pelo menos, um sorovar de Leptospira patogênica; foram reagentes 41,0% das amostras de búfalos, 40,3% das de bois baguás, 17,9% das de porcos-monteiros, 9% das de ovinos e 9,7% das amostras de veados-campeiros; nenhuma das amostras de veados-mateiros e de quatis foi reagente. Os sorovares mais freqüentes foram: pomona, para búfalos e ovinos; icterohaemorrhagiae, para ovinos, veados-campeiros e suínos; e copenhageni, para veados-campeiros e suínos. As tentativas de isolamento dos rins e fígados foram todas negativas, e pela técnica da imuno-histoquímica foi detectada Leptospira no fígado de um porco-monteiro. As principais alterações estruturais, encontradas nos rins de dois veados-campeiros e de um porco-monteiro, foram infiltrado inflamatório intersticial com congestão associada a hemorragias.Three hundred and fifteen serum samples of several animal species living in wild or in feral state in the area of Nhecolândia, Corumbá, MS, Brazil, were examined by the

  12. Aislamiento e identificación de patógenos de la estirpe silvestre del ajo (Allium sativum L.

    Directory of Open Access Journals (Sweden)

    Karina Astorga-Quirós

    2014-02-01

    Full Text Available El cultivo del ajo (Allium sativum L. en Costa Rica se podría convertir en una alternativa rentable para la producción y diversificación de los agricultores de hortalizas. Sin embargo, el tipo de reproducción vegetativa que presenta facilita la transmisión y diseminación de enfermedades, lo que provoca un debilitamiento progresivo de los bulbos. Actualmente, se buscan alternativas de manejo diferentes al control químico, para disminuir el impacto ecológico y ambiental de los patógenos que lo afectan. El control biológico es una de ellas, pero presenta dificultades para el aislamiento y la identificación certera de patógenos asociados a pudriciones que se dan en el suelo. Por lo anterior, el objetivo general de esta investigación consistió en aislar e identificar a nivel de especie cepas de Pseudomonas marginalis, Penicillium sp. y Sclerotium cepivorum a partir de material vegetativo de ajo en campo, para su utilización en futuros trabajos de control biológico de estas enfermedades. La metodología seguida permitió aislar e identificar con un alto porcentaje de certeza a P. marginalis, así como obtener cultivos monospóricos de Penicillium sp. y cultivos puros de S. cepivorum. Las técnicas descritas constituyen la base para futuros trabajos relacionados con las fitopatologías en el cultivo del ajo.

  13. Enzimología de formas silvestres y mutantes de glutamina sintetasa eucariotas sobreexpresadas en escherichia coli

    OpenAIRE

    Betti, Marco

    2005-01-01

    En este trabajo nos hemos propuesto abordar nuevos estudios de estructura-función de la GS eucariota (tipo II) haciendo uso de sistemas de expresión heteróloga que pudiesen permitir la obtención de grandes cantidades para isoformas citosólicas e plasticid

  14. Morangos silvestres: sob a luz dos devaneios poéticos da Casa Onírica Bachelardiana

    Directory of Open Access Journals (Sweden)

    Ana Paula Martins Gouveia

    1999-03-01

    Full Text Available The goal of this article is a reading of the film Smultronstállet by Ingmar Bergman based on the concept of phenomenology discussed by Gaston Bachelard in his book La Poétique de I'Espace.

  15. Myxomycetes de Sonora, México. II: Reserva Forestal Nacional y Refugio de Fauna Silvestre Ajos-Bavispe

    OpenAIRE

    Gabriel Moreno; Marcos Lizárraga; Martín Esqueda; Evangelina Pérez-Silva; Teófilo Herrera

    2006-01-01

    Se estudiaron 26 especies de Myxomycetes de Sonora en México, siendo 23 nuevos registros para la mixobiota del estado, a saber, Comatricha laxa, C. pulchella, Craterium paraguayense, Cribraria violacea, Dictydiaethalium plumbeum, Didymium clavus, D. megalosporum, D. squamulosum, Echinostelium minutum, Enerthenema papillatum, Licea biforis, L. kleistobolus, Macbrideola decapillata, M. synsporos, Mucilago crustacea, Paradiacheopsis fimbriata, Perichaena chrysosperma, P. syncarpon, P. vermicular...

  16. Tropos del viaje a la naturaleza silvestre en "El mal de la taiga (2012)" de Cristina Rivera Garza

    OpenAIRE

    Walczak, Grażyna

    2015-01-01

    En este artículo se analizan los tropos del viaje a la naturaleza virgen en la novela breve de Cristina Rivera Garza, El mal de la taiga (2012). Utilizados previamente por otros escritores, tales como José Eustasio Rivera, Rómulo Gallegos o Alejo Carpentier, los motivos del periplo se desplazan y se transforman, permitiendo a la autora expresar preocupaciones que atañen al ser humano universal: el individuo ante la naturaleza desconocida que abarca tanto el espacio geográfico, como el cuerpo ...

  17. Ecologia molecular de fungos patogênicos onygenales em animais silvestres do interior do estado de São Paulo

    OpenAIRE

    Pereira, Vírginia Bodelão Richini [UNESP

    2009-01-01

    A Paracoccidioidomicose (PCM) é uma micose sistêmica e a de maior ocorrência na América Latina, causada pelo fungo Paracoccidioides brasiliensis. Apesar dos esforços contínuos de diversos grupos de pesquisa principalmente do Brasil, Colômbia Venezuela e Argentina, a fase ambiental produtora de propágulos infectantes, seu nicho ecológico e outros aspectos fundamentais da biologia deste patógeno ainda representa um enigma. Sabe-se, no entanto, que há alguns indicadores biológicos onde se consta...

  18. PirAB toxin from Photorhabdus asymbiotica as a larvicide against dengue vectors.

    Science.gov (United States)

    Ahantarig, Arunee; Chantawat, Nantarat; Waterfield, Nicholas R; ffrench-Constant, Richard; Kittayapong, Pattamaporn

    2009-07-01

    We have evaluated Photorhabdus insect-related protein (Pir) from Photorhabdus asymbiotica against dengue vectors. PirAB shows larvicidal activity against both Aedes aegypti and Aedes albopictus larvae but did not affect the Mesocyclops thermocyclopoides predator. PirAB expressed the strongest toxicity compared to PirA, PirB, or the mixture of PirA plus PirB. Whether the presence of an enterobacterial repetitive intergenic consensus sequence in PirAB, but not in PirA, PirB, or the mixture of PirA plus PirB, has any impact on biological control efficacy needs further investigation.

  19. Protein (Cyanobacteria): 249773 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09782242.1 1117:4644 1150:2740 35823:86 376219:14 transposase (fragment) Arthros...pira sp. PCC 8005 MAQLWDDDISPRTISRALKKIGFTRKKTYGYQERWKQQREEFMAQIEQMEPEGLVYLDEAGMNSQDSDYPYGYCQEGQRFGALKSGKRQG

  20. Protein (Cyanobacteria): 249820 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09780023.1 1117:4644 1150:2740 35823:86 376219:14 transposase (fragment) Arthros...pira sp. PCC 8005 MAELWDDDISPRTISRALKKIGFTRKKTYGYQERWKQQREELIAQIEQMEPEGLVYLDEAGMNSSDSDYPYGYCEEGTTLPMPSNQGRGKGRGELYGPRGLNNNFLTPL ...

  1. Protein (Cyanobacteria): 249770 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09782144.1 1117:4644 1150:2740 35823:86 376219:14 transposase (fragment) Arthros...pira sp. PCC 8005 MAELWDDDISPRTISRALKKIGFTRKKTYGYQERWKQQREEFMAQIEQMEPQEVVYLDEAGMNSQDSDYPYGYCEEGKRFHALKSGKRQG

  2. Protein (Cyanobacteria): 249781 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09781797.1 1117:4644 1150:2740 35823:86 376219:14 transposase (fragment) Arthros...pira sp. PCC 8005 MKKIGFTRKKTYGYQERDEQQREEFMAQIEQMEPQEVVYLDEAGMNSQDSDYPYGYCEEGKRFHALKSGKRQGRVSMIAAWCHQQLLAPF

  3. Protein (Cyanobacteria): 144862 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ded protein LtrA-like (Includes: Reverse-transcriptase ; RNA maturase ; HNH endonuclease) (fragment) Arthros...pira sp. PCC 8005 MNLSRILRETSKQNHYDGCGFQNPAGMKKAGMGIPTIQDRAKQALVKSALEPEWESRFEGTSYGFRPGRSAQDAIARIYLCINHSDYYVLDADIACETFRSEIGLQCLK ...

  4. Protein (Cyanobacteria): 249776 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09783561.1 1117:4644 1150:2740 35823:86 376219:14 transposase (fragment) Arthros...pira sp. PCC 8005 MKKIGFTRKKTYGYQERWKQQREEFIAQIEQMEPEGLVYLDEAGMNSQDSDYPYGYCEEGKRFHALKSGKRQGRVSYMAPWCDQQLLAPF

  5. Protein (Cyanobacteria): 144863 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ded protein LtrA-like (Includes: Reverse-transcriptase ; RNA maturase ; HNH endonuclease) (fragment) Arthros...pira sp. PCC 8005 MNWLRALREISKPNHCDGCGFQNLEGMKKAGMGIPTIQDRARQALVKSALEPEWESRFEGTSYGFRPGRSAQDAIARIYSSINKGEYFVLDAGARRSGMK ...

  6. Protein (Cyanobacteria): 249772 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09781578.1 1117:4644 1150:2740 35823:86 376219:14 transposase (fragment) Arthros...pira sp. PCC 8005 MAELWDDDISPRTISRALKKIGFTRKKTYGYQERWKQQREEFMAQIEQMEPQEVVYLDEAGMNSQDSDYPYGYCEEGKRFHALKSGKRQG

  7. Análisis de la construcción de un aula con incorporación de materiales reciclados en la Escuela de Gestión Social Creciendo Juntos en Paso del Rey, Moreno, pcia. de Buenos Aires

    OpenAIRE

    Rossi, Silvia

    2016-01-01

    Dentro del ámbito del desarrollo sostenible, antes de comenzar cualquier diseño deben considerarse tres aspectos fundamentales: el social, el económico y el ambiental. Como bien se conoce, la actividad de la Construcción es responsable de una gran parte del mal uso de recursos naturales y los arquitectos tienen una responsabilidad ambiental y social en la reducción de la huella de carbono y ecológica. En este contexto se presenta el proyecto y la vinculación con la escuela de Autogestión Crec...

  8. Field Insect Pests and Crop Damage Assessment of Pigeon Pea (Cajanus cajan [L.] Huth grown under Ratoon and in Mixture with Maize Evaluación de Campo de Insectos Pestes y Daño del cultivo de Gandul (Cajanus cajan [L.] Huth creciendo bajo Rebrotes o en Mezcla con Maíz

    Directory of Open Access Journals (Sweden)

    Madang A Dasbak

    2012-03-01

    Full Text Available The widespread adoption of cropping systems that are sustainable and environmentally friendly is vital for the macroeconomic survival of civilization. Intercropping could ensure stability of insect populations in a system. A 3-yr (2005-2007 field trial was therefore carried out in Nigeria under regular and ratoon crops to evaluate five recently developed pigeon pea (Cajanus cajan [L.] Huth genotypes (ICPL 87, ICPL 161, ICPL 85063, ICP 7120, and ICPL 87119 from the International Crops Research Institute for Semi-Arid Tropics (ICRISAT and one local variety for their relative performance and susceptibility to insect pests. The pigeon pea genotypes were in a mixture with two maize genotypes (Zea mays L., open-pollinated and hybrid in regular crops for 2 yr (2005-2006 followed by a ratoon crop for 1 yr (2007. Termites (Odontotermes badius, crickets (Gymnogryllus lucens, and variegated grasshoppers (Zonocerus variegatus were the crop's seedling pests and caused minimal damage. Clavigralla spp. infestations were high at the reproductive stage causing 24% and 29% seed damage in regular and ratoon pigeon pea crops, respectively. Maize slightly suppressed insect pest incidence and damage to pigeon pea pods and seeds but significantly (P La extendida adopción de sistemas de cultivo que son sustentables y benignos para el medio ambiente es vital para la supervivencia macro-económica de la civilización. El intercultivo podría asegurar la estabilidad de población de insectos en un sistema. Un ensayo de campo de 3 anos (2005-2007 fue realizado en Nigeria bajo condiciones de cultivo regular y ratoon para evaluar cinco genotipos de poroto gandul (Cajanus cajan [L.] Huth: ICPL 87, ICPL 161, ICPL 85063, ICP 7120, e ICPL 87119 desde International Crops Research Institute for Semi-Arid Tropics (ICRISAT y una variedad local, por sus rendimientos y susceptibilidades relativas a insectos plaga. Los genotipos de poroto gandul estaban en mezcla con dos genotipos de maíz (Zea mays L., de polinización abierta e híbrido en cultivos regulares por 2 anos (2005-2006 seguido por un ratoon por 1 ano (2007. Termitas (Odontotermes badius, grillos (Gymnogryllus lucens y saltamontes variegado (Zonocerus variegatus fueron las plagas de plántula del cultivo, causando dano mínimo. Infestaciones con Clavigralla spp. fueron altas en el estado reproductivo causando 24% y 29% de dano seminal en cultivos regular y de poroto gandul ratoon. El maíz suprimió la incidencia de la plaga y el dano a las vainas y semillas de poroto gandul pero redujeron significativamente (P < 0,01 el rendimiento de grano en los cultivos de poroto gandul en 2005 y 2006, pero no en ratoon en 2007. Los genotipos de poroto gandul difirieron significativamente (P < 0,05 en incidencia de la plaga al estado de vaina en cultivos regular y ratoon y en rendimiento de grano (P < 0,01 bajo el cultivo regular. El rendimiento de granos de los cultivos de poroto gandul ratoon fue aproximadamente 60% de aquel del cultivo regular. Los genotipos ICPL 161 e ICPL 87 se recomendaron para adopción por los agricultores basados en tolerancia a las plagas y alto rendimiento de granos o como idiotipos en programas de hibridación de poroto gandul.

  9. Growing up with HIV/AIDS: a study on adolescents with HIV/AIDS and their family caregivers Creciendo con VIH/SIDA: un estudio con adolescentes portadoras de VIH/SIDA y sus cuidadoras familiares Crescendo com HIV/AIDS: estudo com adolescentes portadoras de HIV/AIDS e suas cuidadoras-familiares

    Directory of Open Access Journals (Sweden)

    Ana Amélia Antunes Lima

    2008-06-01

    Full Text Available This is an exploratory study with a qualitative approach, which looks at the adolescent process with HIV/AIDS. The purpose is to identify how the adolescent process occurs, from the perspective of these teenagers and their family caregivers. The investigation was performed in Porto Alegre, RS between May and July 2005, and the subjects were four adolescents and three caregivers. Data were collected by means of interviews, which were subject to the content analysis technique. The study revealed that both teenagers and family caregivers did not show concern with the changes typical of the period, especially regarding sexuality questions. Yet, the underlying diagnosis and coping with HIV remain in the family core in order to protect these agents against the stigma of the disease.Es un estudio exploratorio con abordaje cualitativo, que trata del proceso de desarrollo de la adolescencia en portadoras de VIH/SIDA, con el objetivo de identificar cómo ocurre el proceso de la adolescencia, en la visión de estas adolescentes y de sus cuidadoras familiares.La investigación se realizó en Porto Alegre-RS, entre los meses de mayo y julio de 2005; los sujetos fueron cuatro adolescentes y tres cuidadoras. La colecta de las informaciones se hizo por medio de entrevistas que fueron sometidas a la técnica de análisis de contenido. El estudio reveló que las adolescentes y sus cuidadoras familiares, manifestaron preocupación con los cambios propios de ese período, especialmente en asuntos relacionados a la sexualidad. Se hizo evidente que el diagnóstico y la convivencia con el VIH permanecen ocultos en el contexto familiar, con el objetivo de proteger, a estos actores, del estigma de la enfermedad.Estudo exploratório com abordagem qualitativa, que trata do processo de adolescer de portadoras de HIV/AIDS, com o objetivo de identificar como ocorre o processo da adolescência, na ótica dessas adolescentes e de suas cuidadoras-familiares. A investigação foi realizada em Porto Alegre, RS, entre os meses de maio e julho de 2005, sendo que os sujeitos foram quatro adolescentes e três cuidadoras. A coleta das informações ocorreu por meio de entrevistas que foram submetidas à técnica de análise de conteúdo. O estudo revelou que tanto as adolescentes quanto suas cuidadoras-familiares não manifestaram preocupação com as transformações próprias do período, especialmente nas questões que envolvem a sexualidade. Evidenciou-se que o diagnóstico e a convivência com o HIV ainda permanecem velados no círculo familiar, visando a proteção desses atores com relação ao estigma da doença.

  10. Effects of Soil Aluminum on Early Arbuscular Mycorrhizal Colonization of Wheat an Barley Cultivars Growing in an Andisol Efecto del Aluminio del Suelo en la Colonización Temprana por Micorrizas Arbusculares en Cultivares de Trigo y Cebada Creciendo en un Andisol

    Directory of Open Access Journals (Sweden)

    Alex Seguel

    2012-09-01

    Full Text Available Aluminum phytotoxicity in acid soils is an important environmental stress that negatively affects crop production, but arbuscular mycorrhizal (AM fungi performance would allow plants to better withstand this environmental condition. This study aimed to analyze the effect of soil Al on early AM colonization of wheat (Triticum aestivum L. and barley (Hordeum vulgare L. cultivars. Near-isogenic Crac, Invento, and Porfiado wheat cultivars and Sebastián and Aurora barley cultivars were sown in pots in an acid soil at three Al saturation levels (60, 34, and 11%. At 20 d after sowing (DAS 'Crac' presented higher AM colonization (27% than other cultivars. However, 'Invento' had the fastest colonization at 41 DAS, which was inhibited in short term at lower Al-saturation. Moreover, roots of 'Aurora' were colonized 28 and 51% at 20 and 66 DAS, respectively, and also decreased at lower Al-saturation. In soil with 60% Al-saturation a great spore production was observed at 41 DAS, 'Aurora' had the highest spore density at 66 DAS. At 20 DAS a negative relationship (r = -0.37; p La fitotoxicidad por Al en suelos ácidos es un importante estrés que afecta negativamente la producción de cultivos, pero la actividad de hongos micorrícicos arbusculares (MA permitiría que las plantas soporten mejor esta condición ambiental. Este estudio tuvo como objetivo analizar el efecto del Al en la colonización MA temprana de cultivares de trigo (Triticum aestivum L. y cebada (Hordeum vulgare L.. Cultivares de trigo Crac, Invento, y Porfiado, y de cebada Sebastián y Aurora fueron sembrados en macetas en un suelo ácido con tres niveles de saturación de Al (60, 34, y 11%. A los 20 días después de la siembra (DDS 'Crac' presentó la mayor colonización MA (27%; sin embargo, 'Invento' tuvo la más rápida colonización a los 41 DDS, la cual fue inhibida a corto plazo a una menor saturación de Al. Por otra parte, las raíces de 'Aurora' fueron colonizadas 28 y 51% a los 20 y 66 DDS, respectivamente, y también se redujo a una menor saturación de Al. En suelos con 60% de saturación de Al se observó una gran producción de esporas a los 41 DDS, siendo 'Aurora' el de más alta densidad de esporas a los 66 DDS. A los 20 DDS se observó una relación negativa (r = -0.37, p < 0,001 entre la colonización MA temprana y la masa de las raíces. Además, dicha relación fue más fuerte (r = -0.49, p < 0,001 cuando las plantas fueron cultivadas en alta saturación de Al. Una temprana colonización MA se observó en todos los cultivares ensayados cuando se cultivaron en alta saturación de Al y fue superior en las variedades aparentemente más tolerantes a Al, sugiriendo que una temprana colonización MA puede ser un factor importante en la tolerancia a Al para plantas agrícolas cultivadas en suelos ácidos.

  11. Ecología del Paisaje. Un marco para el estudio integrado de la dinámica territorial y su incidencia en la vida silvestre

    OpenAIRE

    Gurrutxaga San Vicente, Mikel; Lozano Valencia, Pedro J.

    2008-01-01

    A review on the conceptual basis and aims of Landscape Ecology, scientific discipline that presents an important geographical component, is realized. It assumes that landscape heterogeneity controls diverse movements and flows of organisms, matter and energy. One of the principal objects of study of the above mentioned discipline is the existing relations between landscape structural patterns and dynamics of wild populations and communities. This is an aspect of great applicability in biodive...

  12. Evaluación de medios de cultivo para propagación in vitro de semillas y explantes de especies silvestres de Solanum

    Directory of Open Access Journals (Sweden)

    Danita Andrade Díaz

    2013-01-01

    Full Text Available Se evaluaron los medios de cultivo Hussey-Stacey (A, Hendrix et al. (H, Atkinson et al. (AT y mitad de Murashyge y Skoog (½MS para la propagación in vitro de semillas y explantes de Solanum mammosum, S. marginatum, S. hirtum y S. umbellatum. En la fase de propagación sexual se evaluó el porcentaje de germinación, número de raíces, longitud de planta, días a formación de hojas y raíces, días a morfogénesis completa y materia seca. Se determinó el tipo de morfogénesis a través de callos, vástago y plantas totalmente formadas. Se estudiaron el número y longitud de brotes, número de raíces y hojas, producción de materia seca y días a morfogénesis completa. Para S. mammosum el mejor medio de germinación fue ½MS, para el desarrollo de plantas fue A y para propagación vegetativa, A-Nudos (Medio A con explantes tipo nudos. En el mismo orden, para S. marginatum fueron los medios A, H y ½MS y/o H con nudos, mientras que en S. hirtum fueron H,A y H-nudos. Para S. umbellatum no se encontraron diferencias en germinación entre H, ½MS y A. Para la formación de plantas el mejor medio fue ½ MS y para propagación vegetativa fue H-Nudo.

  13. Patrones de asociación entre insectos polinizadores y palmas silvestres en Colombia con énfasis en palmas de importancia económica

    OpenAIRE

    Núñez Avellaneda, Luis Alberto

    2014-01-01

    Se describe, analiza y valida el papel de los insectos que han sido considerados los principales polinizadores de palmas neotropicales: las especies del género Mystrops (Nitidulidae), diferentes grupos de gorgojos (Curculionidae), los escarabajos del género Cyclocephala (Dynastidae), especies de y Abejas sin aguijón (Apidae Meliponinae). El estudio se realizó a partir de un análisis multiespecífico y multitemporal de polinizadores que involucró la colecta, separación e identificacion de visit...

  14. Enraizamento de estacas de três espécies silvestres de Passiflora Cutting rooting of three wild Passiflora species

    Directory of Open Access Journals (Sweden)

    Marcelo Fideles Braga

    2006-08-01

    Full Text Available Em ambiente com nebulização controlada, estacas herbáceas com um par de folhas, contendo 2 ou 3 nós, foram testadas quanto ao enraizamento, utilizando-se de bandeja de poliestireno com célula de 95cm³ e saco plástico de 15x25x0,02cm com 1.730 cm³. Foram testadas estacas de Passiflora actinia, P. serrato-digitata e P. setacea. Observou-se que P. serrato-digitata apresentou 94,3% de estacas enraizadas com brotos e 2,4% de mortalidade; enquanto P. actinia e P. setacea apresentaram, respetivamente, 30,5% e 28,6% de estacas enraizadas com brotos e 56,8% e 60,7% de mortalidade. A alta mortalidade das estacas foi atribuída ao estado fenológico das matrizes de P. actinia e P. setacea e ao ataque de larvas de bradisia (Bradysia spp. Estacas com dois e três nós não apresentaram diferenças significativas, e o recipiente saco plástico de 1.730 cm³ proporcionou melhor desenvolvimento das mudas.Steam cuttings of three wild Passiflora species where tested for rooting in a mist regulated greenhouse. Cuttings with two or three buds were used with two kinds of containers: polystyrene trays with 95 cm³ cells and perforated plastic bags of 15x25x0.02cm, with 1,730 cm³. Passiflora serrato-digitata was the best, with 94.3% of rooted cuttings with shoots e only 2.4% of death cuttings. P. actinia and P. setacea showed , respectivelly, 30.5% and 28.6% of rooted cuttings and 56.8% and 60.7%, of death cuttings. The high death were attribute to phenological phases of P. actinia and P. setacea or injury caused by fungus-gnat larvae (Bradysia spp.. Cuttings with two or three buds didn't show differences among them. Plastic bags proporcioned the best results, increasing rooted cuttings and plant development.

  15. Anatomía y Morfología de las Especies Silvestres del Género Hylocereus (Berger) Britton & Rose (Cactaceae) en México

    OpenAIRE

    García Aguilar, María de los Ángeles

    2012-01-01

    Se estudió la anatomía caulinar y la morfología de diez poblaciones del género Hylocereus con distribución en México con el objetivo de evaluar su variación y su contribución en la sistemática del género. En cada una de las localidades muestreadas se colectaron de 3 a 5 individuos fenológicamente maduros a fin de garantizar la mayor homogeneidad en el material. Para la obtención de los caracteres anatómicos se tomaron muestras de ramas adultas en la parte apical, media y b...

  16. Reporte de albinismo en Podiceps major, Pelecanus thagus y Cinclodes fuscus y revisión de aves silvestres albinas del Perú

    Directory of Open Access Journals (Sweden)

    Miriam Torres

    2013-03-01

    Full Text Available Reportamos observaciones de individuos albinos en tres especies de aves peruanas, el Zambullidor Grande (Podiceps major, el Pelícano peruano (Pelecanus thagus y el Churrete cordillerano (Cinclodes fuscus. Los individuos eran albinos parciales casi totalmente blancos, aparentemente adultos, que mostraron un comportamiento normal entre sus conespecíficos. La supervivencia después de varios meses pudo ser comprobada para el Pelícano peruano y el Churrete cordillerano. Debido a que la información publicada sobre albinismo en aves peruanas es muy escasa, se realizó una revisión y se recopilaron registros para otras nueve especies que son también presentados.

  17. Propriedades nutricionais, nutracêuticas e antioxidantes de espécies silvestres condimentares utilizadas na gastronomia tradicional do nordeste transmontano

    OpenAIRE

    Fernandes, Ângela

    2010-01-01

    As plantas aromáticas e medicinais são muito apreciadas e utilizadas em todo o Mundo. Muitas costumavam ser importantes como suplementos na dieta alimentar, fornecendo compostos bioactivos, eram e são ainda usadas como tempero na cozinha tradicional Portuguesa e em diversas aplicações farmacológicas. Neste trabalho, determinou-se a composição nutricional e nutracêutica de três espécies de Lamiaceae (Mentha pulegium, Thymus pulegioides e Thymus mastichina). A determinação da composição nutr...

  18. Estabelecimento in vitro e micropropagação de maracujá silvestre (Passiflora foetida L. In vitro establishment and micropropagation of Passiflora foetida L.

    Directory of Open Access Journals (Sweden)

    W.S. Soares

    2012-01-01

    Full Text Available Entre as espécies do gênero Passiflora, a P. foetida L. apresenta a maior variabilidade genética e tem grande importância medicinal, pois é usada no tratamento de doenças como asma, icterícia, e na forma de emplastros, para as erisipelas e doenças de pele com inflamação. Portanto, são necessários estudos que visem a micropropagação e conservação. As sementes de P. foetida L. apresentam dormência e muitas vezes, levam alguns meses para germinar, produzindo mudas desuniformes e de baixo vigor. Neste sentido, a cultura de tecidos apresenta-se como uma forma alternativa a propagação. Assim, o objetivo do trabalho foi estabelecer e micropropagar P. foetida L., para formação de um banco de germoplasma. Para tanto, sementes foram escarificadas, desinfestadas e inoculadas em meio MS(½ sem reguladores de crescimento e cultivados por 66 dias. Explantes de hipocótilos obtidos de plantas germinadas in vitro, foram cultivados no mesmo meio suplementado com 1,0 mg L-1 de BAP. Na fase de estabelecimento, 45% dos explantes brotaram e formaram gemas axilares. 88,9% dos explantes de hipocótilo induziram brotação e 11,1% produziram calos. Plântulas regeneradas com 1,82 cm de altura, com raízes foram aclimatadas.Among the species of the genus Passiflora, P. foetida L. presents highest genetic variability and also great medicinal importance. This species is used in the treatment of diseases such as asthma, jaundice, and in the form of poultices for erysipelas and skin diseases with inflammation. Therefore, studies are needed to preserve them. Its seeds present dormancy and often take several months to germinate. The tissue culture is a alternative form to propagate species. The objective was to establish and micropropagation P. foetida L., and create a germplasm bank. Seeds were scarified, disinfected, and inoculated on MS medium (½ without regulators for 66 days. Hypocotyls explants obtained of seedlings in vitro germinated were transferred and placed in the same medium supplemented with BAP (1,0 mg L-1. In the establishment phase of 45% of the explants sprouted and formed axillary buds. 88,9% of hypocotyl explants induced shoots and 11,1% produced callus. Seedling measuring 1,82 cm length and rooted were acclimatized.

  19. Animais silvestres utilizados como recurso alimentar em assentamentos rurais no município de Uruará, Pará, Brasil

    Directory of Open Access Journals (Sweden)

    Reinaldo Lucas Cajaiba

    2015-08-01

    Full Text Available The consumption of hunting animals is of fundamental importance for human subsistence in different tropical areas. Knowing the chosen species, the techniques of capture and the quantity are fundamental aspects to understand how to use and the degree of threat of hunting on each wild species. In this perspective, the objective of this work was to record the wild animal species most commonly used as food resource in five rural settlements in the municipality of Uruará-PA, in addition to qualify the main techniques of capturing these species. The data collection was made through semi-structured interviews and participant observation. For the selection of the interviewees, we adopted the “snowball” method. As a result, we identified 38 species of animals consumed, most being mammals (42.1%, followed by birds (39.4% and reptiles (18.5%. The species most frequently mentioned were: Cuniculus paca (n=156, Euphractus sexcinctus (n=154 and Pecari tajacu (n=137. The most used technique was hunting with shotgun. Among the animals cited, Priodontes maximus, Tayassu pecari, Tapirus terrestris, Myrmecophaga tridactyla, Podocnemis unifilis, Tinamus tao, Crax fasciolata and Podocnemis unifilis are in the list of threatened species. The results point to the urgent need for educational programs to farmers regarding the unsustainable use of animals.

  20. Características da microbiota da superfície ocular bacteriana em animais domésticos e silvestres

    OpenAIRE

    Santos, Lucianne Leigue dos

    2012-01-01

    Resumo: O termo microbiota é usado para descrever microrganismos que frequentemente são encontrados em várias regiões do corpo em indivíduos saudáveis. Os constituintes e o número desta microbiota são diferentes de acordo com a área e, às vezes, idade e estado fisiológico de cada indivíduo. A superfície ocular é rica em nutrientes e, consequentemente, pode albergar diversa variedade de microrganismos, os quais constituirão a microbiota indígena. O estudo da microbiota é importante para uma me...

  1. Capacidad antioxidante de poblaciones silvestres de “tara” (Caesalpinia spinosa de las localidades de Picoy y Santa Fe (Provincia de Tarma, departamento de Junín

    Directory of Open Access Journals (Sweden)

    Alberto López S.

    2011-01-01

    Full Text Available El Perú es el principal abastecedor de “tara”, gracias a que nuestro país posee una gran variedad de climas y tipos de suelos, haciendo posible la obtención de este cultivo durante la mayor parte del año. El departamento de Junín cuenta con poblaciones naturales de “tara” que aun no han sido caracterizadas bioquímica ni genéticamente, que podrían aprovecharse en beneficio de las comunidades locales. En este trabajo se reporta la capacidad antioxidante de “tara” provenientes de las localidades de Picoy y Santa Fe, ambas ubicadas en Tarma, Junín. Se utilizó la técnica del DPPH y del ABTS para valorar la capacidad antioxidante; para la determinación de fenoles y flavonoides se utilizó el reactivo de Folin-Ciocalteau según la técnica de Singleton. La muestra de Picoy reportó mayor cantidad de fenoles siendo de 563.70 mg/g de extracto seco, mientras que la cantidad de flavonoides fue de 0.664 mg/g. La capacidad antioxidante mostro una mejor respuesta en la muestra de Picoy, reportándose mediante el DPPH un IC50 1.244 mg/ml y con el ABTS un 35.3% de inhibición. Estos datos podrían aprovecharse para incrementar el valor agregado y mejorar la oferta de este recurso en dicha localidad debido a sus mejores características antioxidantes.

  2. Histología del órgano reservante de la maca silvestre, Lepidium meyenii (Brassicaceae) y comparación con la maca cultivada

    OpenAIRE

    Chain, Fernando Ezequiel; Mercado, Maria Ines; Coll Araoz, Maria Victoria; Catalan, Cesar Atilio Nazareno; Grau, A.; Ponessa, Graciela I.

    2016-01-01

    Samples of the underground reserve organ of wild maca (Lepidium meyenii) from Cumbres Calchaquíes (Tucumán), were fixed in FAA and embedded in paraffin in order to study their anatomy. The underground structure was compared with the storage organ of cultivated maca observed in a previous study. The storage organ of wild maca is a contractile root with normal secondary growth. Peridermis arises from outer cortical parenchymatic cells. Cortex and star shaped pith constituted by amiliferous pare...

  3. Epidemiologia molecular de vírus da raiva em mamíferos domésticos e silvestres do Brasil

    OpenAIRE

    Kimura, Leda Maria Silva

    2006-01-01

    A raiva é uma das doenças mais temidas entre as diferentes zoonoses que ameaçam o Homem, pois evolui sempre para o êxito letal, sendo, na prática, sua morbidade igual à mortalidade. Acrescem-se ainda os prejuízos econômicos, causados ao rebanho bovino nos focos de raiva epizoótica, seu impacto geral na economia pecuária, reduzindo a produção de leite e carne, e suas implicações na área de Saúde Pública. Através da utilização de técnicas clássicas e moleculares, o presente estudo, visou estud...

  4. Nuevos registros de nemátodes parásitos de animales de vida silvestre en el Perú

    Directory of Open Access Journals (Sweden)

    Manuel Tantaleán

    2014-06-01

    Full Text Available Se registran, por primera vez para el Perú, 4 especies de nemátodes: Dipetalonema graciliformis Freitas, 1964 parásito de Saguinus labiatus; Evaginuris branickii (McCiure, 1932 Quentín, 1973 de Dinomys branickii; Alaeuris caudatus (Lent & Freitas, 1948 de Iguana iguana y Serpinema amazonicus de Podocnemis expansa. También, se considera a Saguinus labiatus como un nuevo huésped para Dipetalonema graciliformis.

  5. Notas sôbre a evolução do virus vacínico em animais silvestres da fauna brasileira

    Directory of Open Access Journals (Sweden)

    Cicero Alves Moreira

    1956-06-01

    Full Text Available A note on the evolution of cow-pox virus in wild animals of Brazilian fauna. We have tried the sensibility of wild animals of Brazilian fauna to the cow-pox virus. The following specimens were submitted to experiences: Procyon cancrivorus, Hydrochoerus capybara, Cavea aperea, Coendu villosus, Didelphis aurita, Bradypus tridactylus, Euphractus sexcintus, Tamandua tetradactylus, Nasua narica, Dasyprocta aguti and Testudo tabulata. In all these animals, - excepting Bradypus tridactylus - we have obtained an infection with incubation (five days, aspect and duration similar to cow-pox of the laboratorial animals (calf and rabbit. In the Bradypus tridactylus howewer, the incubation was very long. Only after 30 days of inoculation we verified the infection with the formation of vesiculae and postulae.

  6. Estudo sobre triatomíneos e reservatórios silvestres de Trypanosoma cruzi no estado do Paraná, Sul do Brasil. Resultados preliminares

    Directory of Open Access Journals (Sweden)

    Toledo Max Jean de Ornelas

    1997-01-01

    Full Text Available Em localidades da zona rural de cinco municípios da região noroeste do Paraná adultos e ninfas de Triatoma sordida foram capturados em 21 (41,2% de 51 unidades domiciliares pesquisadas. Foram capturados 154 exemplares de T. sordida e 2 Panstrongylus megistus. De 135 exemplares examinados 58 (43,0% apresentavam o Trypanosoma tipo cruzi. Constatou-se também a infecção em 57,1% (4/7 dos gambás (Didelphis sp examinados. O peridomicílio apresentou-se mais infestado que o intradomicílio, sendo a casa de madeira abandonada a construção mais freqüente (34,7% do total investigado e com maior taxa de infestação (53,9%. Os dados mostram um elevado índice de infestação da zona rural por espécies secundárias de triatomíneos com altas taxas de infecção por flagelados do tipo T. cruzi, em uma área endêmica para a doença de Chagas já em fase de vigilância epidemiológica.

  7. Tolerancia aL NaCI de plantas andaluzas de vid silvestre (Vitis vinifera L., ssp sylvestris (sylvestris (Gmelin) Hegi)

    OpenAIRE

    Rivasplata, Paula E.

    2005-01-01

    68 páginas, 10 fotos, 18 tablas, 96 referencias.-- Memoria final presentada al XLII Curso Internacional de Edafología y Biología Vegetal, patrocinado por UNESCO-AECI y CSIC que desde 1963 hasta 2009 se ha impartido en el Centro de Edafología y Biología Aplicada del Cuarto (CEBAC) y a partir de 1987 pasó a denominarse Instituto de Recursos Naturales y Agrobiología de Sevilla (IRNAS-CSIC).-- Existe un ejemplar de la publicación en la Biblioteca del Instituto de Recursos Naturales y Agrobiología...

  8. DAÑOS CAUSADOS POR EL BARRENADOR MAYOR DE LOS GRANOS Prostephanus truncatus (Horn(COLEOPTERA: BOSTRICHIDAE EN MAÍZ Y RAMAS DE PLANTAS SILVESTRES

    Directory of Open Access Journals (Sweden)

    Luz R. Bourne-Murrieta

    2014-01-01

    Full Text Available Prostephanus truncatus (Horn es un insecto barrenador de la madera que se ha adaptado a los productos alimenticios almacenados, principalmente de maíz. En este trabajo se cuantificaron las pérdidas y daños ocasionados por el barrenador en 10 variedades de maíz y 10 especies vegetales para determinar la susceptibilidad y los efectos que el insecto pudiera ocasionar si se adapta a las condiciones del noroeste de México. Las semillas de los maíces y los trozos de ramas de las especies arbóreas se sometieron a infestación artificial por adultos de P. truncatus y se incubaron a 27 ± 1 °C y 70 ± 3 % de humedad relativa. La preferencia de los insectos y los daños ocasionados en cada material fueron determinados. Los insectos prefirieron y dañaron en mayor grado al “Maizón”, una variedad de maíz criollo sembrado por los productores de la región serrana de Sonora. Los trozos de ramas con mayor daño provocado por P. truncatus fueron Ricinus communis, Jatropha cardiophylla y Parkinsonia aculeata; sin embargo, el insecto no fue capaz de reproducirse en éstas. El “Maizón” también presentó la disminución más drástica de germinación y fue una de las variedades con mayor número de adultos de P. truncatus emergidos.

  9. Bases Técnicas para la Elaboración de Procedimientos Operativos enfocados al Control de Fugas de Animales Silvestres y Exóticos

    OpenAIRE

    Nestor Varela; Paula Moreno-Merchán

    2011-01-01

    Las personas que manejan fauna se encuentran expuestas a múltiples causas que afectan su salud y seguridad. Actualmente en varios países se demandan planes de protección contra desastres y urgencias, normatividad que cobija a las Instituciones que manejan fauna en cautiverio. El escape de un animal se define cono la salida del mismo de un entorno controlado, debido a error humano, fallas del recinto, desastres naturales e incluso la acción directa de una persona, pudiendo ser un suceso de mín...

  10. Primeros registros de hongos gasteroides en la Reserva Forestal Nacional y Refugio de Fauna Silvestre Ajos-Bavispe, Sonora, México

    OpenAIRE

    Martín Esqueda; Alfonso Sánchez; Moisés Rivera; Martha L. Coronado; Marcos Lizárraga; Ricardo Valenzuela

    2009-01-01

    Gasteroid fungi associated with seven different vegetation types in the Ajos-Bavispe National Forest Reserve and Wildlife Refuge were seasonal sampled over one-year period. Forty-two species representing the families Geastraceae (14), Agaricaceae (25), Diplocystidiaceae (1) and Sclerodermataceae (2) were determined in the 10 sampled localities. Astraeus hygrometricus and Crucibulum laeve were the most widely distributed; but most species showed a restricted distribution. The most species-rich...

  11. AVALIAÇÃO SOROLÓGICA DE Parainfluenzavirus Tipo 1, Salmonella spp., Mycoplasma spp. E Toxoplasma gondii EM AVES SILVESTRES

    Directory of Open Access Journals (Sweden)

    Guilherme Augusto Marietto Gonçalves

    2013-12-01

    Full Text Available Newcastle disease, salmonellosis and mycoplamosis are the most important infectious diseases in poultry. Toxoplamosis is a common disease in urban environment. The present study investigated serologic evidence of these diseases in captive and wildlife birds, with rapid plate agglutination test, haemagglutination inhibition test, and modified agglutination test. In a total of 117 blood serum samples, 20 showed the presence of Toxoplasma gondii, Mycoplasma gallisepticum, and Salmonella spp. antibodies. Amazona aestiva was the specie with the highest number of positive individuals (13/20. We also verified the first detection of T. gondii antibodies in birds of prey from Mivalgo chimachima and Rupornis magnirostris species.

  12. Base genética da resistência de um acesso de tomate silvestre ao mosaico-amarelo do pimentão

    OpenAIRE

    Juhász,Ana Cristina Pinto; Silva,Derly José Henriques da; Zerbini Júnior,Francisco Murilo; Carneiro,Pedro Crescêncio Souza; Soares,Bruno Oliveira; Cruz,Cosme Damião

    2008-01-01

    O objetivo deste trabalho foi avaliar a base genética da resistência de Lycopersicon hirsutum ao potyvírus Pepper yellow mosaic virus (PepYMV). Foram avaliadas 540 plantas, inclusive os parentais 'Santa Clara' (suscetível) e 'BGH 6902' (resistente), e as gerações F1, F2, RC1:1 e RC1:2, derivadas do cruzamento desses parentais. As plantas receberam inoculações mecanicamente, e a concentração viral de PepYMV em cada planta foi determinada por ELISA indireto. Foram realizadas as análises quantit...

  13. La utilidad de los modelos de distribución de especies en la gestión cinegética de los ungulados silvestres

    Directory of Open Access Journals (Sweden)

    Refoyo, P.

    2014-12-01

    Full Text Available The usefulness of species distribution models in hunting management of wild ungulates We developed a distribution model of Iberian ibex (Capra pyrenaica using the maximum entropy method (Maxent based on information from the database of the Spanish Ministry of Agriculture, Food and Environment. The goal was to study the usefulness of such models to determine potential areas for reintroduction or natural colonization of the species. To validate the model, we used data generated from known densities of the Iberian ibex in 107 protected areas: 26 areas where the species is present, and 81 where it is not present. Findings showed that the preferred habitat for the species has steep slopes, altitude over 1,000 m, and seasonal variation in precipitation and temperature. We detected a significant relationship between the densities obtained in the study areas and their relation to the preferred habitat. Our results indicate these models can be useful in species management planning to determine areas for reintroduction of the species.

  14. Importância epidemiológica de alguns animais silvestres na esquistossomose mansônica Epidemiologic importance of some wild rodents in the schistosomiasis mansoni

    Directory of Open Access Journals (Sweden)

    Urara Kawazoe

    1983-10-01

    Full Text Available Com o intuito de averiguar a importância de alguns roedores como possíveis reservatórios do S. mansoni, na ausência do homem parasitado, foi realizada pesquisa, visando contribuir para o esclarecimento de aspectos ligados à cadeia epidemiológica da esquistossomose, bem como conhecer alguns parâmetros da biologia de certos roedores, em seu habitat semi-natural. O experimento foi realizado num viveiro de 952 m², no município de Taubaté, São Paulo (Brasil, numa área endêmica de esquistossomose mansônica humana, e teve a duração de três anos e seis meses (agosto de 1973 a dezembro de 1976. Foram utilizados como hospedeiros definitivos, Holochilus brasiliensis leucogaster, Zygodontomys lasiurus, Oryzomys nigripes eliurus e Cavia aperea aperea; como hospeideiro intermediário, Biomphalaria tenagophila e posteriormente B. glabrata. Entre agosto de 1973 e janeiro de 1976, não houve encontro de B. tenagophila eliminando cercárias de S. mansoni; não se verificou, também, infecção natural de roedores. Em agosto de 1975, houve introdução acidental de desovas da B. glabrata, cujos adultos, em 1976, apresentaram infecção por S. mansoni em três ocasiões, com índices de 2,0; 1,6 e 0,8%. No mesmo ano de 1976, dois Holochilus, nascidos no Viveiro, eliminaram ovos viáveis de S. mansoni. Foi possível obter dados de 41 H. b. leucogaster, 28 introduzidos e 14 nascidos no local. O exemplar que sobreviveu mais tempo completou 346 dias. Os animais nascidos no Viveiro e capturados pela primeira vez pesavam, em média, 20 a 50 g. Notou-se que o peso corporal aumentou com o tempo e parece não estacionar até a morte do animal. Z. lasiurus e C. a aperea não procriaram e nem adquiriram infecção ao S. mansoni. O. n. eliurus, procriou e permaneceu vivo, em média, menos de 100 dias; não foi observada eliminação de ovos do parasita. É pouco provável que H. b. leucogaster e B. tenagophila mantenham o ciclo da esquistossomose na ausência da contaminação humana, na natureza. Porém, é possível que, futuramente, H. b. leucogaster na presença de B. glabrata, possa servir de reservatório da esquistossomose, na natureza, quando encontrados em abundância e desde que adaptados com cepas adequadas do parasita.The importance of some wild rodents as possible reservoir hosts of S. mansoni related to the epidemiologic chain of this parasite and some biological aspects of these rodents were studied in semi-natural habitats. The experiment was performed in an enclosed area of about 1,000 m² situated in Taubaté, State of S. Paulo, one of the endemic area of human schistosomiasis, during a period of three years and six months (from August 1973 to December 1976. Wild rodents of the following species were used as definitive hosts: Holochilus brasiliensis leucogaster, Zygodontomys lasiurus, Oryzomys nigripes eliurus and Cavia aperea aperea. Biomphalaria tenagophila and B. glabrata were used as intermediate hosts. From August 1973 to January 1976 it was not possible to find any B. tenagophila eliminating S. mansoni cercariae nor any rodents infected with the same parasite. In August, 1975, egg patches of B. glabrata snails were accidentaly introduced into the area and in 1976 some adult snails were eliminating S. mansoni cercariae. In that same year, two Holochilus that were born in the area were discharging S. mansoni eggs in their feces. Some biological data were collected from 41 H. b. leucogaster of which 28 individuals were introduced into and 14 were born in the area. The majority of body weights of rodents born in the area and captured for the first time was between 20 and 50 grams. In this group of 41 rodents observed, body weight continued to increase throughout the life span of each individual sampled. Z. lasiurus and C. a. aperea did not show any infection with S. mansoni and they did not leave any progeny in the area. O. n. eliurus reproduced in the area and remaining there for about 100 days did not show any infection with the parasite. Thus, H. b. leucogaster and B. tenagophila, in the absence of infected humans, will hardly maintain the life cicle of schistosomiasis but Holochilus together with B. glabrata would probably maintain the life cicle of S. mansoni in nature without the presence of infected man, since in the area there is a suitable strain of S. mansoni, both for definitive and intermediate hosts.

  15. Installation of devices in water tanks to prevent drowning of wild animals (Instalacion de Estructuras Dentro de Tanques de Agua Para Evitar El Ahogamiento de Animales Silvestres)

    Science.gov (United States)

    Alberto Lafon

    2006-01-01

    Domestic farm and ranch properties use a variety of water retention structures and water supply infrastructures that benefit wildlife. Some water supply systems, however, are harmful to wild birds, small mammals, and reptiles. Water supply systems include metal water tanks, cemented reservoirs, or excavated earthen retention ponds (or tanques as they are known in...

  16. Viabilidad fitoclimática de las repoblaciones de pino silvestre (Pinus sylvestris L.) en la Sierra de los Filabres (Almería)

    OpenAIRE

    Fernández Cancio, Ángel; Navarro Cerrillo, Rafael María; Sánchez Salguero, Raúl; Fernández Fernández, Rocío; Manrique Menéndez, Emilio

    2011-01-01

    La variabilidad climática actual se caracteriza por provocar cambios bruscos en los cursos fitoclimáticos, lo que está desencadenando procesos de mortalidad de especies forestales. El objetivo de este trabajo es analizar la adecuación fitoclimática de las masas artificiales de Pinus sylvestris L. en la Sierra de los Filabres (Almería), para lo cual se analizaron 35 variables fitoclimáticas que determinan la estabilidad climática de la especie. El estudio de los valores interanuales de las var...

  17. Proceso de recolección y comercialización de hongos comestibles silvestres en el Valle de Toluca, México

    Directory of Open Access Journals (Sweden)

    2001-01-01

    Full Text Available In Mexico, human consumption of edible fungi has occurred since the time of the Pre Columbian cultures. Historians of the sixteenth century and beyond have described the use of fungi as well as the manner in which they were classified. Presently, in the rural areas of Mexico, more than two hundred edible varieties are registered as being harvested, with different ethnic groups having a vast knowledge about them. The present study took place in the Valley of Toluca, with the intention of understanding the phenomena of harvesting fungi, as well as the process of their commercialization. The study took place from 1994 to 1996, taking into account four trips accompanying harvesters in the Valley as well as in mountains bordering the valley, and in three markets. Of the thirty four “taxa” encountered, all had been reported previously – an indication of their persistence.

  18. Aedes albopictus em área rural do Brasil e implicações na transmissão de febre amarela silvestre

    OpenAIRE

    Almério de Castro Gomes; Marisa Dantas Bitencourt; Délsio Natal; Pedro Luis Silva Pinto; Luis Filipe Mucci; Marcia Bicudo de Paula; Paulo Roberto Urbinatti; José Maria Soares Barata

    1999-01-01

    Durante estudos ecológicos sobre mosquitos anofelíneos no município de Bataguassu, Estado de Mato Grosso do Sul, foram encontradas larvas e adultos de Aedes albopictus. Pela primeira vez sua introdução ocorre numa área enzoótica do vírus selvático da febre amarela no Brasil. Isto sugere risco potencial para transferência desse vírus para área urbana infestada com Aedes aegypti.

  19. Aedes albopictus em área rural do Brasil e implicações na transmissão de febre amarela silvestre

    Directory of Open Access Journals (Sweden)

    Gomes Almério de Castro

    1999-01-01

    Full Text Available Durante estudos ecológicos sobre mosquitos anofelíneos no município de Bataguassu, Estado de Mato Grosso do Sul, foram encontradas larvas e adultos de Aedes albopictus. Pela primeira vez sua introdução ocorre numa área enzoótica do vírus selvático da febre amarela no Brasil. Isto sugere risco potencial para transferência desse vírus para área urbana infestada com Aedes aegypti.

  20. Aedes albopictus em área rural do Brasil e implicações na transmissão de febre amarela silvestre

    Directory of Open Access Journals (Sweden)

    Almério de Castro Gomes

    1999-02-01

    Full Text Available Durante estudos ecológicos sobre mosquitos anofelíneos no município de Bataguassu, Estado de Mato Grosso do Sul, foram encontradas larvas e adultos de Aedes albopictus. Pela primeira vez sua introdução ocorre numa área enzoótica do vírus selvático da febre amarela no Brasil. Isto sugere risco potencial para transferência desse vírus para área urbana infestada com Aedes aegypti.

  1. Procedimientos de nominación en la flora silvestre: agavanzo, escaramujo, rosal bravío

    Directory of Open Access Journals (Sweden)

    Molina, Isabel

    2002-12-01

    Full Text Available The author describes a classification of the folk names of the dog rose in the Peninsular Spanish Geography. This is a well known shrub in the rural space because of its different employments and applications. The linguistic filiation of lexical variants and geographic distribution is also presented.

    En este estudio se presenta una clasificación de los nombres populares del escaramujo en la geografía española peninsular, arbusto muy conocido en el medio rural por sus variados usos y aplicaciones. Se establece la filiación lingüística de las variantes léxicas y se aclara su distribución geográfica.

  2. OCORRÊNCIA DE PARASITOS GASTRINTESTINAIS EM AVES SILVESTRES NO MUNICÍPIO DE SEROPÉDICA, RIO DE JANEIRO, BRASIL

    Directory of Open Access Journals (Sweden)

    Ísis Alves Costa

    2010-12-01

    Full Text Available This study aimed to assess the role of endoparasitic infections as another factor of biological pressure on both migratory and local bird species. The occurrence of endoparasites may be considered a sign of undesirable hygienic alterations, causing the shortening of natural fields, compromising the resting area and the habitat nutritional quality. A total of 75 fecal samples were collected at the Campus of the Universidade Federal Rural do Rio de Janeiro (UFRRJ, Brazil, between August 2007 and May 2008, and they were analyzed in a Lugol´s solution by Faust´s technique. Amongst the 82.66% positive samples for enteric parasites, 44% were parasitized by the trichomonads and 5.33% by the Chilomastix enterozoary genera, 52% presented coccidian oocysts, 29.33% showed Entamoeba coli, 37.22% presented Iodamoeba butschlii vegetative forms, and 10.66% were positive for worm eggs. The high prevalence of enteroparasites observed indicates the need of more detailed and frequent evaluations of the environmental sanitary conditions, whose impact seems to be associated to the scarce local hygienic conditions due to the growing anthropization.

  3. OCORRÊNCIA DE PARASITOS GASTRINTESTINAIS EM AVES SILVESTRES NO MUNICÍPIO DE SEROPÉDICA, RIO DE JANEIRO, BRASIL

    OpenAIRE

    Ísis Alves Costa; Cleide Domingues Coelho; Camila Bueno; Ildemar Ferreira; Ronald Bastos Freire

    2010-01-01

    This study aimed to assess the role of endoparasitic infections as another factor of biological pressure on both migratory and local bird species. The occurrence of endoparasites may be considered a sign of undesirable hygienic alterations, causing the shortening of natural fields, compromising the resting area and the habitat nutritional quality. A total of 75 fecal samples were collected at the Campus of the Universidade Federal Rural do Rio de Janeiro (UFRRJ), Brazil, between August 2007 a...

  4. Gestão do stock farmacêutico num hospital de fauna silvestre : apresentação de dois estudos de caso

    OpenAIRE

    Borges, Liliana Isabel Ferreira

    2012-01-01

    Dissertação de Mestrado Integrado em Medicina Veterinária A subida constante dos custos da sociedade em geral e dos cuidados de saúde em particular, tanto a nível humano, como animal, requer a implementação de medidas que controlem as despesas, sendo essencial o não comprometimento da qualidade destes serviços. Os stocks são o grande investimento de qualquer serviço farmacêutico. Deste modo, uma eficiente gestão do inventário farmacêutico traduz-se no equilíbrio entre um ade...

  5. Caracterização de ácidos orgânicos por UPLC-PDA em plantas silvestres de uso alimentar

    OpenAIRE

    Pereira, Carla; Barros, Lillian; Carvalho, Ana Maria; Isabel C. F. R. Ferreira

    2012-01-01

    A análise de ácidos orgânicos tem-se tornado cada vez mais importante devido ao papel destes compostos na atividade fisiológica das plantas. Têm sido desenvolvidas várias técnicas de análise de ácidos orgânicos em plantas nomeadamente, cromatografia gasosa (GC), eletroforese capilar, cromatografia de troca iónica e cromatografia líquida de alta eficiência (HPLC). A determinação de ácidos orgânicos por GC requer passos de derivatização e, por isso, as técnicas de HPLC têm sido mais utilizadas....

  6. Métodos e Implicaciones de la Contracepción en Fauna Silvestre y Exótica en Zoológicos

    OpenAIRE

    Dave Wehdeking

    2010-01-01

    Es fácil comprender la importancia de los programas de mejoramiento diseñados para conservar las especies amenazadas y en peligro. Al mantener en cautiverio las poblaciones de animales, los zoológicos y acuarios son capaces de realizar investigación fundamental y allanar el camino a la posible reintroducción de especies en la naturaleza...

  7. Uma estação biológica para o estudo dos mosquitos e dos outros animaes silvestres relacionados com a febre amarela

    Directory of Open Access Journals (Sweden)

    Henrique de Beaurepaire de Aragão

    1943-01-01

    Full Text Available The outbreak of the jungle or forest yellow fever, through the adapta¬tion, quite recently of the yellow fever virus o the forest mosquitoes, brou¬ght the necessity of ecological researches on hese mosquitoes, as well as on the wild animals they bite, some of them being susceptible to the desease. This has been done by the special yellow fever Service of the State of Sao Paulo, in a special Biological Station in Perús, São Paulo, which has been built in the midst of the jungle. This station was made with plain materials, and covered with straw, but was confortable enough for the technical work, i nthe early months of 1938. During the months in which the investigations were being carried on, the following interesting results were obtained: 1. As we have already pointed out in other places, the forest mosquitoes biting us during daytime, are always new born insects, having not yet sucked blood, as it is the general rule with all mosquitoes, and therefore also, with the anopheles and stegomyia, and this explains why nobody gets malaria or yellow fever, transmitted by anofeles or by aedes aegypti during the day. We think therefore, the jungle yellow fever, got during daytime is not due to the infected jungle or forest mosquito biting, but to infection through the human skin coming into close contact with tre virus, which the forest mosquitoes lay with their dejections, on the leaves of the trees where they remain sitting du¬ring the day. 2. As it is the rule with anopheles, stegomyia and other mosquitoes, the insects once having sucked blood, take nocturnal habits and, therefore, bite us, only during the night, so it happens with the forest mosquito, and insects with developped eggs and blood in stomach have been caught within the sta¬tion house, during the night. During the day, these mosquitoes do not bite, but remain quite still on the leaves of the trees, in the damp parts of the woods. 3. Jungle or forest mosquitoes can easely bite wild animals, some with more avidity then ethers, as it has bee npointed out to the opossum (didei-phis and other animals. They also bite birds having very thin skin and only exceptionally, cold bloods animals. 5. Is has hot been possible to ascertain how forest mosquitoes are able to live, from onde season to another, through winter, when temperature drops near and even below zero. They have not been found in holes of the terrain, of trees and of animals, as it is the rule in cold countries. During winter, in the forest, it is possible to find larvs in the holes of bambus and trees full of water. As wild animals do not harbour the yellow fever virus for a long time in their body, it is diffcult to explain how the desease lasts from one season to another. Many ecological features on the mosquito, remains yet to be explained and therefore it in necessary to go on with the investigations, in bio¬logical stations, such as that one built up in Perús, São Paulo.

  8. PirAB Toxin from Photorhabdus asymbiotica as a Larvicide against Dengue Vectors▿

    OpenAIRE

    Ahantarig, Arunee; Chantawat, Nantarat; Waterfield, Nicholas R.; ffrench-Constant, Richard; Kittayapong, Pattamaporn

    2009-01-01

    We have evaluated Photorhabdus insect-related protein (Pir) from Photorhabdus asymbiotica against dengue vectors. PirAB shows larvicidal activity against both Aedes aegypti and Aedes albopictus larvae but did not affect the Mesocyclops thermocyclopoides predator. PirAB expressed the strongest toxicity compared to PirA, PirB, or the mixture of PirA plus PirB. Whether the presence of an enterobacterial repetitive intergenic consensus sequence in PirAB, but not in PirA, PirB, or the mixture of P...

  9. Talcum Powder and Cancer

    Science.gov (United States)

    ... would not have the same type of potential bias, have not found an increased risk. For any ... well as journalists, editors, and translators with extensive experience in medical writing. Coggiola M, Bosio D, Pira ...

  10. Development and Validation of RP-LC Method for the Determination of Cinnarizine/Piracetam and Cinnarizine/Heptaminol Acefyllinate in Presence of Cinnarizine Reported Degradation Products.

    Science.gov (United States)

    El-Houssini, Ola M; Zawilla, Nagwan H; Mohammad, Mohammad A

    2013-01-01

    Specific stability indicating reverse-phase liquid chromatography (RP-LC) assay method (SIAM) was developed for the determination of cinnarizine (Cinn)/piracetam (Pira) and cinnarizine (Cinn)/heptaminol acefyllinate (Hept) in the presence of the reported degradation products of Cinn. A C18 column and gradient mobile phase was applied for good resolution of all peaks. The detection was achieved at 210 nm and 254 nm for Cinn/Pira and Cinn/Hept, respectively. The responses were linear over concentration ranges of 20-200, 20-1000 and 25-1000 μgmL(-1) for Cinn, Pira, and Hept respectively. The proposed method was validated for linearity, accuracy, repeatability, intermediate precision, and robustness via statistical analysis of the data. The method was shown to be precise, accurate, reproducible, sensitive, and selective for the analysis of Cinn/Pira and Cinn/Hept in laboratory prepared mixtures and in pharmaceutical formulations.

  11. Analysis of the genome of a Korean isolate of the Pieris rapae granulovirus enabled by its separation from total host genomic DNA by pulse-field electrophoresis.

    Directory of Open Access Journals (Sweden)

    Yong Hun Jo

    Full Text Available BACKGROUND: Most traditional genome sequencing projects involving viruses include the culture and purification of the virus particles. However, purification of virions may yield insufficient material for traditional sequencing. The electrophoretic method described here provides a strategy whereby the genomic DNA of the Korean isolate of Pieris rapae granulovirus (PiraGV-K could be recovered in sufficient amounts for sequencing by purifying it directly from total host DNA by pulse-field gel electrophoresis (PFGE. METHODOLOGY/PRINCIPAL FINDINGS: The total genomic DNA of infected P. rapae was embedded in agarose plugs, treated with restriction nuclease and methylase, and then PFGE was used to separate PiraGV-K DNA from the DNA of P. rapae, followed by mapping of fosmid clones of the purified viral DNA. The double-stranded circular genome of PiraGV-K was found to encode 120 open reading frames (ORFs, which covered 92% of the sequence. BLAST and ORF arrangement showed the presence of 78 homologs to other genes in the database. The mean overall amino acid identity of PiraGV-K ORFs was highest with the Chinese isolate of PiraGV (~99%, followed up with Choristoneura occidentalis ORFs at 58%. PiraGV-K ORFs were grouped, according to function, into 10 genes involved in transcription, 11 involved in replication, 25 structural protein genes, and 15 auxiliary genes. Genes for Chitinase (ORF 10 and cathepsin (ORF 11, involved in the liquefaction of the host, were found in the genome. CONCLUSIONS/SIGNIFICANCE: The recovery of PiraGV-K DNA genome by pulse-field electrophoretic separation from host genomic DNA had several advantages, compared with its isolation from particles harvested as virions or inclusions from the P. rapae host. We have sequenced and analyzed the 108,658 bp PiraGV-K genome purified by the electrophoretic method. The method appears to be generally applicable to the analysis of genomes of large viruses.

  12. Structuring of the acai pulp exporting agribusiness' organizational field/ Estruturacao do campo organizacional das agroindustrias exportadoras de Polpa de Acai/Estructuracion del campo organizacional de las agroindustrias exportadoras de pulpa de acai

    National Research Council Canada - National Science Library

    Filho, Milton Cordeiro Farias; Sousa, Jose Welington

    2013-01-01

    .... Se trata de una industria que esta creciendo desde pequenas unidades artesanales de procesamiento hacia fabricas que incorporan tecnologias de producto, proceso y gestion, que operan en el mercado...

  13. Caracterización de los aceites crudo, neutro y decolorado de la pulpa y cascara de la fruta silvestre Paraqueiba sericea tulasne «Umarí».

    Directory of Open Access Journals (Sweden)

    Chasquibol Silva, Nancy A.

    1997-02-01

    Full Text Available Crude, neutro and blenched oil extracted from pulp and peel of jungle fruit Paraqueiba sericea tulasne «Umarí» were studied. The crude oil was extracted with hexane by the soxhlet method giving a 47.86% yield, a 31.72% yield in neutro oil and a 94.89% yield in blenched oil. Chemical and physical constants were determined. In addition, five methyl esters of fatty acids were quantitatively determined by GLC using DEGS as stationary phase. The results indicated that Umarí oil belongs to a not drying type with a high content of unsaturated fatty acids principaly oleic. The analytical values obtained confirm the convenience of using Umarí oil in food and cosmetic industries.

    Se estudian los aceites crudo, neutro y decolorado del fruto del Umarí. La extracción del aceite crudo se realizó mediante hexano por el método de soxhlet. El rendimiento fue de un 47,86% en aceite crudo, 31,72% en aceite neutro y 94,89% en aceite decolorado. Por métodos analíticos se determinaron constantes químicas y físicas. Además por cromatografía gas-líquido se cuantificaron cinco esteres metílicos de ácidos grasos, usando DEGS como fase estacionaria. Los resultados del estudio indican que el aceite de Umarí corresponde a un aceite del tipo no secante y con alto contenido de ácidos grasos insaturados principalmente oleico. Los índices analíticos obtenidos confirman la conveniencia de usar aceite de Umarí para aplicaciones en alimentos y cosmética.

  14. Auteurs affichés, auteurs dissimulés. Le recours aux citations dans le 'Commentaire sur l'Enéide' attribué à Bernard Silvestre

    Directory of Open Access Journals (Sweden)

    Francine Mora

    2017-06-01

    Full Text Available Birger Munk Olsen's works have pointed out the importance of the commentaries in the reception and canonization of the Latin auctores during the twelfth-century Renaissance. In Bonaventure's famous classification, the commentator, who writes both with his own words and with the words of the others, but gives to the second of these the primary position, is lower in rank than the author. He is also dependent on the commentators who wrote before him. However, the study of mentions or quotations of auctores and former commentators in medieval commentaries shows that the latter used their predecessors only in order to expose their own point of view. A good example of this is furnished by the commentary of the Aeneid commonly attributed to Bernardus Silvestris. This article studies its difference of treatment between its two models, Macrobius and Fulgentius – the first is displayed, the second is more concealed –, and also its use of Ovid, whose Metamorphoses are used as early as in the commentary of Book 1, but who is not explicitly claimed as a model.

  15. Evaluación de riesgo del tratamiento de semillas con plaguicidas para las aves silvestres de ecosistemas agrícolas:el caso de la perdíz roja

    OpenAIRE

    López Antia, Ana

    2015-01-01

    La conservación de las aves agrícolas es uno de los mayores retos de conservación en Europa. El declive de estas aves está claramente ligado a la transformación del sistema de producción agrícola que se viene dando desde mediados del pasado siglo. Uno de los puntos de partida de esta tesis es que la intensificación agrícola ha llevado a una reducción en el alimento natural disponible para las aves agrícolas, viéndose éstas obligadas a buscar fuentes alternativas de alimento como la semilla de...

  16. Patrones de distribución de felinos silvestres (Carnívora: Felidae en el trópico seco del Centro-Occidente de México

    Directory of Open Access Journals (Sweden)

    Juan Felipe Charre-Medellín

    2015-09-01

    Full Text Available El estado de Michoacán se caracteriza por presentar una importante heterogeneidad ambiental, en términos de clima, topografía y tipos de vegetación, que incluyen al bosque tropical seco que se encuentra en peligro de extinción a nivel mundial. Algunos trabajos mencionan la presencia de las seis especies de felinos que habitan en México, para la región; sin embargo, la evidencia para apoyar estos trabajos es escasa, por lo que llenar esta falta de información es especialmente crítico en el caso de especies o hábitats amenazados. El objetivo de este estudio fue sistematizar la información y analizar los patrones de distribución de los felinos en el estado de Michoacán, dentro del centro-occidente de México. Realizamos una revisión de la información bibliográfica y contenida en bases de datos sobre la presencia de felinos en esta región. Asimismo, realizamos trabajo de campo que en el curso de diez años donde se aplicaron distintos métodos para detectar la presencia de especies de felinos (recorrido de senderos para obtener evidencia directa e indirecta de la presencia de las especies, trampas cámara y entrevistas. Localizamos 29 registros de presencia en literatura y bases de datos. Por otra parte acumulamos un total de 1 107.5 km de transectos recorridos y 8 699 días/cámara-trampa. A través de este esfuerzo de muestreo, generamos 672 registros de presencia de las seis especies. Lynx rufusfue la especie con menos registros totales (n = 3 y cuya distribución contrastó más con la del resto de las especies. La especie con más registros fue Leopardus pardalis(n = 343. En general, el 89% de los registros de felinos se obtuvieron por debajo de los 1 000 msnm. En promedio, la temperatura media anual y la precipitación anual donde se ubicaron los registros fue de 24 °C y 1 040 mm respectivamente. La especie que mostro un patrón más claro en términos de temperatura y precipitación fue L. rufus(15.8 ± 1.3°C y 941 ± 171 mm. De acuerdo con el dendrograma resultante del análisis de conglomerados de las combinaciones de ecorregiones y tipos de vegetación se logró distinguir cinco grupos. Este estudio permite tener un panorama más completo de los patrones de distribución de los felinos en una región de importante contraste ambiental y sujeto a un fuerte impacto por las actividades humanas. Asimismo, los datos generados en este estudio pueden ayudar a profundizar nuestro entendimiento de la relación que existe entre la distribución de especies de felinos y las características del ambiente y servir como base para el desarrollo de estrategias de conservación local y regional.

  17. Contribuição da fauna silvestre em projetos de restauração ecológica no Brasil Contribution of the wildlife in ecological restoration projects in Brazil

    Directory of Open Access Journals (Sweden)

    Wanuza Helena Campos

    2012-12-01

    Full Text Available O sucesso no processo de restauração e manutenção da dinâmica de um ecossistema é extremamente dependente da capacidade das espécies em promover interações interespecíficas entre as diversas formas de vida. Estas interações criam um cenário favorável à restauração ecológica de ecossistemas degradados. Assim, por meio de revisão de literatura, o objetivo deste trabalho é relatar a contribuição e utilização dos diferentes grupos de animais na execução de projetos de restauração ecológica no Brasil. As aves e mamíferos frugívoros e também outros animais, como os répteis, peixes e insetos, têm se destacado como ferramentas de auxílio aos projetos de restauração ecológica. As técnicas para atração de animais e consequente chegada de propágulos em um ecossistema degradado compreende a utilização de poleiros, que servem de pouso e abrigo para a avifauna e morcegos, e a utilização de abrigos artificiais, que servem para fuga de predadores, descanso e reprodução dos animais. De modo geral, estes estudos são excelentes ferramentas para gerir ações de manejo ambiental em ecossistemas degradados, possibilitando a recuperação da biodiversidade destes ambientes. The success in the process of restoration and maintenance of the dynamics of an ecosystem is highly dependent on the capacity of species to promote interspecific interactions among the various life forms. These interactions create a favorable environment for the ecological restoration of degraded ecosystems. Thus, by review the literature, the objective of this study is to report the contribution and use of different animal groups in carrying out ecological restoration projects in Brazil. The fruit-eating birds and mammals and also other animals such as reptiles, fish and insects have been highlighted as tools to aid environmental ecological restoration projects. Techniques for attracting animals and consequent arrival of seedlings in a degraded ecosystem comprises the use of perches, which serve as landing and shelter for birds and bats, and the use of artificial shelters, which serve to escape from predators, resting and reproduction of animals. In general, these studies are excellent tools for managing environmental management actions in degraded ecosystems, enabling the recovery of biodiversity in these environments.

  18. An English-Spanish Glossary of Terminology Used in Forestry, Range, Wildlife, Fishery, Soils, and Botany = Glosario en Ingles-Espanol de Terminologia Usada en Forestales, Pastizales, Fauna, Silvestre, Pesqueria, Suelos, y Botanica.

    Science.gov (United States)

    Medina, Alvin Leroy

    This document presents English-Spanish/Spanish-English equivalent translations of scientific and management terms commonly used in the field of natural resource management. The glossary is composed of two sections. Section 1 contains the English to Spanish translations, while Section 2 provides the Spanish to English translations. Each section is…

  19. Distribución geográfica y aprovechamiento de las uvas silvestres (Vitis spp.) de la región totonaca en la Sierra Norte de Puebla

    OpenAIRE

    Gilberto Luna Gaona; Juan Guillermo Cruz Castillo; Emiliano Pérez Portilla; Atenógenes Licona Vargas; Marisela Sánchez Sánchez; Omar Franco Mora

    2010-01-01

    Se estudió la distribución geográfica y el aprovechamiento de Vitis spp. autóctonas de la región indígena totonaca de la Sierra Norte del estado de Puebla, México. Se determinaron cinco grupos que crecen en tres diferentes unidades fisiográficas considerando sus características vegetativas. Se localizaron individuos desde los 159 m hasta los 1 816 m de altitud en los municipios de Venustiano Carranza y Huauchinango, respectivamente. Un total de 139 plantas de Vitis spp. fueron localizadas ge...

  20. Estudos sôbre reservatórios e vetores silvestres do Trypanosoma cruzi. XXII. Modificações dos focos naturais da tripanossomose americana e suas conseqüências

    Directory of Open Access Journals (Sweden)

    Mauro Pereira Barreto

    1967-08-01

    Full Text Available Os focos naturais da tripanossomose americana, como tôda biogeocenose, podem. permanecer relativamente estáveis, sendo esta estabilidade necessária para a própria existência dêsses focos. Mas o balanço ecológico pode ser alterado, sendo muito importante aquelas alterações devidas à interferência direta ou indireta do homem ao exercer atividades ligadas ao desbravamento e à colonização. Entre as conseqüências podemos citar: 1 redução ou desaparição dos focos naturais; 2 concentração de hospedeiros e vectores em áreas favoráveis limitadas; 3 deslocamento de hospedeiros e vectores para outras áreas; 4 invasão das habitações humanas e anexos, com a instalação do ciclo doméstico da infecção. Estas possibilidades são analisadas e ilustradas com exemplos.

  1. Prevalencia y factores de riesgo asociados a la infección por endoparásitos en rumiantes domésticos y silvestres de la provincia de Lugo

    OpenAIRE

    Painceira Iglesias, Alejandra María

    2012-01-01

    Con objeto de conocer las endoparasitosis que afectan a los rumiantes en la provincia de Lugo, entre septiembre de 2006 y octubre de 2008 se realizó un estudio en él que se analizaron 1136 muestras fecales de vacuno, 1892 de ovino y 362 de corzos. La eliminación de ooquistes de Eimeria, huevos de trematodos y de nematodos gastrointestinales fue moderada mientras que la de larvas de nematodos broncopulmonares y huevos de Moniezia fue baja. Las elevadas prevalencias sugieren una alta contami...

  2. ABORDAGEM BIOGEOGRÁFICA SOBRE A FAUNA SILVESTRE EM ÁREAS ANTROPIZADAS: O SISTEMA ATIBAIA-JAGUARI EM AMERICANA (SP / Biogeographical approach about the wild fauna in altered areas:the Atibaia-Jaguari systen in Americana (SP

    Directory of Open Access Journals (Sweden)

    Roberto Marques Neto

    2006-12-01

    Full Text Available The current article shows a biogeographical study about fauna of the Atibaia-Jaguari systen inAmericana (SP. The research undertake to do the list of the species of reptiles, birds and mammals,as well as the show and discuss facts relationship between fauna with the physical mean and theanthropic exploration of the territory.

  3. Percepción y patronos de uso de la fauna silvestre o comunidades indigenas Embera - Katíos en la cuenca del río San Jorge, zona amortiguadora del PNN - Paramillo.

    Directory of Open Access Journals (Sweden)

    Javier Alfonso Racero - Casarrubia

    2008-12-01

    Full Text Available In workshops with four indigenous communities in the Embera-Katíos communal lands (resguardo , located in the upper San Jorge River Valley (Tres Playitas, Las Piedras, Boca San Cipriano, San Juan Medio, information about the wild fauna that they recognized inside their hunting grounds was collected. Mammals, reptiles, and birds, especially the Psittacidae family, are the vertebrates most used by the indigenous communities. No kind of use was found for amphibians. The consumption of reptiles such as Iguana iguana, Tupinambis teguixin, Caiman crocodylus fuscus, and Crocodylus acutus show them to be an important part of their culture. The indigenous communities associate environmental problems with habitat destruction due to the cultivation of illicit crops and forest clearing in the buffer zone around Paramillo National Park.

  4. An English-Spanish glossary of terminology used in forestry, range, wildlife, fishery, soils, and botany (Glosario en Ingles-Espanol de terminologia usada en forestales, pastizales, fauna, silvestre, pesqueria, suelos, y botanica)

    Science.gov (United States)

    Alvin Leroy Medina

    1988-01-01

    The English-Spanish/Spanish-English equivalent translations of scientific and management terms (jargon) commonly used in the field of natural resource management are presented. The glossary is useful in improving communications and fostering understanding between Spanish- and English-speaking persons.

  5. Detección por reacción en cadena de la polimerasa de transcriptasa inversa del virus de la fiebre amarilla en monos silvestres: una herramienta sensible para la vigilancia epidemiológica

    OpenAIRE

    Méndez, Jairo A; Édgar Parra; Marcela Neira; Rey,Gloria J

    2007-01-01

    Introducción. La fiebre amarilla es una enfermedad zoonótica mantenida en la naturaleza por primates no humanos; su vigilancia por técnicas sensibles de laboratorio es necesaria para hacer evidente la actividad viral en territorio selvático. Objetivo. Detectar el virus de la fiebre amarilla en muestras de tejido hepático de primates no humanos, mediante la técnica de reacción en cadena de la polimerasa de transcriptasa inversa (RT-PCR) con iniciadores diagnósticos específicos. Materiale...

  6. LEVANTAMENTO DA FAUNA SILVESTRE NO CENTRO DE REABILITAÇÃO DO BATALHÃO DA POLÍCIA MILITAR AMBIENTAL NOS ANOS DE 2010, 2011 E 2013 NO MUNICÍPIO DE CANDEIAS DO JAMARI-RO

    OpenAIRE

    Lima, Renato Abreu; Silva, Sumara Matos

    2014-01-01

    http://dx.doi.org/10.5902/2236117012289Nosso planeta é habitado por muitos milhões de espécies, e é patrimônio para a humanidade nos aspectos ecológico, científico, econômico e cultural. No Brasil temos a maior diversidade do planeta o que o eleva ao posto de principal nação entre os 17 países de maior biodiversidade. O Batalhão de Polícia Militar Ambiental (BPA) tem a missão de planejar, coordenar e executar o policiamento, visando à proteção dos animais e do meio ambiente. E é no Centro de ...

  7. Ocorrência de patógenos de origem bacteriana e viral e marcadores de virulência de Escherichia coli e Rhodococcus equi isolados das fezes de aves silvestres de cativiero da fauna brasileira

    OpenAIRE

    Morais, Amanda Bonalume Cordeiro de [UNESP

    2014-01-01

    The present study investigated the occurrence of Escherichia coli, Rhodococcus equi, Salmonella sp., Coronavirus and Rotavirus in the feces of Passeriformes and psittaciformes belonging to Brazilian wildlife, from 29 different species, without enteric signs. Virulence markers were also investigated in strains of E. coli (cnf1, hlyA, papC, papGI, papGII, papGIII, fimH, afa, sfa, iucD, usp, vt1, vt2, eae, k88) and R. equi (vapA and vapB genes). The birds used in the study came from the Centro d...

  8. Analysis of the generation and monitoring of impact on fauna in the gas pipeline works in the current environmental legislation; Analise da geracao e monitoramento do impacto sobre a fauna silvestre em obras de gasodutos face a legislacao ambiental vigente

    Energy Technology Data Exchange (ETDEWEB)

    Caldas, Flaviana V.; Serricchio, Claudio [PETROBRAS, Rio de Janeiro, RJ (Brazil); Akahori, Lisa [TELSAN Engenharia e Servicos Ltda, Vitoria, ES (Brazil); Nascimento, Reinaldo R. [IMC Saste - Construcoes, Servicos e Comercio Ltda., Sao Paulo, SP (Brazil)

    2008-07-01

    The impacts to wildlife in areas where gas pipelines will be implemented are considerable, changing the existing balance. The main environmental measure adopted in the cases is the deployment of the Fauna Management Programme. This programme is sub - divided into two: Monitoring and Rescue of the fauna. The tracking step starts before the installation of the venture, with the completion of a first in order to identify the impacts before the venture, and finishes two years after the end of the works. These studies are based on guidelines set in the Normative Instruction of the environmental licensor agency, in which the criteria for implementation are restrictive, often without making a license agency distinction of methodology for enterprises with different characteristics. This article intended to review the criteria and the procedures established by the legislation and its real applicability in gas pipeline projects face to the environmental impacts identified to this activity. For this analysis, the methodology used was the case study of two gas pipelines: Cabiunas - Vitoria (GASCAV) and Cacimbas - Catu (GASCAC). The results allowed to conclude that the actions developed to the Sub-Programme of Rescue of the fauna are satisfactory to control environmental impacts and that the Sub-Programme of Monitoring of the fauna just confirm behaviors and information's previous detected. (author)

  9. Repelência de substâncias naturais e sintéticas aos mamíferos silvestres consumidores de sementes de Araucaria angustifolia (Bertol. Kuntze em semeadura no campo.

    Directory of Open Access Journals (Sweden)

    Guilherme O. S. Ferraz de Arruda

    2008-01-01

    Full Text Available This work aimed at testing some natural and synthetic substances, not phytotoxics and not lethal for the fauna, to verify the repellence action for the consuming wild animals of Parana-Pine seeds, in two direct sowing experiments in the field. In experiment I, there was the direct application of the treatments in the Parana-Pine seeds and, in the experiment II, there was the application of the treatments only in the surface of the plantation hollows, after the sowing of Parana-Pine seeds. The Parana-Pine seeds and the treatments were prepared at Laboratory of Center of Agroveterinary Sciences, University of Santa Catarina State, at Lages city, Brazil. The experiments were carried to a native-antropic field area at Lages city. It was adopted the experimental design of randomized blocks for both experiments. Experiment I was composed of 15 treatments, 10 seeds per treatment, with 4 replications, and experiment II was composed of 11 treatments, 10 seeds per treatment, with 4 replications. The tested substances, isolated or in mixtures, were: fruit of red pepper, root of parsley, stem and leaf of wormwood herb, lemon scented gum essential oil, linseed oil, castor bean oil, rosin, copper oxychloride, copper sulphate, sulphur, látex ink and calcium lignosulfonate. Through the periodic inspections, during 167 and 165 days respectively for the experiments I and II, data were collected and organized through the attacked and not attacked Paraná-Pine seeds, being submitted to statistical analysis later. The predation rates were considered high for both experiments: 86,7% in experiment I and 84,3% in experiment II. In the experiment with treated Parana-Pine seeds, the longer time for the beginning of the predation was 104 days after the sowing, while, in the experiment with treatment in the environment (hollows, it was 64 days after the sowing. Solution of rosin and alcohol + lemon scented gum oil, applied in the seeds, presented potential for reduction of the predation level. The treatments with linseed oil presented changeable behaviors, equally to the treatments with latex ink, in the experiment with treated Parana-Pine seeds. In the experiment with treated hollows, the lignosulfonate of calcium in mixture with extracts of pepper, with root of parsley and with wormwood herb presented significant effect of reduction on the predation. The solution of linseed with red pepper extracts and with root of parsley extract also had significant effect for reduction of the predation of these seeds, in the experiment with treated hollows

  10. Caracterização de frutos e sementes em acessos de maracujá silvestre (Passiflora foetida L. Characterization of fruits and seeds of wild passion fruit (Passiflora foetida L..

    Directory of Open Access Journals (Sweden)

    W.S. Soares

    2011-01-01

    Full Text Available A espécie Passiflora foetida L.é uma trepadeira exótica cujas folhas e frutos possuem propriedades medicinais. No Brasil, a erva é utilizada na forma de extratos ou emplastros para erisipelas e doenças de pele com inflamação. O objetivo deste trabalho foi caracterizar cinco acessos de Passiflora foetida L. baseados em 17 descritores morfológicos O experimento foi conduzido em casa de vegetação em delineamento inteiramente ao acaso, com 15 repetições por genótipo. As variáveis analisadas foram cor da casca do fruto, formato do fruto, comprimento do fruto, diâmetro do fruto, massa fresca do fruto, comprimento do pedicelo, cor da polpa do fruto, espessura da casca, acidez titulável, sólidos solúveis, potencial hidrogeniônico, razão sólidos solúveis/ acidez titulável, comprimento da semente, diâmetro da semente, espessura da semente, massa fresca das sementes e o número de sementes por fruto. Os dados foram submetidos à análise de variância e teste de médias pelo teste Tukey a 5% de probabilidade. Houve diferença significativa pelo teste F a 5% de probabilidade, entre os genótipos para quase todas as características com exceção da espessura da casca, massa fresca do fruto, comprimento da semente e massa fresca das sementes. A característica que apresentou maior variação foi o teor de sólidos solúveis. E entre os genótipos, o acesso 5 foi o que apresentou as maiores médias pelo teste de Tukey a 5% de probabilidade, em todas as características analisadas, podendo ser utilizado em programas de melhoramento da espécie.The species Passiflora foetida L. é an exotic vine, which leaves and fruit have medicinal properties. In Brazil, the herbis used in the form of extracts or poultices for erysipelas and skin diseases with inflammation. The aim of this study was to characterize five Passiflora foetida L. accessions based on 17 morphological descriptors The experiment was conducted in a greenhouse in a completely randomized design with 15 replicates per genotype. The variables were the fruit skin color, fruit shape, fruit length, fruit diameter, fresh fruit, length of pedicel, flesh color of the fruit, skin thickness, acidity, soluble solids, hydrogen potential ratio soluble solids / acidity, seed length, seed diameter, thickness of seed, fresh seed and seed number per fruit. The data were submitted to analysis of variance and the means were compared by Tukey test at 5% of probability. There was a significant difference by F test at 5%,of probability among the genotypes for nearly all traits, except the thickness of the shell, fresh fruit mass, seed length and fresh weight of seed. The variable that most variation was the soluble solids. The genotype 5 had the highest means by Tukey test at 5% of probability on all characteristics that can be used in breeding programs of the species.

  11. Las áreas silvestres protegidas del estado como zonas de conservación de la naturaleza: El Parque Nacional Torres del Paine, Región de Magallanes y de la Antártica Chilena

    Directory of Open Access Journals (Sweden)

    M. González

    2013-12-01

    Full Text Available El presente trabajo es una breve descripción del Parque Nacional Torres del Paine, un área protegida localizada en el sur de Chile, que se caracteriza por la presencia de paisajes montañosos de origen glaciar, con una serie de lagos, lagunas, y ríos, los cuales albergan especies endémicas de flora y fauna. Estas características convierten a este parque en uno de los más visitados a nivel nacional. Se discuten aspectos sobre conservación y manejo del parque.

  12. Transmissão da tuberculose bovina entre espécies domésticas e silvestres em Portugal: primeiras evidências moleculares em isolados de Mycobacterium bovis de uma exploração do Alentejo

    OpenAIRE

    Duarte, Elsa Leclerc

    2010-01-01

    No âmbito de um estudo mais alargado para a caracterização molecular de estirpes de Mycobacterium bovis (M. bovis) e de Mycobacterium caprae (M. caprae) isoladas em Portugal, tipificaram-se dois isolados de M. bovis provenientes de um bovino e de um javali (Sus scrofa), que coabitavam na mesma exploração na região do Alentejo. Duas metodologias, reconhecidas pela sua reprodutibilidade e poder discriminatório, foram utilizadas na genotipagem: o "spoligotyping" e a análise de MIRU-VNTR, c...

  13. Morfología del sistema sensorial en abejas silvestres argentinas. Características del sistema de integración de la información quimiosensorial

    OpenAIRE

    Galvani, Gerónimo Luis

    2013-01-01

    Los sensilios son la unidad funcional básica de los receptores en la cutícula de los insectos, actuando principalmente en la mecano y la quimiorecepción. Con el objetivo de comprender la asociación entre el sistema sensorial externo y la variedad de comportamientos que surgieron durante la historia evolutiva de las abejas, se estudió la morfología externa de los sensilios antenales en 34 taxones pertenecientes a la familia Apidae. Se utilizaron técnicas de microscopia óptica y electrónica. Lo...

  14. PLANTAS SILVESTRES CON POTENCIALIDAD ORNAMENTAL DE LOS BOSQUES MONTANO BAJOS DEL ORIENTE ANTIOQUEÑO, COLOMBIA NATIVE PLANTS WITH ORNAMENTAL POTENTIAL IN THE LOW MONTANE FORESTS OF EASTERN ANTIOQUIA, COLOMBIA

    Directory of Open Access Journals (Sweden)

    Jorge Alberto Sierra Escobar

    2005-06-01

    Full Text Available El estudio se realizó en cinco municipios del altiplano del oriente antioqueño (La Ceja, El Retiro, Guarne, Rionegro, y El Carmen de Viboral, además del municipio de Envigado vereda Pantanillo y el corregimiento de Santa Elena de la ciudad de Medellín, los cuales se encuentran localizados en el extremo norte de la cordillera central de Los Andes colombianos. El estudio consistió en seleccionar, dentro de algunas áreas boscosas, especies de hierbas y arbustos con follaje, flores o frutos llamativos que por su belleza presentaran alto potencial ornamental. Con esta finalidad se seleccionaron 26 especies de las cuales se recolectaron semillas, esquejes y estacas para proceder a determinar protocolos de reproducción sexual y vegetativa, determinándose las exigencias ecológicas, protocolos y potencialidades de 11 especies de plantas y arbustos como: Besleria sp., Cleome speciosa, Columnea sp., Gaultheria erecta, entre otras, las cuales presentaron características ornamentales deseables que se espera sean explotadas.This study was conducted in five towns in the high plains of eastern Antioquia (La Ceja, El Retiro, Guarne, Rionegro, and Carmen de Viboral, as well as the Pantanillo neighborhood of the Envigado municipality and the Santa Elena township of Medellin, which are located in the northern limit of the central mountain range of the Andes (Colombia. The study consisted of selecting within forested areas species of herbs and shrubs with attractive leaves, flowers or fruits that might have high ornamental potential for their beauty. To this end, were selected 26 species for which seeds, cuttings, and stakes were collected to begin determining protocols for sexual and vegetative propagation, eventually determining the ecological requirements, protocols, and potentials for 11 species of plants and shrubs, such as: Besleria sp., Cleome speciosa, Columnea sp., Gaultheria erecta, among others, which presented desirable ornamental characteristic that hopefully will be exploited.

  15. Camouflaging of seeds treated with pesticides mitigates the mortality of wild birds in wheat and rice crops Camuflagem de sementes tratadas com pesticidas mitiga a mortalidade de aves silvestres em plantações de trigo e arroz

    Directory of Open Access Journals (Sweden)

    Alexandre de Almeida

    2010-04-01

    Full Text Available Seeds used to plant wheat, corn and rice crops in Brazil are treated with the insecticide carbofuran associated with the dye rhodamine B, attracting granivorous birds and causing mortality during sowing. The objective of this study was to evaluate if using camouflaged seeds can minimize mortality caused by the ingestion of seeds with carbofuran. Alternatives for reducing mortality, such as using carbofuran without rhodamine B or replacing carbofuran by carbosulfan, were compared. Three experiments were carried out in regions of known bird mortality in the states of Paraná and São Paulo, Brazil, using conventional sowing over plowed soil in the traditional planting system, 15,896 kg of seeds in 111.46 ha. Bird carcasses were collected and dissected to unveil which poisoned seed treatments had caused birds' deaths. The mortality mounted to 296 birds of 11 species. Eared doves were the most numerous casualties (263. There was significant correlation between mortality and number of consumed seeds. The consumption of camouflaged seeds was lower than that of commercial seeds treated with rhodamine B. The mortality caused by seeds with both rhodamine B and carbofuran was higher than mortality caused by seeds camouflaged only with carbofuran. The replacement of carbofuran with carbosulfan also seemingly reduced mortality, but carbosulfan mortality might have been underestimated as a result of the apparent movement of affected birds after exposure. Seeds treated with carbofuran and rhodamine B and without any dye, were attractive. Because legal requirement for seeds treated with pesticides to be differentiated by dying, the substitution of rhodamine B by camouflaging must be encouraged.Plantações de trigo, milho e arroz no Brasil utilizam sementes tratadas com o inseticida carbofuran, associado ao corante rodamina B, que é atrativo às aves granívoras, causando notável mortalidade durante o plantio. O objetivo deste estudo foi avaliar se sementes camufladas minimizam a mortalidade de aves, causada pela ingestão de sementes tratadas com carbofuran. Possíveis alternativas para redução da mortalidade como carbofuran sem a rodamina B e o carbusulfan, foram testadas comparativamente. Realizaram-se três experimentos em regiões de expressiva mortalidade de aves no Paraná e São Paulo. Semeaduras foram convencionais sobre solo arado no sistema de plantio tradicional, utilizando 15.896 kg de sementes em 111,46 ha. Carcaças de aves foram coletadas e dissecadas, revelando quais tratamentos de sementes envenenadas causaram mortes. A mortalidade foi de 296 aves de 11 espécies. Pombas avoantes foram as vitimas mais numerosas com 263 mortes. Houve correlação significativa entre mortalidade e quantidade de sementes consumidas. O consumo de sementes camufladas e com carbofuran foi menor em relação ao de sementes com rodamina B e com carbosulfan. A mortalidade causada por sementes com rodamina B e carbofuran foi maior em relação à causada por sementes camufladas e com carbofuran, que foi igual à causada por sementes com rodamina B e carbosulfan, cujo inventário foi subestimado. Sementes tratadas com carbofuran, com e sem rodamina B, foram atrativas. Como sementes tratadas com agrotóxicos devem por lei receber coloração diferenciada para evitar acidentes com humanos, camuflagem de sementes deve ser encorajada substituindo a rodamina B.

  16. Caracterización fenológica, morfológica, fisiológica, fitoquímica, y molecular de las especies silvestres españolas del género Crocus.

    OpenAIRE

    PASTOR FÉRRIZ, MARÍA TERESA

    2016-01-01

    [EN] The genus Crocus belonging to the family Iridaceae, is known for its cultivated species, saffron (Crocus sativus L.). The genus includes about 100 species, many of which are of interest as ornamentals for their products or secondary metabolism, and others are exclusively wild. On the whole, they are a source of genetic variability of enormous interest. The rapid disappearance of the culture of saffron in Europe due to the significant amount of manpower required, has led to significant...

  17. Estudio jurídico sobre la aplicación del proceso sancionatorio ambiental para la protección de la fauna silvestre en tres municipios del departamento del Chocó, 2005-2010

    OpenAIRE

    Lisneider Hinestroza Cuesta; Darwin Yesid Cuesta Palacios; Sailyn Yubely Cossio Ramírez; Marisela Mena Valencia

    2012-01-01

    El régimen sancionatorio ambiental se define como el conjunto de normas, procedimientos y/o acciones utilizados para imponer los correctivos administrativos y castigar al que infringe o viola las normas ambientales vigentes, para garantizar la conservación del medio ambiente y el uso racional de los recursos naturales. Con el objetivo de analizar desde un enfoque jurídico su aplicación y el cumplimiento de las funciones administrativas de las Autoridades Ambientales, asignadas por la Ley 99 d...

  18. ¿Es posible la recuperación de especies silvestres extintas a través de la transferencia somática nuclear? Is the recovery of extinct wild species through somatic nuclear transfer possible?

    Directory of Open Access Journals (Sweden)

    Janet López-Saucedo

    2010-08-01

    Full Text Available El avance de las ciencias biomédicas está llegando a campos inexplorados y sorprendentes; en fecha reciente, se ponderó la posibilidad de "recuperar" especies extintas al publicarse la "resurrección" de la primera subespecie extinta: el bucardo. No obstante, la incorporación de técnicas reproductivas avanzadas en el mundo de la conservación biológica se mantiene hasta ahora limitada e incluso, en ocasiones, mal encaminada. Los factores involucrados en este pobre desarrollo son diversos, pero uno de los más importantes es el rechazo de la comunidad "conservacionista" a las estrategias de alta tecnología. Sin embargo, considerando que México es un país megadiverso, con un gran número de especies de mamíferos amenazados, es urgente la necesidad de que se incorporen herramientas biotecnológicas al estudio y conservación de las especies del país, y más aún, que sean las mismas comunidades científicas latinoamericanas quienes desarrollen y utilicen sus propias herramientas. En esta nota, se discuten los avances científicos que proponen la transferencia somática nuclear como una herramienta de conservación, sus posibilidades reales, las necesidades y sugerencias para su aplicación y desarrollo con el fin de convertir la biotecnología moderna en instrumento para la lucha por la conservación de las especies amenazadas de México y Latinoamérica.The advances in the world of the biomedical sciences are reaching unexplored and unexpected areas, such as the possibility of "recovering" extinct species. This has been highlighted by the recent publication of the "resurrection" of the first extinct subspecies: the Pyrenean ibex. Nevertheless, the incorporation of advanced reproductive techniques in the world of biological conservation has been limited until now and in occasions even misguided. The factors involved in this slow development are diverse but the most important one is the rejection by the "conservationist" community to high technology approaches. However, considering that Mexico is one of the megadiverse countries with a great number of species of threatened mammals, biotechnological tools are urgently needed for conservation research of Mexican species. Furthermore, these tools need to be utilized and developed by our own scientific Latin-American community. In this note, we discuss the scientific advances that have proposed the use of somatic nuclear transfer as a conservation tool, its real possibilities, the needs and suggestions for its development in threatened Mexican / Latin-American mammal species that should allow modern biotechnology to turn into one more tool in the battle of biological conservation.

  19. OBTENCIÓN DE CEPAS Y PRODUCCIÓN DE INÓCULO DE CINCO ESPECIES DE HONGOS SILVESTRES COMESTIBLES DE ALTA MONTAÑA EN EL CENTRO DE MÉXICO

    Directory of Open Access Journals (Sweden)

    Yolanda Arana-Gabriel

    2014-01-01

    Full Text Available Se obtuvieron cepas de Psathyrella spadicea , Floccularia aff. luteovirens , Clitocybe squamulosa , Flammulina mexicana y Lyophyllum aff. shimeji , cuyos esporomas son recolectados y consumi - dos por habitantes del Nevado de Toluca, México. Las cepas se estudiaron in vitro en seis medios de cultivo (ACP: Agar croquetas de perro, AM: Agar maíz, PDA-PL: Agar papa dextrosa-pepto - na y levadura, EMA-PL: Agar extracto de malta-peptona y levadura, PDA y EMA a 18 °C y 25 °C. Las especies se desarrollaron satisfactoriamente a 18 °C , siendo F. mexicana y L . aff. shimeji las que tuvieron mayor velocidad de crecimiento y producción de biomasa. Flammulina mexicana solo se desarrolló a 18 °C, presentando mayor crecimiento y producción de biomasa en ACP. La cepa de L. aff. shimeji creció a 18 y 25 °C, la mayor velocidad de crecimiento se registró en medio PDA a 18 °C y la mayor producción de biomasa en EMA-PL a 18 °C. Considerando las mejores condiciones para el desarrollo de micelio in vitro, se produjo inóculo primario de F. mexicana y L . aff. shimeji en trigo y sorgo. La mayor densidad del micelio y porcentaje de grano cubierto se obtuvieron con el sustrato de trigo.

  20. Caracterización de la generación segregante de un híbrido de tomate con genes nor y silvestres Characterization of the segregating generation of a tomato hybrid carrying nor and exotic genes

    Directory of Open Access Journals (Sweden)

    Gustavo Rodríguez

    2005-01-01

    Full Text Available El objetivo del trabajo fue estudiar en la generación segregante del híbrido entre una cultivar de Lycopersicon esculentum homocigota para el gen nor y la accesión LA1385 de L. esculentum var. cerasiforme, la recombinación de caracteres productivos y de calidad de fruto a través de las metodologías de análisis multivariado. En las generaciones F1 y F2 y en los progenitores se evaluaron caracteres vegetativos y productivos (longitud de entrenudos, perímetro del tallo en las partes basal, media y apical, número de flores por inflorescencia, número de inflorescencias por planta y días a cosecha y de calidad de fruto (peso, forma, sólidos solubles, acidez, firmeza, color y vida poscosecha. Se utilizaron las correlaciones canónicas entre los caracteres vegetativos y productivos y los de calidad de fruto y también un análisis de agrupamiento para las características del fruto, incluyendo los progenitores, la F1 y la F2. Estos análisis permitieron demostrar que las características productivas y de calidad de fruto recombinaron en la generación segregante. La vida poscosecha fue la característica de los frutos más importante para discriminar grupos en la F2. Para tres niveles de agrupamiento cada grupo de individuos F2 se comportó como alguno de los progenitores o la F1.The objective of this work was to study recombination of the productive and fruit quality traits in the segregating generation of the hybrid between a cultivated variety of Lycopersicon esculentum homozygous for nor and the accession LA1385 of L. esculentum var. cerasiforme using multivariate statistical analysis. F1 and F2 generations and the parents were evaluated for vegetative and productive traits (internode length, stem perimeter at the basal, middle and apical parts, number of flowers per cluster, number of clusters per plant and days to harvest and quality fruit traits (weight, shape, soluble solids content, acidity, firmness, color and shelf life. A canonical correlation between vegetative and productive traits and those of fruit quality and clustering for fruit traits performed with the F1 and F2 and the parents were used. The productive and fruit quality traits showed recombination in the segregating generation. Shelf life was the most outstanding fruit trait to discriminate groups in the F2. For three cluster levels each group of F2 individuals behaved each one of the parents and the F1.

  1. Optimización del manejo sustentable de una población silvestre de guanacos (Lama guanicoe) mediante modelos de simulación

    OpenAIRE

    Zubillaga, María

    2017-01-01

    Esta Tesis tiene como objetivo el desarrollo de una serie de modelos predictivos para describir la dinámica poblacional del guanaco (Lama guanicoe) con el fin de elaborar un modelo de manejo sustentable para esta especie. Dado que las predicciones de estos modelos pueden estar afectadas por una serie de factores, generalmente de naturaleza aleatoria, se pusieron a prueba una serie de metodologías para evaluar e incorporar dicha aleatoriedad (tanto demográfica como ambiental) en los modelos de...

  2. Utilização de pelos de animais silvestres para monitoramento ambiental de Cd, Cr, Cu, Fe, Mn, Pb e Zn Utilization of wild animal hair for the environmental monitoring of Cd, Cr, Cu, Fe, Mn, Pb e Zn

    Directory of Open Access Journals (Sweden)

    Carlos Henrique Hoff Brait

    2009-01-01

    Full Text Available This study investigates the use of wild animal hair of C. brachyurus, C. thous and L. pardalis as biomonitors of trace metal at Parque Nacional das Emas, Brazil. Results reveal a strong correlation between Cd and Pb as well as Cu and Zn, which suggests a single source of emission. Most metals showed a lower or equal concentration than those obtained in previous studies. The research shows that monitoring may be performed only with Zn, Pb, Cd, and Cr because of statistical similarity and of a non-natural occurrence of large amounts of the material under analysis.

  3. Aproximación al Análisis de Bioquímica Sanguínea y Uroanálisis en Animales Silvestres y Especies no Convencionales

    OpenAIRE

    Julieannie Ruíz-Rodríguez

    2013-01-01

    Décadas atrás, la Medicina Veterinaria enfocaba su diagnóstico a los signos y síntomas observados en el animal, determinando de esta manera el tratamiento a instaurar; al correr de los años, por la variación sintomatológica en los individuos, los hallazgos sobre nuevos microorganismos y la diversidad de patologías presentes, los profesionales veterinarios se han visto en la necesidad de hacer uso de herramientas valiosas, entre estas los análisis clínicos para diagnóstico de las patologías de...

  4. Estudos dos agrupamentos vegetativos relacionados com as áreas onde foram efetuadas as pesquisas sôbre a febre amarela silvestre no Município de Passos, Estado de Minas Gerais

    Directory of Open Access Journals (Sweden)

    Henrique P. Veloso

    1947-09-01

    Full Text Available The work reported here was carried-out on the invitation of Dr. Henry Kumm, Director of the Rockefeller Foundation, and by appointment from Dr. Henrique Aragão, Director of the Instituto Oswaldo Cruz. It was done during the investigation of sylvan yellow fever, in June 1947, with a view to establishing the phyto-ecological conditions of the county of Passos. The pe¬riod was, however, too short for definite conclusions to be reached. Thanks are due to Dr. O. R. Causey, Chief of Research on Yellow Fever for transpor¬tation and other help. THE REGIONAL VEGETATION. Aerial photographs of the county of Passos shoto that it is covered by three great types of vegetation: Rain Forest, Secondary Pasture Land and Scrub.1 Detailed investigation, however, brings out the fact that these correspond to different seres; furthermore, each type presents not only the specific, characteristics of the biological form dominant for the climate, but also are at various stages, which express HABITATS differing from those of the normal sere. The phytogeographic survey of the region shows that most of it is now covered by secondary pasture land (disclimax in which Melinis minutiflora, v. "fat grass" (fig. 1, predominates. The mosaic of Rain Forest and of small patches of Scrub reveals the effects of human intervention (BARRETO, H. L. de Mello 1; consequently, all the formations have to be regarded as secon¬dary, though some of them probably include relicts of the primitive climax (WARMING, E. 2. On close examination, the Scrub cannot be considered as the climax, because of the following facts: 1. In the zone of Rain-Forest stretches of forest are present in very varied topographic conditions and the reconstitution of the associations show that man has destroyed an ecological unit (fig. 2. 2. In the zone of Scrub the characteristic patches are small. The banks of rivers and brooks, the valleys and ravine and whatever the soil has retained some humidity, is being invaded fry Rain Forest, which seems to be growing under optimum conditions. The Scrub is thus limited to small belts on the calcareous mountains and on sandy soils with alcaline depths (pH abo¬ve 7 which do not retain enough moisture for the Rain Forest that is progres¬sively restricting the area occupied by Scrub. In view of the topographic and present climatic conditions the Rain Forest must consequently be regarded as the regional climax. The presence of ecologically contradictory elements and associations shows that the real problem is that of the fluctuations of the climate of Passos or even of Minas Geraes during the quaternary and recent periods (DAN-SEREAU, P. : 3, a subject on which little is known and which is tied to the evolution of the climate of Brazil (OLIVEIRA, E. : 4 . The transformation of Scrub into Rain Forest has been - observed by the author before, in other parts of Brazil (VELOSO, PL P.: 5 . It seems probable that the Rio Grande has also greatly influenced the change of the regional vegetation, by invading areas of Scrub and dislocating the limit of the Pluvial climate towards the Canastra Range, though there are remnants of Scrub (postclimax transfor¬med into secondary open country (disclimax, fig. 5 by human devastation and the setting of fire to the land. VEGETATION GROUPS OF THE PLUVIAL TYPE. The map of the region also shows that at the present time the small patches of forest (whether devasted or intact occupy the least accessible places, such as valleys, peaks and abrupt slopes (fig. 2. Even these are now being destroyed, so that in the near future this forested region will be en¬tirely reduced to poor pasture land unless energetic measures of conservation are undertaken in time. The Special Service for Prophylaxis against Yellow Fever installed two of their four Stations for the Capture of Mosquitos in this area, one of them at Batatal and the other at Cachoeira, which have separate formations each of them composed of several associations. Other vegetation formations were also analysed, from the synecological point of view, so as to ascertain of which degree of succession their associations belong. These phytosociological sur¬veys give an idea of the principal characteristics of each station. BATATAL FORMATION. The abrupt nature of the valley has rendered this location inappropriate for agricultural purposes since colonial times. The relict of the primitive forest climax saved by this circumstance has expanded gradually to zones whose paedologic conditions favour the eatablishment of mesophilous species. The aerial photograph shows two small stretches of forest, one apparently primi¬tive, the other composed of associations belonging to the subclimax of the subsere. CACHOEIRA FORMATION. Aerial photographs show that this station is crossed by a small river, which divides it into two separate parts. The first, which presents ecological conditions similar, though not identical to those of Batatal, is favoured by topography and apparently remains primitive forest. Though the topography of the other, on the whole, favours the establishment of groups belonging to the normal sere of the climax, is has been partly devastated recently and the aspect of the associations has been completely modified. It was is this part that the four posts for the capturing of mosquitos were set up. The first forest is favoured by deposition of organic matter, washed out from the nearby devasted areas by torrential rains, and thus provides, an appropriate HABITAT for the climax species with certain hygrophilous trends of the ecological quasiclimax type. This association seems to have reached a biological equilibrium, as the dominates. Gallesia gorarema and Cariniana legalis (fig. 10, present an optimum vitality with a vigorous habit and a normal evolutionary cycle. The Cariniantum legalis Gallesiosum equilibrium, corresponds however, to a provisory association, because if the moving of soil by torrential rains should cease it would become possible…

  5. Animales silvestres como reservorios de leptospirosis en Chile: Una revisión de los estudios efectuados en el país Wild animals as reservoirs of leptospirosis in Chile.: Revision of studies in the country

    OpenAIRE

    Zamora, J; S Riedemann

    1999-01-01

    Se entrega información sobre ratas y ratones capturados en laprovincia de Valdivia que actúan como reservorios de serovares deLeptospirainterrogans y Leptospira borgpeterseni, así como tambiénse dan a conocer resultados de otras especies animales capturados en lazona central del país. Se analizan los porcentajes de positividaddetectados por especie animal y el consecuente riesgo que significan estosreservorios animales para los animales domésticos y para el hombre. Se completa la información ...

  6. ¿Se correlacionan los ataques de jaguares Panthera onca y pumas Puma concolor (Carnivora: Felidae al ganado con la riqueza de especies y la abundancia relativa de presas silvestres?

    Directory of Open Access Journals (Sweden)

    Albert Burgas

    2014-12-01

    Full Text Available Los ataques de grandes felinos al ganado son una de las principales causas de conflicto entre humanos y felinos, siendo por ello un tema prioritario para la conservación de estas especies. Se ha argumentado que la reducción en abundancia de presas naturales incrementa la ocurrencia de ataques a las especies domésticas. Sin embargo son pocos los estudios que han evaluado esta afirmación, algunos con resultados contradictorios. Nosotros investigamos cómo la ocurrencia de ataques al ganado, por parte de puma o jaguar, se relaciona con la abundancia y la riqueza de sus presas naturales. Muestreamos las presas potenciales contando los rastros de presencia a lo largo de transectos lineales en 14 fincas sin ataques (control y en 14 fincas con ataques en el Noroeste de Costa Rica durante la temporada lluviosa de 2009. Encontramos una relación negativa entre la ocurrencia de ataques al ganado y la riqueza (p=0.0014 y abundancia (p=0.0012 de presas naturales. Nuestros resultados respaldan la aplicación de medidas que promuevan el mantenimiento y recuperación de las presas naturales como medida para reducir los ataques al ganado y conservar las poblaciones de puma y jaguar.

  7. Evaluación de la diversidad morfológica en Crotalaria incana L. (Fabaceae, Faboideae, una leguminosa silvestre de valor forrajero Evaluation of morphological diversity in Crotalaria incana L. (Fabaceae, Faboideae, a native forage legume

    Directory of Open Access Journals (Sweden)

    A. M. Planchuelo

    2011-06-01

    Full Text Available Crotalaria incana L. es una leguminosa subtropical de valor forrajero. Estudios morfológicos mostraron que las poblaciones cordobesas tienen similitud con C. megapotamica Burkart, endémica de Entre Ríos. Se estudiaron 58 materiales de herbario considerados unidades taxonómicas operacionales (OTUs. Se analizaron 58 caracteres exomorfológicos de los cuales 17 formaron parte de una matriz evaluada mediante análisis multivariado y componentes principales. El fenograma y los componentes principales separan las 58 OTUs en dos grupos diferenciados por la pubescencia, largo y ancho de los folíolos y largo de los pelos. Los caracteres atribuidos a C. megapotamica tienen valor discriminante positivo que no justifica su inclusión en la sinonimia de C. incana, pero a su vez, no tienen una gran significación taxonómica como para que C. megapotamica sea una especie independiente. Se establece que los materiales de Córdoba y de toda la Argentina sean tratados como un complejo taxonómico, denominado Crotalaria incana L. sensu lato. Se recomienda llamar a los grupos identificados como Grupo 1 y Grupo 2, hasta resolver los estatus nomenclaturales mediante estudios de tipos, revisión de nombres científicos y establecimiento de las correctas sinonimias. Se provee descripción morfológica e ilustración de C. incana L. s.l. y se listan los materiales estudiados.Crotalaria incana L. is subtropical forage legume. Morphological studies reveled that the population growing in Cordoba is similar to C. megaponamica Burkart, endemic of Entre Rios. Fifty eight herbarium specimens considered as operational taxonomic units (OTUs were studied. Fifty eight morphological characters were analyzed using statistical techniques and 17 characters were used for cluster and principal component analyses. The phenogram and the principal components separate the 58 OTUs in two groups, identified by characters related with pubescence of vegetative organs, length and width of leaflets and the hairs lengths. The morphological characters attributed to C. megapotamica have some discriminate values which suggest that is not a synonym of C. incana; however, the taxonomic values (of said characters are not strong enough to allowed C. megapotamica be considered as independent species. It was established that the materials from Córdoba and the rest of the country be considered as a taxonomic complex named Crotalaria incana L. sensu lato. It was recommended to name the two identified groups: Group 1 and Group 2 until the nomenclature status is resolved through analysis of type, nomenclature revision, and determination of correct synonyms. Morphological description, illustration and studied materials are provided for C. incana L. s.l.

  8. Aedes albopictus em área rural do Brasil e implicações na transmissão de febre amarela silvestre Aedes albopictus in rural zone of Brazil and its implication in the sylvatic yellow fever transmission

    Directory of Open Access Journals (Sweden)

    Almério de Castro Gomes

    1999-02-01

    Full Text Available Durante estudos ecológicos sobre mosquitos anofelíneos no município de Bataguassu, Estado de Mato Grosso do Sul, foram encontradas larvas e adultos de Aedes albopictus. Pela primeira vez sua introdução ocorre numa área enzoótica do vírus selvático da febre amarela no Brasil. Isto sugere risco potencial para transferência desse vírus para área urbana infestada com Aedes aegypti.Larvae and adult forms of Aedes albopictus were found during ecological study of anopheline mosquitos in the rural zone of the state of Mato Grosso do Sul in Brazil. This occurrence was registered, for the first time in Brazil, in an enzoootic area if sylvatic yellow fever virus. This implies a potential risk of the transfer of this virus to an urban area infested with Aedes aegypti.

  9. Estudio jurídico sobre la aplicación del proceso sancionatorio ambiental para la protección de la fauna silvestre en tres municipios del departamento del Chocó, 2005-2010

    Directory of Open Access Journals (Sweden)

    Lisneider Hinestroza Cuesta

    2012-01-01

    Full Text Available El régimen sancionatorio ambiental se define como el conjunto de normas, procedimientos y/o acciones utilizados para imponer los correctivos administrativos y castigar al que infringe o viola las normas ambientales vigentes, para garantizar la conservación del medio ambiente y el uso racional de los recursos naturales. Con el objetivo de analizar desde un enfoque jurídico su aplicación y el cumplimiento de las funciones administrativas de las Autoridades Ambientales, asignadas por la Ley 99 de 1993, la Ley 1333 de 2009, decretos y resoluciones que la reglamentan, se realizó una investigación de tipo descriptivo en los municipios de Istmina, Riosucio y Quibdó, en el departamento del Chocó, a partir del estudio de casos, análisis de legislación ambiental nacional y jurisprudencia de la Corte Constitucional colombiana, determinando las competencias de la autoridad ambiental con jurisdicción en la región (Corporación Autónoma Regional para el Desarrollo Sostenible del Chocó, CODECHOCÓ. No existen reportes concretos sobre la imposición de sanciones ambientales para la protección del recurso fauna durante los años 2005 a 2010 y se presentan en medios de comunicación local y por la comunidad en general cuestionamientos sobre el ejercicio de la potestad sancionatoria de esta autoridad ambiental.

  10. Caracterização química e valor nutricional dos frutos de Byrsonima myricifolia Griseb (Malpighiaceae – alimento de aves silvestres. Chemical composition and nutritional value of fruits of Byrsonima myricifolia Griseb (Malpighiaceae – avifauna food.

    Directory of Open Access Journals (Sweden)

    Elisabeth de OLIVEIRA

    2007-06-01

    Full Text Available Frutos maduros de Byrsonima myricifoliaGriseb (murici, pertencente à família Malpighiaceae,provenientes do Núcleo Curucutu do ParqueEstadual da Serra do Mar, Estado de São Paulo,foram avaliados quanto à sua composição químicae potencial nutricional. Os frutos, muito procuradospela avifauna local, foram coletados e sua polpasubmetida à análise química, segundo as NormasAnalíticas do Instituto Adolfo Lutz. A determinaçãodos elementos inorgânicos foi realizada através dadigestão ácida da amostra em HNO3 a 30% v/v,assistida por radiação de microondas e quantificada através da técnica da espectrometria de emissãoótica acoplada ao plasma por indução (ICP-OES.A polpa se mostrou ácida (pH = 3,6, com altosteores de substâncias voláteis (80,7% p/p, açúcares(6,7% p/p e fibras alimentares (9,4% p/p.Apresentou baixos teores de lipídios (1,3% p/pe proteínas (1,3% p/p. Quanto aos minerais,mostrou-se rica nos elementos K, Na, Ca e Mg enos microelementos Cu, Zn, Fe e V. A presença doelemento Pb evidenciou problemas de contaminaçãoantrópica no local de coleta. Mature fruits of Byrsonima myricifoliaGriseb (murici, belonging to the Malpighiaceaefamily and proceeding from Serra do Mar StatePark, Curucutu Nucleus, São Paulo State, wereevaluated concerning to the chemical compositionand nutritional potential. The fruits are frequentlysearched by the local avifauna. They were collectedand their pulp was submitted to chemical analysisaccording to the norms of the Adolfo Lutz Institute.The determination of the inorganic elements wasmade through the acid digestion of the sample inHNO3 at 30% v/v, aided by microwaves radiation,and quantified through the technique of ICP-OES.The pulp was acid (pH = 3.6 and with high contentsof volatile substances (80.7% w/w, sugar (6.7% w/w,and alimentary fibers (9.4% w/w. The pulp presentedlow level of fat (1.3% w/w and protein (1.3% w/w.As for the minerals, they were rich in theelements K, Na, Mg and Ca, and in the essentialmicroelements Cu, Zn, Fe and V. The presence ofPb element evidenced problems of anthropiccontamination in the place of the collect.

  11. INFOINCLUSÃO EM PIRAÍ DIGITAL: EVIDÊNCIAS EMPÍRICAS A PARTIR DA TEORIA ATOR-REDE

    Directory of Open Access Journals (Sweden)

    Adonai Teles

    2012-08-01

    Full Text Available O artigo apresenta o status quo do programa Piraí Digital, com base na Teoria Ator-Rede (ANT e no modelo heurístico de inclusão digital (2iD. Numa primeira etapa desta pesquisa, o modelo heurístico original foi expandido com base nos pressupostos da ANT, gerando uma versão mais adequada (e2iD para a observação do fenômeno da infoinclusão em Piraí. Em seguida, a ANT foi adotada como suporte metodológico para que os autores, por meio de entrevistas e observação direta, compreendessem, sob a ótica dos atores ouvidos, como a infoinclusão tem ocorrido no município de Piraí. A partir daí, os resultados são apresentados com base na taxonomia da ANT e dos elementos do modelo e2ID. O presente trabalho de pesquisa sobre a infoinclusão em Piraí começou em 2007 e se estendeu até os últimos meses de 2009. Concluiu-se que a inclusão digital em Piraí tem sido uma realidade na administração pública local, na educação e na saúde. Porém, percebeu-se que o setor produtivo e a sociedade civil local, pouco ou nada tem se beneficiado do programa em questão. Finalmente, foi possível compreender o papel dos vários atores públicos nas redes de atores da ANT e explicar porque os resultados de Piraí Digital não têm, até agora, impactado homogeneamente a sociedade local.

  12. Wild food plants traditionallly used in the province of Madrid, Central Spain.

    OpenAIRE

    Morales Valverde, Ramón; Tardío, Javier; Pascual, Higinio

    2005-01-01

    [ES]PLANTAS SILVESTRES ALIMENTARIAS USADAS TRADICIONALMENTE EN LA PROVINCIA DE MADRID, CENTRO DE ESPAN˜ A. En este trabajo se exponen los resultados obtenidos en un estudio etnobota´nico, realizado entre 1999 y 2002, sobre las plantas silvestres usadas tradicionalmente en la alimentacio ´n en la regio´n de Madrid, en el centro de Espan˜a. Se ha registrado el uso de 123 especies vasculares, pertenecientes a 31 familias, incluyendo verduras, frutos silvestres, plantas utilizadas ...

  13. DIDÁCTICA DESARROLLADORA: POSICIÓN DESDE EL ENFOQUE HISTÓRICO CULTURAL

    OpenAIRE

    Toruncha, José Zilberstein; Cruz, Silvia Olmedo

    2016-01-01

    ResumenEl trabajo expone una revisión de los fundamentos esenciales de una propuesta denominada Didáctica Desarrolladora, elaborada por docentes e investigadores cubanos en las dos ultimas décadas del pasado siglo (SILVESTRE, 1985; SANTOS,1989; MIEDES, SANTOS; ZILBERSTEIN, 1992; SILVESTRE et al., 1993; SILVESTRE;1999; ZILBERSTEIN, 1997, 2000, 2003b; ZILBERSTEIN; PORTELA;MCPHERSON, 1999; SILVESTRE; ZILBERSTEIN 2000a, 2000b, 2002; LEAL,2000; RICO; SANTOS; MARTÍN-VIAÑA, 2001; CASTELLANOS et al.,...

  14. Reprodução do pirá-brasília, Simpsonichthys boitonei Carvalho (Cyprinodontiformes, Rivulidae, e caracterização de seu habitat na Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística, Brasília, Distrito Federal, Brasil Reproduction of pira-brasília, Simpsonichthys boitonei Carvalho (Cyprinodontiformes, Rivulidae and its habitat characterization in the Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística, Brasília, Distrito Federal, Brazil

    Directory of Open Access Journals (Sweden)

    Oscar A. Shibatta

    2005-12-01

    Full Text Available Este trabalho teve como objetivo analisar a reprodução e as características físicas e químicas do habitat de Simpsonichthys boitonei Carvalho, 1959, uma espécie rara e endêmica do Distrito Federal. Os peixes foram coletados com peneira em uma poça temporária localizada na Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística (RECOR, bacia do rio Taquara, Distrito Federal. Os exemplares foram medidos (comprimento total em mm e pesados (peso total, peso das gônadas femininas e peso do corpo em gramas para o cálculo do fator de condição (K, do índice gonado-somático (IGS e do índice gonadal (IG. Também foram feitas análises físicas e químicas do ambiente. O brejo permaneceu com água durante oito meses (de dezembro a agosto, com transparência total, profundidade não ultrapassando 25 cm, condutividade menor que 15 µS/cm e pH entre 4,70 a 5,11. O oxigênio dissolvido variou entre 2,60 a 4,15 ppm, e a temperatura da água entre 20 a 25,5ºC. A análise da reprodução evidenciou que são peixes de desova parcelada, cujas fêmeas adultas permanecem com fator de condição alto durante boa parte da vida, diminuindo à medida que envelhecem. Os ovos foram depositados no substrato, e o período de incubação variou de 55 a 100 dias. Em laboratório esses ovos foram mantidos em água, onde 15,4% completaram o desenvolvimento embrionário. A proporção de fêmeas foi significativamente maior que a de machos. Pelas características acima, pode-se inferir que duas gerações do pirá-brasília podem ser encontradas no mesmo período de inundação.This study aims to analyze the reproduction and the physical and chemical characteristics of the habitat of Simpsonichthys boitonei Carvalho, 1959, a rare and endemic species of Distrito Federal. The fish were collected with sieve in a temporary pool located in the Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística (RECOR, rio Taquara basin, Distrito Federal. The specimens were measured (total length in mm, weighted (total weight, feminine gonad weight and body weight in grams, for calculation of condition factor (K, gonad-somatic index (IGS and gonad index (IG. Physical and chemical analyses of environment were also made. The temporary pool was filled with water for eight months (December to August, with total transparency, depth not surpassing 25 cm, conductivity smaller than 15 µS/cm and pH among 4,70 to 5,11. The dissolved oxygen varied among 2,60 to 4,15 ppm, and the temperature of the water among 20 to 25,5 ºC. The analysis of reproduction evidenced that the fish has fractional spawning, whose adult females stay with high condition factor during great part of life, but decreasing with their age. The eggs were deposited in the substratum, and the incubation period varied among 55 to 100 days. In laboratory these eggs were maintained in water, where 15,4% complete the embryonic development. The proportion of females was significantly larger than males. For the characteristics above, we can infer that at least two generations of pirá-brasília can be found in the same flood period.

  15. Disease: H01159 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H01159 Anterior segment dysgenesis (ASD), including: Anterior segment mesenchymal d...ysgenesis; Aniridia; Axenfeld-Rieger syndrome (ARS); Peters anomaly; Iridogoniodysgenesis (IRID) Anterior se...OMIM: 107250 106210 180500 602482 604229 601631 137600 261540 PMID:18989383 Summers KM, Withers SJ, Gole GA, Piras S, Taylor PJ Anter...ior segment mesenchymal dysgenesis in a large Australian family is associated with

  16. A New Typology for State-Sponsored International Terrorism

    Science.gov (United States)

    2011-12-01

    Organization NIF National Islamic Front PIJ Palestinian Islamic Jihad PIRA Provisional Irish Republican Army WMD Weapons of Mass Destruction xii THIS PAGE...Islamic Front ( NIF ) to power. The party’s leader, Hassan al-Turabi, sought to establish an Islamist state in Sudan and offered sanctuary for Islamic

  17. Understanding Why Terrorist Operations Succeed or Fail

    Science.gov (United States)

    2009-01-01

    they can draw when deciding how many members are devoted to a particular attack.13 Large groups (e.g., PIRA, Hezbollah, or the Liberation Tigers of...the food supply: The case of botulinum toxin in milk ,” Proceedings of the National Academy of Sciences, Vol. 102, No. 28, 2005, pp. 9984–9989.

  18. Primer-introduced restriction analysis polymerase chain reaction method for non-invasive prenatal testing of β-thalassemia.

    Science.gov (United States)

    Liu, Saijun; Chen, Liyuan; Zhang, Xiandong; Li, Jian; Lin, Haiying; Liu, Louhui; Xie, Jiansheng; Ge, Huijuan; Ye, Minglan; Chen, Caifen; Ji, Xingwen; Zhang, Caifen; Xu, Fengping; Jiang, Hui; Zhen, Hefu; Chen, Shiping; Wang, Wei

    2015-01-01

    We have developed a new method for non-invasive prenatal testing (NIPT) of paternally inherited fetal mutants for β-thalassemia (β-thal). Specially designed primer-introduced restriction analysis-polymerase chain reaction (PIRA-PCR) were used to detect four major mutations [IVS-II-654, HBB: c.316-197C > T; codon 17 (A > T), HBB: c.52A > T; -28 (A > G), HBB: c.-78A > G and codons 41/42 (-TTCT), HBB: c.126_129delCTTT] causing β-thal in China. The PIRA-PCR assay was first tested in a series of mixed DNA with different concentrations and mixed proportions. Subsequently, this assay was further tested in 10 plasma DNA samples collected from pregnant women. In the DNA mixture simulation test, the PIRA-PCR assay was able to detect 3.0% target genomic DNA (gDNA) mixed in 97.0% wild-type gDNA isolated from whole blood. For plasma DNA testing, the results detected by PIRA-PCR assay achieved 100.0% consistency with those obtained from the amniocentesis analysis. This new method could potentially be used for NIPT of paternally inherited fetal mutants for β-thal.

  19. NCBI nr-aa BLAST: CBRC-HSAP-06-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-06-0001 sp|Q01456|OAM_ASCSU Ovarian abundant message protein (Protein OAM...) pir||A48461 ovarian abundant message protein oam - common roundworm gb|AAA73355.1| [Ascaris lumbricoides mRNA sequence.], gene product Q01456 2e-11 52% ...

  20. NCBI nr-aa BLAST: CBRC-HSAP-02-0005 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-02-0005 sp|Q01456|OAM_ASCSU Ovarian abundant message protein (Protein OAM...) pir||A48461 ovarian abundant message protein oam - common roundworm gb|AAA73355.1| [Ascaris lumbricoides mRNA sequence.], gene product Q01456 2e-06 28% ...

  1. NCBI nr-aa BLAST: CBRC-GACU-10-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-10-0021 ref|YP_177714.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H...37Rv] pir||A70524 probable PPE protein - Mycobacterium tuberculosis (strain H37RV) emb|CAE55269.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177714.1 1e-30 41% ...

  2. Micropropagação de cebola a partir de bulbinhos induzidos in vitro Micropropagation of onion from in vitro induced bulblet

    Directory of Open Access Journals (Sweden)

    Benedita Maria Rodrigues

    1996-01-01

    Full Text Available Visando determinar um método para micropropagação a partir de bulbinhos in vitro, de cultivares de cebola (Allium cepa L., foram realizados três experimentos, avaliando-se a influência do 6-benzilaminopurina (BAP x ácido naftalenoacético (ANA e posição do explante no meio de cultura, a influência de bulbinhos desenvolvidos em diversas concentrações de sacarose e o efeito do diâmetro dos bulbinhos sobre a taxa de multiplicação in vitro. Pelos resultados, a posição vertical dos explantes mostrou maior tendência para porcentagem de regeneração nos cultivares Pira Ouro e Pirana Precoce. 0 efeito das concentrações de fitorreguladores na porcentagem de regeneração não foi verificado para o 'Pira Ouro', enquanto para o 'Pirana Precoce', porcentagem mais elevada foi obtida em 4,0 mg/L de BAP x 0,5 mg/L de ANA. Maior taxa de multiplicação foi observada para os dois cultivares em BAP (2,0 mg/L x ANA (0,25 mg/L. Bulbinhos do cultivar Pira Ouro e híbrido entre Pira Ouro e Pirana Precoce, desenvolvidos em 120 g/L de sacarose, mostraram-se mais adequados à micropropagação in vitro no material utilizado. Com relação ao diâmetro inicial do explante, o 'Pira Ouro' não mostrou diferença estatística para os parâmetros avaliados, enquanto no 'Pirana Precoce' maior porcentagem de regeneração foi obtida nos diâmetros M (5 a 10 mm e P (Series of three different experiments were carried out, in order to study the optimization of the use of bulblets obtained in vitro, in the micropropagation of the onion (Allium cepa L.. Initially, it was evaluated the effects of the interaction between two doais of 6-benzylaminopurine (BAP and naphthaleneacetic acid (NAA, and the position of the explant in the medium, for the cultivara Pira Ouro and Pirana Precoce. For 'Pira Ouro' the phytohormone concentrations did not affect the percentage of regeneration; however, for 'Pirana Precoce', the rates of 4.0 mg/L of BAP and 0.5 mg/L of NAA gave the

  3. Uso de terreno urbano y rural en Puerto Rico

    Science.gov (United States)

    Sebastian Martinuzzi; William A. Gould; Olga M. Ramos Gonzalez; Maya Quinones; Michael E. Jimenez

    2008-01-01

    El Proyecto de Analisis de Gap de Puerto Rico (PRGAP) (Gould et al. 2008) desarrollo tres usos de terrenos para Puerto Rico: Urbano, Suburbano, y Rural (Martinuzzi et al. 2007). Estas regiones tambien pueden ser consideradas como urbano, densamente-poblado rural, y escasamente-poblado rural, o como urbano y area silvestre con una interfase de area silvestre-urbana. La...

  4. Características qualitativas de cultivares de cebola no sul de Minas Gerais Qualitative characteristics of onion cultivars in southern Minas Gerais State

    Directory of Open Access Journals (Sweden)

    Silvio Júlio de Rezende Chagas

    2004-02-01

    Full Text Available Com o objetivo de determinar a composição físico-química e química de cultivares de cebola (Allium cepa L., conduziu-se um ensaio na Fazenda Experimental de Lavras da EPAMIG, Lavras-MG, no período de março a setembro de 1995. O delineamento experimental foi de blocos ao acaso com quatro repetições e 6 tratamentos, constituídos pelas cultivares Baia Periforme, Crioula, Granex 33, Pira Ouro, Jubileu e Texas Grano 502. Após a cura, avaliaram-se o pH, sólidos solúveis e totais (%, acidez titulável (%, ácido pirúvico (µmol/g, açúcares totais, redutores e não-redutores (% e índice industrial dos bulbos. As cultivares Crioula, Baia Periforme, Pira Ouro e Jubileu apresentaram as maiores concentrações de sólidos totais e solúveis. A acidez mais elevada foi observada nas cultivares Crioula (0,370% e Pira Ouro (0,315%. Os maiores índices industriais foram apresentados pelas cultivares Crioula (0,87 e Baia Periforme (0,75, e os menores, pelas cultivares Texas Grano 502 (0,51 e Granex 33 (0,32.This study was carried out from March to September of 1995, in the Experimental Field of EPAMIG, Lavras-MG, Brazil, with the objective of determining the physico-chemical and chemical composition of onions from different cultivars (Allium cepa L.. The experimental design was completely randomized blocks with four repetitions and six cultivars as follow: Baia Periforme, Crioula, Granex 33, Pira Ouro, Jubileu and Texas Grano 502. After the cure it was evaluated the pH, soluble and total solids (%, titrate acidity (%, pyruvic acid (µmol/g, total sugar, reducers and non reducers (% and industrial index. The cultivars Crioula, Baia Periforme, Pira Ouro and Jubileu showed the largest concentrations of total and soluble solids. The highest acidity indexes were observed in the cultivars Crioula (0.370% and Pira Ouro (0.315%. The largest industrial indexes were found in the cultivars Crioula (0.87 and Baia Periforme (0.75, and the smallest ones in the

  5. Cosecha de microalgas con nanopartículas magnéticas

    OpenAIRE

    Diez García, Sandra

    2015-01-01

    El objetivo de este trabajo es sintetizar nanopartículas de magnetita con grupos hidroxilo y con grupos amino, y estudiar el uso de ambas en la cosecha de dos especies distintas de microalgas creciendo con distintas fuentes de nitrógeno.

  6. Etnobotánica del chile quipín (Capsucum annuum var. Glabriusculum) en la sierra gorda y semidesierto de Querétaro

    OpenAIRE

    Martínez Torres, Héctor Leonardo

    2012-01-01

    El chile silvestre, comúnmente denominado piquín (C. annuum var. glabriusculum (Dunal) Heiser & Pickersgill) ha sido identificado como el progenitor y pariente silvestre de las formas domesticadas. En México las poblaciones naturales de este taxón se encuentran ampliamente distribuidas y son aprovechadas por los habitantes del medio rural, a través de la recolección. Las poblaciones silvestres también pueden ser la mejor reserva de germoplasma útil ya que conservan los procesos evolutivos nat...

  7. Mamíferos silvestres de la Reserva Ecológica del Pedregal de San Ángel en Ciudad Universitaria, Universidad Nacional Autónoma de México, México, D. F. Wild mammals of Reserva Ecológica del Pedregal de San Ángel, Ciudad Universitaria, UNAM, Mexico, D.F.

    Directory of Open Access Journals (Sweden)

    Yolanda Hortelano-Moncada

    2009-08-01

    Full Text Available Se realizó un inventario de las especies de mamíferos que habitan en la Reserva Ecológica del Pedregal de San Ángel (REPSA. Los datos se obtuvieron a partir de registros de colecciones científicas, de recolectas recientes en el área y de consultas en literatura especializada. Los resultados comprenden 628 registros acumulados desde 1943 y corresponden a 33 especies, agrupadas en 28 géneros, 15 familias y 6 órdenes de mamíferos. La ardilla gris (Sciurus aureogaster nigrescens y el ratón del altiplano (Peromyscus melanophrys melanophrys se registran por primera vez para la REPSA; asimismo, existen 2 registros que están publicados pero no listados en los inventarios previos a la reserva, el murciélago colorado, Lasiurus blossevillii teliotis, y el cuinique, Spermophilus adocetus adocetus; en las categorías de riesgo se encuentran como amenazadas 2 especies y 1 en la de protección especial, y hay 7 endémicas de México. La Reserva es uno de los últimos reductos de material genético de especies cuya localidad tipo se encuentra en la cuenca de México. El componente mastofaunístico de la zona es importante para el mantenimiento de la biodiversidad, por lo que el estudio y la protección de este ecosistema al interior de la ciudad de México debe continuarse.This paper documents the mammals from the Reserva Ecológica del Pedregal de San Ángel. Data were gathered from records in mammal collections, the specialized literature, and through collecting efforts in the area. Records spanning 1943 to the present document the presence of 33 species, 28 genera, 15 families, and 6 orders of mammals. One squirrel and one mouse (Sciurus aureogaster nigrescens, and Peromyscus m. melanophrys are reported for the first time for the reserve. Two addtional records have been previously published but have not been included in previous inventories for the reserve: the red bat, Lasiurus blossevillii teliotis and the cuinique, Spermophilus adocetus adocetus. Two species are currently listed under the risk category of threatened, 1 is under special protection, and 7 are endemic to Mexico. This mammal component is important for the ecosystem of the area and the conservation of biodiversity. The richness of mammals of the area deserves efforts to conserve and preserve the biodiversity of this unique ecosystem within México City.

  8. Free and total testosterone levels in field males of Octodon degus (Rodentia, Octodontidae: accuracy of the hormonal regulation of behavior Niveles de testosterona libre y totales en machos silvestres de Octodon degus (Rodentia, Octodontidae: exactitud de la regulación hormonal del comportamiento

    Directory of Open Access Journals (Sweden)

    MAURICIO SOTO- GAMBOA

    2005-06-01

    Full Text Available Animals exhibit continuous seasonal changes in physiological, morphological and behavioral traits associated to their natural annual cycles. One of the most important changes in the organism occurs at the initiation of breeding season. In males these changes include activation of spermatogenesis, enhance of sexual secondary characters and an increase of aggressiveness. All of theses changes are basically regulated by testosterone, but the physiological basis of this testosterone regulation and the effective hormone proportion that acts in target tissues are unknown. In this work I evaluated the relationship between total testosterone, free testosterone associated to aggressive behavior in wild males of Octodon degus. I compared hormonal levels and aggressive behavior during pre, middle and post breeding periods. Results showed that behavioral aggressiveness was correlated with both total and free testosterone in June, during the beginning of breeding season, but not at other times. Results also indicated a lack of relationship between free and total testosterone in most of breeding period. I discuss the importance of this behavior-hormonal regulation (determined by free testosterone and the physiological importance of this mechanism to the organismLos animales presentan variaciones estacionales continuas que incluyen cambios fisiológicos, morfológicos y conductuales, asociados al ciclo anual. Estos cambios generalmente están activados por factores endógenos o exógenos, pero son regulados por el sistema endocrino de organismo. Uno de los cambios más importantes ocurre en el inicio del periodo reproductivo. Durante este periodo los machos presentan cambios asociados a la producción de esperatozoides, exacerbación de caracteres sexuales secundarios y un aumento de la agresividad. Todos estos cambios son regulados en parte por los niveles de testosterona, sin embargo, los mecanismos fisiológicos de esta regulación son desconocidos. En este trabajo evalué la relación que existe entre los niveles de testosterona libre y totales, y examiné su posible asociación con los niveles de agresividad en machos de una población natural de Octodon degus. Mis resultados indicaron que la agresividad se correlaciona directamente con los niveles de testosterona libre y totales solo durante el mes de junio, al inicio del periodo reproductivo, pero no durante el resto del ciclo reproductivo de esta especie. Esto indicaría que la agresividad solo se correlaciona con los niveles de testosterona libre ya que en el medio y el final del periodo reproductivo los niveles de testosterona se mantienen altos sin que se manifiesten dichas conductas. Finalmente, discuto la importancia de la regulación fina de la conducta determinada por la testosterona libre y la importancia fisiológica de este mecanismo de regulación dentro del organismo

  9. Estudos sôbre reservatórios e vectores silvestres do Trypanosoma cruzi. XXIV. Variação dos dados biométricos obtidos em amostras do T. cruzi isolados de casos humanos da Doença de Chagas

    Directory of Open Access Journals (Sweden)

    Francisco Ferriolli Filho

    1968-02-01

    Full Text Available Estudo biométrico de 10 amostras de Trypanosoma cruzi isoladas de casos humanos da doença de CHAGAS, nove mantidas em camundongos brancos jovens e uma mantida em ratos brancos jovens, mostrou a existência de grandes variações amostrais. Assim os valores do comprimento total médio das diferentes amostras variaram entre 16,3μ e 21,8μ., enquanto os valores do índice nuclear médio oscilaram entre 0,93 e 1,52. Êstes resultados ampliam os limites de variações amostrais até agora observadas no T. cruzi, especialmente os que se referem ao índice nuclear médio.

  10. Human population, economic activities, and wild bird conservation in Mexico: factors influencing their relationships at two different geopolitical scales Población humana, actividades económicas y conservación de aves silvestres en México: factores que influencian sus relaciones en dos escalas geopolíticas diferentes

    Directory of Open Access Journals (Sweden)

    Xavier López-Medellín

    2011-12-01

    Full Text Available Population growth poses threats to biodiversity, specifically to sensitive species. Therefore, an understanding of the conflict between biodiversity and human population is needed to enable long-term planning of development and conservation policies by state and federal governments and society based on limitations and potentials of environments. We used a geopolitical approach to analyze data on human demography, economic activities, natural vegetation, avian diversity, and protected areas of the 32 states of Mexico and the 30 districts of the state of Oaxaca. Using factor analysis, we identified the biodiversity-rich geopolitical units that have a large human population and are developing intense economic activities. We then carried out a series of linear regressions between the resulting factors to test whether they were related, suggesting areas where conservation conflicts may exist, and found that relations between human activities and natural resources vary from region to region. These results help us identify geopolitical units that require detailed studies of the interactions between population and natural resources, and also highlight the importance of using geopolitical scales as study units, where most conservation and development policies are determined, to inform local stakeholders and decision makers.El crecimiento humano representa amenazas para la biodiversidad, especialmente para especies sensibles. Se necesita conocer a fondo el conflicto que representa el crecimiento de la población para la biodiversidad y llevar a cabo políticas y acciones a largo plazo de actividades de desarrollo y conservación evaluadas por gobiernos federales y estatales, basándose en las limitaciones y potenciales de los ecosistemas. Utilizamos una aproximación geopolítica para analizar variables de demografía humana, actividades económicas, superficie de vegetación, diversidad de aves y áreas protegidas de los 32 estados de México y los 30 distritos de Oaxaca. Mediante un análisis de factores, identificamos las entidades geopolíticas con más biodiversidad con alta población humana y que desarrollan intensamente actividades económicas. Posteriormente realizamos regresiones lineales entre los factores para analizar su interrelación, lo que sugiere áreas en las que la conservación está amenazada, encontrando que estas relaciones varían en cada región. Estos resultados identifican las unidades geopolíticas que requieren un estudio detallado de la interacción entre población y recursos naturales y resaltan la importancia de utilizar una escala geopolítica, que es el nivel donde se determinan la mayor parte de las políticas de conservación y desarrollo, para proveer información detallada a usuarios y tomadores de decisiones.

  11. Estudos sôbre reservatórios e vetores silvestres do Trypanosoma cruzi: XVII. Contribuição para o estudo dos focos naturais da tripanossomose americana, com especial referência à região nordeste do Estado de São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    M. P. Barretto

    1967-04-01

    Full Text Available Depois de acentuar que a tripanossomose americana é uma zoonose do tipo anfixenose, bem enquadrável no conceito de PAVLOVSKY de infecção com focos naturais, o Autor analisa o problema da multiplicidade e diversidade dêstes focos que são devidas ao grande número de hospedeiros e vetores naturais com hábitos variados. Descreve, em seguida, alguns focos naturais mais freqüentes e importantes, observados na região nordeste do Estado de São Paulo e áreas limítrofes do Estado de Minas Gerais, focos êstes constituídos por buracos e cavidades no solo, ocos e anfractuosidades em troncos de árvores, tufos de vegetação herbácea, touceiras de piteira e copa de palmeiras, onde triatomíneos e mamíferos convivem.

  12. Estudio jurídico constitucional que fundamente una propuesta de ley que regule la indeminización, a cargo del estado, por la muerte de animales domésticos, ocasionada por especies silvestres en peligro de extinción en zonas de amortiguamiento de las áreas protegidas en el Ecuador

    OpenAIRE

    2016-01-01

    Con la vigencia de la actual Constitución de la República del Ecuador (Asamblea Constituyente, 2008), publicada en el Registro Oficial No. 449, del 20 de Octubre del 2008, la naturaleza que antes de esa fecha tenía reconocimientos legales, adquirió derechos constitucionales, tal como lo explica taxativamente el Título II, Capítulo 7, Artículos 71, 72, 73 y 74 de la referida Carta Magna. En lo medular, esta institución jurídica de orden constitucional se refiere al derecho que tiene la natu...

  13. Repercusión de la presencia de ectoparásitos hematófagos en el cuadro hematológicos de pichones de cotorra silvestre - Impact of the presence of ectoparasitos hematofagos in table haematological pigeons from wild parrot

    Directory of Open Access Journals (Sweden)

    Soto Piñeiro, Carlos J.

    2007-12-01

    Full Text Available Resumen Al realizar una investigación de terreno en La Reserva Ecológica los Indios durante el mes de Mayo del año 2004 se pudo apreciar la elevada presencia de ácaros ectoparásitos en pichones de Cotorra Cubana (Amazona l. leucocephala y la repercusión de esta invasión de ectoparásitos hematófagos en el cuadro hematológico en estas aves. Factor importante para valorar el estado de salud de las mismas. Estas labores permitirán un trabajo de monitoreo y toma de medidas que facilitarán la preservación de esta especie conociendo que factores pueden con mayor importancia afectarla en su ambiente natural. Abstract A survey at Los Indios Ecological Reserve carried out in May 2004 has revealed a high presence of ectoparasitic mites in Cuban Amazon (Amazona l.leucocephala chicks. The survey has proved useful in stating the effcts of the infection at the hemathological level, an important factor to evaluate the state of health of the birds. The current analysis will allow the monitoring and the measures that will facilitate the conservation of this species throughout acknowledging the most relevant factors that affect this species in its natural habitat.

  14. Removal new alternative to chemical and mechanical removal for the study of pollen carried on the wild bee scopae Remoción química como nueva alternativa a la remoción mecánica para el estudio del polen transportado en las escopas de abejas silvestres

    Directory of Open Access Journals (Sweden)

    Marta Caccavari

    2010-12-01

    Full Text Available Taxonomic recognition and quantification of the different pollen types collected by bees offer the most direct method to study the diet. To determine the importance of each plant taxon, it is necessary to separate the pollen deposited only in the collecting structures in order to minimize contamination of grains collected passively in other parts of the body. The technique currently applied is based on the mechanical removal of the pollen loads with dissecting needles and repeated washings with ethanol. Metathoracic scopae that underwent this procedure showed traces of pollen in varying amounts when observed under the microscope. As an alternative to this technique chemical removal using HOK is proposed. The leg is removed and treated separatedly to avoid contamination. The deflocculant properties of HOK successfully allowed to separate the pollen adhered to the scopae, which can be then returned to the individual, unaffected by the procedure. Suspend the pollen in a know quantity of mounting fluid permit take the subsamples and determine the total number of pollen grains of each taxon. In this paper, the new technique is presented and its effectiveness is compared to the technique currenty used.El reconocimiento taxonómico y la cuantificación de los distintos tipos polínicos colectados por las abejas ofrecen el método más directo para estudiar la dieta. Para determinar la importancia de cada taxón vegetal y minimizar la contaminación, es necesario separar el polen depositado en las estructuras de colecta, de los granos recolectados en forma pasiva en otras partes del cuerpo. La técnica que se aplica hasta el momento se basa en la remoción mecánica de las cargas polínicas con agujas de disección y sucesivos lavados con etanol. Escopas de patas metatoráxicas sometidas a este procedimiento al ser observadas bajo lupa presentaban aún granos de polen en cantidades variables. Como una alternativa a esta técnica proponemos la remoción química, mediante la utilización de HOK. La pata se extrae y es tratada por separado para impedir la contaminación. Las propiedades defloculantes del HOK permiten separar exitosamente el polen adherido a la escopa, la cual puede ser devuelta al ejemplar al no ser afectada por el procedimiento. Suspender todo el contenido de polen en un volumen de medio de montaje conocido y luego tomar una submuestra, permite determinar el número total de granos de polen de cada taxón. En este trabajo se presenta la nueva técnica y se compara su efectividad con la técnica utilizada hasta el momento.

  15. Aspectos ecológicos da tripanossomíase americana: XXI - Comportamento de espécies triatomíneas silvestres na reinfestação do intra e peridomicílio Ecological aspects of South American trypanosomiasis: XXI - Sylvatic triatominae behaviour related to the domiciliary and peridomiciliary environments

    Directory of Open Access Journals (Sweden)

    Oswaldo Paulo Forattini

    1984-06-01

    Full Text Available Apresentam-se os resultados obtidos com a observação da presença triatomínea em três localidades, uma delas caracterizada por estar submetida a vigilância anual ininterrupta, e duas por terem sido expurgadas respectivamente seis e um ano e meio antes. As duas primeiras situam-se em áreas de endemicidade de Panstrongylus megistus e a terceira em região endêmica para Triatoma sordida. Em todas foram levadas a efeito inspeções bimestrais destinadas a detectar a presença de triatomíneos no intra e no peridomicílio. Pôde-se confirmar o aspecto lento da domiciliação de P. megistus, em aparente contraste com o T. sordida que desenvolve intensas colônias peridomiciliares. Pelo menos em relação a esta última espécie, não parece haver diferença atrativa por parte do intra e do peridomicílio. A reinfestação do P. megistus acha-se associada freqüente com a presença de infecção natural. A reintrodução de Triatoma infestans associa-se à mobilidade da população humana. A colonização peridomiciliar de T. sordida permitiu o estudo do desenvolvimento dessas colônias, obtendo-se marcante paralelismo com os dados conseguidos em galinheiros experimentais (GE e objeto de publicações anteriores. A presença de Rhodnius neglectus nas três áreas, embora discreta, chama a atenção para seu possível potencial de domiciliação. Com este artigo encerra-se a série "Aspectos ecológicos de tripanossomíase americana".The results of observations on triatominae bugs in three localities, one of them under to active annual regular surveillance and the other two which had undergone house treatment six months and one and half years before, respectively, are reported. Two of these localities were situated in the dispersal center region of Panstrongylus megistus, and the third in the dispersal center region of Triatoma sordida. At two-monthly periods each area was submitted to dwelling inspection in the search for triatominae bugs in indoor and peridomiciliary environments. The results reached confirmed the slow speed of reinfestation by P. megistus, in apparent contrast with that of T. sordida. This latter producing colonies at a high rate in peridomiciliary environments. No difference was found between intra and peridomiciliary environments in their attraction for this bug. P. megistus reinfestation was frequently found associated with natural infection. Reintroduction of Triatoma infestans into dwellings was associated with human population mobility. The peridomiciliary colonization of T. sordida allowed the study of the development of these colonies, and remarkably similar results to those found in the experimental fowl houses previously reported on was obtained. The presence of Rhodnius neglectus was reported in all three localities and, though not prominent, it is necessary to pay some attention to this species as potential house invader.

  16. Observação de aves no Refúgio de Vida Silvestre Metrópole da Amazônia: uma contribuição para a conservação ambiental da unidade e ao desenvolvimento turístico do Estado do Pará

    OpenAIRE

    Almeida, Maria do Perpétuo Socorro Rodrigues de; Secretaria de Estado de Meio Ambiente e Sustentabilidade do Pará, Belém, PA; Bahia, Mirleide Chaar; Universidade Federal do Pará, Belém, PA; Nelson, Sherre Prince; Centro Universitário do Norte, Manaus, AM.

    2016-01-01

    As Unidades de Conservação, espaços protegidos por lei, vêm sendo mais requisitadas para diversas finalidades de uso, seja por turistas convencionais, seja pelas comunidades que residem nas imediações dessas áreas, ou ainda pela procura de atividades específicas, como é o caso dos observadores de aves, que colecionam avistamentos e enriquecem suas vidas com a contemplação desses animais, ao mesmo tempo em que colaboram para a ciência. A observação de aves ou birdwatching é uma atividade de re...

  17. Observação de aves no refúgio de vida silvestre metrópole da Amazônia: uma contribuição para a conservação ambiental da unidade e ao desenvolvimento turístico do estado do Pará

    OpenAIRE

    Almeida, Maria do Perpétuo Socorro Rodrigues de

    2013-01-01

    O ser humano atualmente tem uma grande necessidade do contato com a natureza, pois as áreas naturais estão cada vez mais distantes dos grandes centros urbanos. As Unidades de Conservação, espaços protegidos por lei, vêm sendo mais requisitadaspara diversas finalidades de uso, seja por turistas convencionais, seja pelas comunidades que residem nas imediações dessas áreas, ou ainda pela procura de atividades específicas, como é o caso dos observadores de aves, que colecionam avistamentos e enri...

  18. Propagação vegetativa de espécies silvestres do gênero Piper, com potencial para uso como porta enxertos em pimenta-do-reino (Piper nigrun Vegetative propagation of wild species of the genus Piper, with potential for use as rootstocks in black pepper (Piper nigrun

    Directory of Open Access Journals (Sweden)

    GC Magevski

    2011-01-01

    Full Text Available O estabelecimento de espécies usadas como porta-enxerto, importantes na olericultura, podem ser multiplicadas por meio da estaquia com auxílio de fitorreguladores. Objetivou-se com este trabalho avaliar a influência do AIB no estabelecimento de espécies nativas do gênero Piper com potencial de uso como porta-enxerto de Piper nigrum. Estacas de P. Arboreum, P. amplum e P. sp foram submetidas a diferentes dosagens de AIB (0, 2000, 4000, 6000 e 8000 mg.L-1 e mantidas em estufa agrícola com irrigação intermitente com temperatura e umidade controlados. O delineamento experimental utilizado foi inteiramente casualizado em esquema fatorial 3x5 (3 espécies de Piper x 5 dosagens de AIB e composto por 3 repetições por tratamento, sendo cada parcela composta por 10 estacas. A avaliação foi realizada aos 45 dias de transplantio e as variáveis analisadas foram: índice de sobrevivência, número médio de folhas, número médio de brotos e comprimento médio do maior broto. A espécie Piper arboreum apresentou bons resultados referentes ao crescimento da parte aérea independentemente da concentração de AIB empregada.The establishment of species used as rootstock, which are important in horticulture crop scan may be multiplied, with the aid of growth regulators, by cutting. The objective of this study was to evaluate the influence of IBA on the establishment of native species of the genus Piper with potential use as rootstock of Piper nigrum. Cuttings of P. arboreum, P. amplum and P. sp were treated with different concentrations of IBA (0 ,2000, 4000, 6000 and 8000mg.L-1 and maintained in a greenhouse with intermittent irrigation, with the temperature and humidity controlled. The experimental design was completely randomized in a factorial 3x5 plan (3 Piper species x5 doses of IBA and comprising of three repetitions per treatment, each plot consisting of 10 cuttings. The evaluation was performed at 45 days of transplanting and the analyzed variables were: survival rate, the number of leaves, the number of shoots and the length of the largest shoot. The Piper arboretum species showed the best growth results for the aerial part independent of the IBA concentration used.

  19. Levantamento da fauna de abelhas silvestres na "zona da mata" de Minas Gerais: III. Mata secundária na região de Viçosa (Hymenoptera, Apoidea Survey of the wild bees of the "zona da mata" of Minas Gerais, Brazil: III. Secondary forest in Viçosa region (Hymenoptera, Apoidea

    Directory of Open Access Journals (Sweden)

    José Ricardo Cure

    1992-01-01

    Full Text Available The outcome of a wild bee fauna survey in a secondary forest is reported. Sampling was carried out mainly on herbaceous and shrubby vegetation under and at the border of the forest. Results are compared with data collected with the same methodology from a previously surveyed grassland nearby. The secondary forest was richer in Anthophoridae and Apidae species, and less diverse in Megachilidae. Similarity between the two habitats was low. Several unidentified species of Ceratinula, Trichocerapis mirabilis and the stingless bees Melipona bicolor, M. quadrifasciata, M. marginata, Paratrigona subnuda, Scaptotrigona tubiba and S. xanthotricha, are among the species dependent on the forest environment to survive. Bee population densities in the forest understory are as large as the largest values found for open vegetation in Southeastern Brazil; species richness is also comparable to those of other areas in Southeastern Brazil. Sampling strategies are discussed.

  20. A vegetação no município de Ilhéus, Estado da Bahia: I - estudo sinecológico das áreas de pesquisas sôbre a febre amarela silvestre realizado pelo S. E. P. F. A

    Directory of Open Access Journals (Sweden)

    Henrique P. Veloso

    1946-03-01

    Full Text Available I - Methods. II - Phytogeographic aspects. III - The communities and botanical associations: a The lava Pés-Castelo Novo study area. b The study area at the Pirataquissé farm. c The Ribeirão da Fortuna study area. IV - Conclusions.

  1. A list of mosquito species of the Brazilian State of Pernambuco, including the first report of Haemagogus janthinomys (Diptera: Culicidae, yellow fever vector and 14 other species (Diptera: Culicidae Lista de espécies de mosquitos do Estado de Pernambuco e primeiro relato de Haemagogus janthinomys (Diptera: Culicidae vetor de febre amarela silvestre e outras 14 espécies (Diptera: Culicidae

    Directory of Open Access Journals (Sweden)

    Nádia Consuelo Aragão

    2010-08-01

    Full Text Available INTRODUCTION: Besides mosquito species adapted to urban environments (Culex quinquefasciatus, Aedes aegypti and Aedes albopictus, only 15 species of Anopheles had been recorded in the State of Pernambuco. METHODS: Human-landing mosquitoes were collected in Dois Irmãos Park, in Recife. RESULTS: The first report for the state of Haemagogus janthinomys, an important vector of yellow fever virus, and 14 other species, including Trichoprosopon lampropus, a first reported for Brazil. CONCLUSIONS: The mosquito fauna in the area is diversified and has potential medical and veterinary importance.INTRODUÇÃO: Além de mosquitos adaptados ao ambiente urbano (Culex quinquefasciatus, Aedes aegypti e Ae. albopictus, apenas 15 espécies de Anopheles haviam sido relatadas no Estado de Pernambuco. MÉTODOS: Mosquitos que pousavam em humanos no Parque Dois Irmãos, em Recife foram coletados. RESULTADOS: Haemagogus janthinomys, importante vetor de vírus de febre amarela, e outras 14 espécies são relatadas pela primeira vez no estado, incluindo Trichoprosopon lampropus, relatado pela primeira vez no Brasil. CONCLUSÕES: A fauna de mosquitos na área é muito diversificada e tem potencial importância médica e veterinária.

  2. Decoding Different Patterns in Various Grey Tones Incorporated in the QR Code

    Directory of Open Access Journals (Sweden)

    Filip Cvitić

    2014-07-01

    Full Text Available Using colors in bar codes causes errors that may adversely affect their readability (Tan etal. 2010, given that the contrast between data and background modules is reduced. Due to the unreliability of using color bar codes, most designers still keep to the limitations placed by Pira International (Smithers Pira in 2002 (Williams, 2004. Since the contrast between data modules and background modules is the most important aspect in the process of reliable bar code decoding, this paper explores the dependence of reliable decoding of QR codes incorporated with combinations of grey tones on the technical characteristics of the cameras on smartphones that were marketed in the period between 2008 and 2012.

  3. Approaches Towards the Identification of Patterns in Violent Events, Baghdad, Iraq

    Science.gov (United States)

    2009-05-01

    Gianfranco Piras May 2009 C on st ru ct io n E n gi n ee ri n g R es ea rc h L ab or at or y Approved for public release; distribution is... GIS operations. Julia Koschinsky provided logistical support. The report and its findings are those of the authors alone, and should not be attributed...news sources. While precise geocoding was not possible, there was sufficient information in the reports to associate each event with a neighborhood. A

  4. Killing Range

    OpenAIRE

    Asal, Victor; Gill, Paul; Rethemeyer, R. Karl; Horgan, John

    2015-01-01

    This paper presents an analysis of the Provisional Irish Republican Army's (PIRA) brigade level behavior during the Northern Ireland Conflict (1970-1998) and identifies the organizational factors that impact a brigade's lethality as measured via terrorist attacks. Key independent variables include levels of technical expertise, cadre age, counter-terrorism policies experienced, brigade size, and IED components and delivery methods. We find that technical expertise within a brigade allows for ...

  5. Dicty_cDB: VSD680 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nces producing significant alignments: (bits) Value VSD680 (VSD680Q) /CSM/VS/VSD6-D/VSD680Q.Seq.d/ 228 1e-59...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N (...quences producing significant alignments: (bits) Value (Q6UK63) RecName: Full=Protein pirA; &AY368270_1(AY36

  6. NCBI nr-aa BLAST: CBRC-OCUN-01-0782 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available pira borgpetersenii serovar Hardjo-bovis L550] ref|YP_801264.1| Prolipoprotein diacylglyceryltransferase [Le...ptospira borgpetersenii serovar Hardjo-bovis JB197] gb|ABJ78582.1| Prolipoprotein diacylglyceryltransferase ...[Leptospira borgpetersenii serovar Hardjo-bovis L550] gb|ABJ76506.1| Prolipoprote...in diacylglyceryltransferase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_797515.1 3.3 35% ...

  7. NCBI nr-aa BLAST: CBRC-GGAL-35-0050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-35-0050 ref|YP_177980.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] pir||A70807 hypothetical glycine-rich protein Rv3511 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55605.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177980.1 2e-18 33% ...

  8. NCBI nr-aa BLAST: CBRC-XTRO-01-2365 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2365 ref|YP_177980.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] pir||A70807 hypothetical glycine-rich protein Rv3511 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55605.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177980.1 0.17 36% ...

  9. Flora útil de los cafetales en la Sierra Norte de Puebla, México Useful plants of the Sierra Norte de Puebla, Mexico

    National Research Council Canada - National Science Library

    Miguel Ángel Martínez; Virginia Evangelista; Francisco Basurto; Myrna Mendoza; Antonio Cruz-Rivas

    2007-01-01

    Los cafetales de la Sierra Norte de Puebla son agroecosistemas variados en composición y estructura, donde se pueden encontrar especies vegetales cultivadas y silvestres, nativas e introducidas, y cuya diversidad florística está...

  10. Primer registro de Coccidae (Hemiptera: Coccoidea sobre Duchesnea indica (Rosaceae “frutilla silvestre” en Tucumán, Argentina

    Directory of Open Access Journals (Sweden)

    Patri GONZÁLEZ

    2015-01-01

    Full Text Available Se da a conocer el primer registro de la Argentina y el mundo del Coccidae Saissetia coffeae (Walker sobre Duchesnea indica (Andrews Focke, frutilla silvestre relacionada con frutilla cultivada (Fragaria x ananassa Duch.

  11. Killing Range: Explaining Lethality Variance within a Terrorist Organization.

    Science.gov (United States)

    Asal, Victor; Gill, Paul; Rethemeyer, R Karl; Horgan, John

    2015-04-01

    This paper presents an analysis of the Provisional Irish Republican Army's (PIRA) brigade level behavior during the Northern Ireland Conflict (1970-1998) and identifies the organizational factors that impact a brigade's lethality as measured via terrorist attacks. Key independent variables include levels of technical expertise, cadre age, counter-terrorism policies experienced, brigade size, and IED components and delivery methods. We find that technical expertise within a brigade allows for careful IED usage, which significantly minimizes civilian casualties (a specific strategic goal of PIRA) while increasing the ability to kill more high value targets with IEDs. Lethal counter-terrorism events also significantly affect a brigade's likelihood of killing both civilians and high-value targets but in different ways. Killing PIRA members significantly decreases IED fatalities but also significantly decreases the possibility of zero civilian IED-related deaths in a given year. Killing innocent Catholics in a Brigade's county significantly increases total and civilian IED fatalities. Together the results suggest the necessity to analyze dynamic situational variables that impact terrorist group behavior at the sub-unit level.

  12. RESERVA BIOLOGICA ALBERTO ML. BRENES: Una excepción en Costa Rica

    OpenAIRE

    2011-01-01

    Se presentan diversos aspectos históricos, legales, reglamentarios y administrativos que permiten concluir que la Reserva Biológica Alberto Ml. Brenes se constituye en una excepción en la administración y manejo dentro del sistema de áreas silvestres estatales de Costa Rica, y es una de las pocas áreas silvestres administradas, a nivel mundial, por una universidad pública.

  13. Diversidad de Triatominae (Hemiptera: Reduviidae en Santander, Colombia: implicaciones epidemiológicas

    Directory of Open Access Journals (Sweden)

    Lyda Esteban

    2017-01-01

    Conclusiones. Los resultados evidenciaron diferencias en la diversidad de las dos regiones, además del potencial de las especies silvestres para ocupar ecótopos artificiales. La intrusión de triatominos y la reciente incriminación de especies silvestres en la transmisión de Trypanosoma cruzi, indican la necesidad de un mayor conocimiento de la ecología de estos vectores para orientar las estrategias de control.

  14. Ecología de Patógenos en Pequeños Mamíferos y Quirópteros Neotropicales, Experiencias y Perspectivas -resumen-

    OpenAIRE

    Gerardo Suzán-Azpiri

    2014-01-01

    Las zoonosis emergentes y reemergentes originadas por animales silvestres han puesto en evidencia que las aproximaciones tradicionales para entender‚ prevenir y controlar infecciones quedan limitadas. El estudio de enfermedades en animales silvestres ha evidenciado que las relaciones ecológicas y evolutivas son fundamentales para entender los patrones de ocurrencia y persistencia de infecciones y para replantear estrategias de prevención y control. Los murciégalos y roedores han estado asocia...

  15. Inventario de los parasitoides de Liriomyza spp. (Diptera: Agromyzidae) en la región sur de Honduras

    OpenAIRE

    2016-01-01

    Se presenta un inventario de 25 especies de parasitoides (Hymenoptera) que atacan a tres especies de minadores foliares (Liriomyza) en tres departamentos de la región sur de Honduras. La especie predominante fue Liriomyza sativae. criada de 25 especies de cultivos y plantas silvestres. Las infestaciones de L. sativae fueron mayores en cultivos de Cucurbitaceae, Solanaceae y Fabaceae, y en las plantas silvestres Kallstroemia maxima (Zygophyllaceae) y Ricinus communis (Euphorbiaceae). Se detall...

  16. Chemical composition of oils from wild almond (Prunus scoparia and wild pistachio (Pistacia atlantica

    Directory of Open Access Journals (Sweden)

    Jafari Mohammadi, S. A.

    2013-03-01

    Full Text Available The aim of this study was to determine the fatty acids, sterols and triacylglycerol compositions as well as the amount of tocopherols, total phenols and pigments wild almond and cold pressed wild pistachio oils. Triacylglycerols, tocopherols and pigments were analyzed with HPLC, fatty acids and sterols with gas chromatography, and total phenols photometrically. The main fatty acids in both samples were oleic, linoleic and palmitic acids. The most predominant TAG species are SLL + PLO (21.83% in wild pistachio oil and OOO (47.27% in wild almond oil. Pheophytin a was the major pigment in wild pistachio oil. There were no pigments detected in wild almond oil. Total phenols were 57.6 mg kg-1 oil for wild pistachio and 45.3 mg kg-1 oil for wild almond oil.El objetivo de este estudio fue determinar la composición en ácidos grasos, esteroles, triglicéridos, así como tocoferoles, fenoles totales y pigmentos de aceites de almendras y pistachos silvestres prensados en frío. Triglicéridos (TAG, tocoferoles y pigmentos se analizaron mediante HPLC, los ácidos grasos y esteroles mediante cromatografía de gases, y los fenoles totales espectrofotométricamente. Los principales ácidos grasos de ambas especies fueron los ácidos oleico, linoleico y palmítico. Las especies de TAG predominantes son SLL + OLP (21,83% en el pistacho silvestre y OOO (47,27% en almendras silvestre. Feofitina a es un pigmento importante en los aceites de pistacho silvestre. No se detectó pigmentos en los aceites de almendras silvestres. Los fenoles totales fueron 57,6 mg kg-1 y 45,3 mg kg-1 en los aceites de pistacho silvestre y de almendra silvestre respectivamente.

  17. Déficit y oportunidades de la legislación costarricense sobre comercio electrónico: Un aporte desde la perspectiva de la seguridad, la protección de datos y los derechos del consumidor.

    OpenAIRE

    Chen Sui, Susan

    2013-01-01

    El comercio electrónico se ha desarrollado en los últimos años a un nivel mundial. De acuerdo con el Informe de la UNCTAD (2003), la Economía Digital sigue creciendo con gran empuje. En lo que se refiere a la utilización de Internet, el Informe indica que los países en desarrollo sigue n creciendo a un ritmo más rápido que los países desarrollados. A fines de 2002, el número de usuarios de Internet de los países en desarrollo representaban el 32% de los 591 millones de usuarios...

  18. Plan de educación alimentario nutricional para niños y niñas de 0 a 5 años del proyecto Municipio de Mira.

    OpenAIRE

    De Jesús Méndez, Marcia Noemí

    2013-01-01

    Mejorar las condiciones de nutrición y alimentación de los niños y niñas de 0 a 5 años con bajo peso del Proyecto CNH (Creciendo con nuestros Hijos) Municipio de Mira. El propósito fundamental es investigar el estado nutricional de los niños y niñas de 0 a 5 años que participan en el programa creciendo con nuestros hijos del Municipio de Mira provincia del Carchi. Para lo cual el estudio se desarrolló en cinco capítulos, en el primero se planteó el problema de investigación, objetivos y ju...

  19. Comunicándonos con las cosas

    Directory of Open Access Journals (Sweden)

    Miguel Delgado

    2009-09-01

    Full Text Available Tras la Web 2.0 y gracias a la colaboración entre las personas, Internet sigue creciendo y evolucionando, pero esta vez a través de los objetos. La siguiente evolución pretende que las personas puedan interactuar con las cosas de una forma inteligente mediante tecnologías ampliamente utilizadas como el teléfono móvil e Internet, y tecnologías que permitan etiquetar objetos.

  20. Primer registro del género sapranthus (annonaceae) y una nueva especie para suramérica

    OpenAIRE

    VÉLEZ-ARANGO, JUAN GONZALO; COGOLLO-PACHECO, ÁLVARO

    2012-01-01

    Se describe e ilustra una nueva especie, Sapranthus isae que se diferencia de las otrasespecies del género por sus flores fragantes y por presentar cuerpos elípticos negros en labase de los pétalos internos. La nueva especie sólo se conoce del norte de Colombia enel departamento del Cesar, Municipio de Curumaní, creciendo en afloramientos rocososde la cordillera Oriental, que se encuentran rodeados de sistemas cenagosos

  1. Comunicándonos con las cosas

    OpenAIRE

    Miguel Delgado; Sergio Ciruela; Nicolás Marín

    2009-01-01

    Tras la Web 2.0 y gracias a la colaboración entre las personas, Internet sigue creciendo y evolucionando, pero esta vez a través de los objetos. La siguiente evolución pretende que las personas puedan interactuar con las cosas de una forma inteligente mediante tecnologías ampliamente utilizadas como el teléfono móvil e Internet, y tecnologías que permitan etiquetar objetos.

  2. Análise sensorial, teores de nitrato e de nutrientes de alface cultivada em hidroponia sob águas salinas Sensory analysis, nitrate and nutrient concentration of lettuce grown in hydroponics under saline water

    Directory of Open Access Journals (Sweden)

    Dalva Paulus

    2012-03-01

    Full Text Available O presente trabalho teve como objetivos determinar os teores de nutrientes e de nitrato e realizar análise sensorial de alface cultivada em sistema hidropônico sob água salina. O experimento foi conduzido em ambiente protegido no período de dezembro de 2007 a janeiro de 2008, em Piracicaba (SP. O delineamento experimental foi de blocos ao acaso, sendo estudados cinco níveis de salinidade da água de irrigação, utilizando-se NaCl (Condutividade elétrica da água (CEa: 0,42, 1,53, 3,52, 5,55 e 7,43 dS m-1 em duas cultivares de alface (Verônica e Pira Roxa, em esquema fatorial. Foram avaliados a análise sensorial aplicando escala hedônica e através dessa, o que os provadores mais apreciaram e o que menos gostaram de cada amostra, intenção de compra e consumo, teor de nitrato, absorção de nutrientes pela folhas e determinação dos nutrientes presentes na solução nutritiva. Para o atributo sabor a cultivar Verônica recebeu as melhores notas no nível de salinidade 1,53 e 5,55 dS m-1. Para a cultivar Pira Roxa a melhor nota foi atribuída para a alface produzida na água não salina. Para os demais atributos não houve diferença significativa nos diferentes níveis de salinidade. Com relação à intenção de compra, constatou-se que as alfaces cv. Verônica e Pira Roxa apresentaram boa aceitação de mercado. Os menores níveis de nitrato (1960 mg kg-1 e 2620 mg kg-1 de massa de matéria fresca, da Verônica e Pira Roxa, respectivamente, foram relacionados à condutividade elétrica de 0,42 dS m-1, aumentando a salinidade da água para 7,43 dS m-1, o teor foliar de nitrato aumentou para 2500 mg kg-1 e 3420 mg kg-1 para as cultivares Verônica e Pira Roxa. Como o tempo de exposição da alface à salinidade em sistema hidropônico foi curto, em torno de 25 dias, não se verificou sintomas de deficiência nutricional e toda alface foi classificada como apropriada para consumo humano.This study aimed to evaluate the content of

  3. y la floración

    Directory of Open Access Journals (Sweden)

    M. I. Vergara-Santana

    2005-01-01

    Full Text Available Los mecanismos que favorecen el aislamiento reproductivo es tema de estudio en el proceso de evolución de plantas. Las plantas domesticadas, al ser sometidas a selección artificial, pueden ser consideradas como modelos biológicos en la especiación simpátrica. Se estudió la morfología floral y la etapa fenológica de floración de Hyptis suaveolens: formas silvestre, arvense y domesticada. Se observaron diferencias significativas en las estructuras florales (P<0.05: en el tamaño del tubo de la flor (mayor en domesticada, longitud del estilo (mayor en silvestre, filamento de estambres y anteras (mayor en silvestre. Respecto a la duración del periodo de floración, las diferencias también fueron significativas (P<0.02: 19.6 y 24 días en las formas domesticada y silvestre, respectivamente. Las poblaciones arvenses mostraron valores intermedios en la mayoría de los caracteres sugiriendo hibridación silvestre domesticado e infiltración genética. Se sugiere que la selección artificial produjo cambios que facilitan la autogamia en la variedad domesticada de H. suaveolens, favoreciendo con ello el proceso hacia el aislamiento reproductivo

  4. PIR-B-deficient mice are susceptible to Salmonella infection.

    Science.gov (United States)

    Torii, Ikuko; Oka, Satoshi; Hotomi, Muneki; Benjamin, William H; Takai, Toshiyuki; Kearney, John F; Briles, David E; Kubagawa, Hiromi

    2008-09-15

    Paired Ig-like receptors of activating (PIR-A) and inhibitory (PIR-B) isoforms are expressed by many hematopoietic cells, including B lymphocytes and myeloid cells. To determine the functional roles of PIR-A and PIR-B in primary bacterial infection, PIR-B-deficient (PIR-B(-/-)) and wild-type (WT) control mice were injected i.v. with an attenuated strain of Salmonella enterica Typhimurium (WB335). PIR-B(-/-) mice were found to be more susceptible to Salmonella infection than WT mice, as evidenced by high mortality rate, high bacterial loads in the liver and spleen, and a failure to clear bacteria from the circulation. Although blood levels of major cytokines and Salmonella-specific Abs were mostly comparable in the two groups of mice, distinct patterns of inflammatory lesions were found in their livers at 7-14 days postinfection: diffuse spreading along the sinusoids in PIR-B(-/-) mice vs nodular restricted localization in WT mice. PIR-B(-/-) mice have more inflammatory cells in the liver but fewer B cells and CD8(+) T cells in the spleen than WT mice at 14 days postinfection. PIR-B(-/-) bone marrow-derived macrophages (BMMphi) failed to control intracellular replication of Salmonella in vitro, in part due to inefficient phagosomal oxidant production, when compared with WT BMMphi. PIR-B(-/-) BMMphi also produced more nitrite and TNF-alpha upon exposure to Salmonella than WT BMMphi did. These findings suggest that the disruption of PIR-A and PIR-B balance affects their regulatory roles in host defense to bacterial infection.

  5. Dual Effects of IL-1 Overactivity on the Immune System in a Mouse Model of Arthritis due to Deficiency of IL-1 Receptor Antagonist

    Institute of Scientific and Technical Information of China (English)

    Jian Yan; Yan Jiao; Hong Chen; Feng Jiao; Karen A.Hasty; John M.Stuart; Weikuan Gu

    2013-01-01

    Previous studies have revealed the significance of cytokine interleukin 1 (IL-1) in the onset and progression of meumatoid arthritis (RA).The precise molecular mechanisms related to IL-1 underlying RA is still elusive.We conducted a whole genome-wide transcriptomal comparison of wild-type (WT) and arthritis-prone IL-1 receptor antagonist (IL-Irn) deficient BALB/c mice to address this issue.To refine our search efforts,gene expression profiling was also performed on paired wild-type and arthritis-resis nt IL-1m deficient DBA/1 mice as internal controls when identifying causative arthritis candidate genes.Two hundred and fifteen trans dpts were found to be dysregulated greater than or equal to 2-fold in the diseased mice.The altered transcriptome in BALB/c mice revealed increased myeloid cell activities and impaired lymphocyte functionality,suggesting dual regulatory effects of IL-1 hyperactivil on immunological changes associated with arthritis development.Phase-specific gene expression changes were identified,such as early increase and late decrease of heat shock protein coding genes.Moreover,common gene expression changes were also observed,especially the upregulation of paired Ig-like receptor A (Pira) in both early and late phases of arthritis.Real-time PCR was performed to validate the expression of Pira and an intervention experiment with a major histocompatibility complex (MHC) class I inhibitor (brefeldin A) was carried out to investigate the role of suppressing Pira activity.We conclude that global pattern changes of common and distinct gene expressions may represent novel opportunities for better control of RA through early diagnosis and development of alternative therapeutic strategies.

  6. Ácido giberélico, bissulfureto de carbono e ácido 2-4 cloroetil fosfônico e a dormência e produtividade de tubérculos de batata Giberellic acid, carbon-disulphide and 2-4 chloro-ethyl phosphonic and the dormancy and yield of potato tubers

    Directory of Open Access Journals (Sweden)

    Ricardo Antonio Ayub

    1999-01-01

    Full Text Available Com o objetivo de avaliar a eficiência do ácido giberélico, bissulfureto de carbono e ácido 2-4 cloroetil-fosfônico (EthrellR na quebra de dormência e na produção de batata, cv. "Marijke", foi conduzido um ensaio no período de 1990/ 91 em Piraí do Sul, PR . A superioridade do tratamento com o ácido 2-4-cloroetil-fosfônico em relação ao ácido giberélico e ao bissulfureto de carbono, aliada a sua facilidade de aplicação, justifica a sua recomendação com vistas a quebra de dormência de tubérculos do genótipo de batata em estudo, para a região de Piraí do Sul, PR, onde a dose de 842 mg.L-1 de EthrellR ocasionou a produção máxima de 23395 kg/ha.In order to evaluate the efficiency of giberellic acid, carbon-disulphide, and 2-4 chloro-ethyl phosphonic acid (EthrellR on dormancy breaking and yield of potato cv. 'Marijke', an essay was conducted at Piraí do Sul, PR, Brazil, during 1990/1991. The superiority of the EthrellR treatment over giberellic acid and carbon-disulphide, and its easy application, justify its use for dormancy breaking of potato tubers, for the studied genotype and location, at the rate of 842 mg.L-1, resulting in a potato yield of 23,395 kg/ha.

  7. Wild common bean in the Central Valley of Costa Rica: ecological distribution and molecular characterization

    Directory of Open Access Journals (Sweden)

    Rosa In\\u00E9s Gonz\\u00E1lez Torres

    2004-01-01

    Full Text Available Frijol silvestre en el Valle Central de Costa Rica: distribución ecológica y caracterización molecular. Este trabajo presenta una actualización sobre la distribución de las formas silvestres de fríjol común en Costa Rica, su ecología y su caracterización molecular. Ala fecha 22 poblaciones fueron encontradas en cuatro cuencas alrededor del Valle Central, generalmente en vegetaciones ruderales (frecuentemente bordes de cafetales, con estatuto de conservación variable (desde protegido a amenazado. Su caracterización molecular indica su pertenencia al acervo genético mesoamericano. Varios marcadores indican una variabilidad aumentada en las formas silvestres y permiten inferir la presencia de un fenómeno de flujo genético e introgresión desde materiales cultivados.

  8. NCBI nr-aa BLAST: CBRC-DNOV-01-1085 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-1085 ref|NP_240139.1| high-affinity zinc uptake system membrane protein Zn...uB [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] sp|P57402|ZNUB_BUCAI High-affinity zinc uptake s...ystem membrane protein znuB pir||A84967 hypothetical protein znuB [imported] - Buchnera sp. (strain APS) dbj...|BAB13025.1| high-affinity zinc uptake system membrane protein ZnuB [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] NP_240139.1 0.53 36% ...

  9. Uso da taxocenose de peixes como indicadora de degradação ambiental no rio Paraíba do Sul, Rio de Janeiro, Brasil

    OpenAIRE

    Francisco Gerson Araújo

    1998-01-01

    An adaptation of index of biotic integrity (IBI) was performed for the first time in Brazil at the Rio Paraíba do Sul, between Barra Mansa and Barra do Piraí, a very important extent of this river because of the high pollution levels, and for being the main abstraction source of Rio de Janeiro city water supply. A monthly standardised sampling programme, from March-1995 to February-1996, was carried out at four sites. Seines, casting nets and net trays were used for catching fishes. IBI was o...

  10. Monogenoidea en Serrasalmus rhombeus (Linnaeus, 1766) de la Cuenca Amazónica Boliviana

    OpenAIRE

    Leslie Córdova; Antoine Pariselle

    2013-01-01

    El presente trabajo analiza la diversidad de parásitos monogenoideos como un carácter indepen- diente, esperando que por su alta especifi cidad, éstos parásitos puedan caracterizar las poblaciones de sus hospederos, la piraña blanca, Serrasalmus rhombeus . El estudio se llevó acabo en cuatro sub-cuencas de la Cuenca Amazónica Boliviana (Iténez, Beni, Madre de Dios e Ichilo); se obtuvie- ron 1135 parásitos, los cuales fueron agrupados en seis géneros y once especies: Anacanthorus jegui, A. ama...

  11. Efecto potencial del cambio climático en la proporción de sexos del caimán en Costa Rica

    OpenAIRE

    Escobedo-Galván, José Armando; Retana, José A.; Méndez, Cristina; González-Maya, José

    2012-01-01

    Las especies que exhiben determinación sexual ambiental son vulnerables a los cambios continuos en las condiciones ambientales. Para evaluar cómo las poblaciones silvestres de cocodrilos podrían verse afectadas por las condiciones ambientales y el cambio climático, se consideró las relaciones entre las variables climáticas y la proporción de sexos en una población -natural de caimanes, Caiman crocodilus, en el Refugio Nacional de Vida Silvestre Caño Negro, en el norte de Costa Rica. Se observ...

  12. Aspectos críticos do controle da febre amarela no Brasil

    OpenAIRE

    Tauil, Pedro Luiz

    2010-01-01

    São apresentados aspectos epidemiológicos e do controle da febre amarela no Brasil, considerando os ciclos de transmissão silvestre e urbano. Sem registros de transmissão no Brasil desde 1942, houve casos de febre amarela urbana em 2008 no Paraguai, depois de mais de 50 anos sem essa ocorrência nas Américas. A redução do número dos casos silvestres e a manutenção da eliminação dos casos urbanos são os dois principais objetivos do controle da febre amarela no Brasil. Embora haja consenso quant...

  13. Entrevista a Esteban Suárez Robalino. Wildlife Conservation Society-Ecuador

    Directory of Open Access Journals (Sweden)

    Juan Pineda

    2013-09-01

    Full Text Available La conservación es básicamente un espacio común que parte de la suposición de que es posible lograr convivencia entre las sociedades humanas y la vida silvestre, y nuestro trabajo de conservación básicamente lo enfocamos tratando de resolver los conflictos que hay entre la vida silvestre y las poblaciones humanas y que dificultan la consecución de esa convivencia....

  14. TRÁFICO ILEGAL DE TORTUGAS CONTINENTALES (TESTUDINATA) EN COLOMBIA: UNA APROXIMACIÓN DESDE EL ANÁLISIS DE REDES

    OpenAIRE

    FELBER JAIR ARROYAVE BERMUDEZ; OSCAR YANDY ROMERO GOYENECHE; MARÍA ARGENIS BONILLA GÓMEZ; RAFAEL GERMAN HURTADO HEREDIA

    2014-01-01

    El uso de productos extraídos o provenientes de la fauna silvestre es relevante para el desarrollo económico y el bienestar social en muchos lugares del mundo. Sin embargo, frecuentemente la fauna silvestre entra en los circuitos de tráfico ilegal para abastecer los mercados de mascotas y productos como pieles, plumas, “carne de monte”, entre otros. El tráfico ilegal genera enormes presiones sobre las especies sujetas a extracción y es una de las principales amenazas para estas. En Colombia, ...

  15. BIOLOGÍA REPRODUCTIVA DEL ORÉGANO MEXICANO (Lippia graveolens Kunth) EN TRES CONDICIONES DE APROVECHAMIENTO

    OpenAIRE

    2009-01-01

    El orégano mexicano (Lippia graveolens Kunth) se recolecta de casi todo el territorio nacional y su aprovechamiento coincide con el periodo de floración de la planta limitando la formación de frutos y semillas. Se estudiaron aspectos de la reproducción de L. graveolens en individuos de una población silvestre sin aprovechamiento (San Juan Raya, estado de Puebla, México) y de otra población silvestre pero con aprovechamiento constante (La Salitrera, estado de Guanajuato), y de una población cu...

  16. Influência de hábitos antrópicos na dispersão de Triatoma pseudomaculata Corrêa & Espínola, 1964, através de Mimosa tenuiflora (Willdenow) (Mimosaceae) no Estado do Ceará, Brasil Influence of anthropic habits in the dispersion of Triatoma pseudomaculata Corrêa & Espínola, 1964 through Mimosa tenuiflora (Willdenow) (Mimosaceae) in the State of Ceará, Brazil

    OpenAIRE

    Simone Patrícia Carneiro Freitas; Assilon Lindoval Carneiro Freitas; Severino do Monte Prazeres; Teresa Cristina Monte Gonçalves

    2004-01-01

    Triatoma pseudomaculata foram capturados em entrecascas de Mimosa tenuiflora (jurema-preta) em ecótopo silvestre de sete municípios do Estado do Ceará. Esta planta apresenta alta taxa de cobertura geográfica nas áreas de caatingas, sendo freqüentemente utilizada pela população rural. A presença de triatomíneos no peridomicílio, na região do Cariri, pode estar associada ao uso pela população da madeira de M. tenuiflora, quando trazida do ambiente silvestre, repleta de triatomíneos, facilitando...

  17. Chemical healthcare waste management in small Brazilian municipalities.

    Science.gov (United States)

    Ferreira, João A; Bila, Danielle M; Ritter, Elisabeth; Braga, Ana Cs

    2012-12-01

    The disposal of healthcare waste (HCW) seems to have been solved in developed countries, while in most developing countries the problem persists because the disposal methods are expensive and larger than the budget of small- and medium-sized municipalities. The current study evaluates the encapsulation process for the disposal of medical chemical waste. The experiment was developed in the Piraí municipality (Rio de Janeiro State, Brazil) and the chemical wastes were produced in the local public hospital, as well as the 12 units of primary care health services. Chemical waste generated at health services units may include the liquid waste from cleaning materials and disinfectants, expired and unused pharmaceutical products, and cytotoxins. These are all considered hazardous waste products and they must be disposed of via an authorised system at approved sites (e.g. industrial landfills). The process of encapsulating chemical medical waste in concrete (cement, crushed stones and sand) followed by their disposal at sanitary landfills is a procedure that is not considered in Brazilian Legislation. Despite the oversight, this method of disposal was used in the municipality of Piraí, with the approval of the Rio de Janeiro State Agency for Environmental Control. The safety aspects of this method and the limits of its applicability, particularly in small municipalities, were evaluated in this study. The results indicate that, within certain parameters, this method may provide a viable solution for the disposal of HCW in small municipalities.

  18. Genetic variants of serum butyrylcholinesterase in Chilean Mapuche Indians.

    Science.gov (United States)

    Acuña, M; Eaton, L; Ramírez, N R; Cifuentes, L; Llop, E

    2003-05-01

    We estimated the frequencies of serum butyrylcholinesterase (BChE) alleles in three tribes of Mapuche Indians from southern Chile, using enzymatic methods, and we estimated the frequency of allele BCHE*K in one tribe using primer reduced restriction analysis (PCR-PIRA). The three tribes have different degrees of European admixture, which is reflected in the observed frequencies of the atypical allele BCHE*A: 1.11% in Huilliches, 0.89% in Cuncos, and 0% in Pehuenches. This result is evidence in favor of the hypothesis that BCHE*A is absent in native Amerindians. The frequencies of BCHE*F were higher than in most reported studies (3.89%, 5.78%, and 4.41%, respectively). These results are probably due to an overestimation of the frequency of allele BCHE*F, since none of the 20 BCHE UF individuals (by the enzymatic test) individuals analyzed showed either of the two DNA base substitutions associated with this allele. Although enzymatic methods rarely detect the presence of allele BCHE*K, PCR-PIRA found the allele in an appreciable frequency (5.76%), although lower than that found in other ethnic groups. Since observed frequencies of unusual alleles correspond to estimated percentages of European admixture, it is likely that none of these unusual alleles were present in Mapuche Indians before the arrival of Europeans. Copyright 2003 Wiley-Liss, Inc.

  19. Uso da taxocenose de peixes como indicadora de degradação ambiental no rio Paraíba do Sul, Rio de Janeiro, Brasil

    Directory of Open Access Journals (Sweden)

    Francisco Gerson Araújo

    1998-01-01

    Full Text Available An adaptation of index of biotic integrity (IBI was performed for the first time in Brazil at the Rio Paraíba do Sul, between Barra Mansa and Barra do Piraí, a very important extent of this river because of the high pollution levels, and for being the main abstraction source of Rio de Janeiro city water supply. A monthly standardised sampling programme, from March-1995 to February-1996, was carried out at four sites. Seines, casting nets and net trays were used for catching fishes. IBI was obtained by integrating 12 ecological and environmental attributes of fish taxocene, populations, and individual organisms to assess biological integrity based in Species Composition, Trophic Structure and Fish Condition. Overall, water quality was classified between poor and fair and an improvement was detected between the high polluted Barra Mansa site and the less polluted Barra do Piraí site, showing the capacity of restoration of the river over this 50 km. Seasonally, the best conditions were reached from March to August, and the worse, from September to February, when most aloctone materials are brought to the river.

  20. Insulin receptor A and Sirtuin 1 synergistically improve learning and spatial memory following chronic salidroside treatment during hypoxia.

    Science.gov (United States)

    Barhwal, Kalpana; Das, Saroj K; Kumar, Ashish; Hota, Sunil K; Srivastava, Ravi B

    2015-10-01

    Hypoxia has been reported to cause hippocampal neurodegeneration resulting in learning and memory deficits. In the present study, we investigated the potential of salidroside, a glucoside derivative of tyrosol, in ameliorating hypoxia-induced neurodegeneration and memory impairment. Morris water maze test showed improvement in learning and spatial memory of salidroside-treated hypoxic rats correlating with increased dendritic intersections and arborization. Salidroside administration increased phosphorylation of insulin receptor subunit A (IRA) at Y972, Y1162/63, and Y1146 sites and subsequent activation of AMP-activated protein kinase (AMPK) α subunit isoforms pAMPKα1 and pAMPKα2 resulting in mitochondrial biogenesis. Contrarily, silencing of IRA in salidroside-supplemented hypoxic hippocampal cells could not improve cell viability or alter pAMPKα1 and pAMPKα2 expression. Rats administered with salidroside showed elevated expression of phosphorylated cAMP response element-binding protein in the hippocampus. Salidroside administration also resulted in increased sirtuin 1 (SIRT1) activity through a cytochrome P4502E1 (CYP2E1)-regulated mechanism that was independent of pIRA. Taken together, these findings suggest a synergistic role of pIRA and SIRT1 in salidroside-mediated neuroprotection, mitochondrial biogenesis, and cognitive improvement during hypoxia. We propose a novel mechanism for salidroside-mediated neuroprotection in hypoxia. © 2015 International Society for Neurochemistry.

  1. Produção e indicadores fisiológicos de alface sob hidroponia com água salina Production and physiologic indicators of lettuce grown in hydroponics with saline water

    Directory of Open Access Journals (Sweden)

    Dalva Paulus

    2010-03-01

    Full Text Available O uso de água salina na produção de hortaliças constitui no momento atividade essencial, tendo em vista o aumento da demanda de água doce, tanto pela atividade agrícola quanto pelo abastecimento urbano e industrial. O objetivo do trabalho foi avaliar a produção e os indicadores fisiológicos de alface cultivada em hidroponia com a utilização de água salina. O experimento foi conduzido em ambiente protegido, em Piracicaba-SP. O delineamento experimental foi de blocos ao acaso, sendo estudados os efeitos de cinco níveis de salinidade da água de irrigação, utilizando-se NaCl [Condutividade elétrica (Cea: 0,42, 1,53, 3,52, 5,55 e 7,43 dS m-1] em duas cultivares de alface (Verônica e Pira Roxa, em esquema fatorial. Foram determinadas massa fresca e seca de folhas, caule, raízes e da parte aérea; teor de nitrato, prolina e clorofila. O aumento da salinidade da água reduziu linearmente as massas fresca e seca das folhas, caule, raízes e da parte aérea. As massas fresca e seca foram 36% e 57% superiores na cultivar Verônica, respectivamente. A cultivar Pira Roxa apresentou maior teor de nitrato 25% (3008 mg L-1, clorofila total 50% (1,46 mg g-1massa fresca e prolina, 71,43% (0,21 µM g-1massa fresca-1 em relação à Verônica, o que pode ser um mecanismo de adaptação daquela cultivar ao estresse salino. Com relação à produtividade comercial, obteve-se uma perda de 69 e 64% para as cultivares Pira Roxa e Verônica, quando se utilizou água mais salina (7,43 dS m-1. Em relação à produção de massa seca, a perda pelo uso dessa água foi de 53% e 44%, respectivamente. Os resultados obtidos em sistema de cultivo hidropônico podem indicar a possibilidade do uso da água salina como alternativa para produção de hortaliças para produtores que têm disponibilidade de água salina e restrita disponibilidade de água doce, embora com redução na produtividade.The use of saline water in the production of vegetables constitutes

  2. ANÁLISE DOS PARÂMETROS DE FUNCIONAMENTO E SIMULAÇÃO COMPUTACIONAL EM UM PROTÓTIPO DE TURBINA OPERANDO A AR COMPRIMIDO

    Directory of Open Access Journals (Sweden)

    Wesley Saldanha Nogueira Oliveira

    2016-12-01

    Full Text Available RESUMO. Este trabalho apresenta os resultados iniciais da comparação de alguns parâmetros de funcionamento do protótipo de uma turbina de ação simples, operando com ar comprimido como fluido de trabalho, realizados na unidade do SENAI de Barra do Piraí/RJ. O protótipo foi desenvolvido integralmente no Centro Universitário Geraldo Di Biase - UGB - Campus de Barra do Piraí/RJ, que inicialmente teve como o fluido de trabalho o vapor d’água, que nos testes inicias se mostrou ineficiente. A simulação computacional do sistema foi feita através do software SolidWorks na Universidade Federal Fluminense - UFF - Campus de Volta Redonda/RJ, o que permitiu determinar a faixa de trabalho que apresentou maior eficiência nos resultados experimentais do sistema por meio da relação entre pressão de operação, velocidade angular transmitida pelo fluido ao eixo da turbina e a potência da mesma. Os valores nas simulações em velocidade tangencial na região rotacional apresentaram-se convergentes aos valores experimentais medidos no protótipo.

  3. Presence of two alternative kdr-like mutations, L1014F and L1014S, and a novel mutation, V1010L, in the voltage gated Na+ channel of Anopheles culicifacies from Orissa, India

    Directory of Open Access Journals (Sweden)

    Bhatt Rajendra M

    2010-05-01

    Full Text Available Abstract Background Knockdown resistance in insects resulting from mutation(s in the voltage gated Na+ channel (VGSC is one of the mechanisms of resistance against DDT and pyrethroids. Recently a point mutation leading to Leu-to-Phe substitution in the VGSC at residue 1014, a most common kdr mutation in insects, was reported in Anopheles culicifacies-a major malaria vector in the Indian subcontinent. This study reports the presence of two additional amino acid substitutions in the VGSC of an An. culicifacies population from Malkangiri district of Orissa, India. Methods Anopheles culicifacies sensu lato (s.l. samples, collected from a population of Malkangiri district of Orissa (India, were sequenced for part of the second transmembrane segment of VGSC and analyzed for the presence of non-synonymous mutations. A new primer introduced restriction analysis-PCR (PIRA-PCR was developed for the detection of the new mutation L1014S. The An. culicifacies population was genotyped for the presence of L1014F substitution by an amplification refractory mutation system (ARMS and for L1014S substitutions by using a new PIRA-PCR developed in this study. The results were validated through DNA sequencing. Results DNA sequencing of An. culicifacies individuals collected from district Malkangiri revealed the presence of three amino acid substitutions in the IIS6 transmembrane segments of VGSC, each one resulting from a single point mutation. Two alternative point mutations, 3042A>T transversion or 3041T>C transition, were found at residue L1014 leading to Leu (TTA-to-Phe (TTT or -Ser (TCA changes, respectively. A third and novel substitution, Val (GTG-to-Leu (TTG or CTG, was identified at residue V1010 resulting from either of the two transversions–3028G>T or 3028G>C. The L1014S substitution co-existed with V1010L in all the samples analyzed irrespective of the type of point mutation associated with the latter. The PIRA-PCR strategy developed for the

  4. Molecular Factors and Biological Pathways Associated with Malaria Fever and the Pathogenesis of Cerebral Malaria

    Science.gov (United States)

    2007-04-09

    Inference Package (Version 3.2). 5:164-166. 14. Freitas-Junior, L. H., R. Hernandez -Rivas, S. A. Ralph, D. Montiel-Condado, O. K. Ruvalcaba-Salazar, A. P... Rojas -Meza, L. Mancio-Silva, R. J. Leal- Silvestre, A. M. Gontijo, S. Shorte, and A. Scherf. 2005. Telomeric heterochromatin propagation and

  5. CITES aplicació en fauna salvatge i clínica d'animals exótics /

    OpenAIRE

    Ticó Gil, Gemma.; Verdés Martinez, Judit.

    2011-01-01

    CITES: Convention on International Trade in Endangered Species of Wild Fauna and Flora = Conveni sobre el Comerç Internacional d’Espècies Amenaçades de Fauna i Flora Silvestre. Treball presentat a l'assignatura de Deontologia i Veterinària Legal (21223)

  6. Exploring the Regional Distribution of Tourism and the Extent to Which There Is Convergence

    DEFF Research Database (Denmark)

    Mérida, Adrián L.; Carmona, Mónica; Congregado, Emilio

    2016-01-01

    proposed by Carrion-i-Silvestre et al. (2005). Finally, the hypothesis of club convergence (Philips and Sul, 2007) is also tested. The results point to absence of full convergence even when controlling for structural breaks while three different clubs of convergence are found. We discuss potential policy...

  7. Identification of organic acids in Cichorium intybus inhibiting virulence-related properties of oral pathogenic bacteria

    NARCIS (Netherlands)

    Papetti, A.; Mascherpa, D.; Carazzone, C.; Stauder, M.; Spratt, D.A.; Wilson, M.; Pratten, J.; Ciric, L.; Lingström, P.; Zaura, E.; Weiss, E.; Ofek, I.; Signoretto, C.; Pruzzo, C.; Gazzani, G.

    2013-01-01

    The low molecular mass (LMM) extract of Cichorium intybus var. silvestre (red chicory) has been shown to inhibit virulence-linked properties of oral pathogens including Streptococcus mutans, Actinomyces naeslundii and Prevotella intermedia. In the present study HPLC-DAD-ESI/MS2 was used to investiga

  8. Identification of organic acids in Cichorium intybus inhibiting virulence-related properties of oral pathogenic bacteria

    NARCIS (Netherlands)

    Papetti, A.; Mascherpa, D.; Carazzone, C.; Stauder, M.; Spratt, D.A.; Wilson, M.; Pratten, J.; Ciric, L.; Lingström, P.; Zaura, E.; Weiss, E.; Ofek, I.; Signoretto, C.; Pruzzo, C.; Gazzani, G.

    2013-01-01

    The low molecular mass (LMM) extract of Cichorium intybus var. silvestre (red chicory) has been shown to inhibit virulence-linked properties of oral pathogens including Streptococcus mutans, Actinomyces naeslundii and Prevotella intermedia. In the present study HPLC-DAD-ESI/MS2 was used to

  9. Sugerencias para la ampliación y normalización de los nombres vernáculos de las plantas en lengua española

    OpenAIRE

    Mateo Sanz, Gonzalo

    2014-01-01

    Se aportan una serie de datos y reflexiones sobre la importancia de abordar la nominación de las plantas silvestres con nombres vernáculos en general y en concreto en el ámbito de la lengua española.

  10. Notes on the Cactaceae of Curaçao, Aruba, Bonaire and North Venezuela

    NARCIS (Netherlands)

    Wagenaar Hummelinck, P.

    1938-01-01

    La flora de cactos de las islas situadas entre Trinidad y la península de La Goajira comprende trece especies silvestres, aparte del género Melocactus: Pereskia Guamacho, Opuntia caribaea, O. curassavica, O. Wentiana, O. elatior, Rhipsalis cassutha, Hylocereus Lemairei, Acanthocereus pentagonus, Lem

  11. Medida de los fenoles totales y de la capacidad antioxidante y antirradicalaria de los hongos comestibles marasmius oreades, lactarius deliciosus y macrolepiota procera y su degradación a diferentes tiempos y temperaturas

    OpenAIRE

    Gómez Herrador, Silvia

    2014-01-01

    El tratamiento térmico que se utilizamos en cocina elimina diferentes sustancias bioactivas beneficiosas para nuestro organismo, entre otras destacan los polifenoles presentes en distintas setas silvestres recogidas en CyL, que poseen actividad antioxidante y antirradicalaria, conceptos relacionados con el envejecimiento celular.

  12. Ontology supported system for searching evidence of wild animals trafficking in social network posts

    Directory of Open Access Journals (Sweden)

    Rafael da Silva Carrasco

    2014-04-01

    Full Text Available O comércio ilegal de animais silvestres é uma das atividades criminais mais lucrativas da atualidade. No Brasil, a grande variedade de fauna nativa tem alimentado o mercado ilegal, o que gera sérias implicações ambientais e sociais. A luta contra o comércio ilegal de animais silvestres é crucial para ajudar a proteger os recursos naturais e evitar a disseminação de outras formas de crime. Esse tipo de comércio ilegal usa cada vez mais, a internet para realizar suas atividades. A fim de combater tal crime, um sistema automático de monitorização é essencial. No entanto, para realizar essa tarefa de forma eficaz, o sistema deve ser capaz de analisar as mensagens trocadas durante essa prática. Para isso, é necessário o conhecimento dos conceitos e relações que ocorrem nesse domínio. Este artigo apresenta um sistema multiagente apoiado por ontologia de domínio e frames semânticos para buscar evidências de comércio ilegal de animais silvestres. No artigo, é mostrado como o sistema pode ser usado na tarefa de rastreamento do comércio ilegal de animais silvestres, além de apresentar os resultados da aplicação do sistema em um pequeno corpus.

  13. Estudio y análisi de viabilidad para la implantación de una fábrica de cerveza en Cataluña

    OpenAIRE

    Solanelles Martí, Joan; Rodríguez Nogal, Carlos

    2015-01-01

    El sector de la cerveza artesanal está creciendo a un ritmo muy elevado, continuamente se multiplican las microempresas que fabrican éste tipo de cerveza, pero, a menudo, el precio que se paga por una de estas cervezas es desorbitado. No se trata de una cuestión de calidad únicamente, sino de ineficiencia en los procesos, no tener acceso a economías de escala para la compra de materia prima, la distribución y por un excesivo peso de los costes fijos debido a las bajas produccio...

  14. Editorial

    Directory of Open Access Journals (Sweden)

    Oscar Oswaldo Rodriguez Díaz

    2014-12-01

    Full Text Available El mercado de alta tecnología está creciendo a pasos gigantescos, es importante explorarlo, conocerlo y tratar de aprovechar al máximo, es así como la sociedad de consumo compra en forma masiva productos que apenas aprendemos a usar en un bajo porcenytaje de capacidades, un ejemplo es el celular, dispositivo que en primera instancia fue creado para realizar llamadas de cualquier puto y lugar "realizar llamadas", pero el mercado de consumo necesita nuevos dispositivos que complementen la vida diaria.

  15. Migración e impacto de las remesas en la economía nacional

    OpenAIRE

    Rosa Albina Garavito Elías; Rino Enzo Torres Baños

    2004-01-01

    Se investigan las remesas familiares de los trabajadores migratorios mexicanos en EUA. Uno de los hallazgos es que el aumento de la tasa de migración se asocia con el agotamiento del modelo de desarrollo estabilizador y se profundiza con la aplicación del neoliberalismo; también que en tanto las asimetrías económicas con EUA no se amortigüen, la migración seguirá creciendo. Las remesas hoy, como el sector agropecuario durante el desarrollo estabilizador, están cumpliendo un papel central en l...

  16. Novel methods in distributed machine learning for large datasets

    OpenAIRE

    Peteiro Barral, Diego

    2016-01-01

    [Resumen] La cantidad de datos almacenados actualmente está creciendo a un ritmo sin precedentes. Con la variedad, velocidad y volumen de datos transmitiéndose a través de redes de comunicación y bases de datos, encontrar patrones relevantes en estos datos que conduzcan a conclusiones significativas se ha convertido en un reto. En este contexto, el aprendizaje automático se ha convertido en una pieza fundamental para extraer el mayor valor posible de estos conjuntos de da...

  17. Design of scalable PGAS collectives for NUMA and manycore systems

    OpenAIRE

    Álvarez Mallón, Damián

    2016-01-01

    [Resumen] El número de núcleos por procesador está creciendo, convirtiendo a los sistemas multinúcleo en omnipresentes. Esto implica lidiar con múltiples niveles de memoria en sistemas NUMA, accesibles a través de complejas jerarquías para procesar las crecientes cantidades de datos. La clave para un movimiento eficiente y escalable de datos es el uso de operaciones de comunicación colectivas que minimizen el impacto de los cuellos de botella. Usar comunicaciones unilaterales se vuelve más im...

  18. The importance of emotional intelligence : proposals for educational intervention for preschool

    OpenAIRE

    Meis Leiro, Lucía

    2015-01-01

    Traballo Fin de Grao en Mestre ou Mestra en Educación Infantil. Curso 2014-2015 [ES] Hace ya más de quince años que apareció el concepto de Inteligencia Emocional y aunque su importancia ha ido creciendo, en general, los aspectos emocionales todavía se encuentran bastante descuidados en el ámbito escolar, tanto en el ciclo de Educación Infantil como en posteriores etapas educativas. Por esta razón, el propósito de este trabajo es profundizar en la importancia que posee la Inteligencia Emoc...

  19. Contribución al estudio del sistema de lipasas de Trichoderma harzianum

    OpenAIRE

    Jorge, Maria de Lurdes Antunes

    2016-01-01

    [ES]Entre los hongos del género Trichoderma se han descrito algunas especies importantes como agentes de biocontrol, tales como las parejas anamorfo/teleomorfo T. harzianum/Hypocrea lixii, T. viride/H. rufa, T. atroviride/H. atroviridis y T. virens/H. virens. Trichoderma tiene una amplia distribución geográfica, está presente en casi todos los suelos y en hábitats diversos (creciendo en madera, corteza, sobre y dentro otros hongos y sustratos innumerables). Por su adaptación a distintos en...

  20. Las márgenes de los pueblos de indios. Agregados, arrendatarios y soldados en el Tucumán colonial. Siglos XVIII y XIX.

    OpenAIRE

    Farberman, Judith

    2009-01-01

    Desde mediados del siglo XVIII, la documentación sobre los pueblos de indios del Tucumán incluye escuetas referencias sobre “agregados” y “soldados”, la móvil población que va creciendo en sus márgenes y que podía incluso superar en número a las familias tributarias. Normalmente, los agregados se vinculaban a los pueblos pagando un arriendo al cacique. Por ello, pudieron contribuir a la perduración de algunas reducciones y a la consolidación de su sistema de autoridades. Sin embargo, el mismo...

  1. Consumo responsable

    Directory of Open Access Journals (Sweden)

    Educadores por la sostenibilidad

    2007-01-01

    Full Text Available Hablar de consumo moderado es plantear el problema del hiperconsumo de las sociedades “desarrolladas” y de los grupos poderosos de cualquier sociedad, que sigue creciendo como si las capacidades de la Tierra fueran infinitas. Baste señalar que los 20 países más ricosdel mundo han consumido en este siglo más naturaleza, es decir, más materia prima y recursos energéticos no renovables, que toda la humanidad a lo largo de su historia y prehistoria

  2. Como se regula el contrato corporal, la teoría del negocio jurídico, aplicación a la compraventa de órganos vivos, con lo deudos de las personas fallecidas, a título oneroso o gratuito

    OpenAIRE

    Oliveros Tinoco, Mario Andrés

    2012-01-01

    La Ley 919 del 2004, expone que la venta de órganos perjudica la salud, por ello las partes del cuerpo humano no pueden ser objeto de transacciones comerciales en Colombia. Sin embargo existe un nuestro país y en algunos otros, un mercado donde los órganos humanos, adquieren un valor desmesurado, y ha venido creciendo ostensiblemente, un comercio ilegal de esta clase de órganos, haciendo que las leyes sean ineficaces. Así las cosas se trataran de dar una solución desde el punto de vista juríd...

  3. Native and Non-Native Dichotomy: Challenges of and Attitudes Towards Native and Non-Native English Speaking Teachers

    OpenAIRE

    Pérez Pérez, Jasmina Laura

    2015-01-01

    [ES]El número de profesores de inglés sigue creciendo debido a la importancia de esta lengua. El presente trabajo investiga el rol de los profesores de inglés nativos y los profesores de inglés no nativos en contextos en los que el inglés se enseña como lengua extranjera, mediante el análisis del concepto nativo, los desafíos de estos profesores y las actitudes de Perez 2 estudiantes, profesores de inglés nativos y no nativos hacia ambos grupos de profesores, con el propósito de identif...

  4. LA TRANSFERENCIA DE LOS ESTUDIOS SUPERIORES Y LA EDUCACION PARA EL TRABAJO

    OpenAIRE

    2005-01-01

    La demanda del sistema educativo sigue creciendo. En la sociedad se han establecido exigencias que no existían hace veinte años : movimientos populares que exigen educación bilingüe y bicultural , se está generalizando la educación para personas con necesidades especiales .Esto sucede en el contexto de una imagen desvalorizada de la enseñanza .Aún son bajos los presupuestos educativos. Aún cuesta vincular adecuadamente educación – empresa. La educación es uno de los temas que más preocupan a...

  5. PLANTAS ARVENSES ASOCIADAS A CULTIVOS DE MAÍZ DE TEMPORAL EN SUELOS SALINOS DE LA RIBERA DEL LAGO DE CUITZEO, MICHOACÁN, MÉXICO

    OpenAIRE

    2013-01-01

    Se muestrearon comunidades de plantas arvenses en cultivos de maíz de temporal creciendo sobre suelos con problemas de salinidad, durante el ciclo agrícola 1996 en 10 sitios de la ribera del Lago de Cuitzeo. Se registraron 133 especies correspondientes a 94 géneros y 34 familias. De estas últimas las que presentaron el mayor número de especies fueron Compositae, Gramineae, Euphorbiaceae, Solanaceae y Leguminosae que en conjunto representan más de la mitad de la riqueza específica con 63.89%. ...

  6. Propuesta Para La Disposición Adecuada De Los Residuos Sólidos Reciclables En El Laboratorio San Martín

    OpenAIRE

    Araya-Trejos, Yesenia

    2011-01-01

    Proyecto de Graduación (Maestría en Gestión de Recursos Naturales y Tecnologías de Producción) Instituto Tecnológico de Costa Rica. Área Académica Agroforestal, 2011. En las últimas décadas la generación de residuos sólidos ha ido creciendo exponencialmente a nivel mundial. Dentro de los factores que han contribuido a tal expansión están: la cultura de usar y tirar los llamados “desechables”, la elevada cantidad y diversidad de materiales de empaque que se comercializan con los productos, ...

  7. Very-high-energy -ray observations of pulsar wind nebulae and cataclysmic variable stars with MAGIC and development of trigger systems for IACTs

    OpenAIRE

    López Coto, Rubén

    2015-01-01

    La historia de la astronomía es tan antigua como alcanzan nuestros registros. Todas las civilizaciones han estado interesadas en el estudio del cielo nocturno, sus objetos y fenómenos. Estas observaciones se realizaron a simple vista hasta el comienzo del siglo XVII, cuando Galileo Galilei empezó a usar un instrumento desarrollado recientemente llamado telescopio. Desde entonces, el rango de longitudes de onda accesible ha ido creciendo, con una explosión en el siglo XX gracias...

  8. Very-high-energy -ray observations of pulsar wind nebulae and cataclysmic variable stars with MAGIC and development of trigger systems for IACTs

    OpenAIRE

    López Coto, Rubén; Fernández Sánchez, Enrique

    2015-01-01

    La historia de la astronomía es tan antigua como alcanzan nuestros registros. Todas las civilizaciones han estado interesadas en el estudio del cielo nocturno, sus objetos y fenómenos. Estas observaciones se realizaron a simple vista hasta el comienzo del siglo XVII, cuando Galileo Galilei empezó a usar un instrumento desarrollado recientemente llamado telescopio. Desde entonces, el rango de longitudes de onda accesible ha ido creciendo, con una explosión en el siglo XX gracias al desarrollo ...

  9. Simón Bolívar y la cultura iberoamericana

    Directory of Open Access Journals (Sweden)

    Luis López de Mesa

    1979-08-01

    Full Text Available Simón Bolívar -en cuanto héroe de la historia de América- nació en Cartagena del Caribe en 1812 y murió en Lima hacia 1926. Comparando esos catorce años de prodigiosa actividad pública con el promedio de "realizaciones " que en el decurso de su vida lleva a cabo el hombre común, resultaría de longevidad casi milenaria: prueba de ello es que su pensamiento actúa aún en el continente americano, y que sus obras siguen creciendo a la faz del mundo.

  10. Nuevos registros de Dothideomycetes (Ascomycota) no liquenizantes de los bosques andino patagónicos de Argentina

    OpenAIRE

    Sanchez, Romina Magali; Bianchinotti, Maria Virginia

    2016-01-01

    Tres especies de Dothideomycetes (Ascomycota) no liquenizantes halladas creciendo sobre corteza de árboles nativos de los bosques Andino Patagónicos de Argentina son aquí descriptas. Melanomma subdispersum y Mytilinidion tortile se registran por primera vez para América del Sur. El área de distribución de Mytilinidion andinense se amplía desde la provincia de Río Negro, donde fue hallada por primera vez, hacia la provincia de Chubut. Se brindan descripciones, datos de distribución geográfica,...

  11. Posibilidades de formación en Seguridad Alimentaria en el contexto educativo universitario.

    Directory of Open Access Journals (Sweden)

    M Fernández

    2010-01-01

    Full Text Available La formación en Seguridad Alimentaria está creciendo en la actualidad, dadas las necesidades de profesionales con una formación científica sólida, fundamentalmente en el Análisis de riesgos, capaces de resolver los problemas variados que se plantean desde los distintos sectores relacionados con la misma. Se revisan las posibilidades de formación existentes en nuestro país, a nivel de Grado y Postgrado, haciendo especial referencia en las materias, cursos, y másters existentes en las Universidades de Valencia, Córdoba y Sevilla.

  12. Implantación de las matemáticas en la educación secundaria obligatoria: un análisis en el contexto internacional

    OpenAIRE

    Castelnuovo, Emma

    1998-01-01

    Hace ahora cinco años que comenzó a implantarse la educación secundaria obligatoria en algunos centros de diferentes lugares. Desde entonces, el número de estudiantes y de centros que se han incorporado a esta etapa educativa ha ido creciendo progresivamente. Tenemos ya alguna experiencia que nos permite hacer un primer balance de sus características más relevantes y sus efectos en relación con la enseñanza y el aprendizaje de las matemáticas y de las condiciones en las que se ha ido poniendo...

  13. Influencia de las fuentes de financiamiento externo en el crecimiento y desarrollo de las empresas agroindustriales del distrito de Abancay Apurímac Perú (periodo 2012- 2013)

    OpenAIRE

    Jiménez Mendoza, Wilber; Luciano Alipio, Rober Anibal; Soto Carrión, Carolina

    2014-01-01

    En los últimos años, el Perú viene creciendo sostenidamente, la tasa de crecimiento del PBI ha superado el 7%, lo que nos indica que estamos atravesando por una bonanza económica; sin embargo esta se explica por la explotación y exportación básicamente de materias primas como minerales, la construcción y los productos agroindustriales. Apurímac no es ajeno a esta realidad, si bien es cierto, contribuye aproximadamente con el 0.5% del PBI nacional, se prevé un futuro má...

  14. LA CALIDAD EN LA CADENA DE VALOR DEL PRODUCTO AGROALIMENTARlO. DIFERENCIAS PERCIBIDAS ENTRE EL AGRICULTOR INDIVIDUAL Y EL ASOCIADO /

    OpenAIRE

    García Pérez, A. M.; Oreja Rodríguez, JR.; E. González Dávila

    2004-01-01

    La transformación de la agricultura ha supuesto su integración progresiva al resto de los sectores de la economía y, al mismo tiempo, la disminución de la contribución de la actividad agraria al valor final de los alimentos. Por lo tanto, el peso específico de las actividades de transformación y distribución en el valor añadido total de los productos alimentarios ha ido creciendo en detrimento de la aportación de la agricultura. Estos cambios han originado la necesidad de buscar un nuevo marc...

  15. Quickbird image segmentation for mapping crops and their agro-environmental associated measures

    OpenAIRE

    López-Granados, Francisca; Castillejo-González, I.L.; Peña-Barragán, J.M.; Jurado-Expósito, M.; Sánchez de la Orden, Manuel; García-Torres, L.; García-Ferrer Porras, Alfonso

    2009-01-01

    En la últimas décadas han ido creciendo considerablemente los conocimientos y la sensibilización sobre la protección al medioambiente en muy diversas áreas, entre las que se encuentra la Agricultura. El uso intensivo del laboreo ocasiona graves daños medioambientales como la erosión del suelo, la contaminación de las aguas superficiales (escorrentía y colmatación de embalses), el descenso del contenido de la materia orgánica y de la biodiversidad de los suelos labra...

  16. Proyecto de implementación de un laboratorio para diagnóstico y mantenimiento de sistemas de inyección electrónica a diesel para la UPS

    OpenAIRE

    Barros Fajardo, Lauro Fernando; Gutierrez Siavichay, Oswaldo Javier

    2005-01-01

    Hoy en día el parque automotor va creciendo a pasos agigantados, al país ingresan vehículos de distintas marcas con tecnologías nuevas, los ingenieros automotrices tienen que capacitarse permanentemente y adquirir equipos que permitan brindar un mantenimiento preventivo y correctivo a estos vehículos en una forma técnica y en el menor tiempo posible. Debido a la falta de talleres especializados en la ciudad de Cuenca se ha realizado los estudios para dar mantenimiento a vehículos con siste...

  17. Anatomía Artística: Bases Anatómicas del Retrato Escultórico Realista

    OpenAIRE

    Jiménez Mateos, Miguel Ángel

    1999-01-01

    El saber sobre la estructura del organismo humano ha ido creciendo siguiendo las bases de cualquier otra ciencia. La curiosidad de los propios humanos los condujo a observar los organismos y a intentar indagar en ellos más allá de los límites de la observación superficial, penetrando en su interior dividiendo sus partes. “Anatomía: cortar repetidas veces”. La Anatomía analiza las relaciones causales que tanto la estructura como la función guardan entre sí, así como las modificaciones de índol...

  18. Parque eólico offshore de Essaouira

    OpenAIRE

    Núñez Pérez, Alfonso

    2015-01-01

    El principal motivo de implantar un parque de generación eléctrica de estas características es responder a una necesidad palpable en el ámbito mundial como es el crecimiento en la demanda energética unido a un agotamiento de los recursos petrolíferos. En el caso de Marruecos, solo genera el 3% de la energía actual que consume, y se espera que la demanda siga creciendo hasta 2030 a un ritmo de un 7 - 8% anual, por lo que la búsqueda de nuevas fuentes de energía se convierte en necesidad impres...

  19. Integración de la arquitectura cognitiva SOAR en un entorno ROS sobre un Parrot AR.Drone 2.0

    OpenAIRE

    Kothakota, Sai Kishor; Angulo Bahón, Cecilio

    2015-01-01

    En la vida diaria, el uso de aplicaciones de Inteligencia Artificial (IA) está creciendo. Sin embargo, todavía se necesita de un mayor apoyo para su integración en los robots, lo que conllevará el desarrollo de seres inteligentes capaces de tomar decisiones. Los algoritmos de inteligencia artificial hacen el trabajo más fácil y eficaz. En este documento integramos una Arquitectura Cognitiva (SOAR) desde el dominio de la IA computacional en un Parrot AR.Drone 2.0, un drone cuatrimotor. El p...

  20. PROPUESTAS PARA EL DESARROLLO Y COMERCIALIZACIÓN DEL TURISMO ORNITOLÓGICO EN EXTREMADURA

    Directory of Open Access Journals (Sweden)

    José Manuel Hernández Mogollón

    2011-01-01

    dada su riqueza en aves. El número de empresas enfocadas a este segmento está creciendo, las agencias de viajes ya incluyen estos paquetes en sus programaciones y la administración turística regional promueve eventos como la Feria Internacional de Turismo Ornitológico (FIO en Monfragüe, considerado punto de referencia mundial. Este trabajo trata de poner de manifiesto la relevancia de Extremadura como destino de turismo ornitológico aportando propuestas para su desarrollo y comercialización.

  1. Integración de una tarjeta RFID de bajo coste en el framework robot operating system

    OpenAIRE

    González de la Cruz, Gustavo

    2014-01-01

    Cada vez son más numerosas las aplicaciones que utilizan las tecnologías de identificación automática. En los últimos años, estas aplicaciones están teniendo una importancia muy grande. Un ejemplo de ello es el caso de los sistemas de identificación por radiofrecuencia RFID, ya que estos sistemas están creciendo en el campo de la robótica, en donde se necesitan nuevas formas de interactuar con el robot. Los sistemas RFID pueden ser integrados en robots personales para llevar a cabo tareas ...

  2. Diseño de un sistema de buenas prácticas de manufactura en

    OpenAIRE

    Sánchez Vásquez, Viviana Lorena; Decker Campuzano, Fernando Enrique

    2010-01-01

    Hace ya más de 60 años, abre sus puertas a sus clientes la empresa familiar LA DELICIA dedicada a la elaboración de una gran variedad de panes, dulces y tortas. La misma se ha mantenido entre las más importantes del sector debido al distintivo toque de sabor y apariencia artesanal de sus productos. En el transcurso de los años la empresa ha ido creciendo a tal punto que hoy en día ha pasado de ser una panadería artesanal de barrio como lo fue en sus orígenes, para convert...

  3. A multi-scale analysis of transforming agricultural markets in the context of globalization: implications for natural resources, food prices and rural poverty in Latin America

    OpenAIRE

    2016-01-01

    Vivimos una época en la que el mundo se transforma aceleradamente. La globalización está siguiendo un curso imparable, la población mundial así como la población urbana siguen creciendo, y en los países emergentes los ingresos promedios aumentan, resultando en un cambio también acelerado de las dietas y hábitos alimentarios. En conjunto esos factores están causando un aumento fundamental de la demanda de alimentos. Junto con la apertura de los mercados agrícolas, estos procesos han provocado ...

  4. El problema de la salud en los Estados Unidos

    OpenAIRE

    Elsie L. Montiel Ziegler

    1990-01-01

    El alto costo de la atención a la salud es uno de los principales problemas internos que ha enfrentado la sociedad norteamericana en los últimos meses. Existe un acuerdo general acerca de la necesidad de reducir los costos sin afectar el derecho de todos los norteamericanos a la atención de sus necesidades de salud.La crisis que afecta al sistema de salud de los Estados Unidos involucra varios aspectos: los costos han ido creciendo rápidamente, de manera que la nación gasta más del 12% de su ...

  5. Crecimiento demográfico y cambio climático

    OpenAIRE

    Wilfredo Bulege Gutiérrez

    2013-01-01

    El mundo seguirá creciendo. Las más recientes proyecciones de las Naciones Unidas no prevén todavía un punto de inflexión en el crecimiento poblacional en el transcurso del presente siglo, pero se estima que, dadas las tendencias demográficas registradas, para mediados de siglo seremos alrededor de 9 mil 300 millones de habitantes en el planeta. La dinámica demográfica es la principal fuerza conductora del cambio ambiental global, pues constituye una presión para ocupar cada vez más espacios,...

  6. Plataforma para el procesamiento de imágenes médicas de ultrasonido obstétrico habilitada en la nube

    OpenAIRE

    Figueroa, Kevin Jessid; Mendoza, Luis Enrique

    2015-01-01

    El seguimiento fetal no invasivo mediante imagenología ha venido creciendo en los últimos treinta años. Con estos estudios se detectan problemas futuros con el fin de prevenirlos. Este artículo presenta un software que mediante imágenes de ultrasonido permite detectar la zona de translucencia nucal. Dicha zona es importante para la detección de trisomía 21 o síndrome de Down. Para ello el software contiene técnicas de operaciones morfológicas y la transformada Watershed. Adicionalmente, se de...

  7. Insuficiencia cardíaca y diabetes

    OpenAIRE

    Jorge Thierer

    2006-01-01

    La prevalencia de la insuficiencia cardíaca y la diabetes continúa creciendo. Ambas están fuertemente asociadas. La diabetes es un fuerte predictor de aparición de insuficiencia cardíaca. Las razones son la presencia de enfermedad coronaria y los trastornos metabólicos vinculados con la resistencia a la insulina que generan disfunción contráctil. Los pacientes con insuficiencia cardíaca que son diabéticos tienen peor evolución. Los Betabloqueantes, vasodilatadores y los inhibidores de la en...

  8. ANÁLISIS Y REPERCUSIÓN DE LAS LANZADERAS DE STARTUPS EN ESPAÑA COMO FACTOR DE ÉXITO PARA LAS MISMAS

    OpenAIRE

    2016-01-01

    {ES] El fenómeno de las aceleradoras de startup está creciendo en todo el mundo, con un número cada vez mayor de programas activos principalmente en los Estados Unidos y también en otras partes del mundo como Europa, Asia/Pacífico, Israel, Oriente Medio y Norte África etc. Sin embargo, hay poca literatura académica sobre estos programas de aceleración de startups y las fuentes de información no están completas, por lo que se dificulta enormemente la ...

  9. Electroterapia y electroporación en el tratamiento de tumores: modelos teóricos y experimentales

    OpenAIRE

    Turjanski, Pablo Guillermo

    2011-01-01

    El cáncer es una de las primeras causas de muerte por enfermedad en el mundo y su incidencia sigue creciendo con el aumento de la contaminación y la expectativa de vida. A pesar de los grandes avances científicos logrados en la lucha contra esta enfermedad, aun es necesario buscar soluciones más integrales, económicas y con menos efectos secundarios adversos que las terapias tradicionales. Aquí estudiamos el uso de campos eléctricos para la eliminación de tumores sólidos, lo que podría repres...

  10. Prácticas musicales durante el proceso de urbanización en Bogotá (Colombia), 1900-1940

    OpenAIRE

    Julio Aldemar Gómez Castañeda

    2015-01-01

    Durante el proceso de urbanización que vivió Bogotá en las primeras décadas del siglo XX, además de los cambios demográficos, de infraestructura o de servicios, las formas de ritualizar alrededor de la música experimentaron una serie de transformaciones. En la medida en que la ciudad fue creciendo, y los tiempos para el entretenimiento y la recreación fueron aflorando, las prácticas musicales se ajustaron a nuevas influencias, espacios, escenarios y condiciones técnicas. Algunas de ellas se r...

  11. Ejercicio físico adaptado en plataformas Bosu, para la mejora del equilibrio y agilidad en la población mayor

    OpenAIRE

    Rodríguez Marugán, María de la Merced

    2014-01-01

    La actividad física ha cobrado mucha relevancia en los últimos años y con mayor acentuación en la población mayor de 65 años. Es por ello, que están creciendo muchas formas de revitalización geriátrica. El envejecimiento afecta al sistema nervioso y a las propiedades del sistema neuromuscular, lo cual conlleva déficits evidentes en el equilibrio y la marcha. Es por ello que desde la fisioterapia se ha llevado a cabo la puesta en marcha de un programa de ejercicio físico adaptado en plat...

  12. El Mercado Europeo de Productos Orgánicos de Comercio Justo

    OpenAIRE

    Garibay, Salvador; Richter, Toralf

    2005-01-01

    Los países centroamericanos son importantes productores de productos orgánicos. Su base de exportaciones, sin embargo, es altamente dependiente de un número limitado de productos (café, cacao, banano, azúcar) lo que atenta contra la sostenibilidad del sector exportador. Por lo tanto, hay una urgente necesidad de diversificar la base de exportaciones y de desarrollar mercados nacionales y regionales, los cuales están creciendo continuamente y tienen un gran potencial. El propósito de este repo...

  13. Las dimensiones del valor percibido en productos con atributos sociales y medioambientales: una aplicación al caso de café orgánico y de comercio justo

    OpenAIRE

    Aragón Gutiérrez, Carlos

    2013-01-01

    En un sector importante de consumidores está surgiendo el interés por los productos con propiedades éticas, principalmente cuando éstas están vinculadas con temas que impactan a una gran parte de la humanidad, como son la protección del medio ambiente y la mitigación de la pobreza. En el ámbito corporativo también está creciendo rápidamente el interés en lo ético por el potencial que tiene para influir sobre las decisiones de compra del consumidor. En este contexto, ha surgido el concepto de...

  14. Interacciones entre "Pythium ultimum" y bacterias de la rizosfera en la patogénesis de la podredumbre del tallo del brócoli

    OpenAIRE

    Parra Sáez, María Angeles

    2015-01-01

    sintomatología que se asocia comúnmente a la enfermedad denominada podredumbre blanda bacteriana ocasionada por la bacteria Erwinia carotovora. Sin embargo, en este trabajo se ha aislado al hongo Pythium ultimum creciendo, al mismo tiempo, con varias especies de bacterias que habitan corrientemente en los suelos del interior del tallo floral de piezas de brócoli maduras afectadas de podredumbre blanda en cultivos del sureste de España durante el año 2012. P. ultimum causa “damping-off” en num...

  15. Ejercitando el futuro a través de los parques científicos y tecnológicos

    OpenAIRE

    Bellavista, Joan

    2009-01-01

    En plena etapa de convulsión y con- nfusión sobre la evolución de la Economía y la Sociedad, el movimiento internacional de Parques Científicos y Tecnológicos continúa avanzando con fuerza. Desde esta perspectiva agregada internacional, la creación de nuevos parques, nuevas empresas del conocimiento y nuevos servicios de referencia sigue creciendo a un ritmo parecido al de años anteriores. En este contexto propongo un ejercicio de hiperrealismo, donde nuestro comportamiento individual y colec...

  16. LA ACCIÓN Y EL ENFOQUE PSICOSOCIAL DE LA INTERVENCIÓN EN CONTEXTOS SOCIALES: ¿PODEMOS PASAR DE LA MODA A LA PRECISIÓN TEÓRICA, EPISTEMOLÓGICA Y METODOLÓGICA?. THE ACTION AND THE PSYCHOSOCIAL APPROACH OF THE INTERVENTION IN SOCIAL CONTEXTS: CAN WE MOVE FROM THE FASHION TO THE THEORETICAL, EPISTEMOLOGICAL, AND METHODOLOGICAL PRECISION?.

    OpenAIRE

    Juan David Villa Gómez

    2012-01-01

    El siguiente artículo derivado de investigación, se plantea la pregunta en torno a una realidad que viene creciendo en Colombia: el incremento de los proyectos de intervención psicosocial en diversos sectores sociales, especialmente con víctimas del conflicto armado, violencia social, violencia de género e intrafamiliar, entre otras; además de población en situación de pobreza extrema, desplazamiento forzado y víctimas de catástrofes naturales. En relación con esta lógica de intervención y de...

  17. TEORÍA TRANSTEORÉTICA DE CAMBIO DE CONDUCTA: HERRAMIENTA IMPORTANTE EN LA ADOPCIÓN DE ESTILOS DE VIDA ACTIVOS

    OpenAIRE

    Carlos Álvarez

    2008-01-01

    A pesar del culto a la belleza que ha regido en esta sociedad globalizada, y a la importancia de la actividad física en relación con la prevención de las enfermedades cardiodegenerativas (US.DHHS, 1996), el sedentarismo sigue creciendo en la población. ¿Qué estrategias puede usar un profesional en movimiento humano para lograr activar a la población? Es aquí donde surge el modelo transteorético como una opción innovadora que supera con creces las intervenciones biologistas clásicas y cortopl...

  18. METANO BIOGENICO COMO COMBUSTIBLE VEHICULAR

    OpenAIRE

    2013-01-01

    Actualmente la mitad del petróleo que se consume en el mundo está asociado al sector transporte y continúa creciendo a un ritmo vertiginoso, tanto así, que la International Energy Agency (IEA) proyecta que para el 2030 éste llegará al 90%, tras lo cual, no se podrá suplir adecuadamente la demanda mundial. La realidad latinoamericana no es ajena a esta problemática. Chile y Brasil son las naciones que presentan el mayor porcentaje de importación de petróleo de la región y en el cas...

  19. Laboratorios virtuales y docencia de la automática en la formación tecnológica de base

    OpenAIRE

    Cerezo Coca, Francisco

    2016-01-01

    Recientemente, ha surgido un interés por aprender a programar, debido a las oportunidades profesionales que da este tipo de estudios universitarios. Es fácil de entender porque el número de trabajos para programadores e ingenieros informáticos está creciendo rápidamente. Por otro lado, un amplio grupo de psicólogos opinan que el pensamiento computacional es una destreza fundamental para cualquiera, no sólo para los ingenieros informáticos. Para leer, escribir y realizar operaciones aritmética...

  20. Implementación de un EVA para el ingreso a la universidad : El caso del módulo “Estrategias de Aprendizaje en la Universidad” para los alumnos de la Licenciatura en Sistemas de Información

    OpenAIRE

    Castro Chans, Beatriz; Godoy Guglielmone, María Viviana; Sobol, Blanca; Mariño, Sonia Itatí

    2012-01-01

    La utilización de EVA –entornos virtuales de aprendizaje– ha ido creciendo en las universidades públicas y privadas del país como herramienta de apoyo a la modalidad presencial o para el dictado virtual de cursos y asignaturas tanto de grado como de posgrado. Este artículo describe y analiza la utilización de aulas virtuales en el marco del Curso de Nivelación y Ambientación 2012, implementado en la Facultad de Ciencias Exactas y Naturales y Agrimensura de la UNNE y específicamente del modulo...