WorldWideScience

Sample records for pinta panulirus inflatus

  1. Comentarios sobre la distribución de la langosta pinta Panulirus inflatus y la langosta roja P. interruptus (Crustacea: Palinuridae en el Pacífico mexicano Remarks on the distribution of the pinto lobster Panulirus inflatus and the red lobster P. interruptus (Crustacea: Palinuridae in the Mexican Pacific

    Directory of Open Access Journals (Sweden)

    Ernesto Campos

    2007-06-01

    Full Text Available El trabajo de campo sobre la costa oeste de la península de Baja California entre los años 2000 y 2005 dio como resultado la ampliación del ámbito geográfico norteño, desde la Bahía de Santa María hasta Punta Eugenia y sus zonas aledañas, para una población permanente de la langosta pinta Panulirus inflatus (Bouvier, 1895. Registros de esta especie para Bahía de Los Ángeles (golfo de California e isla Guadalupe, México y San Diego, California, en Estados Unidos de América están considerados extralímite y se relacionan con el incremento en la temperatura promedio en el golfo, la condición de calentamiento del agua marina en el Pacifico oriental o el evento El Niño. Adicionalmente, un análisis histórico detallado sobre la distribución de la langosta roja P. interruptus (Randall, 1893 sugiere que los registros al sur de Bahía Magdalena, Baja California Sur y aquellos de la parte sur del Golfo de California son extralímite. Sin embargo, los individuos de Bahía de Los Ángeles y sus áreas aledañas (incluyendo Isla Tiburón y Guaymas, Sonora parecen representar una población que quedó aislada de aquella de la costa oeste de la península de Baja California después de que el corredor marino medio-peninsular, presente en el período Terciario neógeno, se cerró al emerger completamente la península.Fieldwork along the west coast of the Baja California peninsula has resulted in a northern range extension, from Bahía Santa María to Punta Eugenia and vicinity, Baja California Sur, Mexico, for a permanent population of the pinto lobster Panulirus inflatus (Bouvier, 1895. Records of this species from Ángel de la Guarda Island (within the Gulf of California and Guadalupe Island, Mexico and San Diego, California, USA are considered extralimital and related to annual water warming in the Gulf and the Eastern Pacific warm water condition or El Niño event, respectively. In addition, an historic analysis of the red lobster

  2. Taxonomy of the phyllosoma of Panulirus inflatus (Bouvier, 1895 and P. gracilis Streets, 1871, based on morphometry and molecular analysis

    Directory of Open Access Journals (Sweden)

    Isabel Muñoz-García

    Full Text Available Analysis of wild phyllosoma of Panulirus inflatus (Bouvier, 1895 and P. gracilis Streets, 1871 determined the morphological structures having taxonomic value for differentiation of the two species, in addition to the structures described previously. Of 54 phyllosoma, species identity was confirmed by PCR-restriction fragment length polymorphism (RFLP on 42 P. inflatus and 4 P. gracilis, for which morphology and morphometric measurements were taken. Morphological analysis found subexopodal spines, spines at the base of pereopods 1 and 2, and the mandibles are structures of taxonomic value for differentiating the two species. Morphometric data did not allow differentiation.

  3. PINTA: a web server for network-based gene prioritization from expression data

    DEFF Research Database (Denmark)

    Nitsch, Daniela; Tranchevent, Léon-Charles; Goncalves, Joana P.

    2011-01-01

    network. Our strategy is meant for biological and medical researchers aiming at identifying novel disease genes using disease specific expression data. PINTA supports both candidate gene prioritization (starting from a user defined set of candidate genes) as well as genome-wide gene prioritization...... and is available for five species (human, mouse, rat, worm and yeast). As input data, PINTA only requires disease specific expression data, whereas various platforms (e.g. Affymetrix) are supported. As a result, PINTA computes a gene ranking and presents the results as a table that can easily be browsed...

  4. Catch composition of the spiny lobster Panulirus gracilis (Decapoda: Palinuridae off the western coast of Mexico Composición de la captura de la langosta espinosa Panulirus gracilis (Decapoda: Palinuridae en la costa oeste de México

    Directory of Open Access Journals (Sweden)

    Raúl Pérez-González

    2011-07-01

    Full Text Available The lobster fishery in the Gulf of California and the south-central region of the western coast of Mexico consists of small-scale artisanal activity supported by Panulirus gracilis and P. inflatus, with an annual average catch of 132 ton. The present study analyzes the landing composition of this fishery and the population structure of P. gracilis. Carapace lengths (CL for this species ranged from 35 to 125 mm, and the most frequent sizes were between 60 and 85 mm. The size distribution was approximately normal. This implies that the fishery is composed of several size classes, with annual recruitment to the fishing areas. For the 1989-1990 and 1990-1991 fishing seasons, the mean monthly sizes of males were between 70.18 ± 11.74 and 81.11 ± 6.76 mm CL, whereas females averaged from 73.60 ± 8.95 to 80.28 ± 7.53 mm CL. Power-law relationships between carapace length (CL in mm and total weight (TW in g were determined, resulting in the following equations: PT = 0.0021 CL27689 for males and PT = 0.0009 CL³ 0038 for females. During certain periods of the year, males dominated the catch; however, the overall annual male:female ratio was near 1:1.La pesquería de langosta en el golfo de California y en el centro-sur de la costa occidental de México es una actividad artesanal a pequeña escala y es sostenida por Panulirus gracilis y P. inflatus, con una captura promedio anual de 132 ton. En este estudio se analiza la composición de los desembarques de esta pesquería y la estructura de la población de P. gracilis. El intervalo de talla de esta especie fue de 35 a 125 mm de longitud del cefalotórax (LC y el más frecuente se encontró entre 60 y 85 mm. La distribución de tallas fue aproximadamente normal. Esto implica que la pesquería está compuesta por varias clases de tallas, con un reclutamiento anual a las áreas de pesca. La talla media mensual de machos fue entre 70,18 ± 11,74 y 81,11 ± 6,76 mm LC y en hembras de 73,60 ± 8,95 a 80

  5. Alimentación y estado nutricional de las langostas Panulirus inflalus y Panulirus gracilis (Decapoda: Palinuridae) en Guerrero, México

    OpenAIRE

    Lozano-Alvarez, Enrique; Aramoni-Serrano, Gabriela

    2016-01-01

    Se realizó un estudio estacional sobre la alimentación natural y el estado Ilutricional de las langostas Panulirus inflalus del área de Guerrero. en la costa mexicana del Pacífico. Se realizó un estudio estacional sobre la alimentación natural y el estado Ilutricional de las langostas Panulirus inflalus" del área de Guerrero. en la costa mexicana del Pacífico

  6. Consumo de oxígeno y punto crítico en langostas Panulirus argus - Oxygen consumption and critical point in lobsters Panulirus argus

    Directory of Open Access Journals (Sweden)

    Suárez Álvarez, Gerardo

    2012-02-01

    Full Text Available ResumenLa tasa metabólica de la langosta espinosa Panulirus argus se estimó como 46.9 mg O2.kg-1.h-1 a 20oC para ejemplares de 520 g de peso medio.AbstractThe metabolic rate of the spiny lobster Panulirus argus was estimated at 46.9 mg O2.kg-1.h-1 at 20oC for specimens of 520 g of average weight.

  7. Análisis de la pesquería de langosta Panulirus inflatus en la costa de Jalisco, México (marzo de 2002 a diciembre de 2003

    Directory of Open Access Journals (Sweden)

    M. Puente-Gómez

    2006-01-01

    Full Text Available Con la finalidad de conocer el estado actual del recurso pesquero langosta, se realizó este estudio que presenta resultados preliminares del trabajo de campo en la costa Sur de Jalisco (de Punta Pérula a Barra de Navidad, de marzo de 2002 a diciembre de 2003; en él, se midieron, pesaron y anotaron su sexo a 173 organismos. Éstos, fueron colectados con gancho por buzos que trabajaron de 4 a 6 horas diarias en la captura de esta especie. La longitud del cefalotórax (Lc de las langostas se encontró entre 2.40 a 19.70 cm, con una media de 9.55 cm (± 2.339 de desviación estándar y una moda de 10.0 cm. El 50% de los organismos presentó más de 9.0 cm de Lc y pesó más de 500 g: sólo el 13% midió menos de 8.25 cm, la talla mínima legal. Las relaciones morfométricas mostraron un crecimiento alométrico negativo entre la longitud total y la del cefalotórax de b = 0.804 y entre el peso y la longitud del cefalotórax de b = 2.488. La proporción sexual hembra:macho fue de 1:1; y las hembras maduras se observaron en abril y mayo. La captura de langosta varió entre 2 y 250 t anuales entre 1972 y 2001, con un promedio de 33 t, con una tendencia negativa. Entre 1997 y 2001, se capturaron 13 t anuales en promedio. Es posible que por falta de permisos de pesca no se esté registrando la captura correctamente. La CPUE promedio estimada fue de 13 kg/viaje.

  8. Advances in the diagnosis of endemic treponematoses: yaws, bejel, and pinta.

    Directory of Open Access Journals (Sweden)

    Oriol Mitjà

    Full Text Available Improved understanding of the differential diagnosis of endemic treponematoses is needed to inform clinical practice and to ensure the best outcome for a new global initiative for the eradication of yaws, bejel, and pinta. Traditionally, the human treponematoses have been differentiated based upon their clinical manifestations and epidemiologic characteristics because the etiologic agents are indistinguishable in the laboratory. Serological tests are still considered standard laboratory methods for the diagnosis of endemic treponematoses and new rapid point-of-care treponemal tests have become available which are extremely useful in low-resource settings. In the past ten years, there has been an increasing effort to apply polymerase chain reaction to treponematoses and whole genome fingerprinting techniques have identified genetic signatures that can differentiate the existing treponemal strains; however, definitive diagnosis is also hampered by widespread unavailability of molecular diagnostics. We review the dilemmas in the diagnosis of endemic treponematoses, and advances in the discovery of new diagnostic tools.

  9. BUDIDAYA LOBSTER (Panulirus sp. DI VIETNAM DAN APLIKASINYA DI INDONESIA

    Directory of Open Access Journals (Sweden)

    Akhmad Mustafa

    2013-12-01

    Full Text Available Desa Xuan Tun di Kecamatan Van Ninh Kota Nha Trang Provinsi Khanh Hoa merupakan lokasi pertama kegiatan budidaya lobster di Vietnam yang dilakuan pada tahun 1992. Secara umum di Kota Nha Trang, ada tiga jenis lobster yang dibudidayakan yaitu lobster mutiara (Panulirus ornatus, lobster pasir (Panulirus homarus, dan lobster batik (Panulirus longipes, karena benih lobster tersebut mudah didapat pada awalnya, cepat tumbuh, berukuran besar, warna cerah, dan memiliki harga yang tinggi. Kegiatan budidaya lobster pada dasarnya terdiri atas: penangkapan benih lobster, produksi tokolan lobster, dan pembesaran lobster yang masing-masing merupakan segmen usaha tersendiri. Pakan yang digunakan dalam produksi tokolan dan pembesaran lobster adalah berupa udang, kerang, tiram, cumi-cumi, dan ikan rucah, di mana sebagian besar dari pakan tersebut digunakan ikan rucah terutama pada pembesaran lobster. Sebagai akibat penggunaan pakan tersebut dan peningkatan jumlah keramba jaring apung yang cukup signifikan berdampak pada penurunan kualitas perairan yang memicu berkembangya penyakit susu (milky haemolymph disease sehingga terjadi penurunan produksi. Terkait dengan hasil yang didapatkan tersebut, ke depan diperlukan berbagai kegiatan termasuk untuk dapat diaplikasikan di Indonesia. Kegiatan tersebut meliputi: produksi benih lobster secara buatan di hatcheri dan penggunaan pakan buatan berupa moist pellet. Upaya pencegahan penyakit susu dan perlakuan-perlakuan praktis untuk mencegah perkembangan serangan penyakit susu juga perlu mendapat perhatian. Perkembangan budidaya lobster yang begitu cepat memicu terjadinya penurunan daya dukung lahan. Oleh karena itu, kegiatan untuk menentukan daya dukung lahan dan kesesuaian lahan menjadi penting untuk dilakukan untuk menentukan lokasi dan jumlah keramba jaring apung yang dapat dioperasikan. Penentuan daya dukung lahan dan evaluasi kesesuaian lahan tidak hanya dilakukan pada daerah yang

  10. Isolation and characterization of eight polymorphic microsatellites for the spotted spiny lobster, Panulirus guttatus

    Directory of Open Access Journals (Sweden)

    Nathan Truelove

    2016-01-01

    Full Text Available Microsatellite sequences were isolated from enriched genomic libraries of the spotted spiny lobster, Panulirus guttatus using 454 pyrosequencing. Twenty-nine previously developed polymerase chain reaction primer pairs of Panulirus argus microsatellite loci were also tested for cross-species amplification in Panulirus guttatus. In total, eight consistently amplifying, and polymorphic loci were characterized for 57 individuals collected in the Florida Keys and Bermuda. The number of alleles per locus ranged from 8 to 20 and observed heterozygosities ranged from 0.409 to 0.958. Significant deviations from Hardy–Weinberg equilibrium were found in one locus from Florida and three loci from Bermuda. Quality control testing indicated that all loci were easy to score, highly polymorphic and showed no evidence of linkage disequilibrium. Null alleles were detected in three loci with moderate frequencies ranging from (20% to 22%. These eight microsatellites provide novel molecular markers for future conservation genetics research of P. guttatus.

  11. A revision of the Indo-West Pacific spiny Lobsters of the Panulirus Japonicus group

    NARCIS (Netherlands)

    George, R.W.; Holthuis, L.B.

    1965-01-01

    INTRODUCTION As a result of separate investigations on Panulirus japonicus (sens, lat.), the present authors independently came to the conclusion that more than one species was included under that name. The first author (George), when in 1958 studying specimens of the Western Australian spiny

  12. PERBEDAAAN PADAT TEBAR TERHADAP TINGKAT PERTUMBUHAN DAN KELANGSUNGAN HIDUP POST PEURULUS LOBSTER PASIR (Panulirus homarus PADA BAK TERKONTROL

    Directory of Open Access Journals (Sweden)

    Nunik Cokrowati

    2012-10-01

    Full Text Available Prospek budidaya Panulirus homarus menjanjikan dari segi ekonomi dan keadaan alam di wilayah NTB serta merupakan spesies komoditi ekspor utama di Indonesia.Potensi akuakultur lobster pasir tentunya membutuhkan teknik budidaya yang sesuai agar mendapatkan hasil yang optimal.Tujuan penelitian ini adalah untuk mengetahui perbedaan padat tebar terhadap pertumbuhan dan nilai Survival rate (SR serta untuk mengetahui padat tebar yang dapat menghasilkan pertumbuhan dan nilai SR optimum post puerulus Panulirus homarus.Metode yang digunakan dalam penelitian ini adalah metode eksperimental dengan menggunakan Rancangan Acak Lengkap (RAL dengan faktor tunggal yaitu padat tebar dengan densitas 20 ekor/m2, 40 ekor/m2, 60 ekor/m2, dan 80 ekor/m2. Parameter yang diamati adalah pertumbuhan spesifik dan kelangsungan hidup (SR post puerulus Panulirus homarus. Hasil penelitian menunjukkan bahwa pemberian perlakuan perbedaan padat tebar berpengaruh (P<0,05 terhadap pertumbuhan spesifik dan kelangsungan hidup (SR post puerulus Panulirus homarus. Nilai SGR dan SR tertinggi terdapat pada kepadatan 20 ekor/m2 sebesar 2,15425% dengan nilai SR 75%, dengan kualitas air sebagai faktor pembatas dengan nilai rata-rata pH 7,2, suhu 26,930 C, salinitas 34,4 ppt dan DO 5,86 mg/l nilai tersebut dalam batas toleransi  sebagai kehidupan biota air khususnya  lobster pasir. Kata kunci : Panulirus homarus, padat tebar, survival rate

  13. O puru-puru da Amazônia (Pinta, Carate, Mal del Pinto etc

    Directory of Open Access Journals (Sweden)

    F. Nery Guimarães

    1948-03-01

    Full Text Available 1 "Purú-purú" é uma palavra indígena que quer dizer "pintado" ou "manchado", peculiar à Amazonia Brasileira. Com êsse nome é designada uma dermatose referida entre os selvicolas desde 1774, por Ribeiro Sampaio. Certas tribus, com alta incidência da moléstia passaram a ser cahamadas também "Purú-purús", o mesmo acontecendo com o rio onde habitavam - Rio Purús. 2 A doença existe na bacia do Rio Solimões e seus principais afluentes: Javari, Juruá, Purús, Içá, Japurá, e Negro. Por esses rios, o fóco da dermatose se continua nos países limitrofes com o Brasil: Guianas, Venezuela, Colombia, Perú (Equador e Bolivia. 3 Desde 1890 essa dermatose foi relacionada à pinta (carate ou mal del pinto por P. S. de Magalhães, idéa essa depois defendida por Juliano Moreira, Carlos Chagas, Roquete Pinto, Wappeus, O. da Fonseca Filho, Da Matta, Brumpt e outros, baseados na semelhança clínica e na terapêutica. Recentemente (1945, essa provavel identidade das duas dermatoses, recebeu fundamento sorológico de Biocca (que verificou a positividade das reações de Kline e Kahn em doentes de purú-purú, e, pelo presente trabalho, recebe base clínico-epidemio-anatomo-patológica. 4 Sob o ponto de vista clínico, as lesões cutaneas discromicas da moléstia, são de 3 órdens: a lesões papulo-eritemato-escamosas, isoladas ou não, arredondadas, pruriginosas e de bordos nitidos; b lesões maculo-escamosas, maiores mais pálidas, ás vezes já mostrando alterações pigmentares na parte central; c máculas discromod´rmicas, lisas ou ligeiramente escamosas, com maior ou menor alteração pigmentar, as quais assumem diferentes aspéctos, consequentes à hipo - ou hiperpigmentação, variaveis também com a côr do paciente. As colorações predominantes nas manchas, são o branco, o preto e o vermelho, com tonalidades eminentemente variaveis. Embora raramente, nessas extensas dermodiscromias, observa-se superposição de lesões papulo

  14. Patometria, parâmetros genéticos e reação de progênies de mamoeiro à pinta-preta

    Directory of Open Access Journals (Sweden)

    Marcelo Vivas

    2012-01-01

    Full Text Available A resistência genética constitui-se em alternativa sustentável para o controle de doenças em culturas agrícolas, sendo esta, no entanto, dependente da avaliação de populações naturais ou tradicionais visando à ampliação da base genética. Este trabalho relata a avaliação fenotípica de 24 progênies de mamoeiro, oriundas de genótipos crioulos, cultivados por pequenos agricultores no sul do Estado do Espírito Santo. Avaliaram-se características associadas à resistência à pinta-preta, importante doença desta cultura, causada pelo fungo Asperisporium caricae. Para fins comparativos, foram incluídas uma variedade resistente ('Maradol' e uma suscetível ('Golden' à pinta-preta. Pelos parâmetros genéticos estimados, concluiu-se que na população estudada há variabilidade genética quanto à resistência à pinta-preta suficiente para indicar a seleção recorrente como método de melhoramento.

  15. Mechanosensory Neurons With Bend- and Osmo-sensitivity in Mouthpart Setae From the Spiny Lobster Panulirus argus

    DEFF Research Database (Denmark)

    Garm, Anders; Derby, Charles D; Høeg, Jens T

    2004-01-01

    The mouthparts of the spiny lobster Panulirus argus hold primarily two types of setae--simple setae and cuspidate setae. Mechanosensory neurons from these setae were examined by electrophysiological recordings. The population of simple setae contained two types of mechanosensory neurons: displace......The mouthparts of the spiny lobster Panulirus argus hold primarily two types of setae--simple setae and cuspidate setae. Mechanosensory neurons from these setae were examined by electrophysiological recordings. The population of simple setae contained two types of mechanosensory neurons...

  16. Ultrastructure and functional organization of mouthpart sensory setae of the spiny lobster Panulirus argus: new features of putative mechanoreceptors

    DEFF Research Database (Denmark)

    Garm, Anders Lydik; Høeg, Jens T

    2006-01-01

    In comparison with other decapods, the Caribbean spiny lobster Panulirus argus has little diversity in the external morphology of the setae on the mouth apparatus. In mouthpart areas that frequently touch food items only two types of setae can be distinguished: simple setae and cuspidate setae...

  17. Isolation, characterization, and multiplexing of novel microsatellite markers for the tropical scalloped spiny lobster (Panulirus homarus).

    Science.gov (United States)

    Delghandi, M; Goddard, S; Jerry, D R; Dao, H T; Afzal, H; Al-Jardani, S S

    2015-12-29

    Of the various spiny lobster species in the tropical and subtropical Indo-West Pacific region, the tropical scalloped spiny lobster (Panulirus homarus) supports one of the most commercially valuable fishery resources in many coastal African and Asian countries. The last decade has witnessed a serious decline in the wild populations of this species. Knowledge of the genetic basis of spiny lobster population structure is a prerequisite to achieve a sustainable fisheries management for this species. Here, we describe 13 novel polymorphic microsatellite markers developed for P. homarus, using a cross-species primer design strategy based on P. ornatus Roche 454 shot-gun generated sequencing. Microsatellite polymorphisms were assessed in 96 unrelated P. homarus individuals of a natural population, with the number of alleles per locus varying from 2 to 14, the observed and expected heterozygosity from 0.00 to 0.78 and from 0.03 to 0.79, respectively, and with only four loci (Pho-G27, Pho-G32, Pho-G36, and Pho-G58) deviating from Hardy- Weinberg equilibrium. Genetic linkage disequilibrium analysis between all pairs of the loci showed significant departure from the null hypothesis between loci Pho-G22 - Pho-G30, and Pho-G30 - Pho-G35. The successful cross amplification of these microsatellites highlights the potential of the developed microsatellites for future population genetic research within the different Panulirus species.

  18. Stock assessment of the red spiny lobster (Panulirus argus caught in the tropical southwestern Atlantic

    Directory of Open Access Journals (Sweden)

    Humber A Andrade

    2015-03-01

    Full Text Available The stocks of the red spiny lobster (Panulirus argus (Latreille, 1804 in the Caribbean and in the Brazilian coast are of considerable economic importance. There are important genetic differences between the Brazilian and Caribbean populations, which support separated stock assessment. The present study provides an assessment of the Brazilian stock of P. argus using a biomass dynamic model based on a Bayesian approach. Assuming that the catch per unit effort is a valid index of relative abundance, the results of the analysis indicate that stocks have been heavily overexploited since the 1980s. The present-day scenario is pessimistic, and there is evidence that the stock may be close to collapse.

  19. Nutritional value of spiny lobsters (Panulirus sp.) from Southern Coast of Java

    Science.gov (United States)

    Haryono, F. Eko Dwi; Hutabarat, Sahala; Hutabarat, Johannes; Ambariyanto

    2015-12-01

    Five species of spiny lobsters are known to live in southern coast of Java. These lobsters are very popular seafood which was believed to have high nutritional value. However, nutrition content of these species from the area has not been investigated. This research was conducted to study nutrition content in these crustaceans. Five spiny lobsters i.e. Panulirus homarus, P. versicolor, P. ornatus, P. penicullatus, and P. longipes, were collected randomly from different locations at the southern coast of Java. Morphometric measurements were conducted prior to proximate analysis of these lobsters. All species of spiny lobsters investigated have similar carapace length. However, P. homarus and P. versicolor have the highest muscle weight. Proximate analysis shows that P. homarus also has high protein (24.18%) and carbohydrate content (55.68%) and lowest lipid content (6.18%) compare with other species. These results suggest that this lobster has best nutritional value for consumption.

  20. Complete mitochondrial genome of Australian spiny lobster, Panulirus cygnus (George, 1962) (Crustacea: Decapoda: Palinuridae) from coast of Australia.

    Science.gov (United States)

    Kim, Gyungryul; Yoon, Tae-Ho; Park, Won Gyu; Park, Jung Youn; Kang, Jung-Ha; Park, Hyun; Kim, Hyun Woo

    2016-11-01

    We characterized the total mitochondrial genome of Australian spiny lobster, Panulirus cygnus (George, 1962), which is found along the western coast of Australia. Total mitochondrial genome length of P. cygnus was 15 724 bp, in which 13 proteins, 2 ribosomal RNAs, 22 transfer RNAs, and a putative control region were encoded. Nine and four protein-coding genes are encoded on the H-strand and on the L-strand, respectively. According to the phylogenetic analysis, P. cygnus was most closely related to Panulirus japonicus among the compared six species belonging to Palinuridae. Although overall gene organization was the same, the putative control region (between SrRNA gene and tRNA(Ilel)) is least similar to one another among mitochondrial genomes from the compared six species belonging to Palinuridae.

  1. Genetic Isolation among the Northwestern, Southwestern and Central-Eastern Indian Ocean Populations of the Pronghorn Spiny Lobster Panulirus penicillatus

    Directory of Open Access Journals (Sweden)

    Muhamad Fadry Abdullah

    2014-05-01

    Full Text Available The pronghorn spiny lobster Panulirus penicillatus is a highly valuable species which is widely distributed in Indo-West Pacific and Eastern Pacific regions. Mitochondrial DNA control region sequences (566–571 bp were determined to investigate the population genetic structure of this species in the Indian Ocean. In total, 236 adult individuals of Panulirus penicillatus were collected from five locations in the Indian Ocean region. Almost all individuals had a unique haplotype. Intrapopulation haplotype (h and nucleotide (π diversities were high for each locality, ranging from h = 0.9986–1.0000 and π = 0.031593–0.043441. We observed distinct genetic isolation of population located at the northwestern and southwestern edge of the species range. Gene flow was found within localities in the central and eastern region of the Indian Ocean, probably resulting from an extended planktonic larval stage and prevailing ocean currents.

  2. Novos progenitores de batata imunes a PVY e PVX e resistentes à pinta-preta New potato progenitors immune to PVY and PVX, and resistant to early blight

    Directory of Open Access Journals (Sweden)

    Sieglinde Brune

    1999-07-01

    Full Text Available As viroses que ocorrem com muita frequência em plantas de batata no Brasil são responsáveis por queda na produtividade, principalmente quando provocados por uma combinação de vírus. Para PVY e PVX o tipo de resistência usada é a imunidade, controlada por genes simples e dominantes. A pinta-preta, causada pelo fungo Alternaria solani,é uma das principais doenças fúngicas da batata em condições de alta umidade e temperatura, podendo causar até 73% de perdas na produtividade. O uso da resistência genética é de grande interesse agronômico, uma vez que a eliminação ou redução do uso de agrotóxicos leva a menores custos de produção da lavoura, além de mitigar a poluição ambiental e os riscos ao ser humano. A Embrapa Hortaliças avalia anualmente, em seu programa de melhoramento da batata, a imunidade aos vírus PVY e PVX, a resistência à pinta-preta, além de observar as características agronômicas dos clones. Entre os genótipos avaliados em 1991 e 1992 destacaram-se os clones Embrapa/CIP-PP063 e Embrapa/CIP-PP084 com boas características agronômicas, imunidade a PVY e PVX e alto nível de resistência à pinta-preta. Ambos podem ser empregados como progenitores em programas de melhoramento que objetivem imunidade a esses vírus e resistência à pinta-preta. Os clones Embrapa/CIP-PP063 e o Embrapa/CIP-PP084 encontram-se à disposição de instituições interessadas em trabalhos cooperativos com a Embrapa Hortaliças, na forma de tubérculos ou plântulas in vitro.Viruses that occur frequently in potato crops in Brazil are responsible for crop yield losses, mainly when caused by a combination of viruses. For PVY and PVX the type of resistance used is immunity, controlled by single and dominant genes. Early blight caused by Alternaria solani is one of the most important potato diseases in Brazil, especially when high air humidity and warm weather conditions prevail. This disease can cause losses up to 73%. The use of

  3. Genetic isolation between the Western and Eastern Pacific populations of pronghorn spiny lobster Panulirus penicillatus.

    Science.gov (United States)

    Chow, Seinen; Jeffs, Andrew; Miyake, Yoichi; Konishi, Kooichi; Okazaki, Makoto; Suzuki, Nobuaki; Abdullah, Muhamad F; Imai, Hideyuki; Wakabayasi, Toshie; Sakai, Mitsuo

    2011-01-01

    The pronghorn spiny lobster, Panulirus penicillatus, is a circumtropical species which has the widest global distribution among all the species of spiny lobster, ranging throughout the entire Indo-Pacific region. Partial nucleotide sequences of mitochondrial DNA COI (1,142-1,207 bp) and 16S rDNA (535-546 bp) regions were determined for adult and phyllosoma larval samples collected from the Eastern Pacific (EP)(Galápagos Islands and its adjacent water), Central Pacific (CP)(Hawaii and Tuamotu) and the Western Pacific (WP)(Japan, Indonesia, Fiji, New Caledonia and Australia). Phylogenetic analyses revealed two distinct large clades corresponding to the geographic origin of samples (EP and CP+WP). No haplotype was shared between the two regional samples, and average nucleotide sequence divergence (Kimura's two parameter distance) between EP and CP+WP samples was 3.8±0.5% for COI and 1.0±0.4% for 16S rDNA, both of which were much larger than those within samples. The present results indicate that the Pacific population of the pronghorn spiny lobster is subdivided into two distinct populations (Eastern Pacific and Central to Western Pacific), with no gene flow between them. Although the pronghorn spiny lobster have long-lived teleplanic larvae, the vast expanse of Pacific Ocean with no islands and no shallow substrate which is known as the East Pacific Barrier appears to have isolated these two populations for a long time (c.a. 1MY).

  4. The trypsin inhibitor panulirin regulates the prophenoloxidase-activating system in the spiny lobster Panulirus argus.

    Science.gov (United States)

    Perdomo-Morales, Rolando; Montero-Alejo, Vivian; Corzo, Gerardo; Besada, Vladimir; Vega-Hurtado, Yamile; González-González, Yamile; Perera, Erick; Porto-Verdecia, Marlene

    2013-11-01

    The melanization reaction promoted by the prophenoloxidase-activating system is an essential defense response in invertebrates subjected to regulatory mechanisms that are still not fully understood. We report here the finding and characterization of a novel trypsin inhibitor, named panulirin, isolated from the hemocytes of the spiny lobster Panulirus argus with regulatory functions on the melanization cascade. Panulirin is a cationic peptide (pI 9.5) composed of 48 amino acid residues (5.3 kDa), with six cysteine residues forming disulfide bridges. Its primary sequence was determined by combining Edman degradation/N-terminal sequencing and electrospray ionization-MS/MS spectrometry. The low amino acid sequence similarity with known proteins indicates that it represents a new family of peptidase inhibitors. Panulirin is a competitive and reversible tight-binding inhibitor of trypsin (Ki = 8.6 nm) with a notable specificity because it does not inhibit serine peptidases such as subtilisin, elastase, chymotrypsin, thrombin, and plasmin. The removal of panulirin from the lobster hemocyte lysate leads to an increase in phenoloxidase response to LPS. Likewise, the addition of increasing concentrations of panulirin to a lobster hemocyte lysate, previously depleted of trypsin-inhibitory activity, decreased the phenoloxidase response to LPS in a concentration-dependent fashion. These results indicate that panulirin is implicated in the regulation of the melanization cascade in P. argus by inhibiting peptidase(s) in the pathway toward the activation of the prophenoloxidase enzyme.

  5. ASPEK REPRODUKSI LOBSTER (Panulirus sp. DI PERAIRAN TELUK EKAS PULAU LOMBOK

    Directory of Open Access Journals (Sweden)

    M Junaidi

    2010-04-01

    Full Text Available Purposes of this research are to know some reproduction aspects of lobster, including sex ratio, gonad maturity level, size of first gonad mature, fekundity, and relationship of length-weight some. This research was conducted in June until November 2009 in Ekas Bay. During research 5 lobsters species were obtained, they are Panulirus homarus, P. versicolor, P. ornatus P. penicillatus and P. longiceps, with their of is well-balanced (1:1. Size of first gonad mature of P. homarus at carapace length 77,44 mm that happened during June - November with fekundity 28.000 - 96.000 granule, P. versicolor at carapace length 82,20 mm that happened during June - September with fekundity 16.500 - 71.000 granule, P. ornatus at carapace length 76,74 mm that happened during September - November with fekundity 47.000 - 87.000 granule, P. penicillatus at carapace length 69,84 mm that happened during June - November with fekundity 31.000 - 150.000 granule and P. longiceps at carapace length 68,47 mm that happened in June - August with fekundity 47.000 - 140.000 granule. Relationship of carapace length and body weight of five species, also male and female was described using linier regression equation and have negative allometrict pattern, where accretion of carapace length was quicker than body weight accretion.Keyword : reproduction aspect, lobster, Ekas Bay

  6. Trypsin isozymes in the lobster Panulirus argus (Latreille, 1804): from molecules to physiology.

    Science.gov (United States)

    Perera, Erick; Rodríguez-Viera, Leandro; Perdomo-Morales, Rolando; Montero-Alejo, Vivian; Moyano, Francisco Javier; Martínez-Rodríguez, Gonzalo; Mancera, Juan Miguel

    2015-01-01

    Trypsin enzymes have been studied in a wide variety of animal taxa due to their central role in protein digestion as well as in other important physiological and biotechnological processes. Crustacean trypsins exhibit a high number of isoforms. However, while differences in properties of isoenzymes are known to play important roles in regulating different physiological processes, there is little information on this aspect for decapod trypsins. The aim of this review is to integrate recent findings at the molecular level on trypsin enzymes of the spiny lobster Panulirus argus, into higher levels of organization (biochemical, organism) and to interpret those findings in relation to the feeding ecology of these crustaceans. Trypsin in lobster is a polymorphic enzyme, showing isoforms that differ in their biochemical features and catalytic efficiencies. Molecular studies suggest that polymorphism in lobster trypsins may be non-neutral. Trypsin isoenzymes are differentially regulated by dietary proteins, and it seems that some isoenzymes have undergone adaptive evolution coupled with a divergence in expression rate to increase fitness. This review highlights important but poorly studied issues in crustaceans in general, such as the relation among trypsin polymorphism, phenotypic (digestive) flexibility, digestion efficiency, and feeding ecology.

  7. Study on halotolerance of phyllosoma larva of Chinese spiny lobster (Panulirus stimpsoni Holthuis)

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The halotolerance of phyllosoma larva of Chinese spiny lobster (Panulirus stimpsoni Holthuis) was experimentally studied in a man-made seawater of 13, 15, 19, 23, 27, 31, 35, 39,43, 47 and 49 salinity. The experimental results showed that phyllosoma lame survived for 4~6 d with a rate of 25.0% to 47.5% if seawater salinity was increased or decreased gradually from 31 to 49 or to 13 respectively. In a range of 23 to 39 salinity, the phyllosoma larva grew, developed and metamor phosed normally, the metamorphosis rate of which in Stages Ⅱ and Ⅲ being 85% and 48%, respec tively, when cultured in seawater of 31 salinity. It seems that some regular dispersion of larvae ap peared in various salinities of seawater; In lower salinity, they mainly dispersed in the lower layer and in higher salinity, almost stayed in the upper and middle layers. Also, the results indicated that the phyllo soma larva of Chinese spiny lobster had a strong halotolerance to various salinities of seawater ranging from 15 to 47,in which 27 to 35 salinities were appropriate for larva growth and development.

  8. [Biology and fishery of the lobster Panulirus gracilis in Playa Lagarto, Guanacaste, Costa Rica].

    Science.gov (United States)

    Madrigal, Helven Naranjo

    2011-06-01

    Panulirus gracilis is a high valuable lobster species with considerable captures along the tropical Pacific coast. In this study, I present some biological and fishery parameters described after a sample of 843 lobsters, landed in Playa Lagarto from November 2007 to October 2008. From landing records, a total of 74.9% of lobsters were below the minimum legal catch size (80 mm CL). Carapace lengths were in the range of 42.8 and 143.6 mm for males and 115 and 35.8 mm for females. The size structure showed a wide overlapping of population segments, and a trend to increase with depth, where lung diving and "hooka" diving operations take place. Sex ratio was 1.36 M:H. The relationship between weight and LC revealed that females are heavier than males of the same size, and this difference was significant (p fishing mortality (F) was higher in males (0.49-2.34-1.92) than in females (0.47-1.82-1.42). Recruitment was continuous for both sexes during the year, with an elevated intensity of 18.5% in July. Under the current fishing regime the population could be at risk of collapse, as indicated by the high exploitation rate (E) 0.80

  9. Biología pesquera de la langosta Panulirus gracilis en Playa Lagarto, Guanacaste, Costa Rica

    Directory of Open Access Journals (Sweden)

    Helven Naranjo Madrigal

    2011-06-01

    Full Text Available Los parámetros biológicos y pesqueros analizados se fundamentaron en una muestra de 843 langostas provenientes de la actividad pesquera realizada en Playa Lagarto entre noviembre del 2007 y octubre del 2008. Las longitudes cefalotoráxicas de los machos estuvo comprendida entre los 143.6 y 42.8 y 115 y 35.8mm para hembras. El 74.9% de las langostas en los desembarques estuvo por debajo de la talla mínima legal de captura (80 mm de LC. La estructura de tallas muestra un considerable solapamiento de segmentos poblacionales y el incremento de las tallas con la profundidad en donde operan las dos modalidades de pesca estudiadas: el buceo a pulmón y el buceo con compresor. La proporción de sexos obtenida fue de 1.36 M:H. La relación entre LC y peso reveló que las hembras pesan más que los machos de una misma talla y que esta diferencia fue significativa (pBiology and fishery of the lobster Panulirus gracilis in Playa Lagarto, Guanacaste, Costa Rica. Panulirus gracilis is a high valuable lobster species with considerable captures along the tropical Pacific coast. In this study, I present some biological and fishery parameters described after a sample of 843 lobsters, landed in Playa Lagarto from November 2007 to October 2008. From landing records, a total of 74.9% of lobsters were below the minimum legal catch size (80mm CL. Carapace lengths were in the range of 42.8 and 143.6mm for males and 115 and 35.8mm for females. The size structure showed a wide overlapping of population segments, and a trend to increase with depth, where lung diving and “hooka” diving operations take place. Sex ratio was 1.36 M:H. The relationship between weight and LC revealed that females are heavier than males of the same size, and this difference was significant (p<0.05. The von Bertalanffy growth parameters for males and females respectively (K=0.45-0.38, LC∞=166.9-121.7 showed accelerated growth compared to other species. Males observed a higher growth rate

  10. Genetic isolation between the Western and Eastern Pacific populations of pronghorn spiny lobster Panulirus penicillatus.

    Directory of Open Access Journals (Sweden)

    Seinen Chow

    Full Text Available The pronghorn spiny lobster, Panulirus penicillatus, is a circumtropical species which has the widest global distribution among all the species of spiny lobster, ranging throughout the entire Indo-Pacific region. Partial nucleotide sequences of mitochondrial DNA COI (1,142-1,207 bp and 16S rDNA (535-546 bp regions were determined for adult and phyllosoma larval samples collected from the Eastern Pacific (EP(Galápagos Islands and its adjacent water, Central Pacific (CP(Hawaii and Tuamotu and the Western Pacific (WP(Japan, Indonesia, Fiji, New Caledonia and Australia. Phylogenetic analyses revealed two distinct large clades corresponding to the geographic origin of samples (EP and CP+WP. No haplotype was shared between the two regional samples, and average nucleotide sequence divergence (Kimura's two parameter distance between EP and CP+WP samples was 3.8±0.5% for COI and 1.0±0.4% for 16S rDNA, both of which were much larger than those within samples. The present results indicate that the Pacific population of the pronghorn spiny lobster is subdivided into two distinct populations (Eastern Pacific and Central to Western Pacific, with no gene flow between them. Although the pronghorn spiny lobster have long-lived teleplanic larvae, the vast expanse of Pacific Ocean with no islands and no shallow substrate which is known as the East Pacific Barrier appears to have isolated these two populations for a long time (c.a. 1MY.

  11. Anisotropy of Magnetic Susceptibility (AMS) of the Neogene Volcanic Succession at the Sierra Juarez - Las PintasVolcanic Province, Northeastern Baja California, Mexico: Preliminary Results

    Science.gov (United States)

    Mendoza-Borunda, R.; Cañón-Tapia, E.; Suárez-Vidal, F.; Gradilla-Martínez, L.

    2010-12-01

    The Sierra Juarez-Las Pintas Volcanic Province is among the largest in northern Baja California. For this work, we focused on a bimodal volcanic succession of late Miocene age, composed of an extensive ignimbrite unit and few dispersed basaltic flows that crop out in central Sierra Juarez and northern Sierra Las Tinajas. The ignimbrite is zoned, composed by three distinctive members: a basal unwelded white tuff, a mid-section unwelded orange tuff, and an upper red welded tuff. The basaltic flows are olivine-rich. Samples were collected in five sites that define a NE-SW section across the Sierra Juarez Escarpment, in the western boundary of the so-called Gulf Extensional Province. In each of these sites a stratigraphic column composed of more than one geologic unit was sampled. The total number of analyzed cores is ca. 160. The preliminary results show vertical and lateral variations of the AMS of the ignimbrite that can be interpreted in terms of the local flow direction and processes of emplacement of these volcanic deposits. Such variations, in turn, are likely to reflect variations in the dynamics of the eruptive process that produced them. Although the AMS of all the rocks in this province display a complex set of orientations, in this work is shown that when examined in detail important clues concerning the geological evolution of the province can be obtained from these data.

  12. Seleção de acessos de tomateiro resistentes à pinta-preta pela análise de agrupamento das curvas de progresso da doença

    Directory of Open Access Journals (Sweden)

    Bruno Soares Laurindo

    2015-02-01

    Full Text Available O objetivo deste trabalho foi selecionar acessos resistentes à pinta-preta (Alternaria tomatophila por meio da análise de agrupamento das curvas de progresso da doença em tomateiro (Solanum lycopersicum. Foram avaliados 134 acessos de tomateiro do Banco de Germoplasma de Hortaliças da Universidade Federal de Viçosa (BGH-UFV, no delineamento de blocos ao acaso, além das testemunhas suscetíveis 'Débora' e 'Santa Clara'. As plantas foram inoculadas com uma mistura de conídios de diferentes isolados de Alternaria spp. e avaliadas regularmente quanto à severidade da doença a cada três dias após a inoculação, no total de seis avaliações. Ajustou-se o modelo logístico aos dados de severidade da pinta-preta, e as estimativas obtidas para a incidência final da doença (B1 e a taxa de progresso da doença (B3 foram submetidas à análise de variância multivariada (Manova. As médias dessas estimativas, para cada acesso, foram submetidas à análise de agrupamento. Foram formados 24 grupos distintos com base no agrupamento das curvas de progresso da doença, o que possibilitou identificar os acessos BGH-2143, BGH-2235, BGH-2270 e BGH-2118 de tomateiro como potenciais fontes de resistência à pinta-preta.

  13. Morphology of the male gonads of the spiny lobster Panulirus laevicauda (Latreille, 1817

    Directory of Open Access Journals (Sweden)

    Ana Valêsca Pinto de Lima

    2008-08-01

    Full Text Available The present study represented a contribution to the knowledge of the cytological and histological aspects of decapods' reproductive system, describing male germ cells of the spiny lobster Panulirus laevicauda. Seventy-one specimens of different sizes were caught off Fortaleza (Ceará, Brazil. Their testes were removed and fixed in Bouin solution, then, after 24 hours, dehydrated, cleared and embedded in the paraffin. Sections (4 µm thick were stained with hematoxylin-eosin. The testes appeared macroscopically as a pair of long and highly convoluted tubes joined by a transversal commissure giving the organ an H-like shape. Microscopically, supporting cells and germ cells (spermatogonia I and II, spermatocytes, spermatids and spermatozoa were seen in the testicular acini. Some of the acini showed signs of the spermotocytes and the spermatogonia degeneration. The spermatozoa were small cells with the peripheral nuclei and a lightly basophilic cytoplasm. They were nonmotile gametes and are characterized by the absence of a flagellum, but they had spikes radiating from the body. Three stages of follicular development in the mature individuals were observed: (a predominance of spermatogonia I and II; (b increasing numbers of spermatocytes I and II; and (c spermatocytes I and II were prevalent. All the three stages of the spermatozoa were observed in the follicular lumen. These observations agreed with the published descriptions of other palinurid and homarid lobsters. A histochemical analysis of the testes showed that the main component of the tunic was collagenous fibers, that the seminal fluid contained plenty of glycoproteins and carboxyl-glycoconjugates and that the spherical bodies and spermatozoa contained glycoproteins and mucoproteins.O presente trabalho tem como objetivo ampliar os conhecimentos na área de histologia e citologia do sistema reprodutivo dos Decapoda, descrevendo as células germinativas do macho da lagosta Panulirus

  14. Comportamento migratório da lagosta Panulirus argus (Latreille, em frente ao Estado do Ceará, Brasil

    Directory of Open Access Journals (Sweden)

    Antonio Adauto Fonteles-Filho

    1980-12-01

    Full Text Available Tagging experiments have been used to study the migratory behaviour of the spiny lobster Panulirus argus (Latreille, off Ceará State, Brazil. An analysis based on vectorial theory has provided the calculation of the coefficient of directional dispersion ( V, the coefficient of randon disperson (a² and the centre of density, by quarters of the year. The lobsters were found to engage in breeding migration in the second quarter, when there is a low random dispersion and in feeding migration in the third and fourth quarters, when there is high randon dispersion. The spawning areas are located in offshore regions and the lobsters reach them by moving seawardly, from positions occupied nearer the cost, in the fourth quarter.

  15. Effect of astaxanthin and cholesterol on growth, survival, and pigmentation of adult spiny lobster, Panulirus ornatus (Decapoda, Palinuridae

    Directory of Open Access Journals (Sweden)

    Lai V. Hung

    2010-11-01

    Full Text Available Prior research on the spiny lobster Panulirus ornatus (Fabricius, 1798 determined thatintermediate levels of cholesterol are important in diets, but astaxanthin may not be. Here we examinedhow the growth, survival and coloration of spiny lobster were influenced by the inclusion of bothastaxanthin (50, 60 and 70 mg.kg-1 and cholesterol (0.3, 0.4 and 0.5 % in a two factor experiment.Overall, survival was 84.8% with no significant difference among dietary treatments. Lobsters grew thebest when fed the diet containing the lowest cholesterol and greatest astaxanthin of the levels presented.The results of this study point out the need to examine the effects of dietary component addition acrossa range of inclusion levels simultaneously for multiple nutrients.

  16. The early phyllosoma stages of spiny lobster Panulirus echinatus Smith, 1869 (Decapoda: Palinuridae reared in the laboratory

    Directory of Open Access Journals (Sweden)

    FA. Abrunhosa

    Full Text Available The early stages of the Panulirus echinatus were hatched and reared in the laboratory. Ovigerous females were captured in their habitat and carefully transported to the laboratory. Larvae were transferred in a recirculation water tank at a density of 10 larvae.L-1. The larvae were fed on Artemia and gonads of mussel Brachydonts sp. Microalgae Dunaliella viridis was added at a concentration of 150 x 10(4 cell.mL-1. Larvae and exuviae of each zoeal stage were preserved in an alcohol 70% + glycerin (1:1 solution. The phyllosomas moulted eight times; the intermoulting period of each instar averaged about 7 to 10 days. The main morphological changes of each appendage were described in detail, illustrated and compared with previous reports.

  17. Screening of marine bacteria with bacteriocin-like activities and probiotic potential for ornate spiny lobster (Panulirus ornatus) juveniles.

    Science.gov (United States)

    Nguyen, Van Duy; Pham, Thu Thuy; Nguyen, Thi Hai Thanh; Nguyen, Thi Thanh Xuan; Hoj, Lone

    2014-09-01

    Bacteriocins are ribosomally synthesized antimicrobial peptides, which have been found in diverse bacterial species of terrestrial origins and some from the sea. New bacteriocins with new characteristics, new origins and new applications are likely still awaiting discovery. The present study screened bacteria isolated from marine animals of interest to the aquaculture industry for antimicrobial and bacteriocin-like activities in order to uncover biodiversity of bacteriocin producers, and explore the potential application in aquaculture. In total, 24 of 100 screened isolates showed antimicrobial activities and 7 of these exerted bacteriocin-like activities. Sequencing of 16S rRNA genes identified the isolates as members of the six genera Proteus, Providencia, Klebsiella, Alcaligenes, Bacillus and Enterococcus. In some cases, further analysis of housekeeping genes, rpoB for Proteus and recA for Klebsiella, as well as biochemical tests was necessary for identification to species level, and some of the Proteus isolates may represent novel species. The seven bacteriocinogenic isolates showed a wide antimicrobial spectrum against foodborne and animal pathogens, which opens the way to their potential use as marine drugs and probiotics in food, aquaculture, livestock and clinical settings. As a case study, the protective effect of shortlisted bacteriocinogenic isolates were tested in aquaculture-raised spiny lobster (Panulirus ornatus) juveniles. A single-strain (Bacillus pumilus B3.10.2B) and a three-strain (B. pumilus B3.10.2B, Bacillus cereus D9, Lactobacillus plantarum T13) probiotic preparation were added to the feed of Panulirus ornatus juveniles, which were subsequently challenged with the pathogen Vibrio owensii DY05. Juveniles in the probiotic treatments displayed increased growth and reduced feed conversion rates after 60 days, and increased survival rate after pathogen challenge relative to the control. This study represents the first evidence of bacteriocin

  18. MOLECULAR DETECTION AND CLONING FOR RICKETTSIA-LIKE BACTERIA OF MILKY HAEMOLYMPH DISEASE OF SPINY LOBSTER Panulirus spp.

    Directory of Open Access Journals (Sweden)

    Isti Koesharyani

    2017-01-01

    Full Text Available Spiny lobster (Panulirus homarus and Panulirus ornatus are important commodities for Indonesia. The aquaculture of lobster is susceptible for several diseases like parasite, fungi, bacteria, and virus. Among those diseases, milky haemolymph disease (MHD is often seen as a symptom to mass mortality occurred at lobster farms in Gerupuk Bay of Lombok. The purpose of this study was to determine the lobster diseases on cage culture in Gerupuk Bay of Lombok, West Nusa Tenggara. The study was undertaken from January to March 2015. Diseases status was determined by application of molecular plat-form, polymerase chain reaction (PCR with designation of specific primer for MHD (254F/R, 254F: 5’-CGA-GGA-CCA-GAG-ATG-GAC-CTT-3’ and 254R: 5’-GCT-CAT-TGT-CAC-CGC-CAT-TGT-3’ with PCR size product of 254 bp. and for cloned the pathogen was used TA-cloning Invitrogen for the DNA plasmid as positive control for other analysis. Several tissue samples i.e hepatopancreas, haemolymph, part of muscle hepatopancreas P. homarus and P. ornatus were taken from cage culture farms at Gerupuk Bay then preserved on 90% ethanol for further analysis by PCR and then the amplificated DNA were cloned into pCR®2.1 plasmid and transformed into competent E. coli. The result showed that almost all lobster samples from Gerupuk Bay were positive infected by MHD, as the results of PCR amplification whereas the band appeared at 254bp. Also MHD plasmid has been successfully cloned and will be used for further examination. Histopathologically in hepatopancreas infection have seen necrosis that contain numerous of rickettsia-like bacteria.

  19. Postlarval settlement of spiny lobster, Panulirus argus (Latreille, 1804 (Decapoda: Palinuridae, at the Caribbean coast of Costa Rica Asentamiento postlarval en la langosta espinosa, Panulirus argus (Latreille, 1804 (Decapoda: Palinuridae en la costa Caribe de Costa Rica

    Directory of Open Access Journals (Sweden)

    Oscar González

    2011-11-01

    Full Text Available Lobster fishery (Panulirus argus forms an important part of the fishing activities along the Caribbean coast of Central America. The present study provides information regarding the seasonal abundance and distribution of postlarval P. argus in Parque Nacional Cahuita, Costa Rica. During the study period (March 2004-February 2005, a total of 1907 pueruli were obtained from GuSi collectors. Postlarvae were present during all months, with a pronounced peak in January-February 2005 (CPUE of 21.82 and 22.18, pueruli/collector/month, respectively, and minor peaks in May and October 2004. The abundance of postlarval P. argus in the study area was comparable to locations which support important lobster fisheries, e.g. Mexico. A majority of the postlarvae (1027 ind. was collected during the first quarter moon, the remaining pueruli (880 ind. during new moon; these results are in general agreement with similar findings for P. argus in the Caribbean area. Based upon our results, we recommend introducing a local or regional monitoring program, studying spiny lobster migration and distribution patterns, and evaluate the introduction of artificial shelters for P. argus.Las capturas de langosta (Panulirus argus son de gran importancia en la actividad pesquera a lo largo de las costas del Caribe de Centroamérica. El presente estudio proporciona información relevante de la abundancia temporal y la distribución de postlarvas de P. argus en el Parque Nacional Cahuita, Costa Rica. Durante el periodo de estudio (Marzo 2004-Febrero 2005, un total de 1907 puérulos fueron obtenidos del colector GuSi. Las postlarvas fueron colectadas durante todos los meses, con máximos en enero-febrero 2005 (CPUE de 21.82 y 22.18, puérulos/colector/mes, respectivamente, y mínimos en mayo y octubre de 2004. La abundancia de postlarvas de P. argus en el estudio es comparada con áreas que soportan importantes pesquerías, p. ej. México. La mayoría de las postlarvas (1027 ind

  20. Contenido estomacal de langostas Panulirus argus (Decapoda: Palinuridae en playa El Holandés, Sur de la Península de Guanahacabibes, Cuba - Stomach content of lobsters Panulirus argus (Decapoda: Palinuridae in El Holandés beach, Southern of Peninsula of Guanahacabibes, Cuba

    Directory of Open Access Journals (Sweden)

    Lopeztegui Castillo, Alexander

    2012-04-01

    Full Text Available ResumenCon el objetivo de determinar la composición de la dieta natural de Panulirus argus (Latreille 1804, se realizó, durante los meses de julio-agosto del período 2004-2006, el análisis del contenido estomacal de ejemplares capturados in situ en el área protegida de playa El Holandés, al sur de La Península de Guanahacabibes, Pinar del Río.Abstract To determine the composition of the natural diet of Panulirus argus (Latreille 1804 lobsters, it was made, during the months of july-august (2004-2006, the analysis of the stomach content of lobsters captured in situ in the El Holandés beach, a protected beach in the south of Guanahacabibes Peninsula, Pinar del Río.

  1. Effect of copper on the characterization of proteins in the Spiny lobster, Panulirus homarus homarus (Linnaeus,1758

    Directory of Open Access Journals (Sweden)

    Maharajan Athisuyambulingam

    2014-07-01

    Full Text Available Copper is most toxic metal in marine organisms. Characterization of protein occurring in the metabolically active tissues of muscle (MU, hepatopancreas (HP and gills (GL of the spiny lobster, Panulirus homarus homarus on exposure to two sub-lethal doses (9.55 and 19.1 µg/l of copper were studied for 28 days of exposure (DoE. The electrophoretic pattern of muscle, hepatopancreas and gill proteins revealed 12, 8 and 8 slow moving bands (control. The number of bands decreased to 8 and 7, 6 and 5, 6 and 4 after 7 days of exposure to 9.55 µg/l and 19.1 µg/l concentrations of copper, respectively. After 28 days, the protein bands decreased to 7 and 6, 5 and 4, 4 and 4 at 9.55 µg/l and 19.1 µg/l concentrations of copper, respectively. Present study to indicate that to avoid the Cupro-Nickel coil in lobster holding centers in chiller plants used for cooling of water was found to be responsible for the mortality of lobsters during live transportation.

  2. Complete mitochondrial genome of the Chinese spiny lobster Panulirus stimpsoni (Crustacea: Decapoda): genome characterization and phylogenetic considerations.

    Science.gov (United States)

    Liu, Yuan; Cui, Zhaoxia

    2011-01-01

    The genetics and molecular biology of the commercially important Chinese spiny lobster, Panulirus stimpsoni are little known. Here, we present the complete mitochondrial genome sequence of P. stimpsoni, determined by the long polymerase chain reaction and primer walking sequencing method. The entire genome is 15,677 bp in length, encoding the standard set of 13 protein-coding genes, two ribosomal RNA genes, and 22 transfer RNA genes. The overall A+T content of the genome is 65.6%, lower than most malacostracan species. The gene order is consistent with the pancrustacean ground pattern. Several conserved elements were identified from P. stimpsoni control region, viz. one [TA(A)]n-block, two GA-blocks and three hairpin structures. However, the position of [TA(A)]n-block and number of hairpin structure are different from those in the congeneric P. japonicus and other decapods. Phylogenetic analyses using the concatenated nucleotide and amino acid sequences of 13 protein-coding genes do not support the monophyly of suborder Pleocyemata, which is in contrast to most morphological and molecular results. However, the position of Palinura and Astacidea is unstable, as represented by the basal or sister branches to other Reptantia species. P. stimpsoni, as the second species of Palinura with complete mitochondrial genome available, will provide important information on both genomics and conservation biology of the group.

  3. Rafael Pinta el Nuevo Mundo

    OpenAIRE

    Arginiegas, German

    1995-01-01

    En el cuatrocientos, el encuentro entre naciones era el tradicional enfrentamiento de fanatismo religioso. El guerrero siempre ha tratado de dar aire sagrado a sus empresas y los turcos, bélicos por naturaleza, avanzaban sobre Europa con las banderas de Mahoma desplegadas. Los cristianos reyes de occidente, junto con su corona, defendían la iglesia de cristo amenazaba. Una vez más, Jerusalén estaba en manos de los infieles. América se descubre buscando el camino para burlar a los turcos. En e...

  4. Lobster (Panulirus argus captures and their relation with environmental variables obtained by orbital sensors for Cuban waters (1997-2005

    Directory of Open Access Journals (Sweden)

    Regla Duthit Somoza

    2008-09-01

    Full Text Available Chlorophyll concentrations (Chl a data obtained from the Sea Viewing Wide Field of View Sensor (SeaWIFS ocean color monthly images, Sea Surface Temperature (SST pathfinder data obtained from the Advanced Very High Resolution Radiometer (AVHRR sensors, and lobster (Panulirus argus captures at the Cuban shelf were examined in order to analyze their spatial and temporal variability. A cross-correlation analysis was made between the standardized anomalies of the environmental variables (Chl a and SST and the standardized anomalies of lobster captures for each fishery zones for the period between 1997 and 2005. For the deep waters adjacent to the fishing zones it was not observed a clear Chl a seasonality and on average the lowest values occurred south of the Island. It is with the three years lag that Chl a had the greatest numbers of significant correlation coefficients for almost all fishing zones. However, the cross-correlation coefficients with SST showed higher values with 1,5 year lag at all zones. Since the two environmental variables obtained by satellite sensors (SST and Chl a influence the lobsters mainly during the planktonic life cycle, the cross-correlation with lobster captures begin to show significant indexes with lags of 1.5 years or more.Dados de captura da lagosta Panulirus argus na plataforma cubana foram comparados com concentrações de clorofila (Chl a e valores de Temperatura de Superfície do Mar (TSM obtidos pelos sensores Sea Viewing Wide Field of view Sensor (SeaWIFS e Advanced Very High Resolution Radiometer (AVHRR, respectivamente. Uma análise de correlação cruzada foi realizada entre as anomalias padronizadas das variáveis ambientais (Chl a e TSM e as anomalias padronizadas de capturas da lagosta para cada zona de pesca no período 1997-2005. Para as águas profundas adjacentes às zonas de pesca não foi observada uma sazonalidade evidente da Chl a. De forma geral, os menores valores de Chl a ocorreram ao sul da

  5. Variability in prevalence of Cymatocarpus solearis (Trematoda, Brachycoeliidae) in Caribbean spiny lobsters Panulirus argus (Decapoda: Palinuridae) from Bahía de la Ascensión (Mexico).

    Science.gov (United States)

    Briones-Fourzán, Patricia; Muñoz de Cote-Hernández, Rubén; Lozano-Álvarez, Enrique

    2016-06-01

    Cymatocarpus solearis, a brachycoeliid trematode that parasitizes sea turtles, uses spiny lobsters Panulirus argus as second intermediate hosts. We examined variability in infection by C. solearis in Bahía de la Ascensión, Mexico, a tropical bay with a highly productive fishery for P. argus that is based on the extensive use of casitas (large artificial shelters), which can harbor multiple juveniles and adults of this gregarious lobster species. We sampled 3956 lobsters from 466 casitas distributed over three bay zones within two closed seasons and one fishing season. In these lobsters (9.5-115.2mm carapace length, CL), the average infection prevalence was 11.7% but the probability of infection increased significantly with size. Prevalence varied with season but was consistently higher in one zone than in the other two zones. Infection with C. solearis was negatively related with clinical infection with Panulirus argus Virus 1 (PaV1). We also sampled 405 lobsters from the commercial catch obtained throughout the bay at the onset of the fishing season. In these relatively larger lobsters (70.3-168.0mm CL), average prevalence of C. solearis was higher (23.5%) but was not affected by lobster size or sex. Encysted metacercariae occurred in both abdominal and cephalothoracic muscles. The effects of C. solearis on phenotypic traits of P. argus that may potentially impact the host population dynamics and fisheries remain to be investigated. Copyright © 2016 Elsevier Inc. All rights reserved.

  6. Effect of fungicides and alternative products in control of anthracnose and black spot of guavaEfeito de fungicidas e produtos alternativos no controle da antracnose e da pinta preta da goiaba

    Directory of Open Access Journals (Sweden)

    Ivan Herman Fischer

    2012-12-01

    Full Text Available This work aimed to evaluate the efficiency of fungicides in controlling in vitro and in vivo the causal agents of anthracnose (Colletotrichum gloeosporioides and C. acutatum and black spot (Guignardia psidii and evaluate the effect of alternative products to control these diseases. Inhibition of mycelial growth of the pathogens was evaluated for ten fungicides at concentrations of 1, 10 and 100 mg L-1 of active ingredient in potato-dextrose-agar medium. The effectiveness of the fungicides azoxystrobin + difenoconazole, cyproconazole, pyraclostrobin, tebuconazole and tebuconazole + trifloxystrobin in controlling disease incidence and severity of anthracnose, through applications in the field, was measured in fruits collected at three stages of maturation, according to the skin color (dark green, light green and yellowish green. In postharvest dipping of fruits, the products evaluated were citric acid, peracetic acid, salicylic acid, sodium bicarbonate, chlorine dioxide, Ecolife® and chitosan. The fungicides azoxystrobin + difenoconazole, pyraclostrobin, tebuconazole and trifloxystrobin + tebuconazole were highly effective in inhibiting the in vitro mycelial growth of G. psidii and moderately to highly effective in inhibiting C. acutatum and C. gloeosporioides. In field conditions, the fungicide azoxystrobin + difenoconazole was effective in controlling anthracnose and black spot in fruit at three maturity stage (skin color yellowish green. The alternative products tested were ineffective in the curative control of anthracnose and early blight at postharvest of guava. Os objetivos deste trabalho foram avaliar a eficiência de fungicidas no controle in vitro e in vivo dos agentes causais da antracnose (Colletotrichum gloeosporioides e C. acutatum e da pinta preta (Guignardia psidii da goiaba e avaliar o efeito de produtos alternativos no controle pós-colheita destas doenças. A inibição do crescimento micelial dos patógenos foi avaliada para

  7. Preliminary Experiment on the Nutrition of Panulirus stimpsoni Phyllosoma%中国龙虾叶状幼体营养初步试验

    Institute of Scientific and Technical Information of China (English)

    韦受庆; 赖彬

    2000-01-01

    通过多次对比重复试验,对用对虾液汁培育金藻Dicrateria sp.、扁藻Platymomas sp.,用金藻、扁藻培育丰年虫Artemia salina幼体和毛蚶Scapharca subcrenata,以及用金藻、扁藻、丰年虫投喂中国龙虾Panulirus stimpsoni早期叶状幼体进行了探讨.结果表明,叶状幼体进入第Ⅲ期后交替掺喂毛蚶卵巢和刀额新对虾Metapenaeus ensis肉,取得较好的培育效果.

  8. BRS Eliza: cultivar de batata para mesa, com película lisa e resistência à pinta-preta e à requeima BRS Eliza: a fresh market potato cultivar, with smooth skin and early and late blight resistance

    Directory of Open Access Journals (Sweden)

    Arione S. Pereira

    2001-11-01

    Full Text Available BRS Eliza é uma cultivar de batata para consumo de mesa liberada em 2001, pela Embrapa Clima Temperado, Pelotas (RS. É mais adequada ao preparo de purê e salada (cremosa. O ciclo é médio. Os tubérculos têm formato oval, película lisa e amarela, pouca sensibilidade ao esverdeamento, polpa amarelo-clara e olhos superficiais. Não mostrou defeitos fisiológicos nos tubérculos. Tem boa resistência de campo à requeima (Phytophthora infestans e à pinta- preta (Alternaria solani e mediana a viroses. BRS Eliza é suscetível à canela-preta (Erwinia carotovara. Produz alta percentagem de tubérculos de tamanho comercial. Deve ser comercialisada imediatamente após a colheita, requerendo manejo cuidadoso da semente no armazenamentoBRS Eliza is a tablestock potato cultivar released in 2001, by Embrapa Clima Temperado, Pelotas, Brazil. It is adequate for purée and salad. Maturity is medium early. Tubers are oval shaped, yellow and smooth skin, low sensitivity to greening, yellow clear flesh and shallow eyes. BRS Eliza did not show physiological defects on the tubers. Has a good field resistance to late (Phytophthora infestans and early blight (Alternaria solani, and medium resistance to main viroses. BRS Eliza is susceptible to black leg (Erwinia carotovora. It produces a high percentage of commercial tubers. Must be marketed immediately after harvesting. It requires accurate seed management in storage.

  9. Note on phoptography register and preliminares observations from puerulus to juvenile of Panulirus argus after settlement in Amansia sp. macroalgae in Brazil / Nota sobre registro fotográfico e observações preliminares de puerulus a juvenil de Panulirus argus após o assentamento em macroalgas Amansia sp. no Brasil

    Directory of Open Access Journals (Sweden)

    Marco Antonio Igarashi

    2010-09-01

    Full Text Available Puerulus of Panulirus argus settlement is generally in the shallows and typically reside solitary in branched red algae Amansia sp. This type of habitat may be found in many areas of the Ceara State Coast, where macroalgae Amansia sp. with associated other genera of macroalgae and crevice shelters function as habitat for young juvenile spiny lobster. The objective of this work was to help to explain the settlement of puerulus and juvenile of P. argus in the coast of Ceará, Brazil and their behaviour.Puerulus de Panulirus argus assentam geralmente em locais rasos, tipicamente e solitariamente em ramos de algas vermelhas como a Amansia sp. Este tipo de habitat pode ser encontrado em muitas áreas da Costa do Estado do Ceará, onde a macroalga Amansia sp. associado com outros gêneros de macroalgas e fendas nas rochas funcionam como habitat para juvenis. O objetivo desse trabalho foi contribuir no conhecimento do comportamento e habitat de puerulus e juvenil de P. argus no Brasil.

  10. Morphology and distribution of setae on the antennules of the Caribbean spiny lobster Panulirus argus reveal new types of bimodal chemo-mechanosensilla.

    Science.gov (United States)

    Cate, H S; Derby, C D

    2001-06-01

    This study describes the morphology and distribution of setae on the lateral and medial flagella of the antennules of the spiny lobster Panulirus argus in an effort to identify antennular chemoreceptors in addition to the well-studied aesthetasc chemosensilla. Setae were examined using light and electron microscopy, and their distribution on flagellar annuli was analyzed. We identified ten setal types based on external morphology: hooded, plumose, short setuled, long simple, medium simple, short simple, aesthetasc, guard, companion, and asymmetric setae, with the last four types being unique to the "tuft" located on the distal half of the lateral flagellum. The three setal types whose ultrastructure was examined--hooded, long simple, and medium simple setae--had characteristics of bimodal (chemo-mechanoreceptive) sensilla. The antennules have four distinct annular types based on their setal complement, as shown by cluster analysis. This basic distribution of non-tuft setal types is similar for both lateral and medial flagella. Annuli in the tuft region have tuft setal types superimposed on a basic organization of non-tuft setal types. These results show that the antennules possess a diverse set of setae, that these setae have a highly ordered arrangement on the antennules, that at least four (and probably many more) of these setal types are chemosensilla, and suggest that most antennular chemosensilla are bimodally sensitive.

  11. Respiración, excreción y relación oxígeno: nitrógeno de filosomas de la langosta roja Panulirus interruptus Respiration, Excretion and Oxygen: Nitrogen Ratio of the Phyllosomes of the Red Spiny Lobster Panulirus interruptus

    Directory of Open Access Journals (Sweden)

    Eugenio Díaz-Iglesias

    2010-08-01

    Full Text Available El cultivo de la langosta Panulirus interruptus está limitado por la ausencia de conocimientos que permitan concluir el ciclo larval con eficiencia. Este trabajo presenta resultados sobre la respiración y la excreción de larvas filosomas tempranas cultivadas en el laboratorio a 21 °C y alimentadas con nauplios de Artemia enriquecidos con microalgas Isochrysis sp. y Chaetoceros muelleri. El estado postabsortivo se obtuvo después de 13.5 horas de ayuno. Durante el ayuno, el consumo del oxígeno de las larvas disminuyó de 5.29 mg O2 g-1h-1 en la primera hora a 3.54 mg O2 g-1h-1 después de 14 horas. El consumo de oxígeno diurno fue significativamente mayor que el nocturno en las filosomas de los estadios I y II. Los niveles medios del consumo de oxígeno durante día y noche fueron: 4.28 y 3.66 en filosoma I, y 3.8 y 3.17 en filosoma II, respectivamente. No se encontraron diferencias significativas en la excreción de amoniaco entre el día y la noche: las filosomas I excretaron de 0.011 a 0.095 mg NH4 g-1h-1, y las filosomas II, de 0-0.65 mg NH4 g-1h-1. Las tasas de consumo de oxígeno y excreción del amoniaco fueron significativamente más altas en filosoma I que en filosoma II. No se detectaron diferencias significativas entre el día y la noche, en la relación O: N (oxígeno:nitrógeno. Las relaciones O:N de 59.1 a 422.4 obtenidas en ambas fases indican un catabolismo que va de la utilización de mezclas iguales de proteínas y lípidos a la utilización de lípidos e hidratos de carbono.The culture of the lobster Panulirus interruptus is limited due to the lack of knowledge that allow the completion of all larval stages. This work presents data on daytime and nightime oxygen consumption and ammonia excretion in phyllosoma I and II of the red lobster Panulirus interruptus reared in the lab at 21 °C and feeding with enriched Artemia nauplii. During starvation, the oxygen consumption by larvae phyllosoma dropped from 5.29 in the first

  12. Fatty acid profiles of phyllosoma larvae of western rock lobster (Panulirus cygnus) in cyclonic and anticyclonic eddies of the Leeuwin Current off Western Australia

    Science.gov (United States)

    Wang, M.; O'Rorke, R.; Waite, A. M.; Beckley, L. E.; Thompson, P.; Jeffs, A. G.

    2014-03-01

    The recent dramatic decline in settlement in the population of the spiny lobster, Panulirus cygnus, may be due to changes in the oceanographic processes that operate offshore of Western Australia. It has been suggested that this decline could be related to poor nutritional condition of the post-larvae, especially lipid which is accumulated in large quantities during the preceding extensive pelagic larval stage. The current study focused on investigations into the lipid content and fatty acid (FA) profiles of lobster phyllosoma larvae from three mid to late stages of larval development (stages VI, VII, VIII) sampled from two cyclonic and two anticyclonic eddies of the Leeuwin Current off Western Australia. The results showed significant accumulation of lipid and energy storage FAs with larval development regardless of location of capture, however, larvae from cyclonic eddies had more lipid and FAs associated with energy storage than larvae from anticyclonic eddies. FA food chain markers from the larvae indicated significant differences in the food webs operating in the two types of eddy, with a higher level of FA markers for production from flagellates and a lower level from copepod grazing in cyclonic versus anticyclonic eddies. The results indicate that the microbial food web operating in cyclonic eddies provides better feeding conditions for lobster larvae despite anticyclonic eddies being generally more productive and containing greater abundances of zooplankton as potential prey for lobster larvae. Gelatinous zooplankton, such as siphonophores, may play an important role in cyclonic eddies by accumulating dispersed microbial nutrients and making them available as larger prey for phyllosoma. The markedly superior nutritional condition of lobster larvae feeding in the microbial food web found in cyclonic eddies, could greatly influence their subsequent settlement and recruitment to the coastal fishery.

  13. Modelling deep water habitats to develop a spatially explicit, fine scale understanding of the distribution of the western rock lobster, Panulirus cygnus.

    Directory of Open Access Journals (Sweden)

    Renae K Hovey

    Full Text Available BACKGROUND: The western rock lobster, Panulirus cygnus, is endemic to Western Australia and supports substantial commercial and recreational fisheries. Due to and its wide distribution and the commercial and recreational importance of the species a key component of managing western rock lobster is understanding the ecological processes and interactions that may influence lobster abundance and distribution. Using terrain analyses and distribution models of substrate and benthic biota, we assess the physical drivers that influence the distribution of lobsters at a key fishery site. METHODS AND FINDINGS: Using data collected from hydroacoustic and towed video surveys, 20 variables (including geophysical, substrate and biota variables were developed to predict the distributions of substrate type (three classes of reef, rhodoliths and sand and dominant biota (kelp, sessile invertebrates and macroalgae within a 40 km(2 area about 30 km off the west Australian coast. Lobster presence/absence data were collected within this area using georeferenced pots. These datasets were used to develop a classification tree model for predicting the distribution of the western rock lobster. Interestingly, kelp and reef were not selected as predictors. Instead, the model selected geophysical and geomorphic scalar variables, which emphasise a mix of terrain within limited distances. The model of lobster presence had an adjusted D(2 of 64 and an 80% correct classification. CONCLUSIONS: Species distribution models indicate that juxtaposition in fine scale terrain is most important to the western rock lobster. While key features like kelp and reef may be important to lobster distribution at a broad scale, it is the fine scale features in terrain that are likely to define its ecological niche. Determining the most appropriate landscape configuration and scale will be essential to refining niche habitats and will aid in selecting appropriate sites for protecting critical

  14. FEEDING HABITS OF CHINESE SPINY LOBSTER(PANULIRUS STIMPSONI)%中国龙虾摄食习性的研究

    Institute of Scientific and Technical Information of China (English)

    陈政强; 陈昌生; 吴仲庆; 顾李生; 纪德华

    2000-01-01

    Feeding habits of Chinese Spiny lobster, Panulirus stimpsoni, were described in this paper. The lobster fed only in nighttime with two obvious peaks appeared in 1~2 hours after sunset and in midnight, which made its feeding rhythm clearly. The lobster fed 54.77% of its daily ration in the first half of the night, 45.23% in the latter half. The Chinese spiny lobster is an omnivore, having a preference for animal baits and highest food consumption rate of 6.33% when feeding on oyster. It was found the lobster ingested its shell occasionally and perform mutual annihilation scarcely. The feeding intensity was impressionable to food types, water temperatures, salinities, and feeding intervals. Seemly foraging temperature was 15~32(C. Consumption rate was as high as 2.66% when salinity was 32, and was higher when fed every day than when be done in other feeding intervals.%中国龙虾仅在夜间主动摄食,摄食节律明显,日落后和午夜后各有一摄食高峰,午夜前后的摄食量分别占日摄食总量的54.77% 和45.23%。中国龙虾属杂食性,偏好动物性饵料;投喂牡蛎时获最高摄食率6.33%。有食壳现象,但很少相互残食。中国龙虾摄食强度受饵料种类、温度、盐度及投饵方式等因子的影响。摄食的适温范围15~32 ℃。盐度32时摄食率高达2.66%。日皆投饵可获较高摄食率。

  15. A new species of Carcinonemertes, Carcinonemertes conanobrieni sp. nov. (Nemertea: Carcinonemertidae), an egg predator of the Caribbean spiny lobster, Panulirus argus.

    Science.gov (United States)

    Simpson, Lunden Alice; Ambrosio, Louis John; Baeza, J Antonio

    2017-01-01

    A new species of nemertean worm belonging to the genus Carcinonemertes is described from egg masses of the Caribbean spiny lobster Panulirus argus from the Florida Keys, Florida, USA. This is the first species of Carcinonemertes reported to infect P. argus or any other lobster species in the greater Caribbean and western Atlantic Ocean. Carcinonemertes conanobrieni sp. nov. varies in body color from a translucent white to a pale orange, with males ranging in total body length from 2.35 to 12.71 mm and females ranging from 0.292 to 16.73 mm. Among the traits that separate this new species from previously described species in the genus Carcinonemertes are a relatively wide stylet basis, minimal sexual size dimorphism, and a unique mucus sheath decorated with external hooks. Also, juvenile worms were found to encyst themselves next to lobster embryos and female worms lay both long strings of eggs wound throughout the lobster's setae as well as spherical cases that are attached to lobster embryos. The stylet length and stylet basis remain unchanged throughout ontogeny for both male and female worms. Maximum likelihood and Bayesian inference phylogenetic analyses separated this newly described species from all other species of Carcinonemertes with available COI sequences. Carcinonemertes spp. are voracious egg predators and have been tied to the collapse of various crustacean fisheries. The formal description of this new species represents the first step to understand putative impacts of this worm on the population health of one of the most lucrative yet already depressed crustacean fisheries.

  16. Bactérias endofíticas no controle e inibição in vitro de Pseudomonas syringae pv tomato, agente da pinta bacteriana do tomateiro Control with endophytic bacteria and in vitro inhibition of Pseudomonas syringae pv tomato, agent of bacterial speck of tomato

    Directory of Open Access Journals (Sweden)

    Juliana Resende Campos Silva

    2008-08-01

    Full Text Available Para avaliar o potencial de 53 isolados de bactérias endofíticas no controle da pinta bacteriana do tomateiro (Lycopersicum esculentum Mill., realizaram-se seleções massais em casa-de-vegetação e a seguir foi avaliado, in vitro, o antagonismo desses isolados sobre a bactéria desafiante Pseudomonas syringae pv. tomato (Pst. A inoculação das bactérias endofíticas foi feita por microbiolização das sementes de tomate cv. Santa Clara e da desafiante (Pst por pulverização. Aos 7, 14 e 21 dias após a inoculação da Pst, foram realizadas as avaliações da severidade da pinta bacteriana, bem como da altura das plantas. As espécies e os isolados bacterianos mais eficazes na redução da severidade da pinta bacteriana foram: Acinetobacter johnsonii (isolado 10, Bacillus pumilus (isolados 3, 12, 20, 39, 51, Paenibacillus macerans (isolados 37 e 47, PIM 11, Bacillus sphaericus (isolado 45, B. amyloliquefaciens (isolado 50, TOM 2, TOM 24 e Staphylococcus aureus (isolado 18. Mais de 50% dos isolados eficazes na redução da severidade foram da espécie Bacillus pumilus. Das espécies endofíticas mais eficazes na redução da severidade da pinta bacteriana, Bacillus pumilus e B. amyloliquefaciens inibiram também o crescimento da Pst in vitro.Vários dos isolados promoveram também o crescimento das plantas.To asses the potential of fifty three isolates of endophytic bacteria on the control of Pseudomonas syringae pv. tomato (Pst in tomato (Lycopersicum esculentum Mill., several screening were done in greenhouse followed by in vitro studies on antagonism of those isolates to Pst. The inoculation of endophytic bacteria was done by microbiolization of tomato cv Santa Clara seeds. The challenging bacterium (Pst inoculation was done by spraying. At 7, 14 and 21 days after Pst inoculation the assessment of bacterial speck severity was done, and height of plants was also measured. The most efficient endophytic species and isolates in reducing

  17. 中国龙虾栖息习性的观察%THE ROOSTING HABIT OF THE SPINY LOBSTER Panulirus stimpsoni

    Institute of Scientific and Technical Information of China (English)

    陈政强; 陈昌生; 吴仲庆; 林楚城; 贾锡伟

    2001-01-01

    于1999年5月在集美大学水产学院海水养殖试验场进行中国龙虾栖息习性的试验观察。结果表明,正常温度、盐度条件下,中国龙虾有隐匿穴居、昼伏夜出的栖息习性,喜欢栖息于紧身或身体易于找到依靠的水平洞穴中,并有同穴共居现象,低层洞穴的栖息率高于高层洞穴;温度低于12℃时,中国龙虾夜间也很少离穴活动,温度低于8.6℃或高于34℃,盐度低于14.1或高于44.6时,中国龙虾都会逃离洞穴。%Some juvenile lobsters (B.L.=16.6± 2.6 cm) which collected from the wild were cultured in the pond to observe their roosting habit in May 1999. The results of the experiment showed that the spiny lobster, Panulirus stimpsoni preferred to hide in the caves in daytime and out at night under the normal temperature and salinity condition. The lobster liked to roost in a horizontal and narrow cave. There was a phenomenon of several lobsters roosted in the same cave. The roosting rate in the cave of lower layer was more than that in higher one. Under the temperature below 12 ℃ the lobsters rarely left their roosting caves. When the temperature was above 34 ℃ or below 8.6 ℃ and the salinity was below 14.1 or above 44.6 the lobsters escaped from their roosting caves.

  18. Patrón reproductivo y talla media de madurez sexual de hembras de la langosta Panulirus gracilis (Decapoda: Palinuridae en Playa Lagarto, Guanacaste, Costa Rica

    Directory of Open Access Journals (Sweden)

    Helven Naranjo Madrigal

    2012-12-01

    Full Text Available La langosta Panulirus gracilis es importante como recurso pesquero de las comunidades costeras en el Pacífico Norte de Costa Rica. Debido a la importancia de actualizar el conocimiento relacionado con el patrón reproductivo de esta especie, se analizaron 357 especímenes de langostas P. gracilis hembras capturados mediante el buceo con compresor y el buceo a pulmón durante noviembre de 2007 a octubre del 2008 en Playa Lagarto. Se examinó la composición de las tallas por estrato de profundidad, el patrón mensual de la actividad reproductiva (IAR asociado al aumento relativo de la temperatura superficial del océano, y además se determinó la talla media de madurez sexual utilizando Modelos Lineales Generalizados. Los cuatro estados fisiológicos de madurez sexual mostraron que las hembras sin masa espermatófora y no ovígeras, presentaron las menores tallas con una media de 62.3mm de longitud cefalotoráxica (LC. Se observaron características de madurez sexual a partir de tallas muy bajas que van desde 30 a 50mm de LC, encontrándose la menor hembra ovígera reportada para esta especie de 35.8mm de LC y el mayor porcentaje de hembras maduras entre 70 y 80mm de LC. Los porcentajes del IAR se mantuvieron por encima del 50% durante el año, con excepción de los meses de octubre y enero. Además, se observó un aumento en el IAR que inició a partir de abril y continuó hasta agosto asociado a un relativo aumento en la temperatura a partir del mes de marzo, sin embargo esta relación no fue significativa (r²=0.49, p>0.05. No se descarta que la baja talla media de madurez sexual de 70.2mm de LC para P. gracilis en esta región sea causada por las prácticas de pesca. Se recomienda que se establezca una veda en la región de cinco meses (abril-agosto con el fin de proteger la estacionalidad reproductiva de la especie y promover un mayor reclutamiento a las áreas de pesca.

  19. Advances in tecnological development and present status of the spiny lobster (Panulirus argus from egg to commecial size / Avanços no desenvolvimento tecnológico e status atual do cultivo de lagostas (Panulirus argus do ovo ao tamanho comercial

    Directory of Open Access Journals (Sweden)

    Marco Antonio Igarashi

    2010-04-01

    Full Text Available The purpose of this review is to sumarize the studies on culture of Caribbean spiny lobster (Panulirus argus. Spiny lobster became a highly valued marine organism, since then, have had a manifold increase over the years in Brazil. However, most fisheries are fully exploited, and one of the few ways to increase production is through aquaculture. Keeping the larval spiny lobster alive in the laboratory through these delicate stages is very difficult. The first complete culture of Caribbean spiny lobster from hatch to puerulus stage occurred in 2006 at Mie Prefectural Fisheries Station in Japan. This result reflects the increasing availability of information on optimal culturing conditions, such as optimal environmental parameters, feeding, and tank design. Still, there are significant problems to overcome in the establishment of large-scale culture of phyllosoma. These further challenges include the control of bacterial diseases and excessive aggregation of larvae, the use of prepared diets such as artificial foods, and the reduction of high operating costs. In addition possibilities for the present are exploitation of juveniles from densely populated areas and utilization of natural food resources as feed for the lobster. In conclusion it is possible farming juvenile spiny lobsters in growout system.A proposta desta revisão é resumir as informações sobre os estudos do cultivo de lagosta vermelha (Panulirus argus. As lagostas espinhosas tornaram-se, desde o início de sua exploração, um produto marinho de relevante importância econômica para o Brasil. No entanto, é notória a ocorrência da sobrepesca e, para efeito de minimizar essa situação uma das soluções é o seu cultivo. A larvicultura de lagostas em condições laboratoriais é sobremodo difícil, devido ao alto grau de sensibilidade da larva. O primeiro cultivo completo da lagosta vermelha desde a eclosão até o estágio de puerulus ocorreu em 2006 na Estação de Pesca na

  20. EPIDEMIA DE PINTA-PRETA DA BATATA E COMPARAÇÃO DE MÉTODOS PARA DETERMINAR O INÍCIO DOS SINTOMAS DA DOENÇA NA CULTURA DE BATATA EM CAMPO POTATO EARLY BLIGHT EPIDEMICS AND COMPARISON OF METHODS TO DETERMINE ITS INITIAL SYMPTOMS IN A POTATO FIELD

    Directory of Open Access Journals (Sweden)

    Rodrigo Orlando Campo Arana

    2007-12-01

    Full Text Available Três experimentos foram montados entre os anos de 2000 e 2002, em condições de campo, de Viçosa, estado de Minas Gerais, com a finalidade de avaliar o efeito de epidemias de pinta-preta (Alternaria solani na produção de batata (Solanum tuberosum e determinar o inicio de sintomas da pinta preta na cultura de batata. Usando o método de gradiente de severidade da doença, foram obtidas em cada experimento quatro epidemias da doença, com diferentes severidades, desde D1 até D4, em ordem decrescente, o que permitiu comparar o efeito das epidemias no crescimento da planta e na produção de tubérculos, bem como determinar o momento de se iniciar o controle da doença. Tendo como base o tempo desde o plantio até o aparecimento dos primeiros sintomas da epidemia, foram avaliados os seguintes métodos para previsão da doença: dias acumulados (DA; graus-dia acumulados (GD, tendo como temperatura-base 7ºC; e dias fisiológicos acumulados (DF, tendo como temperatura mínima 7ºC, máxima de 30ºC e ótima de 21ºC. O estabelecimento do gradiente da doença mostrou diferenças significativas na produção em cada experimento. As maiores reduções na produção dos tubérculos ocorreram na parcela não tratada com fungicida D1, com 49,6% em 2000; 52,7% em 2001; e 58,2% em 2002. A previsão da epidemia utilizando-se os métodos DA e GD não indicou o momento certo para iniciar o controle da epidemia. O método DF foi o mais adequado, estabelecendo-se o primeiro sintoma entre 240 e 333 DF. Conclui-se que a pinta-preta, dependendo da severidade, afeta a área foliar e a produção de tubérculos. Dos métodos para determinar o estabelecimento da pinta-preta, o DF apresentou o maior potencial, recomendando-se seu uso para iniciar o manejo da doença aos 250 DF após o plantio, sempre e quando as condições ambientais favorecem o estabelecimento do patógeno.The influence of an early blight epidemic on potato tuber yield was evaluated in three

  1. Variaciones en la condición nutricional de langostas Panulirus argus (Decapoda: Palinuridae en la región este del Golfo de Batabanó, Cuba Variations of the nutritional condition of lobsters Panulirus argus (Decapoda: Palinuridae in Eastern region of the Gulf of Batabanó, Cuba

    Directory of Open Access Journals (Sweden)

    Alexander Lopeztegui Castillo

    2012-03-01

    Full Text Available En Cuba, la región del Golfo de Batabanó es la más importante zona de pesca de langosta debido a que de ella se extrae anualmente alrededor del 70% de la captura nacional. Con el objetivo de determinar variaciones espacio-temporales en la condición nutricional (K de langostas Panulirus argus del Golfo de Batabanó, Cuba, se calculó dicha condición mediante una relación pesolargo (K=Pt/Lt, para lo que se utilizaron ejemplares de cuatro zonas (uno, dos, cuatro y cinco del este del golfo, capturados en los años 1981 y 2010. Se encontró que en todos los casos analizados la condición nutricional fue significativamente mayor en machos que en hembras. Se detectaron variaciones significativas entre zonas en 1981 y 2010. También entre años el estado nutricional de las langostas presenta variaciones significativas, de manera que en 1981 (2.34±0.84g/mm fue mayor que en 2010 (1.96±0.49g/mm. Tanto las variaciones interzonales como las interanuales parecen estar relacionadas con variaciones reportadas en el tipo de fondo y la cobertura vegetal. Variaciones estacionales en la abundancia y distribución de organismos bentónicos que constituyen alimento para las langostas también podrían estar influyendo. Las diferencias entre sexos en cambio, se suponen consecuencia de la metodología utilizada y del dimorfismo sexual característico de esta especie, por cuanto otros métodos de estimación de K que no involucran mediciones morfométricas, no detectan estas diferencias.Variations of the nutritional condition of lobsters Panulirus argus (Decapoda: Palinuridae in Eastern region of the Gulf of Batabanó, Cuba. Nutritional condition can affect survival and growth rate of crustaceans, and this is mostly affected by habitat conditions. This study describes the space-temporary nutritional changes in this commercially important species. With this aim, the variations in the nutritional condition (K of lobsters from four zones (1, 2, 4 and 5 in the Gulf

  2. Oceanographic Currents and Local Ecological Knowledge Indicate, and Genetics Does Not Refute, a Contemporary Pattern of Larval Dispersal for The Ornate Spiny Lobster, Panulirus ornatus in the South-East Asian Archipelago.

    Science.gov (United States)

    Dao, Hoc Tan; Smith-Keune, Carolyn; Wolanski, Eric; Jones, Clive M; Jerry, Dean R

    2015-01-01

    Here we utilize a combination of genetic data, oceanographic data, and local ecological knowledge to assess connectivity patterns of the ornate spiny lobster Panulirus ornatus (Fabricius, 1798) in the South-East Asian archipelago from Vietnam to Australia. Partial mitochondrial DNA control region and 10 polymorphic microsatellites did not detect genetic structure of 216 wild P. ornatus samples from Australia, Indonesia and Vietnam. Analyses show no evidence for genetic differentiation among populations (mtDNA control region sequences ΦST = -0.008; microsatellite loci FST = 0.003). A lack of evidence for regional or localized mtDNA haplotype clusters, or geographic clusters of microsatellite genotypes, reveals a pattern of high gene flow in P. ornatus throughout the South-East Asian Archipelago. This lack of genetic structure may be due to the oceanography-driven connectivity of the pelagic lobster larvae between spawning grounds in Papua New Guinea, the Philippines and, possibly, Indonesia. The connectivity cycle necessitates three generations. The lack of genetic structure of P. ornatus population in the South-East Asian archipelago has important implications for the sustainable management of this lobster in that the species within the region needs to be managed as one genetic stock.

  3. Oceanographic Currents and Local Ecological Knowledge Indicate, and Genetics Does Not Refute, a Contemporary Pattern of Larval Dispersal for The Ornate Spiny Lobster, Panulirus ornatus in the South-East Asian Archipelago.

    Directory of Open Access Journals (Sweden)

    Hoc Tan Dao

    Full Text Available Here we utilize a combination of genetic data, oceanographic data, and local ecological knowledge to assess connectivity patterns of the ornate spiny lobster Panulirus ornatus (Fabricius, 1798 in the South-East Asian archipelago from Vietnam to Australia. Partial mitochondrial DNA control region and 10 polymorphic microsatellites did not detect genetic structure of 216 wild P. ornatus samples from Australia, Indonesia and Vietnam. Analyses show no evidence for genetic differentiation among populations (mtDNA control region sequences ΦST = -0.008; microsatellite loci FST = 0.003. A lack of evidence for regional or localized mtDNA haplotype clusters, or geographic clusters of microsatellite genotypes, reveals a pattern of high gene flow in P. ornatus throughout the South-East Asian Archipelago. This lack of genetic structure may be due to the oceanography-driven connectivity of the pelagic lobster larvae between spawning grounds in Papua New Guinea, the Philippines and, possibly, Indonesia. The connectivity cycle necessitates three generations. The lack of genetic structure of P. ornatus population in the South-East Asian archipelago has important implications for the sustainable management of this lobster in that the species within the region needs to be managed as one genetic stock.

  4. Chemosensory neurons in the mouthparts of the spiny lobsters Panulirus argus and Panulirus interruptus (Crustacea : Decapoda)

    DEFF Research Database (Denmark)

    Garm, Anders Lydik; Shabani, Shkelzen; Høeg, Jens Thorvald

    2005-01-01

    in the mouthparts had concentration-dependent responses, with thresholds between 10-7 and 10-4 M and without saturation even at 10-3 or 10-2 M. They also quickly adapted when exposed to their best compounds at 10-4 and 10-3 M. A comparison of the response properties of these neurons in the mouthparts with those...... detection by the antennae, precise location and collection by the pereiopods, and detailed assessment of quality by the mouthparts....

  5. Sistem Keamanan Berlapis pada Ruangan Menggunakan RFID (Radio Frequency Identification dan Keypad untuk Membuka Pinta Secara Otomatis

    Directory of Open Access Journals (Sweden)

    Muhammad Chamdun

    2014-10-01

    Full Text Available This final project aims to design a door security device using RFID technology (Radio Frequency Identification and the keypad as a method of access into the room. The system will automatically give warning when the code is entered incorrectly or burglars entered by breaking the door. The microcontroller that is used as the central data processing is ATMega 16 microcontroller ATMEL production and security sensors are used PIR (Passive Infra Red and magnetic switches. The design begins with a schematic device hardware and software design using CodeVisionAVR programming. Implementation phase includes the implementation of the physical tools, programs, and sensors. The testing phase is done by testing the input sensors and exit switches, siren output devices, DC motor, LCD (Liquid Crystal Display, the RFID reader, keypad, and system controller. The results of room layered security system works according to design. PIR sensors can detect human activities and turn the LED lamp indicator on. Magnetic switch sensors will provide input to the microcontroller to enable or disable the DC motor as the room locking system. Admin menu that is accessed from the keypad is to add users, remove users, see registered users and change the password. User menu which is also accessed using the keypad, work as the room access using a username and password. This study resulted in the layered security. Room access is done using RFIDTag and password. The room piercing detection is done by sensor PIR (Passive Infra Red and magnetic switches. Alarm used as a piercing action warning. This layered room safety device produces a better security system.

  6. Beyond La Nina, La Pinta, and La Santa Maria: The Invention and Mental Mapping of the New World

    Science.gov (United States)

    Fernandez, Luis Martinez

    2013-01-01

    The topics of Columbus's voyages of exploration, the first encounters between Amerindians and Europeans, and the ensuing collision of their respective worlds provide ample opportunities for creative and stimulating pedagogical approaches that go beyond the stale memorization of dates, places, and names. This essay and accompanying classroom…

  7. Beyond La Nina, La Pinta, and La Santa Maria: The Invention and Mental Mapping of the New World

    Science.gov (United States)

    Fernandez, Luis Martinez

    2013-01-01

    The topics of Columbus's voyages of exploration, the first encounters between Amerindians and Europeans, and the ensuing collision of their respective worlds provide ample opportunities for creative and stimulating pedagogical approaches that go beyond the stale memorization of dates, places, and names. This essay and accompanying classroom…

  8. Sistem Keamanan Berlapis pada Ruangan Menggunakan RFID (Radio Frequency Identification) dan Keypad untuk Membuka Pinta Secara Otomatis

    OpenAIRE

    Muhammad Chamdun; Adian Fatchur Rochim; Eko Didik Widianto

    2014-01-01

    This final project aims to design a door security device using RFID technology (Radio Frequency Identification) and the keypad as a method of access into the room. The system will automatically give warning when the code is entered incorrectly or burglars entered by breaking the door. The microcontroller that is used as the central data processing is ATMega 16 microcontroller ATMEL production and security sensors are used PIR (Passive Infra Red) and magnetic switches. The design begins wi...

  9. Biología pesquera de la langosta Panulirus gracilis en Playa Lagarto, Guanacaste, Costa Rica

    Directory of Open Access Journals (Sweden)

    Helven Naranjo Madrigal

    2011-06-01

    Full Text Available Los parámetros biológicos y pesqueros analizados se fundamentaron en una muestra de 843 langostas provenientes de la actividad pesquera realizada en Playa Lagarto entre noviembre del 2007 y octubre del 2008. Las longitudes cefalotoráxicas de los machos estuvo comprendida entre los 143.6 y 42.8 y 115 y 35.8mm para hembras. El 74.9% de las langostas en los desembarques estuvo por debajo de la talla mínima legal de captura (80 mm de LC. La estructura de tallas muestra un considerable solapamiento de segmentos poblacionales y el incremento de las tallas con la profundidad en donde operan las dos modalidades de pesca estudiadas: el buceo a pulmón y el buceo con compresor. La proporción de sexos obtenida fue de 1.36 M:H. La relación entre LC y peso reveló que las hembras pesan más que los machos de una misma talla y que esta diferencia fue significativa (p<0.05. Los parámetros de crecimiento de von Bertalanffy para machos y hembras respectivamente (K=0.45-0.38, LC∞=166.9-121.7 indican un crecimiento acelerado en comparación a otras especies. Los machos por su parte exhibieron una mayor tasa de crecimiento que las hembras. Además, la mortalidad natural (M, la mortalidad total (Z y la mortalidad por pesca (F fue más alta en machos (0.49-2.34-1.92 que en hembras (0.47-1.82-1.42. El reclutamiento para ambos sexos presentó un comportamiento continuó durante el año con un pulso de mayor intensidad en julio de 18.5%. El significativo porcentaje de langostas por debajo de la talla mínima legal permitida para la pesca evidencia fuerte presión ejercida sobre las tallas juveniles. Afirmación que es reforzada por el valor de la tasa de explotación (E determinada de 0.80, que indica que bajo el actual régimen de pesca la población estaría en riesgo de colapso.

  10. Odors influencing foraging behavior of the California spiny lobster, Panulirus interruptus, and other decapod crustacea

    Energy Technology Data Exchange (ETDEWEB)

    Zimmer-Faust, R.K.; Case, J.F.

    1982-01-01

    Trapping experiments were conducted in the More Mesa coastal area of Santa Barbara, California, 4 km east of the U.C. Santa Barbara campus. Live intact and injured prey and excised tissues were placed in traps, in containers allowing odor release but preventing contacts with entering animals. Individuals of six prey species failed to attract lobsters when alive and intact, but some became attractive once injured. Excised tissues were the most effective baits. Abalone and mackerel muscle were attractive to lobsters but relatively nonattractive to crabs, while angel shark muscle was attractive to crabs but not to lobsters. Shrimp cephalothoraces were repellant to lobsters. Naturally occurring attractant and repellent tissues are thus identified and chemosensory abilities of lobsters and sympatric crabs are demonstrated to differ. Abalone muscle increased in attractivity following 1-2 days field exposure. Molecular weights of stimulants released by both weathered and fresh abalone were < 10,000 daltons with evidence suggesting that the 1000-10,000 dalton fraction may contribute significantly to attraction. Concentrations of total primary amines released from abalone muscle failed to differ from background levels, following an initial three (0-3h) period. Primary amines thus appear not to contribute directly to captures of lobsters, since animals were usually caught greater than or equal to 7 h after baits were positioned. Amino acids were the dominant contributors to present measurements of total primary amines, suggesting that these molecules may not direct lobster foraging behavior in the present experiments. 41 references, 4 figures, 8 tables.

  11. Microbiological aspects of phyllosoma rearing of the ornate rock lobster Panulirus ornatus

    DEFF Research Database (Denmark)

    Bourne, D.; Webster, N.; Payne, Matthew

    2007-01-01

    Rock lobsters of the Palinuridae are the most valuable wild fisheries sector in Australia and are currently target aquaculture species. Significant challenges exist however to produce commercial scale quantities of post-larvae due to an extended larval phase which acerbates a high rate of larval ...

  12. Embellecer lo que el más allá hace presente: Pintura, pinta o visión y el Valle de Sibundoy

    Directory of Open Access Journals (Sweden)

    Carlos Avellaneda Escudero

    2014-04-01

    Full Text Available La experiencia con plantas sagradas de conexión es, en cierto modo, una experiencia artística,un esfuerzo espiritual que influye en el comportamiento, que inspira y estimula la creatividad,pues crea otras formas de percibir, pensar e interpretar el mundo, y permite comprender losfenómenos internos de cada ser-ahí. El uso y conocimiento mismos de este tipo plantas seremonta a un pasado remoto. El presente texto acerca su mirada al suroccidente de Colombiapara describir las pinturas visionarias-chamánicas de dos indígenas del Valle de Sibundoy. Susformas y colores, que son fruto de la revelación y los conocimientos de lo invisible o lo sagradodados por el brebaje-maestro, el yagé, son clave para entender que en su contexto cultural estas(representaciones son un medio que embellece (agradece y presenta la vida y el pensamiento.

  13. Determining the diet of larvae of western rock lobster (Panulirus cygnus using high-throughput DNA sequencing techniques.

    Directory of Open Access Journals (Sweden)

    Richard O'Rorke

    Full Text Available The Western Australian rock lobster fishery has been both a highly productive and sustainable fishery. However, a recent dramatic and unexplained decline in post-larval recruitment threatens this sustainability. Our lack of knowledge of key processes in lobster larval ecology, such as their position in the food web, limits our ability to determine what underpins this decline. The present study uses a high-throughput amplicon sequencing approach on DNA obtained from the hepatopancreas of larvae to discover significant prey items. Two short regions of the 18S rRNA gene were amplified under the presence of lobster specific PNA to prevent lobster amplification and to improve prey amplification. In the resulting sequences either little prey was recovered, indicating that the larval gut was empty, or there was a high number of reads originating from multiple zooplankton taxa. The most abundant reads included colonial Radiolaria, Thaliacea, Actinopterygii, Hydrozoa and Sagittoidea, which supports the hypothesis that the larvae feed on multiple groups of mostly transparent gelatinous zooplankton. This hypothesis has prevailed as it has been tentatively inferred from the physiology of larvae, captive feeding trials and co-occurrence in situ. However, these prey have not been observed in the larval gut as traditional microscopic techniques cannot discern between transparent and gelatinous prey items in the gut. High-throughput amplicon sequencing of gut DNA has enabled us to classify these otherwise undetectable prey. The dominance of the colonial radiolarians among the gut contents is intriguing in that this group has been historically difficult to quantify in the water column, which may explain why they have not been connected to larval diet previously. Our results indicate that a PCR based technique is a very successful approach to identify the most abundant taxa in the natural diet of lobster larvae.

  14. Monoaminergic tone supports conductance correlations and stabilizes activity features in pattern generating neurons of the lobster, Panulirus interruptus

    Directory of Open Access Journals (Sweden)

    Wulf-Dieter C. Krenz

    2015-10-01

    Full Text Available Experimental and computational studies demonstrate that different sets of intrinsic and synaptic conductances can give rise to equivalent activity patterns. This is because the balance of conductances, not their absolute values, defines a given activity feature. Activity-dependent feedback mechanisms maintain neuronal conductance correlations and their corresponding activity features. This study demonstrates that tonic nM concentrations of monoamines enable slow, activity-dependent processes that can maintain a correlation between the transient potassium current (IA and the hyperpolarization activated current (Ih over the long-term (i.e., regulatory change persists for hours after removal of modulator. Tonic 5nM DA acted through an RNA interference silencing complex (RISC- and RNA polymerase II-dependent mechanism to maintain a long-term positive correlation between IA and Ih in the lateral pyloric neuron (LP but not in the pyloric dilator neuron (PD. In contrast, tonic 5nM 5HT maintained a RISC-dependent positive correlation between IA and Ih in PD but not LP over the long-term. Tonic 5nM OCT maintained a long-term negative correlation between IA and Ih in PD but not LP; however, it was only revealed when RISC was inhibited. This study also demonstrated that monoaminergic tone can also preserve activity features over the long-term: The timing of LP activity, LP duty cycle and LP spike number per burst were maintained by tonic 5nM DA. The data suggest that low-level monoaminergic tone acts through multiple slow processes to permit cell-specific, activity-dependent regulation of ionic conductances to maintain conductance correlations and their corresponding activity features over the long-term.

  15. Molecular, Biochemical, and Dietary Regulation Features of α-Amylase in a Carnivorous Crustacean, the Spiny Lobster Panulirus argus.

    Directory of Open Access Journals (Sweden)

    Leandro Rodríguez-Viera

    Full Text Available Alpha-amylases are ubiquitously distributed throughout microbials, plants and animals. It is widely accepted that omnivorous crustaceans have higher α-amylase activity and number of isoforms than carnivorous, but contradictory results have been obtained in some species, and carnivorous crustaceans have been less studied. In addition, the physiological meaning of α-amylase polymorphism in crustaceans is not well understood. In this work we studied α-amylase in a carnivorous lobster at the gene, transcript, and protein levels. It was showed that α-amylase isoenzyme composition (i.e., phenotype in lobster determines carbohydrate digestion efficiency. Most frequent α-amylase phenotype has the lowest digestion efficiency, suggesting this is a favoured trait. We revealed that gene and intron loss have occurred in lobster α-amylase, thus lobsters express a single 1830 bp cDNA encoding a highly conserved protein with 513 amino acids. This protein gives rise to two isoenzymes in some individuals by glycosylation but not by limited proteolysis. Only the glycosylated isoenzyme could be purified by chromatography, with biochemical features similar to other animal amylases. High carbohydrate content in diet down-regulates α-amylase gene expression in lobster. However, high α-amylase activity occurs in lobster gastric juice irrespective of diet and was proposed to function as an early sensor of the carbohydrate content of diet to regulate further gene expression. We concluded that gene/isoenzyme simplicity, post-translational modifications and low Km, coupled with a tight regulation of gene expression, have arose during evolution of α-amylase in the carnivorous lobster to control excessive carbohydrate digestion in the presence of an active α-amylase.

  16. Molecular, Biochemical, and Dietary Regulation Features of α-Amylase in a Carnivorous Crustacean, the Spiny Lobster Panulirus argus.

    Science.gov (United States)

    Rodríguez-Viera, Leandro; Perera, Erick; Martos-Sitcha, Juan Antonio; Perdomo-Morales, Rolando; Casuso, Antonio; Montero-Alejo, Vivian; García-Galano, Tsai; Martínez-Rodríguez, Gonzalo; Mancera, Juan Miguel

    2016-01-01

    Alpha-amylases are ubiquitously distributed throughout microbials, plants and animals. It is widely accepted that omnivorous crustaceans have higher α-amylase activity and number of isoforms than carnivorous, but contradictory results have been obtained in some species, and carnivorous crustaceans have been less studied. In addition, the physiological meaning of α-amylase polymorphism in crustaceans is not well understood. In this work we studied α-amylase in a carnivorous lobster at the gene, transcript, and protein levels. It was showed that α-amylase isoenzyme composition (i.e., phenotype) in lobster determines carbohydrate digestion efficiency. Most frequent α-amylase phenotype has the lowest digestion efficiency, suggesting this is a favoured trait. We revealed that gene and intron loss have occurred in lobster α-amylase, thus lobsters express a single 1830 bp cDNA encoding a highly conserved protein with 513 amino acids. This protein gives rise to two isoenzymes in some individuals by glycosylation but not by limited proteolysis. Only the glycosylated isoenzyme could be purified by chromatography, with biochemical features similar to other animal amylases. High carbohydrate content in diet down-regulates α-amylase gene expression in lobster. However, high α-amylase activity occurs in lobster gastric juice irrespective of diet and was proposed to function as an early sensor of the carbohydrate content of diet to regulate further gene expression. We concluded that gene/isoenzyme simplicity, post-translational modifications and low Km, coupled with a tight regulation of gene expression, have arose during evolution of α-amylase in the carnivorous lobster to control excessive carbohydrate digestion in the presence of an active α-amylase.

  17. PENDEKATAN SOSIAL-EKOLOGI UNTUK PENILAIAN KESESUAIAN LOKASI RESTOCKING LOBSTER PASIR Panulirus homarus (Linnaeus, 1758 PADA BEBERAPA PERAIRAN DI INDONESIA

    Directory of Open Access Journals (Sweden)

    Amula Nurfiarini

    2016-11-01

    yang sama. Jika dibandingkan dengan kriteria pengambilan keputusan terhadap tingkat kesesuaian habitat, menunjukkan sebanyak 17 lokasi berada pada kategori kelayakan tinggi, dan 11 lokasi kategori kelayakan sedang. Prioritas lokasi restocking, terpilih tiga lokasi dengan nilai kelayakan tertinggi yakni perairan Batu Karas dan Pananjung Barat (Pangandaran, serta Perairan Karang Asem (Trenggalek.

  18. Determining the diet of larvae of western rock lobster (Panulirus cygnus) using high-throughput DNA sequencing techniques.

    Science.gov (United States)

    O'Rorke, Richard; Lavery, Shane; Chow, Seinen; Takeyama, Haruko; Tsai, Peter; Beckley, Lynnath E; Thompson, Peter A; Waite, Anya M; Jeffs, Andrew G

    2012-01-01

    The Western Australian rock lobster fishery has been both a highly productive and sustainable fishery. However, a recent dramatic and unexplained decline in post-larval recruitment threatens this sustainability. Our lack of knowledge of key processes in lobster larval ecology, such as their position in the food web, limits our ability to determine what underpins this decline. The present study uses a high-throughput amplicon sequencing approach on DNA obtained from the hepatopancreas of larvae to discover significant prey items. Two short regions of the 18S rRNA gene were amplified under the presence of lobster specific PNA to prevent lobster amplification and to improve prey amplification. In the resulting sequences either little prey was recovered, indicating that the larval gut was empty, or there was a high number of reads originating from multiple zooplankton taxa. The most abundant reads included colonial Radiolaria, Thaliacea, Actinopterygii, Hydrozoa and Sagittoidea, which supports the hypothesis that the larvae feed on multiple groups of mostly transparent gelatinous zooplankton. This hypothesis has prevailed as it has been tentatively inferred from the physiology of larvae, captive feeding trials and co-occurrence in situ. However, these prey have not been observed in the larval gut as traditional microscopic techniques cannot discern between transparent and gelatinous prey items in the gut. High-throughput amplicon sequencing of gut DNA has enabled us to classify these otherwise undetectable prey. The dominance of the colonial radiolarians among the gut contents is intriguing in that this group has been historically difficult to quantify in the water column, which may explain why they have not been connected to larval diet previously. Our results indicate that a PCR based technique is a very successful approach to identify the most abundant taxa in the natural diet of lobster larvae.

  19. Comparative electron microscopy and image analysis of oxy- and deoxy-hemocyanin from the spiny lobster Panulirus interruptus

    NARCIS (Netherlands)

    Haas, Felix de; Breemen, Jan F.L. van; Boekema, Egbert J.; Keegstra, Wilko; Bruggen, Ernst F.J. van

    1993-01-01

    Structural differences between oxy-hemocyanin and deoxy-hemocyanin from the spiny lobster P. interruptus were studied by electron microscopy and image analysis of negatively stained preparations. Projections of the hexameric P. interruptus hemocyanin from electron microscopy were compared with simul

  20. Calidad ambiental en zonas de pesquerias de langosta Panulirus argus (Latreille, 1804) del Golfo de Batabanó, Cuba.

    OpenAIRE

    2008-01-01

    Una de las causas que puede haber incidido de forma negativa en las poblaciones de langosta en el Golfo de Batabanó, son los cambios en la calidad ambiental del medio. Por tal motivo, se estudia el comportamiento de un conjunto de variables abióticas y bióticas y se compara con la información histórica existente que se remonta a la década de los años ’60. El estudio abarca dos matrices, aguas y sedimentos de fondo, en las especialidades de química, microbiología y fitoplancton. La salinidad m...

  1. Las pintas de la sirvienta: El tifo y el temor a los pobres en la ciudad de México, 1874-1877 The servant's spots typhus and fear of the poor in Mexico City, 1874-1877

    Directory of Open Access Journals (Sweden)

    Daniel Herrera Rangel

    2011-06-01

    Full Text Available Tomando como objeto de estudio el brote epidémico de tifo exantemático que conmocionó la vida de la ciudad de México entre 1874 y 1877, el artículo parte desde el enfoque de la historia sociocultural de la enfermedad, para aventurar una mirada a la manera en que eran percibidas las clases bajas por las elites hacia las décadas finales del siglo XIX. Los médicos y la opinión pública, en su lucha por combatir el tifo, un mal culturalmente asociado a la miseria y a la suciedad, focalizarán su temor y su atención sobre los pobres, haciéndolos responsables de la epidemia y estigmatizándolos por su supuesta ignorancia, su falta de aseo y su inmoralidad, lo que alentará severas medidas en su contra.Taking the epidemic outbreak of exanthematic typhus that caused an upheaval in Mexico City life between 1874 and 1877 as its object of study, the article begins by exploring the socio-cultural history of the disease before focusing on the way the lower classes were perceived by the elite towards the end of the nineteenth century. Doctors and public opinion, in their fight to combat typhus, a disease culturally associated with poverty and dirt, focused their fear and attention on the poor, making them responsible for the epidemic and stigmatizing them for their supposed ignorance, lack of hygiene and immorality, which led to severe measures against them.

  2. Las pintas de la sirvienta: El tifo y el temor a los pobres en la ciudad de México, 1874-1877 The servant's spots typhus and fear of the poor in Mexico City, 1874-1877

    OpenAIRE

    Daniel Herrera Rangel

    2011-01-01

    Tomando como objeto de estudio el brote epidémico de tifo exantemático que conmocionó la vida de la ciudad de México entre 1874 y 1877, el artículo parte desde el enfoque de la historia sociocultural de la enfermedad, para aventurar una mirada a la manera en que eran percibidas las clases bajas por las elites hacia las décadas finales del siglo XIX. Los médicos y la opinión pública, en su lucha por combatir el tifo, un mal culturalmente asociado a la miseria y a la suciedad, focalizarán su te...

  3. COMPARATIVE ELECTRON-MICROSCOPY AND IMAGE-ANALYSIS OF OXY-HEMOCYANIN AND DEOXY-HEMOCYANIN FROM THE SPINY LOBSTER PANULIRUS-INTERRUPTUS

    NARCIS (Netherlands)

    DEHAAS, F; VANBREEMEN, JFL; BOEKEMA, EJ; KEEGSTRA, W; VANBRUGGEN, EFJ

    1993-01-01

    Structural differences between oxy-hemocyanin and deoxy-hemocyanin from the spiny lobster P. interruptus were studied by electron microscopy and image analysis of negatively stained preparations. Projections of the hexameric P. interruptus hemocyanin from electron microscopy were compared with simul

  4. HEXAMERS OF SUBUNIT-II FROM LIMULUS HEMOCYANIN (A 48-MER) HAVE THE SAME QUATERNARY STRUCTURE AS WHOLE PANULIRUS HEMOCYANIN MOLECULES

    NARCIS (Netherlands)

    MAGNUS, KA; LATTMAN, EE; VOLBEDA, A; HOL, WGJ

    1991-01-01

    Hemocyanins are copper-containing proteins that transport oxygen in a variety of invertebrates. Considerable evidence has accumulated that arthropodan hemocyanins are multimers of a fundamental hexameric unit. X-Ray crystallographic structure determination has revealed that the hemocyanin molecule f

  5. [Reproductive pattern and mean size of sexual maturity of female lobsters Panulirus gracilis (Decapoda: Palinuridae) in Playa Lagarto, Guanacaste, Costa Rica].

    Science.gov (United States)

    Naranjo Madrigal, Helven

    2012-12-01

    The lobster P. gracilis is important as a fishery resource and also contributes to food security of fishers in coastal communities in the North Pacific of Costa Rica. Due to the importance of updating knowledge related to the reproductive pattern of this species, we analyzed 357 specimens of female lobsters caught by the fishing methods of "hookah" and lung diving, from November 2007 to October 2008 in Playa Lagarto. Furthermore, we examined the size composition by depth; monthly pattern of reproductive activity (RAI) associated with the relative increase in sea surface temperature, and also the mean size at maturity using Generalized Linear Models. Four physiological states of sexual maturity showed that females with no signs of mating or sexual maturity have a minimum mean size of 62.3mm of cephalothorax length (CL). There are characteristics of functional maturity from very small sizes ranging from 30 to 50mm CL, being the smallest berried female reported for this specie of 35.8mm CL and the highest percentage of mature females between 70 and 80mm CL. Percentages of RAI remained above 50% during the year except October and January. In addition, it observed an increase in the RAI that started from April and continued until August associated with a relative increase in temperature on March, although the correlation was not significant (r2=0.49, p>0.05). It is possible that the low mean size at maturity (70.2mm LC) for P. gracilis in this region is related to the fishing activity. It recommends the establishment of a ban in the region of at least five months (April-August) in order to protect the reproductive seasonality of the species and to promote a recruitment increase in the fishing areas.

  6. Relationship Between Sea Surface Temperature Variation Obtained from AVHRR Imagery and Lobster Catching (Panulirus argus in Cuban Waters (1997-2004

    Directory of Open Access Journals (Sweden)

    Milton Kampel

    2007-06-01

    Full Text Available The spatial and temporal variability of sea surface temperature (SST for the Cuban shelf waters was obtained, and the relationship of these with lobster catches in the period from January/1997-December/2004 was analyzed. The data from this environmental variable sensor were obtained from Advanced Very High Resolution Radiometer (AVHRR. The periodicity of the images and data capture by fishing was monthly. Ocean waters and shelf have a seasonal pattern to the SST, reaching the highest in August (29.5 ° C and the lowest in February (26 ° C. The extreme values recorded were recorded in August 1998 with anomalies of 1.9 ° C and -0.9 ° C in February 2001. During the winter period (Nov-Mar it was possible to find a general pattern of water circulation in the area by observing the images; during the summer (May-October this is not observed. Low correlation between SST anomalies and the catch of lobsters by fishing was observed. The best correlation coefficients (0.48 were found to the west of the island, with four years of time lag.

  7. [Influence of lunar cycle on catches of spiny lobster Panulirus argus (Decapoda: Palinuridae) in the Gulf of Batabanó, Cuba].

    Science.gov (United States)

    Lopeztegui, Alexander; Baisre, Julio A; Capetillo, Norberto

    2011-03-01

    Many biological processes such as reproductive and migratory behaviours have been associated with moon cycles. In this study, the nocturnal light levels associated with lunar cycle (INT) were correlated with daily catch rate of lobster P. argus, during seven lunar months of 2002 fishing period, to determine a possible relationship between these variables. The lobster catches were obtained from three fishing companies that develop their activities in the Gulf of Batabanó: EPICOL that fishes in Coloma area; PESCAHABANA in Batabanó area and PESCAISLA in Isla area. Daily catch per boat (CDB) was used as a measurement of daily catch variations (catch rate). The correlation was analyzed showing it in chronological graphs based on average of CDB per lunar phases, comparing lobster catch rate per lunar phases -with the Kruskal-Wallis test-. Spearman rank correlation coefficient and cross correlation techniques were also applied. Similarities between lobster catch rate and the lunar cycle were not found. Spearman rank correlation coefficient was modularly smaller than 0.1 in all cases and demonstrated quantitatively that correlation between CDB and INT does not exist. Kruskal-Wallis test detected differences only in Batabanó area but not when making the analyses for the whole Gulf of Batabanó. Finally, the cross correlations do not detected significance in any zone, as well. It is concluded that, in opposition to what other authors have reported, the catch rates of P. argus and the lunar cycle did not show significant correlation in the Gulf of Batabanó. This trend was independent of the fishing art, which varied according to the time of the year that was analyzed.

  8. Western rock lobsters ( Panulirus cygnus) in Western Australian deep coastal ecosystems (35-60 m) are more carnivorous than those in shallow coastal ecosystems

    Science.gov (United States)

    Waddington, Kris I.; Bellchambers, Lynda M.; Vanderklift, Mathew A.; Walker, Diana I.

    2008-08-01

    The western rock lobster ( Panurilus cygnus George.) is a conspicuous consumer in the coastal ecosystems of temperate Western Australia. We used stable isotope analysis and gut content analysis to determine the diet and trophic position of western rock lobsters from mid-shelf coastal ecosystems (35-60 m depth) at three locations. Lobsters were primarily carnivorous, and no consistent differences in diet were detected with varying lobster size, sex or among locations. The main components of the diet were bait (from the fishery) and small crustaceans - crabs and amphipods/isopods. Foliose red algae, bivalves/gastropods and sponges were minor contributors to diet. The diet of lobsters in deep coastal ecosystems differed from the results of previous studies of diets of lobsters from shallow coastal ecosystems. In particular, coralline algae and molluscs - important prey in studies of lobsters from shallow coastal ecosystems - were minor components of the diet. These differences are likely to reflect differences in food availability between these systems and potentially, differences in choice of prey by lobsters that inhabit deeper water. Given the high contribution of bait to lobster diet, bait is likely to be subsidizing lobster production in deep coastal ecosystems during the fishing season.

  9. AcEST: BP916598 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tr|Q0PIN2|Q0PIN2_PINTA Phenylpropenal double-bond reductase OS=P... 140 4e-32 tr...LESFLDAFNSMFSGENVGKPVIHL 346 >tr|Q0PIN2|Q0PIN2_PINTA Phenylpropenal double-bond reductase OS=Pinus taeda PE=

  10. Syphilis and the endemic treponematoses : clinical, (histo-) pathological and laboratory studies

    NARCIS (Netherlands)

    H.J.H. Engelkens (Herman)

    1993-01-01

    textabstractTreponemal diseases important to mankind are sexually transmitted syphilis and the endemic nonvenereally transmitted treponematoses (yaws, pinta, and endemic syphilis). Historically, the most important disease caused by treponemes is syphilis. During the last few decades, yaws, endemic s

  11. Variabilidad de la temperatura superficial del mar obtenida a partir de imágenes AVHRR y su relación con las pesquerías de langosta (Panulirus argus en las aguas Cubanas (1997-2004

    Directory of Open Access Journals (Sweden)

    Ronald Buss Souza

    2006-08-01

    Full Text Available Se obtiene la variabilidad espacial y temporal de la temperatura superficial del mar (TSM para las aguas de la plataforma cubana, así como la relación de estas con las capturas de langostas, en el período comprendido entre Enero/1997-Diciembre/2004. Los datos de de esta variable ambiental son obtenidos del sensor “Advanced Very High Resolution Radiometer” (AVHRR. La periodicidad de las imágenes y de los datos de captura por zonas de pesca es mensual. Las aguas oceánicas y de la plataforma tienen un comportamiento estacional para la TSM, alcanzando las máximas en Agosto (29,5°C y las mínimas en Febrero (26°C. Los valores extremos registrados se datan en Agosto del 1998 con anomalías de 1,9°C y de -0,9°C en Febrero del 2001. Durante el período invernal (Nov-Abr es posible encontrar un padrón general de circulación de las aguas para el área mediante la observación de las imágenes; en verano (May-Oct no se observa. Se obtiene una baja correlación entre las anomalías de TSM y las capturas de langostas por zonas de pesca. Los mejores coeficientes de correlación (0,48 se hallaron para la zona occidental de la isla, con 4 años de desfase.

  12. AcEST: DK959761 [AcEST

    Lifescience Database Archive (English)

    Full Text Available la paten... 84 4e-20 tr|Q0PIN2|Q0PIN2_PINTA Phenylpropenal double-bond reductase OS=P... 89 2e-18 tr|B8LKL3|...L KVD VP SY+LGVLG+ G TAW Sbjct: 119 KGQDLIKVDASQVPASYYLGVLGMPGLTAW 148 >tr|Q0PIN2...|Q0PIN2_PINTA Phenylpropenal double-bond reductase OS=Pinus taeda PE=2 SV=1 Length = 351 Score = 88.6 bits (

  13. Techniques of artificial breeding and farming lobster%龙虾的人工育苗及其养殖技术

    Institute of Scientific and Technical Information of China (English)

    吴善

    2000-01-01

    @@ 龙虾属节肢动物门,甲壳纲,十足目,龙虾科,龙虾有12种之多,最常见的有锦绣龙虾(Panlirus ornatus)、日本龙虾(Panulirus japonicus)和中国龙虾(Panulirus stimpsoni).锦绣龙虾最大,可达55cm,日本龙虾较小.

  14. O arquipélago “literopintado”: escritura literária de autoria feminina em Cabo Verde

    Directory of Open Access Journals (Sweden)

    Simone Caputo Gomes

    2010-12-01

    Full Text Available Este artigo tem por objetivo estudar a representação de Cabo Verde pela literatura de autoria feminina, que retrata – lê, pinta, desenha, esculpe, escreve, imagina – suas belas paisagens, seu cotidiano popular, seus perfis de mulher, sua riqueza cultural.Palavras-chave: Literatura feminina; Cabo Verde; Representação cultural.

  15. Habitat surrounding patch reefs influences the diet and nutrition of the western rock lobster

    Science.gov (United States)

    In this study the influence of habitat on the diet and nutrition of a common reef-associated generalist consumer, the western rock lobster Panulirus cygnus, was tested. Stable isotopes (13C/12C and 15N/14N) and gut contents were used to assess the diet of lobsters collected from ...

  16. Lobster trap detection at the Saba Bank

    NARCIS (Netherlands)

    Beek, van I.J.M.

    2012-01-01

    According to previous studies and anecdotal evidence there are a lot of lost lobster traps at the Saba Bank. One study estimated the loss to be between 210 and 795 lobster traps per year. The Saba Bank is an approximately 2,200 km2 submerged area and spiny lobster (Panulirus argus) is one of the mai

  17. Which Fishers Are Satisfied in the Caribbean? A Comparative Analysis of Job Satisfaction among Caribbean Lobster Fishers

    Science.gov (United States)

    Monnereau, Iris; Pollnac, Richard

    2012-01-01

    Lobster fishing (targeting the spiny lobster "Panulirus argus") is an important economic activity throughout the Wider Caribbean Region both as a source of income and employment for the local population as well as foreign exchange for national governments. Due to the high unit prices of the product, international lobster trade provides a…

  18. ¿Cómo era la "Santa María"?

    Directory of Open Access Journals (Sweden)

    Boletín Cultural y Bibliográfico Banco de la República

    1968-02-01

    Full Text Available No puedo dar a mis lectores una descripción auténtica de los tres famosos barcos... porque no hay datos ni documentos sobre los que honradamente se puedan describir. Nadie sabe cómo eran exactamente Niña, Pinta y Santa María... Los mejores modelos, que representan investigaciones a fondo son: (1 Los planos de Ernesto D' Albertis, de 1892, de los que se hicieron los modelos del Museo Marino de Pegli, cerca de Génova; (2 Niña 11, Pinta 11 y Santa María 11, construídos según planos de Fernández Duro y Monleón para la Exposición de Chicago, de 1893; (3 La Santa María 111, de D. Julio Guillén, construída en 1927 para la Exposición de Sevilla".

  19. Geothermal Energy in the Pacific Region

    Science.gov (United States)

    1975-05-01

    San Salvador 6 pA/hA/D 0 Islas Quemadas 7 pA 49 San Vicente 8 oB 8 Tecana 9 a Chinameca 10 oB 0 San Miguel 11 pA a Conchagua 12 B3 0 Conchaguita...Negra 6 0 Cerro Azul 7 oB 0 Isla Pinta Isla Pinta 8 B 0 Isla Marchena Isla Marchena 9 oB/A 0 Isla San Salvador isla San Salvador 10 opB 0 Isla Santa Maria...14 pJ’/oB 0 Tupungatito 15 pA 0 San Jose’ 16 T 9 Tinguiririca 17 pA 0 Peteroa 18 T & Descabezado Grande 19 A * Cerro Azul 20 oB 0 Nevados de

  20. A new species of the fungus-farming ant genus Mycetagroicus Brandão & Mayhé-Nunes (Hymenoptera, Formicidae, Attini Uma nova espécie de formiga cultivadora de fungo, do gênero Mycetagroicus Brandão & Mayhé-Nunes (Hymenoptera, Formicidae, Attini

    Directory of Open Access Journals (Sweden)

    Carlos Roberto Ferreira Brandão

    2008-09-01

    Full Text Available The fungus-farming ant genus Mycetagroicus Brandão & Mayhé-Nunes was proposed based on three species from the Brazilian "Cerrado": M. cerradensis, M. triangularis and M. urbanus. Here we describe a new species of Attini ant of the genus Mycetagroicus, M. inflatus n. sp., based on two workers collected in eastern Pará State, Brazil. A new key for species identification, comments on differences among species and new geographical distribution data are furnished.O gênero de formigas cultivadoras de fungos, Mycetagroicus Brandão & Mayhé-Nunes, foi proposto com base em três espécies do Cerrado: M. cerradensis, M. triangularis e M. urbanus. Neste trabalho descrevemos uma nova espécie de Attini do gênero Mycetagroicus, M. inflatus n. sp., baseada em duas operárias coletadas no leste do Pará, Brasil. Apresentamos uma nova chave para a identificação das espécies, comentários sobre as diferenças entre as espécies e novos dados sobre a distribuição geográfica.

  1. Jüri Kasel on väljas kaks suurt näitust : ...

    Index Scriptorium Estoniae

    2005-01-01

    Kuni 6. I 2006 saab Belgias Liege'i kaasaegse kunsti keskuses vaadata Jüri Kase suuri maale, paarisadat joonistust ning objekti ja kuni 12. XII Inglismaal Oxfordi Jacqueline du Pre muusikahoones maale. Liege'i näitusel on väljas ka Jaanus Miku tehtud video "Pinta pilte". 22.-26. XI Eesti kultuuripäevadel Oxfordis esines Weekend Guitar Trio, Kristiina Ehin luges luulet, näidati Priit Tenderi ja Ülo Pikkovi animafilme

  2. Pintores contemporáneos: Ficha para Noé León

    Directory of Open Access Journals (Sweden)

    Mario Rivero

    1968-09-01

    Full Text Available Todo transcurre exactamente como si nada pudiera suceder: Noé León, anónimo, desconocido trabajador de colores y de líneas, trabaja a gusto. Pinta cuadros "bonitos": el Barranquilla de los turistas, el paisaje, el cielo azúl-bandera y las nubes de algodón y de pasta dentífrica.

  3. Internal acetylene unit as a cross-link site for polyimides

    Energy Technology Data Exchange (ETDEWEB)

    Takeichi, T.; Tanikawa, M. [Toyohashi Univ. of Technology (Japan)

    1995-12-01

    We have been studying on the cross-linking behavior of internal acetylenes linked meta-meta to aromatic connecting units which were introduced into the polyimide backbone utilizing 3,3`-diaminodiphenylacetylene (m-intA). In this study, we studied on the cross-linking behavior of internal acetylenes linked para-para to aromatic connecting units. The internal acetylene units were introduced into the polyimide backbone by the reaction of 4,4`-diaminodiphenylacetylene (p-intA) with such acid anhydrides as biphenyltetracarboxylic dianhydride (BPDA), pyromellitic dianhydride (PMDA), and 2,2-bis(3,4-dicarboxyphenyl)hexafluoropropane dianhydride (6FDA). The polyimides showed exotherm on DSC: The onset of the exotherm of p-intA appeared at around 330-390{degrees}C, which is 10-50{degrees}C higher than that of m-intA. The exotherm disappeared after thermal treatment at 400{degrees}C, suggesting the progress of crosslinking between acetylene units. The polyimides cured at 350{degrees}C or 400{degrees}C showed increased Tg and improved physical properties at high temperatures as confirmed by viscoelastic analyses. It was also made clear that polyimides containing p-intA showed higher modulus compared with polyimides containing m-intA, especially when coupled with BPDA and PMDA.

  4. Two new species of nematode (Oxyurida, Hystrignathidae parasites of Passalus interstitialis Escholtz, 1829 (Coleoptera, Passalidae from Cuba and a new locality for Longior similis Morffe, Garcia & Ventosa, 2009

    Directory of Open Access Journals (Sweden)

    Jans Rodríguez

    2010-06-01

    Full Text Available Two new species of hystrignathids (Oxyurida: Hystrignathidae are described as parasites of Passalus interstitialis Escholtz, 1829 from Cuba. Hystrignathus splendidus sp. n. differs from H. inflatus Travassos & Kloss, 1957 bythe eggs ridged, a stouter body and a shorter tail, and from H. tarda (Artigas, 1928 by its eggs being ridged and larger. Lepidonema magnum sp. n. can be differentiated from L. brasiliensis Travassos & Kloss, 1957 by the extension of the lateral alae, length of the first cephalic annule and the stouter body. It differs from L. teresae Garcia, Ventosa & Morffe, 2009 by the esophagus and tail being comparatively shorter. L. bifurcata Cobb, 1898 differs from the new species bythe tail tip bifurcated. L. caracae Kloss, 1962 has more extended lateral alae and a shorter esophagus. Keys to the Cuban species of Hystrignathus and Lepidonema are given. Longior similis Morffe, Garcia & Ventosa, 2009 is recorded from El Pan de Matanzas, Matanzas Province, Cuba.

  5. The unionid (Bivalvia) fauna of the Sipsey River in northwestern Alabama, an aquatic hotspot

    Science.gov (United States)

    McCullagh, W.H.; Williams, J.D.; McGregor, S.W.; Pierson, J.M.; Lydeard, C.

    2002-01-01

    Recent surveys for unionid bivalves were conducted in the mainstem of the Sipsey River and headwater tributaries (Tombigbee River drainage) during the summer and autumn of 1996-1999. A total of 35 species and 22 genera were found. Museum records from the upper Sipsey, based largely on the efforts of H. H. Smith during 1910-11, raised the total number of recorded unionids in the Sipsey to 42. Smith documented 25 species in the river; however, most of his collections were made in the mid- to upper-Sipsey, which has lower diversity. The three most common recently observed species in descending order of abundance were Quadrula asperata (I. Lea, 1861), Pleurobema decisum (I. Lea, 1831), and Tritogonia verrucosa (Rafinesque, 1820). Federally listed species observed recently include Lampsilis perovalis (Conrad, 1834) (threatened), Medionidus acutissimus (I. Lea, 1831) (threatened), P. decisum (endangered), P. perovatum (Conrad, 1834) (endangered), and Potamilus inflatus (I. Lea, 1831) (threatened). Species not observed recently but recorded in prior surveys include Anodontoides radiatus (Conrad, 1834), Arcidens confragosus (Say, 1829), Plectomerus dombeyanus (Valenciennes, 1827), Q. metanevra (Rafinesque, 1820), Q. stapes (I. Lea, 1831) (federally endangered), P. taitianum (I. Lea, 1834) (federally endangered), and Toxolasma parvus (Barnes, 1823). Many, species are known recently or historically by only five or fewer recorded specimens including: A. radiatus, Elliptio arctata (Conrad, 1834), Ligumia recta (Lamarck, 1819), P. taitianum, P. inflatus, Q. aspera (Lea, 1831), Q. metanevra, Q. stapes, T. parvus, Truncilla donaciformis (I. Lea, 1828), Uniomerus tetralasmus (Say, 1831), Utterbackia imbecillis (Say, 1829), A. confragosus, and P. dombeyanus. Unlike the mussel fauna of most Alabama streams, that of the Sipsey River is still relatively intact in terms of species richness despite impacts from mining, silvicultural, and agricultural activities. A concerted effort

  6. Equivalency of Galápagos giant tortoises used as ecological replacement species to restore ecosystem functions.

    Science.gov (United States)

    Hunter, Elizabeth A; Gibbs, James P; Cayot, Linda J; Tapia, Washington

    2013-08-01

    Loss of key plant-animal interactions (e.g., disturbance, seed dispersal, and herbivory) due to extinctions of large herbivores has diminished ecosystem functioning nearly worldwide. Mitigating for the ecological consequences of large herbivore losses through the use of ecological replacements to fill extinct species' niches and thereby replicate missing ecological functions has been proposed. It is unknown how different morphologically and ecologically a replacement can be from the extinct species and still provide similar functions. We studied niche equivalency between 2 phenotypes of Galápagos giant tortoises (domed and saddlebacked) that were translocated to Pinta Island in the Galápagos Archipelago as ecological replacements for the extinct saddlebacked giant tortoise (Chelonoidis abingdonii). Thirty-nine adult, nonreproductive tortoises were introduced to Pinta Island in May 2010, and we observed tortoise resource use in relation to phenotype during the first year following release. Domed tortoises settled in higher, moister elevations than saddlebacked tortoises, which favored lower elevation arid zones. The areas where the tortoises settled are consistent with the ecological conditions each phenotype occupies in its native range. Saddlebacked tortoises selected areas with high densities of the arboreal prickly pear cactus (Opuntia galapageia) and mostly foraged on the cactus, which likely relied on the extinct saddlebacked Pinta tortoise for seed dispersal. In contrast, domed tortoises did not select areas with cactus and therefore would not provide the same seed-dispersal functions for the cactus as the introduced or the original, now extinct, saddlebacked tortoises. Interchangeability of extant megaherbivores as replacements for extinct forms therefore should be scrutinized given the lack of equivalency we observed in closely related forms of giant tortoises. Our results also demonstrate the value of trial introductions of sterilized individuals to test

  7. Vastuskertoimen määrittäminen

    OpenAIRE

    Kinnunen, Teemu

    2011-01-01

    Tämän insinöörityön tarkoituksena oli luoda katsaus virtauksessa olevaan kappaleeseen kohdistuvan vastusvoiman vastuskertoimen määrittämiseen. Vastusvoiman suuruus riippuu kappaleen pinta-alasta, dynaamisesta paineesta ja vastuskertoimesta. Vastuskerroin riippuu virtauksen luonteesta, kappaleen pinnankarheudesta ja kappaleen muodosta. Insinöörityön teoriaosuudessa perehdyttiin pääasiassa Frank M. Whiten ja Yunus A. Çengelin teoksiin vastuskertoimen teoriasta, kooten niistä yhtenäinen suo...

  8. Pesu- ja desinfiointikoneen höyrynlauhduttimen suunnittelu

    OpenAIRE

    Klemettilä, Markus

    2010-01-01

    Tämän insinöörityön aiheena oli suunnitella Franke Finland Oy:n Deko D32SC -pesu- ja desinfiointikoneeseen höyrynlauhdutin. Pesukone on tarkoitettu sairaala- ja laboratoriovälineistön pesuun. Lauhduttimen tehtävä on lauhduttaa lämpödesinfioinnin aikainen alle 100-asteinen vesihöyry. Työssä on tutkittu höyrynlauhtumisen termodynamiikkaa sekä pinta- ja kontaktilauh-duttamista. Kirjallisuustutkimuksen ja aikaisempien kokemusten pohjalta rakennettiin testauksia varten kaksi prototyyppiä Naara...

  9. Nauhakuusenkadun alueen hulevesiselvitys

    OpenAIRE

    Jormalainen, Janne

    2015-01-01

    Tämän opinnäytetyön tarkoituksena oli selvittää Imatran kaupungille Nauhakuusenkadun alueen hulevesimäärät nykytilassa sekä kaavamuutoksen jälkeen ja suositella sopivaa hulevesienkäsittelymenetelmää. Käytin 3D-win- ja Autocad-ohjelmistoja pinta-alojen arviointiin. Valumakertoimia arvioin ilmakuvista sekä paikalla käymällä. Opinnäytetyössä käsitellään hulevesien syntymiseen ja laatuun vaikuttavia tekijöitä ja erilaisia hallinta- ja käsittelymenetelmiä. Hulevesirakenteiden mitoitus va...

  10. Notas para la biografía de una carabela

    Directory of Open Access Journals (Sweden)

    Uriel Ospina

    1964-04-01

    Full Text Available Es curioso observar cómo en sus "Relaciones" Cristóbal Colon no hace referencia a la "Santa María" como una carabela sino como una nao. Que carabelas hayan sido, por ejemplo, la Pinta y la Niña, es cosa fuera de duda. Por lo que hace relación a la Santa María, sus dimensiones, su estructura y su misma apariencia la ponían en un plano de superioridad náutica con respecto al tipo tradicional de carabelas conocido en Europa en los últimos años del siglo XV.

  11. Procesos escriturales e identidad en la novelística de Albalucía Ángel Marulanda

    Directory of Open Access Journals (Sweden)

    Graciela Uribe Álvarez

    2001-01-01

    Full Text Available Este ensayo no pretende ser conclusivo; al contrario, es sólo un paso en la búsqueda de singularidades que permitan hablar de una estética de la escritora pereirana Albalucía Ángel Marulanda (1939, al menos en lo que hace referencia a sus cinco novelas: Los girasoles en invierno (1970, Dos veces Alicia (1972, Estaba la pájara pinta sentada en el verde limón (1975, Misiá señora (1982 y Las andariegas (1984.

  12. Brecht y la música

    OpenAIRE

    Paraskevaídis,Graciela

    2008-01-01

    El activista social, hombre de teatro y cantautor Bertolt Brecht define claramente la función que la música debe asumir en el teatro épico, contraponiendo éste al de ópera dramática: la música no es servidora sino mediadora, pone de manifiesto el texto, lo interpreta, toma posición y marca una conducta. La música no ilustra, no pinta situaciones psicologizantes, sino que actúa sobre la sociedad, estimula al oyente y lo obliga a una actitud crítica. Deja de ser sólo un medio de place...

  13. Vastuskertoimen määrittäminen

    OpenAIRE

    Kinnunen, Teemu

    2011-01-01

    Tämän insinöörityön tarkoituksena oli luoda katsaus virtauksessa olevaan kappaleeseen kohdistuvan vastusvoiman vastuskertoimen määrittämiseen. Vastusvoiman suuruus riippuu kappaleen pinta-alasta, dynaamisesta paineesta ja vastuskertoimesta. Vastuskerroin riippuu virtauksen luonteesta, kappaleen pinnankarheudesta ja kappaleen muodosta. Insinöörityön teoriaosuudessa perehdyttiin pääasiassa Frank M. Whiten ja Yunus A. Çengelin teoksiin vastuskertoimen teoriasta, kooten niistä yhtenäinen suo...

  14. Laboratorio de arte y creatividad: propuesta alternativa para los 5 años

    OpenAIRE

    Martínez-Giménez, María Jesús

    2015-01-01

    ¿Qué actividades de artes plásticas se recuerdan de aquella etapa de colegio? ¿Copia, pinta y recorta? ¿El cielo es azul, y los árboles marrones y verdes? El aprendizaje, para que suceda, debe trabajar sobre contenidos motivadores, que permitan se genere un deseo de más conocimiento. El presente Trabajo Fin de Grado formula una propuesta de intervención enfocada a fomentar y estimular la creatividad en niños de 5 años. Pretende ser un impulso para los maestros en el modo de plante...

  15. Molecular evolution and expression of the CRAL_TRIO protein family in insects.

    Science.gov (United States)

    Smith, Gilbert; Briscoe, Adriana D

    2015-07-01

    CRAL_TRIO domain proteins are known to bind small lipophilic molecules such as retinal, inositol and Vitamin E and include such gene family members as PINTA, α-tocopherol transfer (ATT) proteins, retinoid binding proteins, and clavesins. In insects, very little is known about either the molecular evolution of this family of proteins or their ligand specificity. Here we characterize insect CRAL_TRIO domain proteins and present the first insect CRAL_TRIO protein phylogeny constructed by performing reciprocal BLAST searches of the reference genomes of Drosophila melanogaster, Anopheles gambiae, Apis mellifera, Tribolium castaneum, Bombyx mori, Manduca sexta and Danaus plexippus. We find several highly conserved amino acid residues in the CRAL_TRIO domain-containing genes across insects and a gene expansion resulting in more than twice as many gene family members in lepidopterans than in other surveyed insect species, but no lepidopteran homolog of the PINTA gene in Drosophila. In addition, we examined the expression pattern of CRAL_TRIO domain genes in Manduca sexta heads using RNA-Seq data. Of the 42 gene family members found in the M. sexta reference genome, we found 30 expressed in the head tissue with similar expression profiles between males and females. Our results suggest this gene family underwent a large expansion in lepidopteran, making the lepidopteran CRAL_TRIO domain family distinct from other holometabolous insect lineages.

  16. Which Fishers are Satisfied in the Caribbean? A Comparative Analysis of Job Satisfaction Among Caribbean Lobster Fishers.

    Science.gov (United States)

    Monnereau, Iris; Pollnac, Richard

    2012-10-01

    Lobster fishing (targeting the spiny lobster Panulirus argus) is an important economic activity throughout the Wider Caribbean Region both as a source of income and employment for the local population as well as foreign exchange for national governments. Due to the high unit prices of the product, international lobster trade provides a way to improve the livelihoods of fisheries-dependent populations. The specie harvested is identical throughout the region and end market prices are roughly similar. In this paper we wish to investigate to which extent lobster fishers' job satisfaction differs in three countries in the Caribbean and how these differences can be explained by looking at the national governance arrangements.

  17. AnÃlise da composiÃÃo centesimal e perfil de Ãcidos graxos e crustÃceos

    OpenAIRE

    Laura Freire Tenuta

    2010-01-01

    Este estudo teve como objetivo determinar a composiÃÃo centesimal, o perfil de Ãcidos graxos e o valor calÃrico de trÃs espÃcies de crustÃceos do Estado do CearÃ. As espÃcies estudadas sÃo as mais comercializadas: lagosta espinhosa (Panulirus argus), camarÃo branco (Litopenaeus vannamei), caranguejo uÃÃ, (Ucides cordatus).Os resultados obtidos demonstraram elevados teores de umidade na vÃscera de caranguejo. As carnes de lagosta e de caranguejo apresentaram os maiores percen...

  18. Biology characteristics of Chinese lobster%中国龙虾的生物学特性

    Institute of Scientific and Technical Information of China (English)

    陈政强; 陈昌生; 单剑宇

    2001-01-01

    @@ 中国龙虾(the spiny lobster,Panulirus stimpsoni)隶属节肢动物门、甲壳纲、十足目、龙虾科、龙虾属.已知全球共有龙虾属种类19种,都为经济种类.我国海域共有8个种类分布,中国龙虾既是我国海区特有的地方种,也是重要的海洋渔业对象,其数量最多、分布最广、产量最大.

  19. Capacidade de absorção do chumbo por plantas do género Cistus espontâneas em ambientes mineiros Lead uptake capacity of Cistus plants growing in mining areas

    Directory of Open Access Journals (Sweden)

    M.M. Abreu

    2009-01-01

    Full Text Available A actividade mineira pode gerar grandes quantidades de materiais provenientes da mineralização mais ou menos alterada, fragmentada ou britada, das rochas encaixantes e de escórias que constituem escombreiras, muitas vezes quimicamente instáveis, e que podem fornecer elevados teores de elementos químicos potencialmente contaminantes para os ecossistemas. As plantas que se desenvolvem nestes ambientes degradados podem contribuir para a minimização dos impactos negativos quer de natureza química, quer física e paisagista. Para avaliar o potencial de absorção do Pb das plantas do género Cistus que crescem espontaneamente nas áreas mineiras do Braçal (NW Portugal e de São Domingos (SE Portugal, analisaram-se, respectivamente, por espectrometria de massa com fonte de plasma indutivamente acoplado e espectrofotometria de absorção atómica, após digestão ácida, a parte aérea (folhas e raminhos de Cistus inflatus e as folhas de Cistus ladanifer. Os solos daquelas áreas foram caracterizados relativamente ao pH (H2O, carbono orgânico, capacidade de troca catiónica, Fe e Mn livres, N total e K e P assimiláveis. Determinou-se também (fracção Mining activity can give rise to large quantities of chemically unstable waste rocks and tailings which can drain potential environmentally harmful lixiviates rich in chemical elements. Plants growing in such environments can minimize chemical, physical and visual negative impacts. To evaluate lead absorption by native Cistus growing in Braçal (NW Portugal and São Domingos (SE Portugal mining areas, Cistus inflatus (aerial parts and Cistus ladanifer (leaves were analysed by instrumental neutron activation analysis and atomic absorption spectrometric, respectively, after acid digestions. Soils were characterized by pH(H2O, organic carbon, cation exchange capacity, free Fe and Mn, total nitrogen, and assimilable K and P. Total lead was determined in soils (fraction < 2 mm by inductively

  20. Prediction of genetic gain from selection indices for disease resistance in papaya hybrids Predição de ganhos genéticos para resistência a doenças por índices de seleção em híbridos de mamoeiro

    Directory of Open Access Journals (Sweden)

    Marcelo Vivas

    2012-12-01

    Full Text Available In order to select superior hybrids for the concentration of favorable alleles for resistance to papaya black spot, powdery mildew and phoma spot, 67 hybrids were evaluated in two seasons, in 2007, in a randomized block design with two replications. Genetic gains were estimated from the selection indices of Smith & Hazel, Pesek & Baker, Williams, Mulamba & Mock, with selection intensity of 22.39%, corresponding to 15 hybrids. The index of Mulamba & Mock showed gains more suitable for the five traits assessed when it was used the criterion of economic weight tentatively assigned. Together, severity of black spot on leaves and on fruits, characteristics considered most relevant to the selection of resistant materials, expressed percentage gain of -44.15%. In addition, there were gains for other characteristics, with negative predicted selective percentage gain. The results showed that the index of Mulamba & Mock is the most efficient procedure for simultaneous selection of papaya hybrid resistant to black spot, powdery mildew and phoma spot.Com a finalidade de selecionar híbridos superiores para concentração de alelos favoráveis à resistência de mamoeiro à pinta-preta, oídio e mancha de phoma, foram avaliados, em duas épocas, em 2007, 67 híbridos simples, em delineamento de blocos casualizados com duas repetições. Os ganhos genéticos foram estimados a partir dos índices de seleção de Smith & Hazel, Pesek & Baker, Williams e Mulamba & Mock, com intensidade de seleção de 22,39%, correspondendo a 15 híbridos. O índice de Mulamba & Mock evidenciou ganhos mais adequados para as cinco características avaliadas, quando utilizado o critério de peso econômico atribuído por tentativas. Em conjunto, as severidades da pinta-preta em folhas e em frutos, características consideradas de maior interesse para a seleção de materiais resistentes, expressaram ganho percentual de -44,15%. Além disso, registraram-se ganhos para as demais

  1. Avaliação do extrato etanólico de Ottonia martiana Miq. para o controle de duas doenças florestais Evaluation of Ottonia martiana Miq. alcoholic extract to control two forest diseases

    Directory of Open Access Journals (Sweden)

    M.M. Cunico

    2012-01-01

    Full Text Available Metabólitos secundários presentes em plantas medicinais apresentam várias propriedades biológicas incluindo a atividade antifúngica. Esse estudo avaliou o potencial antifúngico da planta medicinal Ottonia martiana no controle da pinta-preta em erva-mate (Ilex paraguariensis e do mofo-cinzento em eucalipto (Eucalyptus dunnii. Extrato etanólico (EBEtOH dos órgãos totais (raízes, caules, folhas e frutos foi preparado e testado na concentração de 1000 μg mL-1 contra os patógenos Cylindrocladium spathulatum (pinta-preta e Botrytis cinerea (mofo-cinzento. Bioensaios in vitro (germinação de esporos e bioautografia direta e in vivo (teste de patogenicidade em mudas mostraram que o EBEtOH reduziu o crescimento micelial dos patógenos testados e a germinação dos esporos de C. spathulatum e estimulou a germinação de esporos de B. cinerea. O teste de patogenicidade mostrou que o controle da pinta-preta em erva-mate e do mofo cinzento em eucalipto não é viável usando-se a concentração testada de EBEtOH de O. martiana. Na bioautografia direta, foram detectadas zonas de inibição de crescimento micelial dos fungos e que foram relacionadas com a presença de piperovatina.Secondary metabolites from medicinal plants have several biological properties, including antifungal activity. This study evaluated the antifungal potential of the medicinal plant Ottonia martiana to control maté leaf spot (Ilex paraguariensis and eucalypt gray mould (Eucalyptus dunnii. Ethanol extract (EBEtOH of the total parts (roots, stems, leaves and fruits was prepared at the concentration of 1000 μg mL-1 and tested against Cylindrocladium spathulatum (maté leaf spot and Botrytis cinerea (eucalypt gray mould. In vitro bioassays (spore germination and direct bioautography and in vivo bioassays (pathogenicity test in seedlings showed that EBEtOH reduced the mycelial growth of the tested pathogens and the germination of C. spathulatum spores and stimulated the

  2. Host behavior alters spiny lobster-viral disease dynamics: a simulation study.

    Science.gov (United States)

    Dolan, Thomas W; Butler, Mark J; Shields, Jeffrey D

    2014-08-01

    Social behavior confers numerous benefits to animals but also risks, among them an increase in the spread of pathogenic diseases. We examined the trade-off between risk of predation and disease transmission under different scenarios of host spatial structure and disease avoidance behavior using a spatially explicit, individual-based model of the host pathogen interaction between juvenile Caribbean spiny lobster (Panulirus argus) and Panulirus argus Virus 1 (PaV1). Spiny lobsters are normally social but modify their behavior to avoid diseased conspecifics, a potentially effective means of reducing transmission but one rarely observed in the wild. We found that without lobster avoidance of diseased conspecifics, viral outbreaks grew in intensity and duration in simulations until the virus was maintained continuously at unrealistically high levels. However, when we invoked disease avoidance at empirically observed levels, the intensity and duration of outbreaks was reduced and the disease extirpated within five years. Increased lobster (host) spatial aggregation mimicking that which occurs when sponge shelters for lobsters are diminished by harmful algal blooms, did not significantly increase PaV1 transmission or persistence in lobster populations. On the contrary, behavioral aversion of diseased conspecifics effectively reduced viral prevalence, even when shelters were limited, which reduced shelter availability for all lobsters but increased predation, especially of infected lobsters. Therefore, avoidance of diseased conspecifics selects against transmission by contact, promotes alternative modes of transmission, and results in a more resilient host-pathogen system.

  3. Genetic diversity in Treponema pallidum: implications for pathogenesis, evolution and molecular diagnostics of syphilis and yaws.

    Science.gov (United States)

    Smajs, David; Norris, Steven J; Weinstock, George M

    2012-03-01

    Pathogenic uncultivable treponemes, similar to syphilis-causing Treponema pallidum subspecies pallidum, include T. pallidum ssp. pertenue, T. pallidum ssp. endemicum and Treponema carateum, which cause yaws, bejel and pinta, respectively. Genetic analyses of these pathogens revealed striking similarity among these bacteria and also a high degree of similarity to the rabbit pathogen, Treponema paraluiscuniculi, a treponeme not infectious to humans. Genome comparisons between pallidum and non-pallidum treponemes revealed genes with potential involvement in human infectivity, whereas comparisons between pallidum and pertenue treponemes identified genes possibly involved in the high invasivity of syphilis treponemes. Genetic variability within syphilis strains is considered as the basis of syphilis molecular epidemiology with potential to detect more virulent strains, whereas genetic variability within a single strain is related to its ability to elude the immune system of the host. Genome analyses also shed light on treponemal evolution and on chromosomal targets for molecular diagnostics of treponemal infections.

  4. AcEST: DK958984 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3-O-methyltransferase OS=Clar... 99 2e-20 sp|Q00763|COMT1_POPTM Caffeic acid 3-O-methyltransferase 1 OS=Po...... 99 3e-20 sp|Q43046|COMT1_POPKI Caffeic acid 3-O-methyltransferase 1 OS=Po... 97 7e-20 sp|O81646|COMT1_CAPC...|COMT3_POPKI Caffeic acid 3-O-methyltransferase 3 OS=Po... 92 2e-18 sp|Q8GU25|COMT1_ROSCH Caffeic acid 3-O-m...ethyltransferase OS=Rosa... 92 2e-18 sp|Q41086|COMT2_POPTM Caffeic acid 3-O-methyltransferase 2 OS=Po....0|Q5IDE0_PINTA Caffeate O-methyltransferase (Fragment) O... 92 3e-17 tr|Q1JUZ8|Q1JUZ8_IPONI Caffeic acid 3-O

  5. Cuando esas nuevas ramas crezcan yo también habré sanado

    Directory of Open Access Journals (Sweden)

    Ruysen Flores

    2014-09-01

    Full Text Available Ruysen Flores narra sobre cómo superó una enfermedad espiritual que lo aquejaba, siguiendo el ejemplo de las plantas que le había enseñado su maestro Pablo Amaringo. Así como las plantas al podarlas se renuevan, así su espíritu se sanó. Su inspiración es la mitología, la costumbre y las plantas. En su pintura hay un espíritu femenino acuático, cuyos hijos son los delfines. Ruysen pinta a los espíritus protectores que aparecen en los rituales de los chamanes y los espíritus de las plantas y los elementos. Utiliza figuras que vienen en perspectiva, también muy utilizadas por Pablo Amaringo, a las que llamaba “tingunas”. 

  6. AcEST: DK953240 [AcEST

    Lifescience Database Archive (English)

    Full Text Available se 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q9AR74 Definition sp|Q9AR74|TCMO_RUTGR Trans-cinnamate 4-monooxygenase OS=Ruta...ns-cinnamate 4-monooxygenase OS=Ruta gra... 124 4e-28 sp|Q43054|TCMO_POPKI Trans-...e-12 >sp|Q9AR74|TCMO_RUTGR Trans-cinnamate 4-monooxygenase OS=Ruta graveolens GN=CYP73A2 PE=2 SV=1 Length = ...tr|Q5IDB4|Q5IDB4_PINTA Cinnamate 4-hydroxylase (Fragment) OS=Pin... 130 6e-29 tr|Q8H6A1|Q8H6A1_RUTGR Cinnamate 4-hydroxylase OS=Ruta...RTRNVVFDIFTGKGQDMVFTVY 129 >tr|Q8H6A1|Q8H6A1_RUTGR Cinnamate 4-hydroxylase OS=Ruta

  7. Hulevesien hallintavaihtoehtojen mallinnus tiiviissä taajamassa

    OpenAIRE

    Raudaskoski, Outi

    2016-01-01

    Vettä läpäisemättömän pinnan määrä on lisääntynyt kaupungistumisen myötä. Läpäisemätön pinta vaikuttaa veden luonnolliseen kiertokulkuun vähentämällä imeytymistä ja haihduntaa ja lisäämällä pintavaluntaa. Tämän työn tavoitteena oli arvioida erilaisten hulevesien hallintarakenteiden vaikutuksia rankkasadetapahtumien aiheuttamaan valuntaan tiiviisti rakennetussa kaupunkiympäristössä. Tutkimusalueena työssä oli Vallikallion alue Espoossa. Alueen hydrologiaa mallinnettiin SWMM (Storm Water Manage...

  8. AcEST: DK945226 [AcEST

    Lifescience Database Archive (English)

    Full Text Available icea... 46 0.001 tr|Q38JD0|Q38JD0_PINTA Temperature-induced lipocalin OS=Pinus ta... 45 0.001 tr|Q38JE2|Q38JE2_SORBI Temperature...-induced lipocalin-2 OS=Sorghu... 45 0.002 tr|Q38JD4|Q38JD4_SOLLC Temperature...-induced lipocalin OS=Solanum ... 44 0.003 tr|Q38JC7|Q38JC7_SOLTU Temperature-induced lipoca...lin OS=Solanum ... 44 0.003 tr|Q8S9H0|Q8S9H0_WHEAT Temperature stress-induced lipocalin OS=T... 44 0.004 tr|Q38JB1|Q38JB1_TORRU Tempe...rature-induced lipocalin OS=Tortula ... 44 0.005 tr|Q38JE7|Q38JE7_MAIZE Temperatu

  9. Grabados Rupestres de Carros y Ruedas en Vegas de Coria (Cáceres

    Directory of Open Access Journals (Sweden)

    María Carmen SEVILLANO SAN JOSÉ

    2009-10-01

    Full Text Available Presentamos un nuevo petroglifo inédito aparecido en la localidad de Vegas de Coria en la provincia de Cáceres. Interesada en el tema de estas piedras con grabados, y siguiendo las indicaciones de mis compañeros Fernando Alonso y Javier Fortea, que habían visto personalmente este nuevo petroglifo, nos presentamos en la localidad de Vegas de Coria acompañada del primero de ellos. Al llegar al citado pueblo, los naturales dieron muestras enseguida de conocer el petroglifo, que ellos denominan «la piedra pinta». Nos lo describieron diciendo que tenía soles y estrellas pintados y que muchas veces se habían sentado encima de él.

  10. Productivity of semi-domesticated reindeer in Finland

    Directory of Open Access Journals (Sweden)

    Ilpo Kojola

    1991-10-01

    Full Text Available In spite of a twofold increase in the density of reindeer in Finland from 1974 to 1987, meat production per reindeer increased during this period. This was possible due to calf harvesting and supplemental feeding. Results from multiple regression models indicated that calf harvesting influenced both per unit area and per capita production more than supplemental feeding. Correlation between meat production and animal density decreased with increased supplemental feeding. Traditionally, southern and central herds of reindeer fed mainly on arboreal lichens in late winter; however, due to large-scale logging, woodlands rich of arboreal lichens had been greatly reduced. Economic carrying capacity of the winter range apparently has been exceeded in the south; a heavy crash in the number of reindeer is likely if supplemental feeding ceases. In northern herds, intensive calf harvesting enabled satisfactory yield without supplemental feeding. In northern herds, yield increased mainly per unit area (i.e. by increases in herd size; in the south yield per reindeer increased.Lithantuotantoon vaikuttavat tekijat Suomen poron-hoidossa.Abstract in Finnish / Tiivistelmd: Huolimatta Suomessa vuosien 1974 ja 1987 valilla tapahtuneesta porotiheyden kaksinkertaistumisesta, lihantuotto poroa kohti kasvoi jakson aikana. Tama johtui oletettavasti vasateurastuksesta ja lisaruokinnasta. Monimu-uttujaregressiomallien tulosten perusteella vasateurastuksella nayttaisi olevan lisaruokintaa suurempi vaikutus seka poroa etta pinta-alaa kohti laskettuun tuottoon. Ruokinnan tehostuessa pienentyi lihantuoton ja porotiheyden valinen riippuvuus. Etelaosan ja keskiosan porot syovat perinteisesti puussa kasvavia jakalia kevattalvella. Hakkuista johtuen luppometsien osuus on suuresti vahentynyt. Talvilaidunten ekonomien kantokyky on ilmeisesti ylitetty etela- ja keski-osassa; syva romahdus poromaarissa on todennakoista, jos ruokinta lopetettaisiin. Pohjoisosassa voima-perainen vasate

  11. Marcação individual de triatomíneos para estudos comportamentais e ecologicos Individual marking of tiratominea for behavioral and ecological studies

    Directory of Open Access Journals (Sweden)

    José Roberto Mac Cord

    1983-12-01

    Full Text Available Idealizou-se uma técnica de marcação de insetos adultos, visando principalmente à identificação individual de triatomineos, que consiste na elaboração de códigos correspondentes a números, através de cinco cores basicas (vermelho, branco, azul, verde e amarelo representadas por pintas coloridas feitas com tinta esmalte e depositadas do pronoto ao escutelo do inseto manualmente, com um fino pincel de seda. As pintas não devem se estender às asas sobrepostas, porque estas mudam constantemente de posição, encobrindo assim a marcação. A tinta é indelével e, por não apresentar toxicidade, não afeta a longevidade e o comportamento dos insetos. A técnica pode ser utilizada tanto para insetos no laboratório quanto no campo principalmente em trabalhos relacionados à Ecologia e ao Comportamento.A technique for marking adult insects was worked out, aiming at the individual identification of triatomine bugs. It consists on the development of codes corresponding to numbers (units, tens and hundreds by means of five basic colours (red, white, blue, green and yellow, represented by colored spots hand-made with enamel paint from the pronotum to the scutellum of the insect, with a fine silk paint-brush. The spots should not reach the overlapped wings, for these often change position, therefore covering the marks. Being the paint indelible and nontoxic, the life-span and the behaviour of the bugs is not affected. The technique may be applied to insects in the laboratory as well as in the field, specially in studies related to Ecology and Behaviour.

  12. A new species of Pimelodus LaCépède, 1803 (Siluriformes: Pimelodidae from the rio São Francisco drainage, Brazil

    Directory of Open Access Journals (Sweden)

    Frank Raynner V. Ribeiro

    2006-12-01

    Full Text Available Pimelodus pohli, new species, is described from the rio São Francisco drainage. It differs from congeners by the following characters in combination: adults with dark spots on anterodorsal region of body and young specimens (up to 100 mm SL with three rows of dark spots laterally on body; comparatively long adipose fin, more than one third of the distance between posterior end of dorsal fin base and the vertical through posterior end of anal-fin base (21.8-26.2% SL; lips poorly developed; 20-25 gill rakers; and maxillary barbels slightly surpassing the caudal-fin base. A key to the species of Pimelodus of the rio São Francisco drainage is presented.Pimelodus pohli, nova espécie, é descrita da bacia do rio São Francisco. Difere de suas congêneres pela seguinte combinação de caracteres: presença, em exemplares adultos, de pintas escuras na região ântero-lateral do corpo e, em exemplares jovens, de três fileiras de pintas nos lados do corpo (até 100 mm CP; nadadeira adiposa comparativamente longa, ocupando mais de um terço da distância entre o fim da base da nadadeira dorsal e a vertical que passa pelo fim da base da nadadeira anal (21,8-26,2% CP; lábios não desenvolvidos; 20 a 25 rastros branquiais e barbilhões maxilares indo pouco além da base da nadadeira caudal. Uma chave para as espécies de Pimelodus da bacia do rio São Francisco é apresentada.

  13. Disease Gene Prioritization Using Network and Feature

    Science.gov (United States)

    Agam, Gady; Balasubramanian, Sandhya; Xu, Jinbo; Gilliam, T. Conrad; Maltsev, Natalia; Börnigen, Daniela

    2015-01-01

    Abstract Identifying high-confidence candidate genes that are causative for disease phenotypes, from the large lists of variations produced by high-throughput genomics, can be both time-consuming and costly. The development of novel computational approaches, utilizing existing biological knowledge for the prioritization of such candidate genes, can improve the efficiency and accuracy of the biomedical data analysis. It can also reduce the cost of such studies by avoiding experimental validations of irrelevant candidates. In this study, we address this challenge by proposing a novel gene prioritization approach that ranks promising candidate genes that are likely to be involved in a disease or phenotype under study. This algorithm is based on the modified conditional random field (CRF) model that simultaneously makes use of both gene annotations and gene interactions, while preserving their original representation. We validated our approach on two independent disease benchmark studies by ranking candidate genes using network and feature information. Our results showed both high area under the curve (AUC) value (0.86), and more importantly high partial AUC (pAUC) value (0.1296), and revealed higher accuracy and precision at the top predictions as compared with other well-performed gene prioritization tools, such as Endeavour (AUC-0.82, pAUC-0.083) and PINTA (AUC-0.76, pAUC-0.066). We were able to detect more target genes (9/18/19/27) on top positions (1/5/10/20) compared to Endeavour (3/11/14/23) and PINTA (6/10/13/18). To demonstrate its usability, we applied our method to a case study for the prediction of molecular mechanisms contributing to intellectual disability and autism. Our approach was able to correctly recover genes related to both disorders and provide suggestions for possible additional candidates based on their rankings and functional annotations. PMID:25844670

  14. Crustacean peptidergic neurons in culture show immediate outgrowth in simple medium.

    Science.gov (United States)

    Cooke, I; Graf, R; Grau, S; Haylett, B; Meyers, D; Ruben, P

    1989-01-01

    The survival and outgrowth of neurons in culture has usually required conditioning factors. We now report that crustacean neurons, taken from the peptidergic neurosecretory system of the eyestalk of crabs (Cardisoma carnifex) and lobsters (Panulirus marginatus), show immediate outgrowth, sustained for a week or more, in defined medium as simple as physiological saline with glucose and glutamine. The neurons show peptide hormone immunoreactivity that is prominent at growth cones, exhibit differences in form correlated with their immunoreactivity, release peptides to the medium, and have voltage-dependent currents, including a well-sustained Ca current. Cd blocks secretion, growth, and the Ca current. Peptidergic secretory neurons may be able to utilize existing membrane from their store of granules and already active synthetic, transport, and secretory mechanisms for immediate outgrowth.

  15. Milky hemolymph syndrome (MHS) in spiny lobsters, penaeid shrimp and crabs.

    Science.gov (United States)

    Nunan, Linda M; Poulos, Bonnie T; Navarro, Solangel; Redman, Rita M; Lightner, Donald V

    2010-09-02

    Black tiger shrimp Penaeus monodon, European shore crab Carcinus maenas and spiny lobster Panulirus spp. can be affected by milky hemolymph syndrome (MHS). Four rickettsia-like bacteria (RLB) isolates of MHS originating from 5 geographical areas have been identified to date. The histopathology of the disease was characterized and a multiplex PCR assay was developed for detection of the 4 bacterial isolates. The 16S rRNA gene and 16-23S rRNA intergenic spacer region (ISR) were used to examine the phylogeny of the MHS isolates. Although the pathology of this disease appears similar in the various different hosts, sequencing and examination of the phylogenetic relationships reveal 4 distinct RLB involved in the infection process.

  16. Evaluación del impacto ambiental de la elaboración de dos productos alimenticios en Cuba usando la herramienta Análisis de Ciclo de Vida (ACV - Environmental assessment of the production of two alimentary products in Cuba, by using the Life Cycle Assessment (LCA as a tool

    Directory of Open Access Journals (Sweden)

    Cruz-Núñez, Giselle

    2009-04-01

    Full Text Available ResumenEl Análisis del Ciclo de Vida (ACV es un método para analizar yevaluar los efectos y cargas ambientales causados por un producto, proceso o actividad durante su ciclo de vida completo “de la cuna a la tumba”, constituye una herramienta integral orientada hacia el producto y analiza las consecuencias potenciales que el mismo pueda causar para el medio ambiente a lo largo de su ciclo de vida. En el trabajo se realiza el ACV a dos productos elaborados a partir de la Langosta espinosa Panulirus argus en Cuba: LEPC (Langosta Entera Precocinada Congelada y LCCC (Langosta Cola Cruda Congelada mediante la metodología sugerida por la SETAC (Society ofEnvironmental Toxicology and Chemistry, 1991. Se realiza un análisis de costo/beneficio durante el ciclo de vida de ambos productos. Se determinan los volúmenes de desechos y subproductos generados y se proponen nuevas alternativas de reutilización para los mismos.SummaryThe Life Cycle Assessment (LCA is a method to analyze andassess the impact and environmental burdens caused by a product, process or activity during their whole life cycle "from cradle to grave". It is an integral tool oriented to the product and analyzes the potential consequences it might cause to the environment throughout their life cycle. The work includes the LCA of two products made from the Cuban spiny lobster Panulirus argus inCuba: WFPL (Whole Frozen Pre-cooked Lobster and RFLT (Raw FrozenLobster Tail through the methodology suggested by the SETAC (Society of Environmental Toxicology and Chemistry, 1991. A cost / benefit analysis is carried out during the life cycle of both products. The volumes of waste and by-products generated were determined and new alternatives for reuse them are suggested.

  17. Morphology, Quantity and Distribution of Gustatory Hairs in Spiders%一些蜘蛛类群味觉毛的形态、数量和分布

    Institute of Scientific and Technical Information of China (English)

    肖永红; 李枢强

    2012-01-01

    化学通讯是蜘蛛最基础和最普遍的种内及种间通讯方式之一,蜘蛛体表的味觉毛能够接触性地或者近距离地感知环境中的化学物质,但味觉毛的相关研究仅在少数几种蜘蛛中有过报道.我们通过扫描电镜分别对幽灵蛛科( Pholcidae)、弱蛛科(Leptonetidae)、泰莱蛛科(Telemidae)、蟹蛛科(Thomisidae)和球蛛科(Theridiidae)共5科32种蜘蛛味觉毛的形态、数量及分布进行了观察.结果显示:蜘蛛味觉毛一般呈“S”形或弧形;毛根部与体表形成较大角度,末端开口.一般分布在步足的跗节和后跗节,一些种类在步足胫节亦有味觉毛分布.所观察的蜘蛛中绝大部分种类在触肢上未发现味觉毛,仅有2种蟹蛛即角红蟹蛛(Thomisus labefactus)和膨胀微蟹蛛(Lysiteles inflatus)以及1种球蛛即鼬形微姬蛛(Phycosoma mustelinum)在触肢上有味觉毛.味觉毛的数量在不同蜘蛛种类中有较大差异,从十几根到上百根不等.蜘蛛味觉毛的形态、数量和分布等特征除了与遗传相关外,亦有可能与其生境和生活方式等有关.%Chemical communication is a basic and universal intra- and inter-specific communication in spiders. Gustatory hairs are chemoreceptors detecting chemicals from the environment by contacting or close-range olfactory. Up till now, few studies compared chemoreceptors among spiders. Here we studied morphology, quantity and distribution of gustatory hairs in 32 spider species from Pholcidae, Leptonetidae, Telemidae, Thomisidae, Theridiidae by scanning electronic microscopy (SEM). The typical features of spider gustatory hairs are in "S" or arc shape with open end, and they emerge from the cuticle at a great angle. Spider gustatory hairs usually locate on tarsi and metatarsi of their legs, while some studied species have gustatory hairs on tibia. Except for 3 spider species, Thomisus labefactus and Lysiteles inflatus from Thomisidae and Phycosoma mustelinum from

  18. Influência do sistema de condução do tomateiro sobre a incidência de doenças e insetos-praga Influence of the training systems of tomato plants on the incidence of diseases and insect-pests

    Directory of Open Access Journals (Sweden)

    Anderson Fernando Wamser

    2008-06-01

    Full Text Available Avaliou-se o efeito dos métodos de tutoramento e de condução de plantas de tomate sobre a severidade de doenças foliares e sobre a incidência de pragas em frutos em diferentes cultivares. Dois experimentos foram realizados em 2004/2005 e 2005/2006 em Caçador, SC. Os tratamentos consistiram da combinação de duas cultivares (Carmen e Débora Max, em 2004/2005, e Nemo Netta e San Vito, em 2005/2006; quatro métodos de tutoramento (cruzado, 'mexicano', vertical com bambu e vertical com fitilho e dois métodos de condução de plantas (com uma e duas hastes por planta mantendo o mesmo número de hastes por área em parcelas sub-subdivididas. Foram avaliadas as severidades de requeima, pinta-preta e mancha bacteriana nas folhas e a porcentagem de frutos com danos causados por doenças fisiológicas ou fitopatológicas e por brocas. Os métodos de tutoramento vertical proporcionaram menor severidade de requeima, pinta-preta e mancha bacteriana nas folhas e ataque de brocas nos frutos, em relação ao método de tutoramento cruzado. A severidade de doenças foliares e porcentagem de frutos com ataque de brocas não diferiram entre métodos de condução de plantas.The effect of different methods of staking and training tomato plants was investigated to determine the severity of leaf damage and the incidence of pests in fruits of different cultivars. Two experiments were carried out in 2004/2005 and 2005/2006, in Caçador, Santa Catarina State, Brazil. The treatments consisted of the combination of two cultivars, Carmen and Débora Max, in 2004/2005, and Nemo Netta and San Vito, in 2005/2006; four staking methods, crossed fence, 'Mexican', vertical staking with bamboo and vertical staking with polypropylene cord; and two training methods, one and two stems per plant keeping the same number of stems per area. Severities of late blight, early blight and bacterial spot in leaves and the percentage of fruits with physiological and phytopathological

  19. Trascendiendo al yo ensimismado. La ética de la atención de Iris Murdoch

    Directory of Open Access Journals (Sweden)

    Cuartango, Román

    2006-12-01

    Full Text Available Many of moral dilemmas would lose its intensity, thinks Iris Murdoch, if we left the confused idea of a sovereign will that chooses independently its courses of action. Paying attention to what constitutes the reality enables a sort of asceticism of the experience, that leads beyond the deliriums of an I absorbed. The exercise of estimating the details, the connections, the complexity, modifies the decision itself: it does not be a matter of electing, but of “seeing” the moral thing -the demand of the thing-, the same as an exact artist does not paint what “he likes” but “what it is there”.

    Muchos de los dilemas morales perderían su intensidad, piensa Iris Murdoch, si abandonáramos la idea de una voluntad soberana que elige autónomamente sus cursos de acción. Prestar atención a la constitución de la realidad posibilita una suerte de ascesis experiencial que conduce más allá del los devaneos de un yo ensimismado. El ejercicio de apreciación de los detalles, de las conexiones, de la complejidad, modifica la decisión misma: no se trata de elegir, sino de “ver” lo moral –la exigencia de la cosa–, igual que un artista cabal no pinta lo que “le gusta” sino “lo que está ahí”.

  20. Cryptic differentiation in the endemic micromoth Galagete darwini (Lepidoptera, Autostichidae) on Galápagos volcanoes.

    Science.gov (United States)

    Schmitz, Patrick; Cibois, Alice; Landry, Bernard

    2008-10-27

    To gain insight into the early stages of speciation, we reconstructed a DNA-based phylogeny, using combined mitochondrial (cytochrome c oxidase subunits I and II: 1008 bp) and nuclear (elongation factor 1-alpha and wingless: 1062 bp) markers of populations of the moth Galagete darwini endemic to the Galápagos, which belongs to an insular radiation similar in size to that of Darwin's finches. Adults of G. darwini were collected in the arid lowlands of 11 of the Galápagos Islands (Baltra, Española, Fernandina, Floreana, Isabela, Pinta, Pinzón, San Cristobal, Santa Cruz, Santiago and Seymour) and the humid highlands of a subset of 5 of them (Fernandina, Floreana, Isabela, Santa Cruz and Santiago). The combined phylogeographic analysis surprisingly revealed that G. darwini populations at higher elevation on the western islands (Fernandina, Isabela and Santiago) represent a distinct lineage from the one in the low arid zones of these same islands. This is the first reported case in the archipelago of genetic cryptic differentiation correlated with elevation on the western Galápagos volcanoes.

  1. ‘URSBRS HADA’: TANGOREIRO DE MATURAÇÃO TARDIA E DUPLO PROPÓSITO

    Directory of Open Access Journals (Sweden)

    MATEUS PEREIRA GONZATTO

    2015-06-01

    Full Text Available O presente trabalho tem como objetivo apresentar a caracterização hortícola básica da nova cultivar de tangoreiro ‘URSBRS Hada’. A partir de avaliações nas condições edafoclimáticas da região da Depressão Central do Rio Grande do Sul, a cultivar demonstra maturação tardia (outubro a dezembro e duplo propósito de uso dos frutos (consumo in natura e produção de suco, além de apresentar-se tolerante, em condições de campo, a doenças, como: cancro-cítrico, pinta-preta e mancha-marrom de alternária. Seus frutos possuem formato achatado, coloração de amarelada a amarelo-alaranjada e são bastante sucosos, com alto teor de sólidos solúveis (SS e elevada acidez (AT . Além disso, trata-se de cultivar bastante produtiva, podendo produzir 20-25 t ha-1 por ano. Em síntese, o tangoreiro ‘URSBRS Hada’ é mais uma opção varietal para a citricultura.

  2. On the origin of the treponematoses: a phylogenetic approach.

    Directory of Open Access Journals (Sweden)

    Kristin N Harper

    Full Text Available BACKGROUND: Since the first recorded epidemic of syphilis in 1495, controversy has surrounded the origins of the bacterium Treponema pallidum subsp. pallidum and its relationship to the pathogens responsible for the other treponemal diseases: yaws, endemic syphilis, and pinta. Some researchers have argued that the syphilis-causing bacterium, or its progenitor, was brought from the New World to Europe by Christopher Columbus and his men, while others maintain that the treponematoses, including syphilis, have a much longer history on the European continent. METHODOLOGY/PRINCIPAL FINDINGS: We applied phylogenetics to this problem, using data from 21 genetic regions examined in 26 geographically disparate strains of pathogenic Treponema. Of all the strains examined, the venereal syphilis-causing strains originated most recently and were more closely related to yaws-causing strains from South America than to other non-venereal strains. Old World yaws-causing strains occupied a basal position on the tree, indicating that they arose first in human history, and a simian strain of T. pallidum was found to be indistinguishable from them. CONCLUSIONS/SIGNIFICANCE: Our results lend support to the Columbian theory of syphilis's origin while suggesting that the non-sexually transmitted subspecies arose earlier in the Old World. This study represents the first attempt to address the problem of the origin of syphilis using molecular genetics, as well as the first source of information regarding the genetic make-up of non-venereal strains from the Western hemisphere.

  3. PERANAN KOMPETENSI INTI DALAM MERGER DAN AKUISISI

    Directory of Open Access Journals (Sweden)

    Dwi Sulistiani

    2013-11-01

    Full Text Available Dalam era globalisasi dan pedagangan  bebas dewasa ini strategi merger dan akuisisi  merupakan fenomena yang semakin marak dilakukan oleh para pelaku bisnis dan  semakin menarik untuk dicermati bersama. Untuk menjalankan perusahaan para manajemen perusahaan selalu dituntut menjaga pertumbuhan usahanya secara optimal. Penerapan strategi merger dan akuisisi merupakan jalan pintas untuk mewujudkan pertumbuhan usaha tanpa perusahaan perlu memulai dari awal suatu jenis usaha yang baru. Dalam suatu kondisi perusahaan yang kuat cenderung membeli perusahaan lain untuk meningkatkan daya saing dan penghematan biaya. Perusahaan yang terlibat dalam merger dan akuisisi akan dapat diperoleh pangsa pasar yang lebih besar dan efisiensi terhadap biaya. Perusahaan yang merasa tidak dapat bertahan hidup secara individual biasanya merelakan diri untuk menjadi target akuisisi. Merger dan akuisisi merupakan suatu realitas dan tantangan yang harus siap dihadapi oleh para pelaku usaha dalam era perdagangan bebas saat ini. Namun tingkat kesuksesan dalam melakukan kegiatan merger dan akuisisi juga sangat dipengaruhi oleh kondisi internal perusahaan meliputi sumber daya, kapabilitas dan kompetensi inti yang dimiliki oleh perusahaan. Tulisan ini akan mencoba memberikan pemahaman bahwa sumber daya, kapabilitas dan  kompetensi inti merupakan faktor penting dalam melakukan kegiatan penggabungan usaha yang pada akhirnya dapat menentukan tingkat keberhasilan proses merger dan akuisisi yang sedang dijalankan oleh perusahaan

  4. How Far into Europe Did Pikas (Lagomorpha: Ochotonidae) Go during the Pleistocene? New Evidence from Central Iberia

    Science.gov (United States)

    Laplana, César; Sevilla, Paloma; Arsuaga, Juan Luis; Arriaza, Mari Carmen; Baquedano, Enrique; Pérez-González, Alfredo

    2015-01-01

    This paper reports the first find of pika remains in the Iberian Peninsula, at a site in central Spain. A fragmented mandible of Ochotona cf. pusilla was unearthed from Layer 3 (deposited some 63.4±5.5 ka ago as determined by thermoluminescence) of the Buena Pinta Cave. This record establishes new limits for the genus geographic distribution during the Pleistocene, shifting the previous edge of its known range southwest by some 500 km. It also supports the idea that, even though Europe’s alpine mountain ranges represented a barrier that prevented the dispersal into the south to this and other taxa of small mammals from central and eastern Europe, they were crossed or circumvented at the coldest time intervals of the end of the Middle Pleistocene and of the Late Pleistocene. During those periods both the reduction of the forest cover and the emersion of large areas of the continental shelf due to the drop of the sea level probably provided these species a way to surpass this barrier. The pika mandible was found accompanying the remains of other small mammals adapted to cold climates, indicating the presence of steppe environments in central Iberia during the Late Pleistocene. PMID:26535576

  5. The European-American exchange.

    Science.gov (United States)

    Guerra, F

    1993-01-01

    The European-American exchange of infectious diseases was responsible for the demographic havoc of the native population in the New World after 1492. Prior to this date medical writers describe the presence in Spain of viral diseases like influenza, parotitis, smallpox, measles, poliomyelitis, and rabies; there were also rickettsiasis, diphtheria, salmonellosis, plague, tubercolosis, leprosy, malaria, scabies and tinea. In America, before European arrivals, there were no records of human viral diseases, though there were records of rickettsiasis, treponematosis--pinta, yaws and syphilis--leihsmaniasis, amibiasis and perhaps leprosy. With the discovery of America in 1492, Columbus's sailors were contaminated by yaws and spread this disease into Europe. In 1493 influenza, as a zoonosis, was introduced into Santo Domingo and was responsible for the annihilation of the natives of the Antilles in less than a quarter of a century; in 1518 smallpox was also introduced in Santo Domingo and then to the American continent by negro slaves: by the same means measles were introduced in 1531. The previous existence or introduction of other infectious diseases in America is also discussed.

  6. Growth rates and morphological measurements of Porcupine caribou calves

    Directory of Open Access Journals (Sweden)

    Katherine L. Parker

    1989-06-01

    Full Text Available Body weights, leg lengths, and surface area were monitored for bottle-raised barren-ground caribou calves (Rangifer tarandus granti from the Porcupine herd up to 1 year of age. Body weights were compared with maternally-raised calves from the same cohort in the wild and from the Delta herd. A successful feeding regime for bottle-raising caribou calves is presented.Veksthastigheter og morfologiske mål hos Porcupine karibu-kalver.Abstract in Norwegian / Sammendrag: Kroppsvekter, visse knokkel-lengder og kropps-overflate areal ble målt hos flaske-oppfødde kalver av barren-ground karibu (Rangifer tarandus granti fra Porcupine-stammen opp til 1 års alder. Kroppsvekter ble sammelignet med normalt oppfødde kalver av samme type i det fri og fra Delta-stam-men. Det presenteres et vellykket system for flaske-oppforing av karibu-kalver.Porcupine-lauman karibuvasojen kasvunopeus ja morfologiset mitat.Abstract in Finnish / Yhteenveto: Porcupine -lauman pulloruokinnalla olleiden tundrakaribuvasojen ruumiinpainot, jalanpituu-det ja ruumiin pinta-alat mitattiin 1 vuoden ikäään saakka. Ruumiinpainoja verrattiin vastaaviin luonnon-oloissa kasvaneisiin saman lauman ja Delta -lauman vasoihin. Tutkimus kuvaa toimivan vasojen pulloruo-kintamenetelmän.

  7. Céu como pintura? Sobre o emprego de διαζωγράφω no passo 55c do Timeu de Platão

    Directory of Open Access Journals (Sweden)

    Lethicia Ouro Oliveira

    2015-04-01

    Full Text Available No mito cosmogônico do diálogo Timeu de Platão, o personagem homônimo narra como um deus artesão confecciona o universo. Dentre outras artes empregadas, o artesão do mundo utiliza-se da pictórica. Platão emprega o verbo διαζωγράφω, que pode significar tanto “configurar” quanto “pintar”, quando fala da formação do céu. O artesão do mundo o configura na forma de um poliedro regular, o dodecaedro, e pinta nele as constelações. Em nosso texto buscaremos primeiramente esclarecer o sentido geral desta “configuração pictórica”. O que Platão quer dizer nesta passagem do mito? Buscando tal esclarecimento, teremos o embasamento para pesquisar por que quando trata da formação das constelações, do céu, ele usa a imagem da pintura, objetivo central desta investigação. Por meio da análise de algumas hipóteses interpretativas, indicaremos direcionamentos de leitura que transparecem seu pensamento sobre o caráter da μίμησις pictórica e, além disso, de sua própria cosmologia.

  8. Do delirante ao ficcional: um estudo sobre a situação psicanalítica em um caso de paranóia

    Directory of Open Access Journals (Sweden)

    Joyce Marly Gonçalves Freire

    Full Text Available Este ensaio é um estudo psicanalítico a respeito de Lia, paranóica, artista em tempo integral, que, ao tecer suas estórias, viu a linha que separa a ficção da realidade ser esfumaçada em seu ato de escrita. Escritora de romances e poesias, Lia também pinta sobre quaisquer suportes que se lhe apresentam. Consideraremos que sua paranóia não pode ser separada de sua produção literária e gráfica, pois elas estão entranhadas umas nas outras. Assim, o tratamento psicanalítico realizado com essa paciente decorreu precisamente daquilo que constitui sua paranóia: sua produção escrita e artística. No desenrolar da situação analítica sua escrita é transformada pela leitura de um outro fora dela e, nesse nicho, Lia pôde construir uma forma diferente de subjetivação.

  9. Visualization and volumetric structures from MR images of the brain

    Energy Technology Data Exchange (ETDEWEB)

    Parvin, B.; Johnston, W.; Robertson, D.

    1994-03-01

    Pinta is a system for segmentation and visualization of anatomical structures obtained from serial sections reconstructed from magnetic resonance imaging. The system approaches the segmentation problem by assigning each volumetric region to an anatomical structure. This is accomplished by satisfying constraints at the pixel level, slice level, and volumetric level. Each slice is represented by an attributed graph, where nodes correspond to regions and links correspond to the relations between regions. These regions are obtained by grouping pixels based on similarity and proximity. The slice level attributed graphs are then coerced to form a volumetric attributed graph, where volumetric consistency can be verified. The main novelty of our approach is in the use of the volumetric graph to ensure consistency from symbolic representations obtained from individual slices. In this fashion, the system allows errors to be made at the slice level, yet removes them when the volumetric consistency cannot be verified. Once the segmentation is complete, the 3D surfaces of the brain can be constructed and visualized.

  10. COMPOSIÇÃO CENTESIMAL E DE MINERAIS DE MARISCOS CRUS E COZIDOS DA CIDADE DE NATAL/RN CENTESIMAL AND MINERAL COMPOSITION OF THE RAW AND COOKED SHELLFISHES OF THE NATAL-RN CITY

    Directory of Open Access Journals (Sweden)

    Lucia de Fátima Campos PEDROSA

    2001-08-01

    Full Text Available Este estudo teve como objetivo analisar a composição centesimal e os teores de zinco, cobre e ferro de cinco tipos de mariscos crus e cozidos: Camarão (Penaeus brasiliensis, Caranguejo (Ucides cordatus, Lagosta (Panulirus argus, Ostra (Crassostrea rhizophorae e Mexilhão (Anomalocardia brasiliana, crus e cozidos, provenientes da cidade de Natal/RN. As amostras da parte comestível de cada alimento foram adquiridas em peixaria do cais do porto. Os mariscos foram considerados fontes expressivas de proteínas e minerais, enquanto as quantidades de lipídeos e calorias foram baixas. Observou-se na maioria das amostras teores de proteínas e de cinzas aumentados após a cocção. A concentração de zinco foi variada, apresentando-se a ostra como a maior fonte dentre as espécies estudadas. Os maiores teores de ferro e cobre foram verificados no mexilhão e na ostra. A cocção provocou perdas de 50% de cobre no mexilhão e praticamente não alterou as concentrações do referido nutriente no caranguejo. Esperamos que estes resultados contribuam para bancos de dados que auxiliarão na melhor estimativa de consumo de nutrientes em inquéritos dietéticos.The aim of this study was to analyse the centesimal composition as well as zinc, copper and iron contents of the five species from raw and cooked shellfishes: shrimp (Penaeus brasiliensis, crab (Ucides cordatus, lobster (Panulirus argus, oyster (Crassostrea rhizophorae and mussel (Anomalocardia brasiliana. The edible samples were collected in the fish market of the Natal city. Shellfishes were considered an expressive source of the proteins and minerals, while quantities of lipids and calories were low. After the cooking process protein and ash concentration increased in most of shellfishes. Zinc analysis showed variable concentration in the species. Oyster was the food with the highest zinc values. Mussel was considered the best source of iron and copper but around 50% of the copper detected was

  11. 不同饵料对波纹龙虾生长影响的研究%Effect of Different Food Resources on the Growth Rate of Lobster

    Institute of Scientific and Technical Information of China (English)

    沈铭辉; 符芳霞; 范薇

    2011-01-01

    Different sources of food were used to raise lobster Panulirus homarus,and different growth rate were studied.Ten experimental groups were carried out.There were five lobsters in each group and each lobster was separated by a plastic cage.Ten experimental groups were set as following: four groups of single resource of food,e.g.mixed fish,mixed shrimps,mixed crabs and mixed mollusk.Six groups of mixture food resource,e.g.mixture of fish and shrimps,mixture of fish and crabs,mixture of fish and mollusk,mixture of shrimps and crabs,mixture of shrimps and mollusk,mixture of crabs and mollusk.Feeding scalar was decided by the taken up rate of the day before feeding.Weight and length were measured every 15 days.The results indicated that mixture of food resource had higher growth rate than single food resource.Within the single food resource experiments,mollusk had the top growth rate,and crabs,shrimps,fish in decline gradient.Within mixed food resource experiments,mixture of shrimp and crab had the best feeding effect.Considering with food price and resource stability,we concluded that lobster fed with mixture of crabs and fish would have the largest benefits.%运用比较饲养法研究不同饵料对波纹龙虾(Panulirus homarus)生长的影响,试验设投喂杂鱼、杂虾、杂蟹、杂贝四个单一饵料组和混合投喂杂鱼+杂虾、杂鱼+杂蟹、杂鱼+杂贝、杂虾+杂蟹、杂虾+杂贝、杂蟹+杂贝6个混合饵料组。结果表明,混合投喂的效果好于单一投喂效果。单一投喂的饵料中杂贝、杂蟹的效果较好,其次是杂虾,杂鱼的效果最差;混合投喂的饵料组合中杂虾+杂蟹的投喂效果最好。结合饵料获得的难易程度、价格高低等因素,笔者认为投喂杂蟹+杂鱼的投入产出比最佳。

  12. Cell Wall Assembly in Fucus Zygotes

    Science.gov (United States)

    Quatrano, Ralph S.; Stevens, Patricia T.

    1976-01-01

    Fertilization triggers the assembly of a cell wall around the egg cell of three brown algae, Fucus vesiculosus, F. distichus, and F. inflatus. New polysaccharide polymers are continually being added to the cell wall during the first 24 hours of synchronous embryo development. This wall assembly involves the extracellular deposition of fibrillar material by cytoplasmic vesicles fusing with the plasma membrane. One hour after fertilization a fragmented wall can be isolated free of cytoplasm and contains equal amounts of cellulose and alginic acid with no fucose-containing polymers (fucans) present. Birefringence of the wall caused by oriented cellulose microfibrils is not detected in all zygotes until 4 hours, at which time intact cell walls can be isolated that retain the shape of the zygote. These walls have a relatively low ratio of fucose to xylose and little sulfate when compared to walls from older embryos. When extracts of walls from 4-hour zygotes are subjected to cellulose acetate electrophoresis at pH 7, a single fucan (F1) can be detected. By 12 hours, purified cell walls are composed of fucans containing a relatively high ratio of fucose to xylose and high levels of sulfate, and contain a second fucan (F2) which is electrophoretically distinct from F1. F2 appears to be deposited in only a localized region of the wall, that which elongates to form the rhizoid cell. Throughout wall assembly, the polyuronide block co-polymer alginic acid did not significantly vary its mannuronic (M) to guluronic (G) acid ratio (0.33-0.55) or its block distribution (MG, 54%; GG, 30%; MM, 16%). From 6 to 24 hours of embryo development, the proportion of the major polysaccharide components found in purified walls is stable. Alginic acid is the major polymer and comprises about 60% of the total wall, while cellulose and the fucans each make-up about 20% of the remainder. During the extracellular assembly of this wall, the intracellular levels of the storage glucan laminaran

  13. LATE CARNIAN-EARLY NORIAN AMMONOIDS FROM THE GSSP CANDIDATE SECTION PIZZO MONDELLO (SICANI MOUNTAINS, SICILY

    Directory of Open Access Journals (Sweden)

    MARCO BALINI

    2012-03-01

    Full Text Available A small collection of ammonoids from the Upper Triassic Scillato Formation at Pizzo Mondello (Agrigento, Sicily is studied. The specimens were collected in a framework of a project aimed at providing an integrated high-resolution bio-chronostratigraphic support to the Upper Carnian-Norian magnetostratigraphic scale defined at this site, that is located in an historical area from which G.G. Gemmellaro collected the Upper Triassic of ammonoids monographed at the beginning of the XX century. The specimens from Pizzo Mondello were bed-by-bed sampled and represent the first collection of Upper Triassic ammonoids described from Sicily since Gemmellaro time. Quite several levels of the Pizzo Mondello section yielded ammonoids, but very few levels have provided more than one specimen. Due to the scarcity of specimens the taxonomic analysis has been complex because Gemmellaro, who described 166 new species, did not explain the variability of many of his taxa. Sixsteen taxa belonging to eleven genera are described. They include Placites sp. ind., Discotropites plinii (Mojsisovics, Anatropites sp., Microtropites cf. paronai, Metathisbites cf. affinis, Hyattites aff. praefloridus, Projuvavites boehmi (Gemmellaro, Projuvavites inflatus (Gemmellaro, Gonionotites cf. italicus, Gonionotites aff. recuperoi, Dimorphites noricus n. sp., Dimorphites selectus Mojsisovics, Dimorphites sp., Pregriesbachites n. gen. , P. bukowskii (Gemmellaro, Discophyllites insignis. Among the new taxa, Dimorphites noricus n. sp. formalizes the nomen nudum “Dimorphites n. sp. 1” quoted in literature for several years, that is index of the lowest subzone of the Norian stage.The small collection document the Discotropites plinii and Gonionotites italicus subzones of the uppermost Carnian Spinosus Zone and the Dimorphites noricus and D. selectus subzones of the Jandianus Zone, the first zone of the Lower Norian. This chronostratigraphic classification firmly tie the Pizzo Mondello

  14. Biophysical connectivity explains population genetic structure in a highly dispersive marine species

    Science.gov (United States)

    Truelove, Nathan K.; Kough, Andrew S.; Behringer, Donald C.; Paris, Claire B.; Box, Stephen J.; Preziosi, Richard F.; Butler, Mark J.

    2017-03-01

    Connectivity, the exchange of individuals among locations, is a fundamental ecological process that explains how otherwise disparate populations interact. For most marine organisms, dispersal occurs primarily during a pelagic larval phase that connects populations. We paired population structure from comprehensive genetic sampling and biophysical larval transport modeling to describe how spiny lobster ( Panulirus argus) population differentiation is related to biological oceanography. A total of 581 lobsters were genotyped with 11 microsatellites from ten locations around the greater Caribbean. The overall F ST of 0.0016 ( P = 0.005) suggested low yet significant levels of structuring among sites. An isolation by geographic distance model did not explain spatial patterns of genetic differentiation in P. argus ( P = 0.19; Mantel r = 0.18), whereas a biophysical connectivity model provided a significant explanation of population differentiation ( P = 0.04; Mantel r = 0.47). Thus, even for a widely dispersing species, dispersal occurs over a continuum where basin-wide larval retention creates genetic structure. Our study provides a framework for future explorations of wide-scale larval dispersal and marine connectivity by integrating empirical genetic research and probabilistic modeling.

  15. Inter-cohort growth for three tropical resources: tilapia, octopus and lobster.

    Science.gov (United States)

    Velázquez-Abunader, Iván; Gómez-Muñoz, Victor Manuel; Salas, Silvia; Ruiz-Velazco, Javier M J

    2015-09-01

    Growth parameters are an important component for the stock assessment of exploited aquatic species. However, it is often difficult to apply direct methods to estimate growth and to analyse the differences between males and females, particularly in tropical areas. The objective of this study was to analyse the inter-cohort growth of three tropical resources and discuss the possible fisheries management implications. A simple method was used to compare individual growth curves obtained from length frequency distribution analysis, illustrated by case studies of three tropical species from different aquatic environments: tilapia (Oreochromis aureus), red octopus (Octopus maya) and the Caribbean spiny lobster (Panulirus argus). The analysis undertaken compared the size distribution of males and females of a given cohort through modal progression analysis. The technique used proved to be useful for highlighting the differences in growth between females and males of a specific cohort. The potential effect of extrinsic and intrinsic factors on the organism's development as reflected in the size distribution of the cohorts is discussed.

  16. Pacific ciguatoxins in food web components of coral reef systems in the Republic of Kiribati.

    Science.gov (United States)

    Mak, Yim Ling; Wai, Tak-Cheung; Murphy, Margaret B; Chan, Wing Hei; Wu, Jia Jun; Lam, James C W; Chan, Leo L; Lam, Paul K S

    2013-12-17

    Ciguatera fish poisoning (CFP) is a foodborne illness caused by consumption of coral reef fishes contaminated by ciguatoxins (CTXs); of the known CTX congeners, the Pacific ciguatoxins (P-CTXs) are the most toxic. Little is known about the trophodynamics of P-CTXs in coral reef systems. The present study explores the distribution, transfer, and trophic magnification of P-CTX-1, -2, and -3 in coral reef systems with high (ciguatoxic) and low (reference) ciguatoxicity in a CFP-endemic nation by use of liquid chromatography-tandem mass spectrometry (LC-MS/MS). In ciguatoxic coral reef systems, P-CTXs were detected in 54% of herbivorous fishes [total P-CTXs <0.500-1670 pg/g wet weight (ww)], 72% of omnivorous fishes (<0.500-1810 pg/g ww), and 76% of carnivorous fishes (<0.500-69 500 pg/g ww), as well as a lobster ( Panulirus penicillatus ; 2.36 pg/g ww) and an octopus (Octopodidae; 2.56 pg/g ww). The dominant P-CTXs in grazers and piscivorous fishes were P-CTX-2 and -1, respectively. No significant correlation between P-CTX levels and lipid content in three target predatory fishes indicated that accumulation of P-CTXs does not depend on fat content. A weak but significant positive relationship was observed between δ(15)N and P-CTX-1 levels, but further investigation is required to confirm its biomagnification potential.

  17. Antennular projections to the midbrain of the spiny lobster. II. Sensory innervation of the olfactory lobe.

    Science.gov (United States)

    Schmidt, M; Ache, B W

    1992-04-15

    The projection pattern of antennular sensory afferents in the olfactory lobe (OL) of the spiny lobster, Panulirus argus, was examined by backfilling axons in the antennular nerve (AN) with biocytin. Thin, presumptive olfactory afferents from the lateral division of the AN form a tract in the brain that diverges into a dense plexus that completely envelops the glomerular cortex of the OL. Most of the thin (diameter less than or equal to 0.3-1 microns) afferents project to single glomeruli. About 10% of the thin afferents, however, branch in the plexus and project to multiple glomeruli. A smaller number of medium-sized to thick (diameter 2-10 microns), presumably mechanosensory, afferents also innervate the OL and co-project to multiple glomeruli with the thin afferents. Afferents arborize profusely within the columnar glomeruli into very fine processes that penetrate to the base of the columns, but selectively terminate in either the cap/subcap region or in the innermost part of the base of the columns, often with conspicuous terminal boutons, forming two distinct regions of presumptive synaptic output. These results suggest that 1) The majority of the OL innervation is provided by olfactory sensilla (aesthetascs), but that other types of sensilla provide additional, likely mechanosensory, input to the OL. 2) The projection of olfactory afferents is not strictly uniglomerular. 3) The columnar organization of crustacean olfactory glomeruli is functionally significant and may provide an evolutionary correlate of the recently proposed subdivision of the vertebrate olfactory bulb into "functional columns."

  18. Local interneurons define functionally distinct regions within lobster olfactory glomeruli

    Science.gov (United States)

    Wachowiak; Diebel; Ache

    1997-01-01

    Whole-cell recording coupled with biocytin injection revealed four types of interneurons intrinsic to the olfactory lobe (OL) of the spiny lobster Panulirus argus. Each type of neuron had a distinct pattern of arborization within the three anatomically defined regions of OL glomeruli (cap, subcap and base). Type I interneurons innervated all three regions, while types II, III and IV branched only in the cap, subcap and base, respectively. Type I interneurons responded to electrical stimulation of the antennular (olfactory) nerve with a burst of 1­20 action potentials and a 1­10 s depolarization. Type II (cap) interneurons responded to the same input with a burst of 1­3 action potentials followed by a shorter hyperpolarization. Type III (subcap) interneurons responded with a burst of 1­6 action potentials followed by a delayed, 0.5­4 s depolarization. Type IV (base) interneurons responded with a brief depolarization or a burst of 1­3 action potentials followed by a 1 s hyperpolarization. The regionalized arborization and the different response properties of the type II, III and IV interneurons strongly imply that lobster olfactory glomeruli contain functionally distinct regions, a feature that should be useful in understanding the multiple synaptic pathways involved in processing olfactory input.

  19. "龙虾"问答

    Institute of Scientific and Technical Information of China (English)

    徐敏; 王群

    2004-01-01

    @@ 1问: 近几年,"干煸龙虾"风靡上海.由于初中生物学课上要讲授有关节肢动物的分类知识,因此有必要向学生说明清楚生物学上的"龙虾"与干煸龙虾的龙虾非同类.据资料,生物学上所谓的龙虾,英文名lobster,属甲壳纲龙虾科.体长一般20~40cm,体重3~4kg.常在海底或岸边爬行,不善于游泳.我国沿海有8种以上,其中数量最多的一种叫"中国龙虾",学名Panulirus stimpsoni,分布于广东和南海.而上海的干煸龙虾,属甲壳纲蝲蛄科螯虾属,英文名crayfiah.

  20. Caribbean Spiny Lobster Fishery Is Underpinned by Trophic Subsidies from Chemosynthetic Primary Production.

    Science.gov (United States)

    Higgs, Nicholas D; Newton, Jason; Attrill, Martin J

    2016-12-19

    The Caribbean spiny lobster, Panulirus argus, is one of the most valuable fisheries commodities in the Central American region, directly employing 50,000 people and generating >US$450 million per year [1]. This industry is particularly important to small island states such as The Bahamas, which exports more lobster than any other country in the region [1]. Several factors contribute to this disproportionally high productivity, principally the extensive shallow-water banks covered in seagrass meadows [2], where fishermen deploy artificial shelters for the lobsters to supplement scarce reef habitat [3]. The surrounding seabed communities are dominated by lucinid bivalve mollusks that live among the seagrass root system [4, 5]. These clams host chemoautotrophic bacterial symbionts in their gills that synthesize organic matter using reduced sulfur compounds, providing nutrition to their hosts [6]. Recent studies have highlighted the important role of the lucinid clam symbiosis in maintaining the health and productivity of seagrass ecosystems [7, 8], but their biomass also represents a potentially abundant, but as yet unquantified, food source to benthic predators [9]. Here we undertake the first analysis of Caribbean spiny lobster diet using a stable isotope approach (carbon, nitrogen, and sulfur) and show that a significant portion of their food (∼20% on average) is obtained from chemosynthetic primary production in the form of lucinid clams. This nutritional pathway was previously unrecognized in the spiny lobster's diet, and these results are the first empirical evidence that chemosynthetic primary production contributes to the productivity of commercial fisheries stocks.

  1. Nitric oxide synthase-dependent immune response against gram negative bacteria in a crustacean, Litopenaeus vannamei.

    Science.gov (United States)

    Rodríguez-Ramos, Tania; Carpio, Yamila; Bolívar, Jorge; Gómez, Leonardo; Estrada, Mario Pablo; Pendón, Carlos

    2016-03-01

    Nitric oxide (NO) is a short-lived radical generated by nitric oxide synthases (NOS). NO is involved in a variety of functions in invertebrates, including host defense. In previous studies, we isolated and sequenced for the first time the NOS gene from hemocytes of Panulirus argus, demonstrating the inducibility of this enzyme by lipopolysaccharide in vitro e in vivo. Hyperimmune serum was obtained from rabbits immunized with a P. argus -NOS fragment of 31 kDa produced in Escherichia coli, which specifically detected the recombinant polypeptide and the endogenous NOS from lobster hemocytes by western blotting and immunofluorescence. In the present work, we demonstrate that the hyperimmune serum obtained against P. argus NOS also recognizes Litopenaeus vannamei NOS in hemocytes by western blotting and immunofluorescence. Our data also show that while the hemolymph of L. vannamei has a strong antibacterial activity against the Gram negative bacteria Aeromonas hydrophila, the administration of the anti NOS serum reduce the natural bacterial clearance. These results strongly suggest that NOS is required for the shrimp immune defense toward Gram negative bacteria. Therefore, the monitoring of induction of NOS could be an important tool for testing immunity in shrimp farming.

  2. Photon activation analysis of trace elements in several kinds of invertebrate animals. 1. Arthropoda crustacea

    Energy Technology Data Exchange (ETDEWEB)

    Fukushima, Michiko; Tamate, Hidetoshi [Ishinomaki Senshu Univ., Miyagi (Japan)

    1998-09-01

    Quantitative analysis of trace elements was made for marine mollusca by light quantum activation method. Crustacea which is likely to be well reflecting the environment of ocean floor was used as the subjects. Various kinds of these animals including Carcinus Portunus. Palinurus, Panulirus, Squilla etc. were collected from the sea off Japan to determine the concentrations of 15 kinds of elements in the gills, muscles, head/thorax region and viceraneous organs. The concentration of As was found markedly high in either of gills, muscles or viceraneous organs of Palinurus taken from the sea near Okinawa. It was found that there are no difference in the concentrations of As, Fe, Mn and Pb among the species studied and Fe, Mn and Pb were detected at high levels in the gills of Carcinus, whereas the Fe and Mn concentrations in the gills of Palinurus were considerably lower than other species tested. Thus, the element concentration was different among the regions studied and also species. (M.N.)

  3. Ionotropic crustacean olfactory receptors.

    Directory of Open Access Journals (Sweden)

    Elizabeth A Corey

    Full Text Available The nature of the olfactory receptor in crustaceans, a major group of arthropods, has remained elusive. We report that spiny lobsters, Panulirus argus, express ionotropic receptors (IRs, the insect chemosensory variants of ionotropic glutamate receptors. Unlike insects IRs, which are expressed in a specific subset of olfactory cells, two lobster IR subunits are expressed in most, if not all, lobster olfactory receptor neurons (ORNs, as confirmed by antibody labeling and in situ hybridization. Ligand-specific ORN responses visualized by calcium imaging are consistent with a restricted expression pattern found for other potential subunits, suggesting that cell-specific expression of uncommon IR subunits determines the ligand sensitivity of individual cells. IRs are the only type of olfactory receptor that we have detected in spiny lobster olfactory tissue, suggesting that they likely mediate olfactory signaling. Given long-standing evidence for G protein-mediated signaling in activation of lobster ORNs, this finding raises the interesting specter that IRs act in concert with second messenger-mediated signaling.

  4. Cascading effects of fishing on Galapagos rocky reef communities: reanalysis using corrected data

    Science.gov (United States)

    Sonnenholzner, Jorge I.; Ladah, Lydia B.; Lafferty, Kevin D.

    2009-01-01

    This article replaces Sonnenholzner et al. (2007; Mar Ecol Prog Ser 343:77–85), which was retracted on September 19, 2007, due to errors in entry of data on sea urchins. We sampled 10 highly fished and 10 (putatively) lightly fished shallow rocky reefs in the southeastern area of the Galapagos Marine Reserve, Ecuador. After the correction, these are the new results: there was a negative association between slate-pencil urchins Eucidaris galapagensis and non-coralline algae. In addition, pencil urchins were less abundant where there were many predators. An indirect positive association between predators and non-coralline algae occurred. Fishing appeared to affect this trophic cascade. The spiny lobster Panulirus penicillatus, the slipper lobster Scyllarides astori, and the Mexican hogfish Bodianus diplotaenia were significantly less abundant at highly fished sites. Urchin density was higher at highly fished sites. Non-coralline algae were nearly absent from highly fished sites, where a continuous carpet of the anemone Aiptasia sp. was recorded, and the algal assemblage was mainly structured by encrusting coralline and articulated calcareous algae.

  5. Polyphenol content and antioxidant activity of maqui (Aristotelia chilensis Molina Stuntz during fruit development and maturation in Central Chile Contenidos de polifenoles y actividad antioxidante de maqui (Aristotelia chilensis Molina Stuntz durante el desarrollo y maduración de frutos en Chile Central

    Directory of Open Access Journals (Sweden)

    Carolina Fredes

    2012-12-01

    determinar el contenido de fenoles totales, antocianos totales y la actividad antioxidante (método FRAP habilidad del plasma para reducir el hierro férrico de frutos de maqui cosechados en diferentes estados de madurez de dos poblaciones silvestres ubicadas en Chile Central. Cada estado de madurez fue caracterizado de acuerdo a los días desde la cuaja de frutos, tamaño y sólidos solubles. El contenido de fenoles totales disminuyó mientras que el contenido de antocianos totales aumentó desde fruto verde hasta fruto en pinta; sin embargo, los valores de ambas variables aumentaron desde pinta hasta fruto purpura oscuro. La mayor capacidad antioxidante se observó en los frutos del Ultimo estado de maduez analizado (purpura oscuro. Los resultados demostraron que la madurez de consumo en frutos de maqui puede ser esperada con 1100 grados día de crecimiento (91 d después de cuaja en Chile Central. En este momento de cosecha, frutos con sólidos solubles entre 18 y 19 °Brix tienen los mayores contenidos de antocianos y actividad antioxidante (FRAP. Este estudio constituye los primeros avances en el entendimiento de la maduración de frutos de maqui y su correspondiente actividad antioxidante.

  6. CONTROLE DE ALTERNARIA SOLANI COM FUNGICIDAS NA CULTURA DO TOMATEIRO CONTROL OF ALTERNARIA SOLANI WITH FUNGICIDES IN TOMATO PLANTS

    Directory of Open Access Journals (Sweden)

    Fabrício Silva Coelho

    2011-06-01

    Full Text Available A pinta-preta, causada pelo fungo Alternaria solani, caracteriza-se por ser uma importante e destrutiva doença da cultura do tomate, sob condições de alta temperatura e umidade. Objetivou-se avaliar a eficiência de diferentes fungicidas no controle da Alternaria solani na cultura do tomateiro na região de Lavras (MG. O experimento foi desenvolvido na Universidade Federal de Lavras - Departamento de Agricultura, no período de novembro de 2004 a janeiro de 2005. O delineamento experimental foi o de blocos casualizados com 10 tratamentos e quatro repetições. Cada parcela composta por 12 plantas. As aplicações foram realizadas com um pulverizador costal manual (45 lbf/pol2, volume de aplicação de 800 L•ha-1, totalizando sete aplicações, com intervalos de sete dias. Foram realizadas cinco avaliações para a severidade foliar da doença com o uso de escala diagramática. Todos os fungicidas apresentaram potencial de controle da pinta-preta dentro das características inerentes ao seu grupo químico. Os melhores níveis de controle foram obtidos com os tratamentos Chlorothalonil 500 g•L-1 + Tetraconazole 20 g•L-1 (dosagem 200 mL•100 L-1, Chlorothalonil 400 g•L-1+ Oxicloreto de Cobre 420 g•kg-1 e Chlorothalonil 750 g•kg-1 + Tetraconazole 20 g•kg-1 (dosagem 150 g•100 L-1. Tetraconazole 100 g•L-1 proporcionou os menores níveis de controle.The early blight disease on tomato, caused by the fungus Alternaria solani, is referred to in importance due its destructive power, under conditions of high temperature and humidity. This study aimed to evaluate the effectiveness of various fungicides in your control in the region of Lavras-MG, Brazil. The experiment was conducted at the Federal University of Lavras, Department of Agriculture in the period from November 2004 to January 2005. The experimental design was randomized blocks with 10 treatments and four replications, each plot comprise 12 plants. The applications were made

  7. [Typical dishes consumed in Sonora: regionalization and nutrient contribution].

    Science.gov (United States)

    Jardines, R P; Bermúdez, M C; Wong, P; León, G

    1985-12-01

    This study deals with the development of a method to identify typical food dishes, successfully applied in the State of Sonora, Mexico. The State was divided into six regions considering the size of the territory and existence of different physical, economic and sociocultural conditions, and how they influence the consumption patterns. A list of 66 regional food dishes was prepared by interviewing housewives from different parts of Sonora who now lived in the city of Hermosillo. From this list, 47 dishes were identified as regionally consumed, and a State-wide survey was performed to determine their frequency of consumption. Based on the categories of "very frequently", "frequently" and "less frequently", a group of 15 dishes (2 per region, plus 3 dishes throughout the State) was selected. A questionnaire was used to obtain the different ways they had of preparing them. The "typical recipe" for each dish was also determined, using the mode as statistical parameter. Samples of these food dishes were prepared at the laboratory following the selected home recipes for proximal analysis and determination of their vitamin A, thiamine, riboflavin, niacin, calcium, phosphorus and iron content. The results showed that a portion of "gallina pinta" contributed more than 25% of the daily recommended intake established by the National Institute of Nutrition "Salvador Zubirán" (INNSZ) for an adult man for energy, protein, iron, niacin and 24.3% thiamine and 21.0% calcium. The "chivichangas de queso", for example, contributed 45.2% of the calcium requirement, and the "tamales de carne", 36% iron.(ABSTRACT TRUNCATED AT 250 WORDS)

  8. Emprêgo de desfolhantes na cultura da batatinha The use of potato vine killers

    Directory of Open Access Journals (Sweden)

    O. J. Boock

    1962-01-01

    Full Text Available Uma das medidas que se impõem para a melhoria do estado de sanidade dos tubérculos de batatinha (Solanum tuberosum L., tanto para o consumo como principalmente para o plantio, é a destruição da folhagem com alguma antecedência à colheita normal Além dessa melhoria, tal prática permite colocar o produto no mercado antes das épocas das maiores safras obtendo-se maiores lucros. Neste trabalho são apresentados resultados obtidos com o emprêgo de desfolhantes físicos, químicos e mecânicos, para determinação dos mais eficientes nas condições locais. Tal prática, em relação ao estado de sanidade, principalmente quanto às moléstias de vírus e apodrecimentos devidos à requeima (Phytophthora infestans e pinta preta (Alternaria solani, será objeto de novos experimentos, utilizando-se como desfolhante aquêles que, neste trabalho, se mostraram mais eficientes e econômicos, como foi o casododinitro-orto-secundário-butil-fenol e do dínitro-cresol.This paper discusses the results of preliminary tests for determining the best way to kill the potato vine under the conditions of the State of São Paulo. Of the methods compared (cutting or flaming the vines, or spraying them with sodium chlorate, sodium arsenite, dinitro cresol or dinitro-o-sec-butyl phenol, spraying with the dinitro derivatives seemed to be the best. Further experiments are needed to observe the incidence of virus diseases and rots caused by Phytophthora infstans and Alternaria solani in the seed potatoes coming from fields treated with the latter products.

  9. Le roi, la reine, et le nègre d’or

    Directory of Open Access Journals (Sweden)

    Narjess Outreligne-Saidi.

    2007-02-01

    Full Text Available Pour perpétuer une « tradition » littéraire, Michel Georges Michel invente un nouveau rôle à Shéhérazade, l’héroïne des Mille et Une Nuit. Il s’agit d’une transposition du conte-cadre dans laquelle le poète, qui est aussi peintre et dessinateur, nous peint un tableau d’un Orient paradisiaque qui se transforme rapidement en une scène tragique, en un massacre. Il s’agit aussi d’une interrogation sur la relation du couple homme-femme.In order to perpetuate a so-called literary tradition, Michel George Michel invents a new role for Shehrezed, the heroine of A Thousand and One Night. The poet, who also paints and draws, transposes the framing tale in order to depict a picture of a paradisical Orient, which quickly turns, however, into a tragic scene of a massacre. The story also interrogates the relationship between men and women.Para perpetuar una « tradición » literaria, Michel Georges Michel crea un nuevo papel para Scherezada, heroína de las Mil y Una noches. Se trata de una transposición del cuento original en la que el poeta, poeta y dibujante, nos pinta el cuadro de un Oriente paradisíaco que se transforma rápidamente en una escena trágica, en una masacre. Además, el poeta interroga la relación del binomio hombre-mujer.

  10. Lack of premating isolation at the base of a phylogenetic tree.

    Science.gov (United States)

    Grant, B Rosemary; Grant, Peter R

    2002-07-01

    Darwin's finches in the Galápagos archipelago are an unusual example of adaptive radiation in that the basal split separates two lineages of warbler finches (Certhidea olivacea and Certhidea fusca) believed until recently to be only one species. The large genetic difference between them contrasts with their similarity in plumage, size, shape, and courtship behavior. They differ in song, which is a key factor in premating isolation of other sympatric Darwin's finches. We conducted playback experiments to see whether members of the population of C. olivacea on Santa Cruz Island would respond to songs of C. fusca from two islands, Genovesa and Pinta, and songs of C. olivacea from another island (Isabela). Another set of experiments was performed, using the same playback tapes, with C. fusca on Genovesa. Some members of both populations responded to all playbacks; therefore, the hypothesis of complete premating isolation on the basis of song is rejected. Discrimination between songs of the two lineages was inconsistent. We conclude that premating barriers to interbreeding among the tested populations have not arisen in the 1.5-2.0 m.yr. of their geographical isolation on different islands. This contrasts with strong premating barriers between more recently derived sympatric species. Early learning of song associated with morphology is later used in mate recognition. This explains why sympatric species that are vocally and morphologically distinct yet genetically less differentiated than Certhidea do not interbreed, whereas the Certhidea lineages that are genetically well differentiated but vocally and morphologically similar have no apparent premating barrier. We discuss this unusual situation in terms of the forces that have produced similarities and differences in song, morphology, and ecology and their relevance to phylogenetic and biological species concepts. Neither principles nor details are unique to Darwin's finches, and we conclude by pointing out strong

  11. Moléstias em tomateiro cultivado em estufas plásticas em quatro municípios da região central do Rio Grande do Sul, Brasil

    Directory of Open Access Journals (Sweden)

    Blume Elena

    2004-01-01

    Full Text Available Moléstias podem atacar severamente hortaliças cultivadas em cultivos protegidos e, para o manejo integrado dessas moléstias, o conhecimento das condições climáticas que favorecem sua incidência nesses cultivos é fundamental. O trabalho teve o objetivo de identificar as moléstias em tomateiro cultivado em estufas plásticas em quatro municípios na região central do Rio Grande do Sul e as condições de temperatura e umidade relativa (UR do ar nas quais elas ocorrem. O estudo foi realizado nos municípios de São Pedro do Sul, São Sepé, Ivorá e Santa Maria (RS, no período de março a outubro de 1998. A temperatura e umidade relativa do ar foram medidas diariamente com um psicrômetro. As moléstias observadas e sua incidência máxima foram: requeima (Phytophthora infestans: 100,0%, pinta-preta (Alternaria solani: 98,1%, mofo cinzento (Botrytis cinerea: 55,4%, cladosporiose (Cladosporuim fulvum: 48,9%, septoriose (Septoria lycopersici: 37,5%, talo-oco (Erwinia spp.: 33,0%, murcha de fusarium (Fusarium oxysporum f. sp. lycopersici: 8,4% e podridão de esclerotínia (Sclerotinia sclerotiorum: 1,3%. Valores de UR superiores a 80%, de maneira geral, aumentaram a incidência das moléstias, em sua maioria de origem fúngica. A incidência de moléstias varia entre municípios de uma mesma região climática de acordo com os fatores meteorológicos e práticas de manejo da cultura.

  12. A Retrospective Study on Genetic Heterogeneity within Treponema Strains: Subpopulations Are Genetically Distinct in a Limited Number of Positions.

    Directory of Open Access Journals (Sweden)

    Darina Čejková

    Full Text Available Pathogenic uncultivable treponemes comprise human and animal pathogens including agents of syphilis, yaws, bejel, pinta, and venereal spirochetosis in rabbits and hares. A set of 10 treponemal genome sequences including those of 4 Treponema pallidum ssp. pallidum (TPA strains (Nichols, DAL-1, Mexico A, SS14, 4 T. p. ssp. pertenue (TPE strains (CDC-2, Gauthier, Samoa D, Fribourg-Blanc, 1 T. p. ssp. endemicum (TEN strain (Bosnia A and one strain (Cuniculi A of Treponema paraluisleporidarum ecovar Cuniculus (TPLC were examined with respect to the presence of nucleotide intrastrain heterogeneous sites.The number of identified intrastrain heterogeneous sites in individual genomes ranged between 0 and 7. Altogether, 23 intrastrain heterogeneous sites (in 17 genes were found in 5 out of 10 investigated treponemal genomes including TPA strains Nichols (n = 5, DAL-1 (n = 4, and SS14 (n = 7, TPE strain Samoa D (n = 1, and TEN strain Bosnia A (n = 5. Although only one heterogeneous site was identified among 4 tested TPE strains, 16 such sites were identified among 4 TPA strains. Heterogeneous sites were mostly strain-specific and were identified in four tpr genes (tprC, GI, I, K, in genes involved in bacterial motility and chemotaxis (fliI, cheC-fliY, in genes involved in cell structure (murC, translation (prfA, general and DNA metabolism (putative SAM dependent methyltransferase, topA, and in seven hypothetical genes.Heterogeneous sites likely represent both the selection of adaptive changes during infection of the host as well as an ongoing diversifying evolutionary process.

  13. SINOPSE DA SITUAÇÃO ATUAL, PERSPECTIVAS E CONDIÇÕES DE CULTIVO PARA LAGOSTAS PALINURIDAE REVIEW OF CURRENT SITUATION, PERSPECTIVE AND NEW TECNOLOGIES FOR GROWOUT OF PALINURID LOBSTERS

    Directory of Open Access Journals (Sweden)

    Marco Antonio Igarashi

    2007-07-01

    Full Text Available A lagosta é um produto de exportação de grande importância para o Nordeste brasileiro. Há uma preocupação visível e constante com o decréscimo da produção lagosteira, razão pela qual se propõe o cultivo da lagosta. Não há cultivo comercial de lagostas no Brasil e, no mundo, poucos juvenis de lagostas são cultivados em escala comercial. Desde 1995, os pesquisadores brasileiros têm feito esforços para criar a lagosta Panulirus argus e P. laevicauda, de pueruli ou juvenis recentes até adulto. Contudo, as investigações envolvem a captura dos exemplares em seu hábitat, para o posterior cultivo em confinamento. Existempossibilidades de o Estado do Ceará cultivar juvenis de P. argus e de P. laevicauda que são encontrados em profusão, porém mais pesquisas são necessárias antes de se iniciar um projeto em escala comercial. A par disso, estratégias para a criação da lagosta são relatadas detalhadamente neste artigo, objetivando contribuir para o êxito dessa atividade. Além disso, demonstra-se que os juvenis podem ser cultivados sob regime de confinamento, por se adaptarem bem às condições artificiais de alimentação. Dadas tais características, a lagosta é um crustáceo que se apresenta apropriado para o cultivo comercial. PALAVRAS-CHAVE: Cultivo, lagosta, manejo. Spiny lobster are important product of exportation in Northeastern of Brasil. There is a visible preoccupation about the reported decline in the catch of lobster. One of the solution to this problem is through culture of spiny lobster. There is no commercial juveniles growout in Brazil and the world culture of juvenile spiny lobster is still conducted on only a small commercial scale. Since 1995 Brazilian researchers have made efforts to rear spiny lobster Panulirus argus and P. laevicauda from the pueruli or early juvenile to the adult stage. The investigations involve capturing pueruli or juveniles and growing them in confinement. This possibility has

  14. Utilization of Shrimp Skin Waste (Sea Lobster) As Raw Material for the Membrane Filtration

    Science.gov (United States)

    Nyoman Rupiasih, Ni; Sumadiyasa, Made; Suyanto, Hery; Windari, Putri

    2017-05-01

    In view of the increasing littering of the sea banks by shells of crustaceans, a study was carried out to investigate the extraction and characterization of chitosan from skin waste of sea lobster i.e. ‘Bamboo Lobster’ (Panulirus versicolor). Chitosan was extracted using conventional methods such as pretreatment, demineralization, deprotienization, and deacetylation. The result showed that the degree of deacetylation of chitosan obtained is 70.02%. The FTIR spectra of the chitosan gave a characteristic of -NH2 band at 3447 cm-1 and carbonyl group band at 1655 cm-1. This chitosan has been used to prepare membrane. The chitosan membrane 2% has been prepared using phase inversion method with precipitation by solvent evaporation. The membranes were characterized by FTIR spectrophotometer, Nova 1200e using BJH method, and filtration method. The results show that thickness of the membrane is about 134 μm. The FTIR spectra show that functional groups present in the membrane are -NH, -CH, C=O, and -OH. Using BJH method obtained that the pore diameter is 3.382 nm with pore density is 8.95 x 105 pores/m3. By filtration method obtained that pure water flux (PWF) of the membrane are 386.662 and 489.627 1/m2.h at pressure 80-85 kPa and 90-100 kPa, respectively. These results show that skin waste of sea lobster was discovered as a raw material to prepare chitosan membrane. The membrane obtained is belonged to mesoporous group which may use in microfiltration process.

  15. Numerical simulations of odorant detection by biologically inspired sensor arrays.

    Science.gov (United States)

    Schuech, R; Stacey, M T; Barad, M F; Koehl, M A R

    2012-03-01

    The antennules of many marine crustaceans enable them to rapidly locate sources of odorant in turbulent environmental flows and may provide biological inspiration for engineered plume sampling systems. A substantial gap in knowledge concerns how the physical interaction between a sensing device and the chemical filaments forming a turbulent plume affects odorant detection and filters the information content of the plume. We modeled biological arrays of chemosensory hairs as infinite arrays of odorant flux-detecting cylinders and simulated the fluid flow around and odorant flux into the hair-like sensors as they intercepted a single odorant filament. As array geometry and sampling kinematics were varied, we quantified distortion of the flux time series relative to the spatial shape of the original odorant filament as well as flux metrics that may be important to both organisms and engineered systems attempting to measure plume structure and/or identify chemical composition. The most important predictor of signal distortion is the ratio of sensor diameter to odorant filament width. Achieving high peak properties (e.g. sharpness) of the flux time series and maximizing the total number of odorant molecules detected appear to be mutually exclusive design goals. Sensor arrays inspired specifically by the spiny lobster Panulirus argus and mantis shrimp Gonodactylaceus falcatus introduce little signal distortion but these species' neural systems may not be able to resolve plume structure at the level of individual filaments via temporal properties of the odorant flux. Current chemical sensors are similarly constrained. Our results suggest either that the spatial distribution of flux across the aesthetasc array is utilized by P. argus and G. falcatus, or that such high spatiotemporal resolution is unnecessary for effective plume tracking.

  16. Comparison of excitatory currents activated by different transmitters on crustacean muscle. II. Glutamate-activated currents and comparison with acetylcholine currents present on the same muscle.

    Science.gov (United States)

    Lingle, C; Auerbach, A

    1983-04-01

    The properties of glutamate-activated excitatory currents on the gm6 muscle from the foregut of the spiny lobsters Panulirus argus and interruptus and the crab Cancer borealis were examined using either noise analysis, analysis of synaptic current decays, or slow iontophoretic currents. The properties of acetylcholine currents activated in nonjunctional regions of the gm6 muscle were also examined. At 12 degrees C and -80 mV, the predominant time constant of power spectra from glutamate-activated current noise was approximately 7 ms and the elementary conductance was approximately 34 pS. At 12 degrees C and -80 mV, the predominant time constant of acetylcholine-activated channels was approximately 11 ms with a conductance of approximately 12 pS. Focally recorded glutamatergic extracellular synaptic currents on the gm6 muscle decayed with time constants of approximately 7-8 ms at 12 degrees C and -80 mV. The decay time constant was prolonged e-fold about every 225-mV hyperpolarization in membrane potential. The Q10 of the time constant of the synaptic current decay was approximately 2.6. The voltage dependence of the steady-state conductance increase activated by iontophoretic application of glutamate has the opposite direction of the steady-state conductance activated by cholinergic agonists when compared on the gm6 muscles. The glutamate-activated conductance increase is diminished with hyperpolarization. The properties of the marine crustacean glutamate channels are discussed in relation to glutamate channels in other organisms and to the acetylcholine channels found on the gm6 muscle and the gm1 muscle of the decapod foregut (Lingle and Auerbach, 1983).

  17. Metabotropic glutamate receptor agonists modify the pyloric output of the crustacean stomatogastric ganglion.

    Science.gov (United States)

    Pérez-Acevedo, Nivia L; Krenz, Wulf D

    2005-11-16

    We have studied the effects of groups I, II, and III metabotropic glutamate receptor (mGluR) agonists and antagonists on pyloric activity in the stomatogastric ganglion (STG) of the Caribbean spiny lobster Panulirus argus. We have found that agonists for all three groups of mGluRs modify the pyloric output. The group I agonist, l-quisqualic acid (l-QA), activated the pyloric central pattern generator (CPG). When the pyloric rhythm was partially suppressed by sucrose-block of input fibers in the stomatogastric nerve (stn), l-QA accelerated the rhythmic activity. In addition, the number of spike discharges was increased in pyloric motoneurons: pyloric (PY), and lateral pyloric (LP). In completely blocked preparations, a slow pyloric rhythm was initiated by l-QA. Groups II and III agonists exerted an inhibitory effect on pyloric activity. The group II agonist, (2S,1'S,2'S)-2-(Carboxycyclopropyl)glycine (L-CCG-I), decreased both the frequency of the pyloric rhythm and the number of spike discharges in the motoneurons: ventricular dilator (VD), PY, and LP. The effects of L-CCG-I were dose-dependent. The group III agonist, l-(+)-2-Amino-4-phosphonobutyric acid (l-AP4), slightly decreased the frequency of the pyloric rhythm and suppressed spike discharges in the VD neuron. All effects of mGluR agonists were reversible. The effect of l-QA was blocked by the broad spectrum mGluR antagonist (S)-Methyl-4-carboxyphenylglycine (MCPG). The inhibitory effect of L-CCG-I was prevented by MCPG and by the group II/III mGluR antagonist (RS)-alpha-Methyl-4-phosphonophenylglycine (MPPG), and was partially blocked by the group II mGluR antagonist (RS)-1-amino-5-phosphonoindan-1-carboxylic acid (APICA). The inhibitory effect of l-AP4 was blocked by MPPG and partially blocked by APICA.

  18. Combined analyses of kinship and FST suggest potential drivers of chaotic genetic patchiness in high gene-flow populations.

    Science.gov (United States)

    Iacchei, Matthew; Ben-Horin, Tal; Selkoe, Kimberly A; Bird, Christopher E; García-Rodríguez, Francisco J; Toonen, Robert J

    2013-07-01

    We combine kinship estimates with traditional F-statistics to explain contemporary drivers of population genetic differentiation despite high gene flow. We investigate range-wide population genetic structure of the California spiny (or red rock) lobster (Panulirus interruptus) and find slight, but significant global population differentiation in mtDNA (ΦST = 0.006, P = 0.001; D(est_Chao) = 0.025) and seven nuclear microsatellites (F(ST) = 0.004, P < 0.001; D(est_Chao) = 0.03), despite the species' 240- to 330-day pelagic larval duration. Significant population structure does not correlate with distance between sampling locations, and pairwise FST between adjacent sites often exceeds that among geographically distant locations. This result would typically be interpreted as unexplainable, chaotic genetic patchiness. However, kinship levels differ significantly among sites (pseudo-F(16,988) = 1.39, P = 0.001), and ten of 17 sample sites have significantly greater numbers of kin than expected by chance (P < 0.05). Moreover, a higher proportion of kin within sites strongly correlates with greater genetic differentiation among sites (D(est_Chao), R(2) = 0.66, P < 0.005). Sites with elevated mean kinship were geographically proximate to regions of high upwelling intensity (R(2) = 0.41, P = 0.0009). These results indicate that P. interruptus does not maintain a single homogenous population, despite extreme dispersal potential. Instead, these lobsters appear to either have substantial localized recruitment or maintain planktonic larval cohesiveness whereby siblings more likely settle together than disperse across sites. More broadly, our results contribute to a growing number of studies showing that low F(ST) and high family structure across populations can coexist, illuminating the foundations of cryptic genetic patterns and the nature of marine dispersal.

  19. A holistic view of dietary carbohydrate utilization in lobster: digestion, postprandial nutrient flux, and metabolism.

    Directory of Open Access Journals (Sweden)

    Leandro Rodríguez-Viera

    Full Text Available Crustaceans exhibit a remarkable variation in their feeding habits and food type, but most knowledge on carbohydrate digestion and utilization in this group has come from research on few species. The aim of this study was to make an integrative analysis of dietary carbohydrate utilization in the spiny lobster Panulirus argus. We used complementary methodologies such as different assessments of digestibility, activity measurements of digestive and metabolic enzymes, and post-feeding flux of nutrients and metabolites. Several carbohydrates were well digested by the lobster, but maize starch was less digestible than all other starches studied, and its inclusion in diet affected protein digestibility. Most intense hydrolysis of carbohydrates in the gastric chamber of lobster occurred between 2-6 h after ingestion and afterwards free glucose increased in hemolymph. The inclusion of wheat in diet produced a slow clearance of glucose from the gastric fluid and a gradual increase in hemolymph glucose. More intense hydrolysis of protein in the gastric chamber occurred 6-12 h after ingestion and then amino acids tended to increase in hemolymph. Triglyceride concentration in hemolymph rose earlier in wheat-fed lobsters than in lobsters fed other carbohydrates, but it decreased the most 24 h later. Analyses of metabolite levels and activities of different metabolic enzymes revealed that intermolt lobsters had a low capacity to store and use glycogen, although it was slightly higher in wheat-fed lobsters. Lobsters fed maize and rice diets increased amino acid catabolism, while wheat-fed lobsters exhibited higher utilization of fatty acids. Multivariate analysis confirmed that the type of carbohydrate ingested had a profound effect on overall metabolism. Although we found no evidence of a protein-sparing effect of dietary carbohydrate, differences in the kinetics of their digestion and absorption impacted lobster metabolism determining the fate of other

  20. Trophic cascades induced by lobster fishing are not ubiquitous in southern California kelp forests.

    Science.gov (United States)

    Guenther, Carla M; Lenihan, Hunter S; Grant, Laura E; Lopez-Carr, David; Reed, Daniel C

    2012-01-01

    Fishing can trigger trophic cascades that alter community structure and dynamics and thus modify ecosystem attributes. We combined ecological data of sea urchin and macroalgal abundance with fishery data of spiny lobster (Panulirus interruptus) landings to evaluate whether: (1) patterns in the abundance and biomass among lobster (predator), sea urchins (grazer), and macroalgae (primary producer) in giant kelp forest communities indicated the presence of top-down control on urchins and macroalgae, and (2) lobster fishing triggers a trophic cascade leading to increased sea urchin densities and decreased macroalgal biomass. Eight years of data from eight rocky subtidal reefs known to support giant kelp forests near Santa Barbara, CA, USA, were analyzed in three-tiered least-squares regression models to evaluate the relationships between: (1) lobster abundance and sea urchin density, and (2) sea urchin density and macroalgal biomass. The models included reef physical structure and water depth. Results revealed a trend towards decreasing urchin density with increasing lobster abundance but little evidence that urchins control the biomass of macroalgae. Urchin density was highly correlated with habitat structure, although not water depth. To evaluate whether fishing triggered a trophic cascade we pooled data across all treatments to examine the extent to which sea urchin density and macroalgal biomass were related to the intensity of lobster fishing (as indicated by the density of traps pulled). We found that, with one exception, sea urchins remained more abundant at heavily fished sites, supporting the idea that fishing for lobsters releases top-down control on urchin grazers. Macroalgal biomass, however, was positively correlated with lobster fishing intensity, which contradicts the trophic cascade model. Collectively, our results suggest that factors other than urchin grazing play a major role in controlling macroalgal biomass in southern California kelp forests, and

  1. Crustin, a WAP domain containing antimicrobial peptide from freshwater prawn Macrobrachium rosenbergii: immune characterization.

    Science.gov (United States)

    Arockiaraj, Jesu; Gnanam, Annie J; Muthukrishnan, Dhanaraj; Gudimella, Ranganath; Milton, James; Singh, Arun; Muthupandian, Saravanan; Kasi, Marimuthu; Bhassu, Subha

    2013-01-01

    Crustin (MrCrs) was sequenced from a freshwater prawn Macrobrachium rosenbergii. The MrCrs protein contains a signal peptide region at N-terminus between 1 and 22 and a long whey acidic protein domain (WAP domain) at C-terminus between 57 and 110 along with a WAP-type 'four-disulfide core' motif. Phylogenetic results show that MrCrs is clustered together with other crustacean crustin groups. MrCrs showed high sequence similarity (77%) with crustin from Pacific white shrimp Litopenaeus vannamei and Japanese spiny lobster Panulirus japonicas. I-TASSER uses the best structure templates to predict the possible structures of MrCrs along with PDB IDs such as 2RELA and 1FLEI. The gene expressions of MrCrs in both healthy M. rosenbergii and those infected with virus including infectious hypodermal and hematopoietic necrosis virus (IHHNV) and white spot syndrome virus (WSSV) and bacteria Aeromonas hydrophila (Gram-negative) and Enterococcus faecium (Gram-positive) were examined using quantitative real time PCR. To understand its biological activity, the recombinant MrCrs gene was constructed and expressed in Escherichia coli BL21 (DE3). The recombinant MrCrs protein agglutinated with the bacteria considered for analysis at a concentration of 25 μg/ml, except Lactococcus lactis. The bactericidal results showed that the recombinant MrCrs protein destroyed all the bacteria after incubation, even less than 6 h. These results suggest that MrCrs is a potential antimicrobial peptide, which is involved in the defense system of M. rosenbergii against viral and bacterial infections.

  2. Primeros registros del Phylum Bryozoa asociados a hábitats artificiales en el Caribe colombiano

    Directory of Open Access Journals (Sweden)

    Oscar Delgadillo-G

    2015-03-01

    Full Text Available Durante el estudio del asentamiento de la langosta espinosa (Panulirus argus sobre colectores artificiales suspendidos en la región de Santa Marta, se evaluaron los peces y otros invertebrados asociados a estos hábitats. El propósito de esta investigación fue determinar las especies de briozoos presentes en los hábitats artificiales instalados en los sectores de la bahía de Pozos Colorados, Isla Pelícano y bahía de Taganga, así como analizar los factores ecológicos de su distribución. Como resultado se encontraron diez briozoos de los cuales Alcyonidium cf. mamillatum, Bugula neritina, Bugula cf. guara, Catenicella uberrima y Aspiscellaria piscaderaensis fueron reportados por primera vez para el Caribe colombiano, y para algunos de estos se amplió su distribución en el Atlántico Occidental Tropical. Durante la época lluviosa (septiembre-noviembre en Isla Pelícano y Pozos Colorados se registró la mayor riqueza y abundancia de briozoos, lo que estuvo probablemente relacionado con la mayor sedimentación y turbidez, en contraste con la época seca (diciembre-febrero. De otro lado, la estación de Taganga presentó valores reducidos de las variables biológicas posiblemente por sus características de aguas claras y movimiento reducido, además de escaso alimento. Los colectores artificiales funcionaron como refugios suspendidos para el asentamiento y desarrollo de estos invertebrados, y claramente son herramientas efectivas en evaluaciones ecológicas y de diversidad, así como para actividades de maricultura.

  3. Sea urchin coelomocytes are resistant to a variety of DNA damaging agents

    Energy Technology Data Exchange (ETDEWEB)

    Loram, Jeannette; Raudonis, Renee; Chapman, Jecar; Lortie, Mae [Bermuda Institute of Ocean Sciences, St. George' s, Bermuda, GE 01 (Bermuda); Bodnar, Andrea, E-mail: andrea.bodnar@bios.edu [Bermuda Institute of Ocean Sciences, St. George' s, Bermuda, GE 01 (Bermuda)

    2012-11-15

    Increasing anthropogenic activities are creating environmental pressures that threaten marine ecosystems. Effective environmental health assessment requires the development of rapid, sensitive, and cost-effective tools to predict negative impacts at the individual and ecosystem levels. To this end, a number of biological assays using a variety of cells and organisms measuring different end points have been developed for biomonitoring programs. The sea urchin fertilization/development test has been useful for evaluating environmental toxicology and it has been proposed that sea urchin coelomocytes represent a novel cellular biosensor of environmental stress. In this study we investigated the sensitivity of coelomocytes from the sea urchin Lytechinus variegatus to a variety of DNA-damaging agents including ultraviolet (UV) radiation, hydrogen peroxide (H{sub 2}O{sub 2}), methylmethane sulfonate (MMS) and benzo[a]pyrene (BaP). LD{sub 50} values determined for coelomocytes after 24 h of exposure to these DNA damaging agents indicated a high level of resistance to all treatments. Significant increases in the formation of apurinic/apyrimidinic (AP or abasic) sites in DNA were only detected using high doses of H{sub 2}O{sub 2}, MMS and UV radiation. Comparison of sea urchin coelomocytes with hemocytes from the gastropod mollusk Aplysia dactylomela and the decapod crustacean Panulirus argus indicated that sensitivity to different DNA damaging agents varies between species. The high level of resistance to genotoxic agents suggests that DNA damage may not be an informative end point for environmental health assessment using sea urchin coelomocytes however, natural resistance to DNA damaging agents may have implications for the occurrence of neoplastic disease in these animals.

  4. Fishing in Easter Island, a recent history (1950-2010

    Directory of Open Access Journals (Sweden)

    Kyrstn Zylich

    2014-10-01

    Full Text Available Easter Island (Rapa Nui is well studied in terms of its archaeology; however, information regarding the history of fishing is extremely limited. Marine resources have likely been exploited from the time the first Polynesians arrived on this remote island. While large pelagics are part of the traditional Rapa Nui diet, inshore fish and invertebrates have also made their way into the diet. Official records of fisheries catches in what is now the Easter Island Province of Chile, which also includes the uninhabited island of Salas y Gómez, are very limited and were available for only some years. Using anecdotal information, historical descriptions and the limited quantitative information available, we reconstructed fisheries catches in the Exclusive Economic Zone (EEZ of the Easter Island Province over the 1950-2010 time period. Totaling almost 6,000 ton, legal catches have been increasing rapidly since the late 1970s, but are now stagnating at around 150-200 ton yr-1. The main species targeted were Pacific chub or 'nanue' (Kyphosus sandwicensis and yellowfin tuna or 'kahi ave ave' (Thunnus albacares, with spiny lobster or 'ura' (Panulirus pascuensis being the most important invertebrate species. There are indications of a substantial illegal fishery for large pelagics in the EEZ of the province, estimated at 200-2,000 ton yr-1, which may have operated for two decades and may be the cause for the declining artisanal catch of tuna by Rapa Nui fishers. Continued pressure on these geographically remote oceanic and inshore marine species, especially those popular amongst tourists, makes accounting for fisheries catches an even greater priority.

  5. [Spatio-temporal dynamics of fishing effort in a multi-species artisanal diving fishery and its effects on catch variability: insights for sustainable management].

    Science.gov (United States)

    Naranjo Madrigall, Helven; Salas Marquez, Silvia

    2014-12-01

    Artisanal diving fisheries are a source of income, employment and food security of coastal areas in many countries. Understanding the dynamics of these fisheries, including the spatial and temporal dynamics of fishing effort, gears and species can help to address the challenges involved in fisheries management. We aimed to analyze the differences in fishing strategies undertaken by fishers that use two different diving methods (hookah and free diving), the conditions and their potential impacts on catches when adjustments to those strategies are applied over time. For this, detailed information of fishing operations from artisanal boats in the North Pacific coast of Costa Rica was analyzed in two fishing seasons (2007-2008 and 2011-2012). Data were collected by onboard observers (fishing site, fishing time, species composition, depth and visibility). Additionally, interviews with divers were applied to obtain information of price per species, species volume and fishing operations. From the total number of trips during both seasons, hookah diving was represented by a sample size of 69.3%, while free diving, with a sample of 41.9%. More than 15 species were identified in each fishing season. Nevertheless, three categories had substantial contributions in both seasons with differences in the proportions for each case: green lobster (Panulirus gracilis), octopus (Octopus sp.) and parrotfish (Scarus perrico and S. ghobban). It is worth noting that an important proportion of catch was retained by fishers for personal consumption purposes, including species of high commercial value. Additional night diving activity, increased the number of dives from one season to another. Besides, cooperation processes in free diving fishing operations, and changes in fishing effort between seasons, defined important changes in fishing strategies. Potential causes of changes in fishing strategies and the implications for management to ensure the sustainability of these fisheries in the

  6. Conched out: Total reconstructed fisheries catches for the Turks and Caicos Islands uncover unsustainable resource usage

    Directory of Open Access Journals (Sweden)

    Aylin eUlman

    2016-05-01

    Full Text Available The Turks and Caicos Islands’ total marine fisheries catches were estimated for 1950-2012 using a catch reconstruction approach, estimating all removals, including reported catch destined for export, and unreported domestic artisanal and subsistence catches. Total reconstructed catch for the period is approximately 2.8 times that reported by Turks and Caicos to the FAO, and 86% higher than the export-adjusted national reported baseline. The pattern of total catches (strong decline to 1970, followed by gradual increase differs distinctly from that shown by data reported to FAO. Reported landings show a steady increase from less than 1,000 t∙year-1 in the 1950s to around 6,000 t∙year-1 in the 2000s. In contrast, the total reconstructed catches suggest declines in total catches from around 20,000 t in 1950 to a low of about 5,000 t in 1970, before gradual increases to about 12 500 t·year-1 in the late 2000s. Major discrepancies between reported and reconstructed data are under-reported artisanal catches in the early decades (accounting for 86% of total catches, and the absence of subsistence catches (14% of total catches in reported data. Queen conch (Strombus gigas and Caribbean spiny lobster (Panulirus argus dominate reconstructed catches. No discards were estimated as fishing has been highly selective, carried out by hand collection (conch, trap or hook (lobster, or hook and line (finfish. New data published here from local seafood consumption surveys demonstrates that the total local consumption of conch equates to almost the entire total allowable catch, before exported amounts are even factored. Policy-makers in the Turks and Caicos need to act if the sustainability of the fisheries stock and fishing industry is to be ensured.

  7. A holistic view of dietary carbohydrate utilization in lobster: digestion, postprandial nutrient flux, and metabolism.

    Science.gov (United States)

    Rodríguez-Viera, Leandro; Perera, Erick; Casuso, Antonio; Perdomo-Morales, Rolando; Gutierrez, Odilia; Scull, Idania; Carrillo, Olimpia; Martos-Sitcha, Juan A; García-Galano, Tsai; Mancera, Juan Miguel

    2014-01-01

    Crustaceans exhibit a remarkable variation in their feeding habits and food type, but most knowledge on carbohydrate digestion and utilization in this group has come from research on few species. The aim of this study was to make an integrative analysis of dietary carbohydrate utilization in the spiny lobster Panulirus argus. We used complementary methodologies such as different assessments of digestibility, activity measurements of digestive and metabolic enzymes, and post-feeding flux of nutrients and metabolites. Several carbohydrates were well digested by the lobster, but maize starch was less digestible than all other starches studied, and its inclusion in diet affected protein digestibility. Most intense hydrolysis of carbohydrates in the gastric chamber of lobster occurred between 2-6 h after ingestion and afterwards free glucose increased in hemolymph. The inclusion of wheat in diet produced a slow clearance of glucose from the gastric fluid and a gradual increase in hemolymph glucose. More intense hydrolysis of protein in the gastric chamber occurred 6-12 h after ingestion and then amino acids tended to increase in hemolymph. Triglyceride concentration in hemolymph rose earlier in wheat-fed lobsters than in lobsters fed other carbohydrates, but it decreased the most 24 h later. Analyses of metabolite levels and activities of different metabolic enzymes revealed that intermolt lobsters had a low capacity to store and use glycogen, although it was slightly higher in wheat-fed lobsters. Lobsters fed maize and rice diets increased amino acid catabolism, while wheat-fed lobsters exhibited higher utilization of fatty acids. Multivariate analysis confirmed that the type of carbohydrate ingested had a profound effect on overall metabolism. Although we found no evidence of a protein-sparing effect of dietary carbohydrate, differences in the kinetics of their digestion and absorption impacted lobster metabolism determining the fate of other nutrients.

  8. Central projections of antennular chemosensory and mechanosensory afferents in the brain of the terrestrial hermit crab (Coenobita clypeatus; Coenobitidae, Anomura

    Directory of Open Access Journals (Sweden)

    Oksana eTuchina

    2015-07-01

    Full Text Available The Coenobitidae (Decapoda, Anomura, Paguroidea is a taxon of hermit crabs that includes two genera with a fully terrestrial life style as adults. Previous studies have shown that Coenobitidae have evolved a sense of spatial odor localization that is behaviorally highly relevant. Here, we examined the central olfactory pathway of these animals by analyzing central projections of the antennular nerve of Coenobita clypeatus, combining backfilling of the nerve with dextran-coupled dye, Golgi impregnations and three-dimensional reconstruction of the primary olfactory center, the antennular lobe. The principal pattern of putative olfactory sensory afferents in C. clypeatus is in many aspects similar to what have been established for aquatic decapod crustaceans, such as the spiny lobster Panulirus argus. However, there are also obvious differences that may, or may not represent adaptations related to a terrestrial lifestyle. In C. clypeatus, the antennular lobe dominates the deutocerebrum, having more than one thousand allantoid-shaped subunits. We observed two distinct patterns of sensory neuron innervation: putative olfactory afferents from the aesthetascs either supply the cap/subcap region of the subunits or they extend through its full depth. Our data also demonstrate that any one sensory axon can supply input to several subunits. Putative chemosensory (non-aesthetasc and mechanosensory axons represent a different pathway and innervate the lateral and median antennular neuropils. Hence, we suggest that the chemosensory input in C. clypeatus might be represented via a dual pathway: aesthetascs target the antennular lobe, and bimodal sensilla target the lateral antennular neuropil and median antennular neuropil. The present data is compared to related findings in other decapod crustaceans.

  9. World reclassification of the Cardiophorinae (Coleoptera, Elateridae), based on phylogenetic analyses of morphological characters

    Science.gov (United States)

    Douglas, Hume B.

    2017-01-01

    Fleutiaux, 1892 (Physodactylinae) is syn. n. of Globothorax Fleutiaux, 1891. The following new genera are described: Austrocardiophorus (type species: Cardiophorus humeralis Fairmaire and Germain, 1860); Chileaphricus (type species: Aphricus chilensis Fleutiaux, 1940); Floridelater (type species: Coptostethus americanus Horn, 1871, transferred from Negastriinae to Cardiophorinae). Paradicronychus (nomen nudum), is syn. n. of Cardiophorus Eschscholtz, 1829. Generic reassignments to make Cardiodontulus, Cardiophorus, Cardiotarsus, Paracardiophorus consistent with phylogenetically revised genus concepts resulted in 84 new combinations. Lectotypes are designated for 29 type species to fix generic concepts: Anelastes femoralis Lucas, 1857; Aphricus chilensis Fleutiaux, 1940; Athous argentatus Abeille de Perrin, 1894; Cardiophorus adjutor Candèze, 1875; Cardiophorus florentini Fleutiaux, 1895; Cardiophorus inflatus Candèze, 1882; Cardiophorus luridipes Candèze, 1860; Cardiophorus mirabilis Candèze, 1860; Cardiophorus musculus Erichson, 1840; Cardiotarsus capensis Candèze, 1860; Cardiotarsus vitalisi Fleutiaux, 1918; Craspedostethus rufiventris Schwarz, 1898; Elater cinereus Herbst, 1784; Elater minutissimus Germar, 1817; Elater sputator Linnaeus, 1758; Elater thoracicus Fabricius, 1801; Eniconyx pullatus Horn, 1884; Esthesopus castaneus Eschscholtz, 1829; Gastrimargus schneideri Schwarz, 1902; Globothorax chevrolati Fleutiaux, 1891; Horistonotus flavidus Candèze, 1860; Horistonotus simplex LeConte, 1863; Lesnelater madagascariensis Fleutiaux, 1935; Oedostethus femoralis LeConte, 1853; Phorocardius solitarius Fleutiaux, 1931; Platynychus indicus Motschulsky, 1858; Platynychus mixtus Fleutiaux, 1931; Triplonychus acuminatus Candèze, 1860; Tropidiplus tellinii Fleutiaux, 1903. A key to genera and diagnoses are provided for all genera and subgenera. A bibliographic synonymy includes references for all taxonomic changes to genera and new species through 2015. PMID:28331397

  10. World reclassification of the Cardiophorinae (Coleoptera, Elateridae, based on phylogenetic analyses of morphological characters

    Directory of Open Access Journals (Sweden)

    Hume B. Douglas

    2017-02-01

    ; Teslasena Fleutiaux, 1892 (Physodactylinae is syn. n. of Globothorax Fleutiaux, 1891. The following new genera are described: Austrocardiophorus (type species: Cardiophorus humeralis Fairmaire and Germain, 1860; Chileaphricus (type species: Aphricus chilensis Fleutiaux, 1940; Floridelater (type species: Coptostethus americanus Horn, 1871, transferred from Negastriinae to Cardiophorinae. Paradicronychus (nomen nudum, is syn. n. of Cardiophorus Eschscholtz, 1829. Generic reassignments to make Cardiodontulus, Cardiophorus, Cardiotarsus, Paracardiophorus consistent with phylogenetically revised genus concepts resulted in 84 new combinations. Lectotypes are designated for 29 type species to fix generic concepts: Anelastes femoralis Lucas, 1857; Aphricus chilensis Fleutiaux, 1940; Athous argentatus Abeille de Perrin, 1894; Cardiophorus adjutor Candèze, 1875; Cardiophorus florentini Fleutiaux, 1895; Cardiophorus inflatus Candèze, 1882; Cardiophorus luridipes Candèze, 1860; Cardiophorus mirabilis Candèze, 1860; Cardiophorus musculus Erichson, 1840; Cardiotarsus capensis Candèze, 1860; Cardiotarsus vitalisi Fleutiaux, 1918; Craspedostethus rufiventris Schwarz, 1898; Elater cinereus Herbst, 1784; Elater minutissimus Germar, 1817; Elater sputator Linnaeus, 1758; Elater thoracicus Fabricius, 1801; Eniconyx pullatus Horn, 1884; Esthesopus castaneus Eschscholtz, 1829; Gastrimargus schneideri Schwarz, 1902; Globothorax chevrolati Fleutiaux, 1891; Horistonotus flavidus Candèze, 1860; Horistonotus simplex LeConte, 1863; Lesnelater madagascariensis Fleutiaux, 1935; Oedostethus femoralis LeConte, 1853; Phorocardius solitarius Fleutiaux, 1931; Platynychus indicus Motschulsky, 1858; Platynychus mixtus Fleutiaux, 1931; Triplonychus acuminatus Candèze, 1860; Tropidiplus tellinii Fleutiaux, 1903. A key to genera and diagnoses are provided for all genera and subgenera. A bibliographic synonymy includes references for all taxonomic changes to genera and new species through 2015.

  11. Anatomía comparada del sistema digestivo de las rayas Urotrygon chilensis y Dasyatis sabina (Myliobatiformes Comparative anatomy of the digestive system of the skates, Urotrygon chilensis and Dasyatis sabina (Myliobatiformes

    Directory of Open Access Journals (Sweden)

    ABRAHAM KOBELKOWSKY

    2010-01-01

    Full Text Available La organización general del sistema digestivo de la raya pinta Urotrygon chilensis y la raya de espina Dasyatis sabina corresponde al patrón morfológico general de los Myliobatiformes. La dentición de estas especies muestra un dimorfismo sexual, consistente en dientes planos en las hembras y dientes puntiagudos en los machos. Entre los músculos mandibulares, el adductor mandibulae es el más complejo. Las cavidades bucofaríngea y visceral son aplanadas dorsoventralmente. El esófago es relativamente largo, el estómago tiene forma de U, el intestino está regionalizado en duodeno, intestino valvular y recto. El mesenterio dorsal está restringido al recto y la glándula rectal. Los caracteres morfológicos más notables que diferencian el sistema digestivo de las dos especies son: la presencia de esfínter cardiaco y la forma en S del recto en U. chilensis, la presencia de escotaduras en las mandíbulas y el mayor número de vueltas de la válvula espiral en D. sabina.The general organization of the digestive system of the rays Urotrygon chilensis and Dasyatis sabina fits with the general morphological pattern of the Myliobatiformes. Dentition of both species shows sexual dimorphism, having the females flattened teeth whereas pointed teeth the males. Among the mandibular muscles, the adductor mandibulae is the most complex. Both the buccopharyngeal and the visceral cavities are dorsoventrally flattened. The esophagus is long, the stomach is U shaped, and the intestine is formed by the duodene, valvular intestine and rectum. The dorsal mesentery is restricted to the rectum and rectal gland. The main morphological characters differentiating both species are: the presence in U. chilensis of the cardiac sphincter and the S shape of the rectum, and the presence in D. sabina of mandibular notches and a higher number of coils of the valvular fold of the intestine.

  12. L'œuvre d'art en tant que témoignage: les artistes confrontés à la guerre La obra de arte como testimonio: los artistas frente a la guerra Art work as a testimony: artists facing the war

    Directory of Open Access Journals (Sweden)

    Dolores Fernández Martínez

    2009-01-01

    Full Text Available Este artículo surge como respuesta a la pregunta de si el arte puede ser considerado fuente testimonial como lo son los documentos escritos que habitualmente tienen en cuenta los historiadores para sus estudios. Pero este tema en arte es complejo. Tenemos el ejemplo universal de Goya, dando testimonio de lo que vio durante la guerra de la independencia, y tenemos distintos dibujos realizados por judíos en los campos de exterminio nazis o de artistas españoles republicanos en los campos de concentración franceses. Pero también está el ejemplo de Picasso cuando pinta « Guernica ». ¿Hasta qué punto este ejemplo, que responde a los anhelos de un pueblo, puede considerarse testimonio? Es indudable que el tema es interesante tratarlo en estos momentos en que asistimos a un gran debate en torno a la memoria histórica, tanto en España como en otros países europeos, y surgen artistas jóvenes que tratan la guerra civil española o el franquismo sin haberlo vividoThis article springs off as an answer to the question of whether we can consider art, as a testimonial source like the written documents that historians use to manage for their studies? But this issue, related to art, is rather complex. We have the universal example of Goya, giving testimony of what he saw during independence war, and we have several drawings made by jews at the Nazis extermination camps or those of republican Spanish artists at the French concentration camps. But there is also the example of Picasso painting « Guernica ». To what extent this example, that portraits the yearnings of people, can be considered testimonial? Undoubtedly this is an interesting subject nowadays, with the ongoing debate about historical memory that is tacking place in Spain and in some other European countries, and the new young artists that make the Spanish civil war or Franco’s regime their subject without having lived them

  13. Lourenço de Salzedo en Roma. Influencias del Manierismo romano en la obra del pintor de la reina Catarina de Portugal

    Directory of Open Access Journals (Sweden)

    Serrao, Vitor

    2003-09-01

    Full Text Available Only in recent years have the works of Lourenço de Salzedo, a quite interesting painter from Seville who worked at the Portuguese court for queen Catherine of Austria (widow of king Joao III, from approximately 1564 to 1577 (year of his death, begun to be regarded in a new light. The recently restored panels that he painted between 1570 and 1572 for the main altarpiece of the Jeronymite Monastery of Lisbon display a profound knowledge of Italian culture, possible only for one who had studied in Rome. In effect, Salzedo was in the city of the Popes toward the middle of the sixteenth century - as were Gaspar Becerra, Pedro Roviale or the Portuguese artist Antonio Campelo - assimilating echos of Roman Bella Maniera painting in the works of the followers of Michelangelo - Girolamo Siciolante da Sermoneta, Daniele da Volterra, Francesco Salviati and Pellegrino Tibaldi.

    Sólo en fecha reciente la Historia del Arte evaluó desde otro punto de vista la obra de Lourenço de Salzedo, un pintor bastante interesante de origen sevillano que pasó a la corte portuguesa, donde, desde 1564, por lo menos, hasta 1577, fecha de su muerte, será pintor de la Reina Catarina de Austria, viuda de D. Joao III. Las recién restauradas tablas que pinta entre 1570-1572 para el retablo mayor del Monasterio de los Jerónimos en Lisboa, después de frustradas diligencias junto a Felipe II para que otros viniesen a pintarlas (Gaspar Becerra, Franz Floris y Francisco de Urbina fueron algunos de los nombres propuestos muestran una profunda cultura italianizante sólo posible de adquirir con una práctica artística en Roma. Testimoniamos que, de hecho, Salzedo pasó por la ciudad papal en los años centrales del siglo XVI —tal como Gaspar Becerra, Pedro Roviale o el portugués Antonio Campelo—, asimilando ahí los ecos de la Bella Maniera romana junto a las obras miguelangelescas tanto de Girolamo Siciolante da Sermoneta como de Daniele da Volterra, Francesco

  14. Apariencia y realidad en Hamlet y Las Meninas

    Directory of Open Access Journals (Sweden)

    Antonio PRIETO MARTÍNEZ

    2009-11-01

    Full Text Available La obra de Shakespeare comenzó a ser estudiada en profundidad a finales del siglo XVII y, sobre todo, en el siglo XVIII. Desde ese siglo hasta el momento actual la investigación en torno a la obra shakesperiana se ha desarrollado hasta tal punto que resulta inabordable. De entre la obra de Shakespeare, Hamlet es probablemente la que suscita mayor interés a causa de su compleja estructura y su contenido ambiguo. Del mismo modo, la obra de Velázquez comenzó a estudiarse con rigor en el siglo XVIII, aunque hasta el siglo XX no se investigan sus características e influencias. Como en el caso de Shakespeare, la bibliografía existente en la actualidad sobre su obra resulta inaccesible para el investigador. De entre todas sus pinturas, Las Meninas, del mismo modo que Hamlet, es la que despierta mayor interés y tiene una proyección universal. Haciendo un recorrido por las investigaciones más importantes realizadas sobre ambas obras en los tres últimos siglos, intento encontrar semejanzas entre ellas, basándome fundamentalmente en su estructura. Apoyando mi investigación en la teoría deconstructivista, según la propuesta de J. Derrida, y siguiendo el esquema formal de ambas obras, propongo el tema general de apariencia y realidad como núcleo de sus semejanzas. Los puntos de analogía entre Hamlet y Las Meninas son, en síntesis, los siguientes: - Texto (expresado en el ser o no ser y el reverso del lienzo sobre el que pinta Velázquez. - El personaje del espectro en Hamlet y el personaje invisible en el cuadro (María Teresa de Austria o el espectador. - Velázquez significante representado en el cuadro y la obra dentro de la obra que representan los cómicos. - El personaje de Claudio, como símbolo del tirano y los reyes representados en el espejo. - Finalmente considero la vigencia y proyección que tienen ambas obras en el mundo actual.

  15. The African hind's (Cephalopholis taeniops, serranidae use of artificial reefs off sal island (Cape Verde: a preliminary study based on acoustic telemetry

    Directory of Open Access Journals (Sweden)

    Pedro G. Lino

    2011-01-01

    Full Text Available The African hind Cephalopholis taeniops (Valenciennes, 1828 is one of the most important commercial demersal species caught in the Cape Verde archipelago. The species is closely associated with hard substrate and is one of the main attractions for SCUBA divers. In January 2006 a former Soviet fishing vessel - the Kwarcit - was sunk off Santa Maria Bay (Sal Island. Young C. taeniops are commonly observed in this artificial reef (AR. In order to investigate the species' use of the AR, 4 specimens were captured and surgically implanted underwater with Vemco brand acoustic transmitters. The fish were monitored daily with an active telemetry receiver for one week after release. Simultaneously, an array of 3 passive VR2 / VR2W receivers was set for 63 days, registering data that allowed an analysis of spatial, daily and short term temporal activity patterns. The results showed site fidelity to the AR, with no migrations to the nearby natural reef. The method used allowed to register a consistent higher activity during daytime and a preference for the area opposite the dominant current.A garoupa-de-pintas Cephalopholis taeniops (Valenciennes, 1828 é uma das espécies demersais comerciais mais importantes no Arquipélago de Cabo Verde. Esta espécie está fortemente associada ao substrato rígido e constitui uma das principais atracções para os mergulhadores. Em Janeiro de 2006 um antigo navio de pesca soviético - Kwarcit - foi afundado ao largo da Baía de Santa Maria (Ilha do Sal. É comum observar juvenis de C. taeniops neste recife artificial (AR. Para investigar a utilização dos AR por esta espécie, foram capturados 4 exemplares nos quais foi implantado um transmissor acústico da marca Vemco, através de cirurgia realizada debaixo de água. Os peixes foram monitorizados através de um receptor de telemetria activo na semana após libertação. Simultaneamente foi instalada uma rede de 3 receptores passivos tipo VR2 / VR2W que registou dados

  16. The Oxidation State of Fe in Glasses from the Galapagos Archipelago: Variable Oxygen Fugacity as a Function of Mantle Source

    Science.gov (United States)

    Peterson, M. E.; Kelley, K. A.; Cottrell, E.; Saal, A. E.; Kurz, M. D.

    2015-12-01

    The oxidation state of the mantle plays an intrinsic role in the magmatic evolution of the Earth. Here we present new μ-XANES measurements of Fe3+/ΣFe ratios (a proxy for ƒO2) in a suite of submarine glasses from the Galapagos Archipelago. Using previously presented major, trace, and volatile elements and isotopic data for 4 groups of glass that come from distinct mantle sources (depleted upper mantle, 2 recycled, and a primitive mantle source) we show that Fe3+/ΣFe ratios vary both with the influence of shallow level processes and with variations in mantle source. Fe3+/ΣFe ratios increase with differentiation (i.e. decreasing MgO), but show a large variation at a given MgO. Progressive degassing of sulfur accompanies decreasing Fe3+/ΣFe ratios, while assimilation of hydrothermally altered crust (as indicated by increasing Sr/Sr*) is shown to increase Fe3+/ΣFe ratios. After taking these processes into account, there is still variability in the Fe3+/ΣFe ratios of the isotopically distinct sample suites studied, yielding a magmatic ƒO2 that ranges from ΔQFM = +0.16 to +0.74 (error < 0.5 log units) and showing that oxidation state varies as a function of mantle source composition in the Galapagos hotspot system. After correcting back to a common MgO content = 8.0 wt%, the trace element depleted group similar to MORB (ITD), and the group similar to Pinta (WD = high Th/La, Δ7/4, Δ8/4 ratios) show Fe3+/ΣFe ratios within the range of MORB (average ITD = 0.162 ± 0.003 and WD = 0.164 ± 0.006). Another trace element enriched group similar to Sierra Negra and Cerro Azul (ITE = enriched Sr and Pb isotopes) shows evidence of mixing between oxidized and reduced sources (ITE oxidized end-member = 0.177). This suggests that mantle sources in the Galapagos that are thought to contain recycled components (i.e., WD and ITE groups) have distinct oxidation states. The high 3He/4He Fernandina samples (HHe group) are shown to be the most oxidized (ave. 0.175 ± 0

  17. Picasso. L’ombre du récit portée sur le tableau (L’Ombre sur la femme et L’Ombre, 1953

    Directory of Open Access Journals (Sweden)

    Jacques Terrasa

    2009-05-01

    Full Text Available En 1927-29, puis de nouveau en 1953, Pablo Picasso représente l’ombre portée du peintre sur la toile. C’est d’abord le profil de son visage, inspiré d’un autoportrait photographique de 1927, qui semble esquiver, dans une dizaine de tableaux, les monstrueuses mâchoires qui caractérisent les visages féminins qu’il peint à cette époque. Vingt-cinq ans plus tard, l’ombre d’un corps que l’on imagine debout devant la scène, interfère avec un nu couché, dans un micro-récit pictural seulement composé de deux toiles, datées du 29 décembre. Mais si l’ombre semble bien impliquer un corps présent dans le contre-champ de l’image, celui de la femme n’est devenu, en cette fin de 1953, que la représentation d’une absence, une enveloppe vide que la peinture n’arrive plus à combler.En 1927-29, y luego en 1953, Pablo Picasso representa la sombra del pintor proyectada sobre el lienzo. Será primero el perfil de su rostro, inspirado en un autorretrato fotográfico de 1927, que parece esquivar, en una decena de cuadros, las monstruosas mandíbulas que caracterizan los rostros femeninos que pinta en este período. Veinticinco años después, la sombra de un cuerpo que uno imagina de pie delante de la escena, interfiere con un desnudo tendido, en un micro relato pictórico compuesto sólo de dos telas, fechadas del 29 de diciembre. Pero si la sombra bien parece implicar a un cuerpo presente en el contracampo de la imagen, el de la mujer se ha convertido, en ese final de 1953, en la representación de una ausencia, una envoltura vacía que la pintura ya no puede colmar.

  18. Potencialidade de um actinomiceto de rizosfera de tomateiro como agente de biocontrole de doenças Potenciality of an actinomycete from tomato rhizosphere as a biocontrol agent for tomato diseases

    Directory of Open Access Journals (Sweden)

    Renato Carrer Filho

    2009-09-01

    Full Text Available Um actinomiceto (Streptomyces setonii, isolado 'UFV-RD1', obtido de rizosfera de planta sadia de tomateiro, foi selecionado dentre outros 117, como promissor agente de biocontrole de enfermidades da cultura. Em testes de antagonismo in vitro contra patógenos do tomateiro, o isolado 'UFV-RD1' foi incapaz de inibir o crescimento de bactérias (Pseudomonas syringae pv. tomato, Ralstonia solanacearum, Pectobacterium carotovorum subsp. carotovorum, Xanthomonas campestris pv. vesicatoria mas inibiu a germinação de conídios de alguns fungos (Alternaria solani, Phytophthora infestans, Corynespora cassiicola, Stemphylium solani. Em ensaios de biocontrole experimental in vivo, em casa de vegetação, o actinomiceto foi efetivo em reduzir a severidade de sintomas no caso de patógenos fúngicos e bacterianos testados como desafiantes. A campo, quando A. solani e P. infestans ocorreram naturalmente, as plantas originárias de sementes microbiolizadas com propágulos da estirpe 'UFV-RD1' exibiram sintomas menos severos que as plantas controle para o caso da pinta preta. O agente de biocontrole é promissor para futuros protocolos de manejo integrado, como forma de reduzir a quantidade de defensivos utilizados.An actinomycete (Streptomyces setonii, isolate 'UFV-RD1', isolated from the rhizosphere of a healthy tomato plant was selected out of 117 as a promising biocontrol agent for tomato diseases. In in vitro antagonism tests against tomato pathogens, the isolate 'UFV-RD1' was unable to inhibit growth of bacterial pathogens (Pseudomonas syringae pv. tomato, Ralstonia solanacearum, Pectobacterium carotovorum subsp. carotovorum, Xanthomonas campestris pv. vesicatoria but inhibited conidium germination of fungi (Alternaria solani, Phytophthora infestans, Corynespora cassiicola, Stemphylium solani. Experimental biocontrol assays in a greenhouse indicated that the actinomycete was effective for reducing symptom severity in the case of bacteria and fungi tested

  19. Caraterización citogenética del pez tropical de agua dulce Parachromis managuensis (Pisces:Cichlidae

    Directory of Open Access Journals (Sweden)

    Lenin Arias-Rodriguez

    2006-03-01

    Full Text Available Para contribuir con el ordenamiento de las especies de la familia Cichlidae, se realizó el estudio citogenético de la mojarra pinta Parachromis managuensis. Fueron utilizados veintiún organismos, ocho machos y trece hembras,colectados en Villahermosa, Tabasco, México. Los especímenes se procesaron por técnicas citogenéticas convencionales (con ligeras modificaciones. Se obtuvieron campos mitóticos y meióticos de buena calidad, de los que fueron seleccionados catorce cariotipos para ser analizados merística y estadísticamente. Los especímenes presentaron número modal diploide de 2n=48 cromosomas, similar al reportado para otros cíclidos neotropicales. Cinco pares fueron cromosomas metacéntricos-submetacéntricos (birrámeos y 19 pares cromosomas subtelocéntricos-telocéntricos (monorrámeos,con número fundamental (NF de 58 brazos.El número haploide se ratificó por conteo de campos meióticos en metafase I. Los campos mitóticos observados y los cariotipos de machos y hembras no presentaron evidencias heteromórficas para identificar cromosomas sexuales.Citogenetic characterization of the tropical freshwater fish Parachromis managuensis (Pisces: Cichlidae. To describe the cytogenetics of the jaguar cichlid fish Parachromis managuensis, we collected eight males and 13 females in Villahermosa, Tabasco, México. The specimens were processed with standard cytogenetic techniques (slightly modified, and high quality fields of chromosomes in mitosis and meiosis were obtained; 14 of these fields were analyzed by meristics and statistics methods. The specimens presented a diploid modal number of 2n=48 chromosomes, which is similar to the number reported for others Central American cichlids; five pairs were submetacentric-metacentrics(biarmedand 19 were subtelocentric-telocentric (uni-armed,giving a fundamental number (NFof 58.The haploid number was confirmed by counting meiotic fields in metaphase I. There was not evidence of

  20. Qualidade de caqui 'Rama forte' após armazenamento refrigerado, influenciada pelos tratamentos 1-MCP e/ou CO2

    Directory of Open Access Journals (Sweden)

    João Peterson Pereira Gardin

    2012-12-01

    Full Text Available Avaliaram-se os efeitos dos tratamentos com CO2 e 1-MCP (1-metilciclopropeno sobre a adstringência (índice de tanino, firmeza da polpa e distúrbios da epiderme em caqui 'Rama Forte'. Frutos foram tratados com 1-MCP por 24 h, logo após a colheita e/ou com alto CO2 (70% por 24 ou 48 h, um dia após a colheita ou após o armazenamento refrigerado (AR. Os caquis foram armazenados sob atmosfera modificada a 0 ºC, por 45 dias, e a seguir mantidos a 23 ºC, por 9 dias. Frutos-controle (não tratados com 1-MCP nem com CO2 amoleceram em três dias e perderam aproximadamente 50% da adstringência em 6 dias após o AR. A exposição ao CO2 acelerou a redução da adstringência. Esse efeito do CO2 foi menor em frutos tratados com 1-MCP, especialmente quando o CO2 foi aplicado após o AR, por apenas 24 h. O tratamento com 1-MCP inibiu o amolecimento e a redução da adstringência, especialmente nos frutos não tratados com CO2. O amolecimento de frutos tratados com 1-MCP foi maior quando a exposição ao CO2 ocorreu antes do AR. A combinação dos tratamentos com 1-MCP e alto CO2 reduziu a incidência de podridões e manchas translúcidas, mas não alterou o desenvolvimento de pintas pretas ('estrias'. Os resultados indicam que é possível induzir perda da adstringência sem excessiva perda da firmeza da polpa de caquis 'Rama Forte' após o AR pela associação dos tratamentos com 1-MCP logo após a colheita e alto CO2 após o AR.

  1. Cultivares de batata para sistemas orgânicos de produção Potato cultivars for organic production systems

    Directory of Open Access Journals (Sweden)

    Fabrício Rossi

    2011-09-01

    Full Text Available Informações a respeito de cultivares adaptadas ao sistema de cultivo orgânico são escassas. O objetivo deste estudo foi avaliar, sob sistema de cultivo orgânico, genótipos nacionais e estrangeiros desenvolvidos para o cultivo convencional, quanto ao potencial produtivo, em condições de campo. O experimento foi conduzido em 2008, no Pólo APTA Leste Paulista, em Monte Alegre do Sul-SP. O delineamento experimental foi em blocos ao acaso, com 18 tratamentos e quatro repetições. Cada parcela foi constituída por 80 batatas-semente, dispostas em quatro linhas de 5 m de comprimento, espaçadas de 80 cm, com 25 cm entre tubérculos. Os genótipos avaliados foram Agata, Asterix, Caesar, Cupido, Éden, Melody, Novella e Vivaldi, de origem estrangeira; e Apuã, Aracy, Catucha, IAC Aracy Ruiva, Itararé, Monte Alegre 172, IAC 6090, APTA 16.5, APTA 15.20 e APTA 21.54, nacionais. Foram avaliadas as características de produtividade total e comercial de tubérculos, massa média total e comercial de tubérculos, teor de matéria seca e severidade da pinta-preta (Alternaria solani. Os clones APTA 16.5, APTA 21.54 e IAC 6090, e as cultivares Cupido, Apuã, Itararé e Monte Alegre 172 foram os mais produtivos. 'APTA 21.54' superou os demais em relação a produtividade comercial (18,07 t ha-1, sendo que 'APTA 16.5', 'Cupido', 'IAC 6090' e 'Itararé' formaram o segundo grupo. As maiores massas médias de tubérculos foram apresentadas pelas cultivares Itararé e Cupido. O clone IAC 6090 e as cultivares Aracy e Aracy Ruiva foram as que apresentaram maiores teores de matéria seca, com valor médio de 22,91%. 'APTA 16.5', 'Apuã', 'Aracy', 'Aracy Ruiva', 'Éden', 'Ibituaçú' e 'Monte Alegre 172' apresentaram alto nível de resistência à pinta-preta. As cultivares Itararé, Apuã e Cupido são adaptadas ao cultivo orgânico, e os clones avançados APTA 16.5, APTA 21.54 e IAC 6090 apresentam potencial de cultivo no sistema orgânico.Information regarding

  2. Dopamine modulates two potassium currents and inhibits the intrinsic firing properties of an identified motor neuron in a central pattern generator network.

    Science.gov (United States)

    Kloppenburg, P; Levini, R M; Harris-Warrick, R M

    1999-01-01

    The two pyloric dilator (PD) neurons are components [along with the anterior burster (AB) neuron] of the pacemaker group of the pyloric network in the stomatogastric ganglion of the spiny lobster Panulirus interruptus. Dopamine (DA) modifies the motor pattern generated by the pyloric network, in part by exciting or inhibiting different neurons. DA inhibits the PD neuron by hyperpolarizing it and reducing its rate of firing action potentials, which leads to a phase delay of PD relative to the electrically coupled AB and a reduction in the pyloric cycle frequency. In synaptically isolated PD neurons, DA slows the rate of recovery to spike after hyperpolarization. The latency from a hyperpolarizing prestep to the first action potential is increased, and the action potential frequency as well as the total number of action potentials are decreased. When a brief (1 s) puff of DA is applied to a synaptically isolated, voltage-clamped PD neuron, a small voltage-dependent outward current is evoked, accompanied by an increase in membrane conductance. These responses are occluded by the combined presence of the potassium channel blockers 4-aminopyridine and tetraethylammonium. In voltage-clamped PD neurons, DA enhances the maximal conductance of a voltage-sensitive transient potassium current (IA) and shifts its Vact to more negative potentials without affecting its Vinact. This enlarges the "window current" between the voltage activation and inactivation curves, increasing the tonically active IA near the resting potential and causing the cell to hyperpolarize. Thus DA's effect is to enhance both the transient and resting K+ currents by modulating the same channels. In addition, DA enhances the amplitude of a calcium-dependent potassium current (IO(Ca)), but has no effect on a sustained potassium current (IK(V)). These results suggest that DA hyperpolarizes and phase delays the activity of the PD neurons at least in part by modulating their intrinsic postinhibitory recovery

  3. Group I, II, and III mGluR compounds affect rhythm generation in the gastric circuit of the crustacean stomatogastric ganglion.

    Science.gov (United States)

    Krenz, W D; Nguyen, D; Pérez-Acevedo, N L; Selverston, A I

    2000-03-01

    We have studied the effects of group I, II, and III metabotropic glutamate receptor (mGluR) agonists on rhythm generation by the gastric circuit of the stomatogastric ganglion (STG) of the Caribbean spiny lobster Panulirus argus. All mGluR agonists and some antagonists we tested in this study had clear and distinct effects on gastric rhythm generation when superfused over combined oscillating or blocked silent STG preparations. A consistent difference between group I agonists and group II and III agonists was that group I agonists acted excitatory. The group I-specific agonists L-quisqualic acid and (S)-3,5-dihydroxyphenylglycine, as well as the nonspecific agonist (1S,3R)-1-aminocyclopentane-1, 3-dicarboxylic acid accelerated ongoing rhythms and could induce gastric rhythms in silent preparations. The group II agonist (2S,1'S, 2'S)-2-(carboxycyclopropyl)glycine (L-CCG-I) and the group III agonist L(+)-2-amino-4-phosphonobutyric acid (L-AP4) slowed down or completely blocked ongoing gastric rhythms and were without detectable effect on silent preparations. The action of L-CCG-I was blocked partially by the group-II-specific antagonist, (RS)-1-amino-5-phosphonoindan-1-carboxylic acid [(RS)APICA], and the group-III-specific antagonist (RS)-alpha-methyl-4-phosphonophenylglycine completely blocked the action of L-AP4. Besides its antagonistic action, the group-II-specific antagonist (RS)APICA had a remarkably strong apparent inverse agonist action when applied alone on oscillating preparations. The action of all drugs was dose dependent and reversible, although recovery was not always complete. In our experiments, the effects of none of the mGluR-specific agonists were antagonized or amplified by the N-methyl-D-aspartate (NMDA)-receptor-specific antagonist D(-)-2-amino-5-phosphonopentanoic acid, excluding the contamination of responses to mGluR agonists by nonspecific cross-reactivity with NMDA receptors. Picrotoxin did not prevent the inhibitory action of L-CCG-I and

  4. A multi-scale strategy for discovery of novel endogenous neuropeptides in the crustacean nervous system.

    Science.gov (United States)

    Jia, Chenxi; Lietz, Christopher B; Ye, Hui; Hui, Limei; Yu, Qing; Yoo, Sujin; Li, Lingjun

    2013-10-08

    The conventional mass spectrometry (MS)-based strategy is often inadequate for the comprehensive characterization of various size neuropeptides without the assistance of genomic information. This study evaluated sequence coverage of different size neuropeptides in two crustacean species, blue crab Callinectes sapidus and Jonah crab Cancer borealis using conventional MS methodologies and revealed limitations to mid- and large-size peptide analysis. Herein we attempt to establish a multi-scale strategy for simultaneous and confident sequence elucidation of various sizes of peptides in the crustacean nervous system. Nine novel neuropeptides spanning a wide range of molecular weights (0.9-8.2kDa) were fully sequenced from a major neuroendocrine organ, the sinus gland of the spiny lobster Panulirus interruptus. These novel neuropeptides included seven allatostatin (A- and B-type) peptides, one crustacean hyperglycemic hormone precursor-related peptide, and one crustacean hyperglycemic hormone. Highly accurate multi-scale characterization of a collection of varied size neuropeptides was achieved by integrating traditional data-dependent tandem MS, improved bottom-up sequencing, multiple fragmentation technique-enabled top-down sequencing, chemical derivatization, and in silico homology search. Collectively, the ability to characterize a neuropeptidome with vastly differing molecule sizes from a neural tissue extract could find great utility in unraveling complex signaling peptide mixtures employed by other biological systems. Mass spectrometry (MS)-based neuropeptidomics aims to completely characterize the neuropeptides in a target organism as an important first step toward a better understanding of the structure and function of these complex signaling molecules. Although liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS) with data-dependent acquisition is a powerful tool in peptidomic research, it often lacks the capability for de novo sequencing of

  5. Editorial de lanzamiento del Periódico Ambiente e Água

    Directory of Open Access Journals (Sweden)

    Getulio Teixeira Batista

    2006-08-01

    Full Text Available Lo que se espera es que el lanzamiento del Ambiente y Água sea más un servicio a la publicación científica en las áreas de la Ciencia involucradas en los recursos hídricos y ambientales del Brasil y del Mundo. Especialmente, lo que se espera es que Ambi-Água promocione la divulgación científica en la extensión internacional y, de ese modo, promocione la integración científica global. Este periódico publica artículos originales en portugués, inglés y español. En esta primera edición han sido publicados artículos en todas las tres lenguas originales de diferentes áreas de América (central y del sur. Esos artículos enfocaron la investigación de la relación de la temperatura superficial del mar con la pesca de langosta (Panulirus argus en aguas territoriales cubanas; la variabilidad de la respuesta hidrológica relacionada a fenómenos episódicos como El Niño y La Niña; la detección en tiempo casi real de la deforestación en la Amazonia; El efecto de diferentes niveles de irrigación y de fertilización nitrogenada en la productividad del trigo; la caracterización climática y el estudio de las tendencias en la serie temporal de la temperatura del aire y precipitación; y la evolución de espacio de áreas regadas en el medio Vale do Paraíba do Sul, el sureste de Brasil, haciendo una clara demostración del la interdisciplinaridad en la temática del periódico.

  6. Comparative phylogeography of the western Indian Ocean reef fauna

    Science.gov (United States)

    Borsa, Philippe; Durand, Jean-Dominique; Chen, Wei-Jen; Hubert, Nicolas; Muths, Delphine; Mou-Tham, Gérard; Kulbicki, Michel

    2016-04-01

    Panulirus homarus, small giant clam Tridacna maxima). Heterogeneous and often unbalanced sampling design, paucity of data in a number of cases, and among-species discrepancy in phylogeographic structure precluded any generalization regarding phylogeographic patterns. Nevertheless, the WIO might have been a source of haplotypes in some cases and it also harboured an endemic clade in at least one case. The present survey also highlighted likely cryptic species. This may eventually affect the accuracy of the current checklists of species, which form the basis of some of the recent advances in Indo-West Pacific marine ecology and biogeography.

  7. Dissolved Gases in Seawater and Sediments (Paper 7R0315)

    Science.gov (United States)

    Key, R. M.

    1987-07-01

    Certainly the most controversial results derived from the study of any dissolved gas concerned oxygen utilization rates in the North Atlantic. Jenkins (1982) estimated a net oxy-gen utilization rate (OUR) for the Beta triangle region of the North Atlantic (apices 26.5°N x 38.5°W, 32.5°N x 30.0°W, and 22.5°N x 28.5°W) of 5.7 moles of oxygen consumed m-2 yr-1 for the zone below 100m. He assumed that the oxygen distribution below the euphotic zone was stationary and steady state and therfore that the in situ oxygen consumption must be balanced by physical transport of oxygen into the area. His estimates were based on measured distributions of dissolved oxygen and the tracers 3He and 3H and a simple model which assumed lateral advection was small. The derived value or OUR was several times higher that previous estimates based on 14C and 15N incubation techniques. The OUR requires a downward flux of carbon from the photic zone of approximately 50 gCm-2yr-1 , which is again much higher that previous results. Jenkins and Goldman (1985) amplified the arguments in a study of seasonal oxygen cycling and primary production based on a ten year time series of measurements from the Panulirus station near Bermuda. Considering insolation, heat budgets and 3He/3H data they estimated a vertically integrated oxygen production rate of 5 Mm-2yr-1 and a subsequent new production of 50 gCm-2yr-1. The results were supported by calculations based on a second order turbulence closure model (Klein and Coste, 1984). These results have been challenged primarily on the basis of the spatial variability of the phenomenon!. Whatever the final outcome Jenkins has clearly demonstrated that the time has come to take a fresh look at oxygen utilization rates and primary productivity given the tools and modelling capabilities now at hand. The TTO data set will go a long way toward providing the necessary data set for the North Atlantic when the analyses are complete. Other studies have dealt with

  8. Picos de Europa National and Regional parks (Northern Spain): the karst underground landscape

    Science.gov (United States)

    Ballesteros, Daniel; Jiménez-Sánchez, Montserrat; Rodríguez-Rodríguez, Laura; José Domínguez-Cuesta, María; Meléndez-Asensio, Mónica; García-Sansegundo, Joaquín

    2015-04-01

    Karst caves represent an environmental with a high value from the Geoheritage and Geodiversity points of view given by hidden underground landscape practically reserved to the speleologists. Nevertheless, cave surveys, 3d models of caves and DEMs, and pictures can be used to approach the endokarst geoheritage characterization. The Picos de Europa National and Regional parks include the 14% of World's Deepest Caves (>1 km depth); moreover these parks shows a high environmental value related with seven protection figures: Biosphere Reserve, Special Protection Area, the Site of Community Importance, and four Natural Monument. The aim of this work is to present the Geoheritage values of the underground landscape of the Picos de Europa National and Regional parks. These parks involve several alpine karst massifs up to 700 km2 and 2,600 m asl, as the Picos de Europa mountains (declared Global Geosite by its geomorphological interest), the Mampodre Massif, and the Peñas Pintas and Yordas peaks (sited in Riaño dam area). The alpine karst involves a large underground landscape formed by more than 3,700 epigenic caves with 403 km of conduits. The 95 % of the cave conduits are located in the Picos de Europa mountains and correspond to caves up to 18.9 km length and 1.6 km depth; the 5 % of cave conduits are sited in other small karst areas and include caves up to 1.5 km length and 200 m depth. The karst caves present high natural, scientific and cultural values. The natural value corresponds to the singularity and the spectacular vertical development of the caves and a very high Geodiversity of cave features. The karst shows a high concentration of deep caves (81 caves deeper than 500 m) that is twice higher than the concentration of other karst areas, as Arabika Massif (Western Caucasus). The natural value is mainly related to the presence of geomorphological and hydrogeological features, highlighting high vadose canyons and shafts, old phreatic and epiphreatic conduits

  9. Ocorrência de doenças do tomateiro na região de Guanambi, BA

    Directory of Open Access Journals (Sweden)

    M. A. S. Guimarães

    2015-12-01

    Full Text Available As doenças do tomateiro são responsáveis por grandes prejuízos econômicos e a falta de conhecimento técnico no diagnóstico e controle dessas doenças onera os custos e limitam a sua produção. Esse trabalho tem como objetivo realizar um levantamento para identificação e registro de ocorrência de doenças do tomateiro na região de Guanambi, BA. O levantamento foi realizado nos Distritos de Morrinhos e Guirapá e nos Povoados de Brejos dos Padres e do Tanque. Para tanto, foram realizadas visitas nas áreas produtoras de tomate e para avaliação do histórico da área foi aplicado um questionário aos produtores. Amostras de plantas infectadas foram coletadas e levadas para análise no Laboratório de Fitopatologia do IFBaiano - Campus Guanambi ou enviadas para diagnóstico em Clinica Fitopatológica. Foram diagnosticadas nove doenças bióticas: vira cabeça do tomateiro (Tomato spotted wilt virus, oídio (Oidium sp., murcha de fusário (Fusarium oxysporum, requeima (Phytophthora infestans, mofo preto (Alternaria alternata, mancha de estenfílio (Stemphylium sp., mancha de cladospório (Fulvia fulva, pinta-preta (Alternaria solani e murcha bacteriana (Ralstonia solanacearum; e três doenças abióticas (podridão apical, deficiência de fósforo e murcha por asfixia nos cultivos de tomate. Dentre as doenças bióticas encontradas, o vira cabeça do tomateiro e o oídio foram as mais frequentes. Occurrence of diseases in tomato in the region of Guanambi, BahiaAbstract: The tomato diseases are responsible for great economic losses and the lack of technical knowledge in the diagnosis and control of these diseases onerous costs and limit their production. This work aims to conduct a survey to identify and record of the tomato diseases occurrence in the Guanambi region, Bahia state. The survey was conducted in Morrinhos, Guirapá, Brejo dos Padres and Tanque Districts. Therefore, visits were made in tomato producing areas and for the

  10. Qualidade de caqui 'Rama forte' após armazenamento refrigerado, influenciada pelos tratamentos 1-MCP e/ou CO2 Quality of 'Rama Forte' perssimon following cold torage influenced by 1-MCP and/or CO2treatments

    Directory of Open Access Journals (Sweden)

    João Peterson Pereira Gardin

    2012-12-01

    Full Text Available Avaliaram-se os efeitos dos tratamentos com CO2 e 1-MCP (1-metilciclopropeno sobre a adstringência (índice de tanino, firmeza da polpa e distúrbios da epiderme em caqui 'Rama Forte'. Frutos foram tratados com 1-MCP por 24 h, logo após a colheita e/ou com alto CO2 (70% por 24 ou 48 h, um dia após a colheita ou após o armazenamento refrigerado (AR. Os caquis foram armazenados sob atmosfera modificada a 0 ºC, por 45 dias, e a seguir mantidos a 23 ºC, por 9 dias. Frutos-controle (não tratados com 1-MCP nem com CO2 amoleceram em três dias e perderam aproximadamente 50% da adstringência em 6 dias após o AR. A exposição ao CO2 acelerou a redução da adstringência. Esse efeito do CO2 foi menor em frutos tratados com 1-MCP, especialmente quando o CO2 foi aplicado após o AR, por apenas 24 h. O tratamento com 1-MCP inibiu o amolecimento e a redução da adstringência, especialmente nos frutos não tratados com CO2. O amolecimento de frutos tratados com 1-MCP foi maior quando a exposição ao CO2 ocorreu antes do AR. A combinação dos tratamentos com 1-MCP e alto CO2 reduziu a incidência de podridões e manchas translúcidas, mas não alterou o desenvolvimento de pintas pretas ('estrias'. Os resultados indicam que é possível induzir perda da adstringência sem excessiva perda da firmeza da polpa de caquis 'Rama Forte' após o AR pela associação dos tratamentos com 1-MCP logo após a colheita e alto CO2 após o AR.This study evaluated the effects of CO2 and 1-MCP (1-methylcyclopropene treatments on astringency (tannin index, flesh firmness and skin disorders on 'Rama Forte' persimmon. Fruit were treated with 1-MCP for 24 h right after harvest and/or with high CO2 (70% CO2 balanced with air for 24 or 48 h, one day after harvest or after cold storage (CS. Fruit were stored in modified atmosphere for 45 days at 0ºC and then held at 23ºC for 9 days. Control fruit (untreated with neither 1-MCP nor CO2 softened in 3 days and lost about 50

  11. Marketing de banana: preferências do consumidor quanto aos atributos de qualidade dos frutos Marketing of banana: consumer preferences relating to fruit quality attributes

    Directory of Open Access Journals (Sweden)

    Fernando César Akira Urbano Matsuura

    2004-04-01

    Full Text Available O Brasil produz aproximadamente seis milhões de toneladas por ano de banana (Musa spp., com consumo médio da ordem de 35 kg/ habitante / ano. A aceitação da banana deve-se, principalmente, a seus aspectos sensoriais, valor nutricional e conveniência. A identificação das necessidades e desejos dos clientes consiste em uma atividade crítica do marketing. O objetivo deste trabalho foi o de pesquisar as preferências do consumidor de um mercado local (município de Cruz das Almas - Estado da Bahia considerando os atributos de qualidade dos frutos frescos de banana madura. A metodologia utilizada foi a da pesquisa descritiva por método estatístico. Os dados foram coletados por questionário, na forma de entrevista pessoal com 400 pessoas. Os atributos de qualidade (variáveis questionados e avaliados foram relacionados com a aparência, cor, textura, aroma, sabor e vida útil esperada dos frutos de banana. De acordo com a preferência dos consumidores entrevistados, o fruto de banana maduro ideal deve apresentar características como: penca contendo 10 a 12 dedos (frutos, dedos de tamanho médio ou grande, diâmetro médio, quina presente, ausência de pintas pretas na casca, cor da polpa amarelo-clara ou média, textura firme, aroma e sabor de intensidade média, mediamente doce e vida útil de 7 a 10 dias em condição ambiente. O sabor, vida útil e aparência dos frutos de banana são considerados os mais importantes atributos na escolha ou compra da banana, segundo os consumidores entrevistados.Brazil has an approximate production of six million annual tons of banana (Musa spp., with a consumption close to 35 kg / inhabitant / year. The acceptance of the banana fruit is due, mainly, to its sensorial aspects, nutritional value and convenience. The identification of the customers' needs and desires consists of a critical activity of the marketing. The objective of this work was to research the consumer preferences of a local market (Cruz

  12. Pinto Coloso, nueva variedad de frijol para el estado de Durango Pinto Coloso, a new dry bean variety for the State of Durango

    Directory of Open Access Journals (Sweden)

    Rigoberto Rosales Serna

    2010-12-01

    Full Text Available En Durango los productores agrícolas demandan variedades de frijol pinto con grano tolerante al oscurecimiento acelerado de la testa y tamaño mayor en relación con Pinto Saltillo, la cual es la variedad más popular actualmente. El objetivo fue generar variedades superiores a Pinto Saltillo en calidad comercial, tolerancia similar al oscurecimiento de la testa y mayor tamaño de grano. En el INIFAP-Durango se generó la variedad Pinto Coloso (PT08036, con el método genealógico, a partir de la cruza entre Pinto Mestizo y Pinto Saltillo [(Pinto Mestizo/Pinto Saltillo-69-2-2]. Esta variedad mostró rendimiento promedio de 1 715 kg ha-1 y fluctuaciones entre 923 kg ha-1 hasta 2 645 kg ha-1. En promedio Pinto Coloso, comparado con Pinto Saltillo, presentó mayor precocidad a floración (40 vs 45 días, madurez (81 vs 88 días y tamaño del grano (39 vs 30. El crecimiento de Pinto Coloso es de enredadera indeterminada, con guías cortas no trepadoras, la altura del dosel oscila entre 34 y 38 cm y la guía crece 75 cm. Pinto Coloso tiene granos de 48 g por 100 semillas y un intervalo de peso entre 30 y 48 g por cada 100 semillas. El grano es transversalmente elíptico, de forma externa elíptica-romboidal, color crema de la testa, pintas de color café y el hilio es amarillo-naranja. Pinto Coloso mostró tolerancia a la antracnosis y roya; así como valores medios y altos de susceptibilidad a tizón común y pudriciones de raíz. Esta variedad está en proceso de validación en terrenos de productores para establecer su adaptabilidad y potencial para incrementar la calidad del frijol pinto producido en México.In Durango, farmers demand pinto bean cultivars with slow darkening grains and larger seed size compared to Pinto Saltillo, which is currently the most popular variety. The aim was to generate commercially superior varieties showing slow darkening coat, earlier maturity and larger seed size in comparison to Pinto Saltillo. Pinto Coloso (PT

  13. A revision of the Axylus group of Agraeciini (Orthoptera: Tettigoniidae: Conocephalinae) and of some other species formerly included in Nicsara or Anthracites Revision of the Indo-Australian Conocephalinae, Part 3.

    Science.gov (United States)

    Ingrisch, Sigfrid

    2015-11-23

    Axylus group is used to include the five genera Axylus Stål, 1877, Anthracites Redtenbacher, 1891 sensu stricto, Eucoptaspis Willemse, 1966, Eulobaspis gen. nov., and Heminicsara Karny, 1912. It is mainly based on a combination of the characters shape of pronotum, spiniform meso- and metasternal lobes, and similar basic ground plans of the male cerci, titillators and female subgenital plates. The five genera together with two superficially similar genera Euanthracites gen. nov. and Sulasara gen. nov. are fully revised. Papuacites gen. nov. is proposed for two New Guinean species formerly included in Anthracites. Nicsara Walker, 1869 is restricted to Australian species; Spinisternum Willemse, 1942 is synonymised with Heminicsara Karny, 1912; Odontocoryphus Karny, 1907 based on two nymphs is synonymised with Macroxiphus Pictet, 1888; Pseudoliara Karny, 1907 described after one nymph is regarded incertae sedis. 40 new combination of species are proposed: Axylus bimaculatus (Redtenbacher, 1891) comb. nov., A. inferior (Brunner, 1898) comb. nov., A. inflatus (Brunner, 1898) comb. nov., A. loboensis (De Haan, 1842) comb. nov., A. minutus (Dohrn, 1905) comb. nov., A. nigrifrons (Brunner, 1898) comb. nov., A. philippinus (Hebard, 1922) comb. nov., A, taylori (Hebard, 1922) comb. nov., and A. thoracicus (Dohrn, 1905) comb. nov. (all from Nicsara); Euanthracites apoensis (Hebard, 1922) comb. nov., E. femoralis (Dohrn, 1905) comb. nov., E. rufus (Ingrisch, 1998) comb. nov., and E. tibialis (Karny, 1931) comb. nov. (from Anthracites); Eucoptaspis inexpectatus (Willemse, 1953) comb. nov. (from Gonatacanthus Karny, 1907); Eulobaspis dehaani (Karny, 1920) comb. nov., E. emarginata (Karny, 1926) comb. nov., E. moluccana (Redtenbacher, 1891) comb. nov., E. personata (Karny, 1926) comb. nov., E. quadrimaculata (Karny, 1926) comb. nov., E. rotundata (Karny, 1926) comb. nov., and E. strigatipes (Bolivar, 1898) comb. nov. (from Nicsara); Eulobaspis lobaspoides (Karny, 1907) comb. nov

  14. Progresso de doenças fúngicas e correlação com variáveis climáticas em mamoeiro Progress of fungal diseases and correlation with climatic variables in papaya

    Directory of Open Access Journals (Sweden)

    Márcio Shiguero Suzuki

    2007-06-01

    Full Text Available Avaliou-se o progresso de doenças fúngicas do mamoeiro e os efeitos dos fatores climáticos em três áreas experimentais: 1- área de produção de mamão conduzida no sistema convencional, que recebeu irrigação por gotejamento; 2- área de produção de mamão conduzida no sistema convencional, que recebeu irrigação por aspersão; 3- área de produção de mamão cultivada no sistema orgânico, com irrigação por microaspersão. Na área 1 foram avaliados três sistemas diferentes de condução: 1 sem a aplicação de fungicidas e sem sanitização das plantas (testemunha sem sanitização; 2 sem a aplicação de fungicidas e com sanitização das plantas (testemunha com sanitização; e 3 com a aplicação de fungicidas para o controle de doenças foliares e sem sanitização (padrão do produtor. Em cada sistema de condução foram demarcadas quatro parcelas (repetições com 20 plantas, sendo 10 plantas consideradas úteis. Foram avaliadas a incidência e a severidade da mancha-de-ascoquita, pinta-preta e do oídio como doenças foliares. Nos frutos, após a colheita foram avaliadas as incidências da antracnose, mancha-chocolate e podridão-peduncular. As epidemias da mancha-de-ascoquita ocorrem em temperaturas variando de 15 ºC a 20 ºC; para a pinta-preta as condições favoráveis ao desenvolvimento de epidemias foi temperatura variando de 25 ºC a 30 ºC e umidade relativa variando de 80 % a 100 %, sendo o pico da intensidade da doença ocorre entre os meses de novembro a março. Para o oídio, a faixa de temperatura que favoreceu a doença foi 15 ºC a 20 ºC e umidade relativa de 60 a 70 %. Em relação às podridões que incidiram nos frutos, observou-se que não houve relação entre a incidência da podridão-peduncular e a precipitação pluvial acumulada, 15 dias antes da avaliação ou no período de desenvolvimento do fruto (r The effect of climatic conditions on progress of fungal diseases of papaya were evaluated in

  15. Biogeochemical and ecological impacts of boundary currents in the Indian Ocean

    Science.gov (United States)

    Hood, Raleigh R.; Beckley, Lynnath E.; Wiggert, Jerry D.

    2017-08-01

    , though local wind forcing can lead to transient near shore current reversals and localized coastal upwelling. The poleward direction of this eastern boundary current is unique. Due to its high kinetic energy the Leeuwin Current sheds anomalous, relatively high chlorophyll, warm-core, downwelling eddies that transport coastal diatom communities westward into open ocean waters. Variations in the Leeuwin transport and eddy generation impact many higher trophic level species including the recruitment and fate of rock lobster (Panulirus cygnus) larvae. In contrast, the transport of the Agulhas Current is very large, with sources derived from the Mozambique Channel, the East Madagascar Current and the southwest Indian Ocean sub-gyre. Dynamically, the Agulhas Current is upwelling favorable; however, the spatial distribution of prominent surface manifestations of upwelling is controlled by local wind and topographic forcing. Meanders and eddies in the Agulhas Current propagate alongshore and interact with seasonal changes in the winds and topographic features. These give rise to seasonally variable localized upwelling and downwelling circulations with commensurate changes in primary production and higher trophic level responses. Due to the strong influence of the Agulhas Current, many neritic fish species in southeast Africa coastal waters have evolved highly selective behaviors and reproductive patterns for successful retention of planktonic eggs and larvae. For example, part of the Southern African sardine (Sardinops sagax) stock undergoes a remarkable northward migration enhanced by transient cyclonic eddies in the shoreward boundary of the Agulhas Current. There is evidence from the paleoceanographic record that these currents and their biogeochemical and ecological impacts have changed significantly over glacial to interglacial timescales. These changes are explored as a means of providing insight into the potential impacts of climate change in the Indian Ocean.

  16. Resistance to starvation of first-stage juveniles of the Caribbean spiny lobster

    Directory of Open Access Journals (Sweden)

    Alí Espinosa-Magaña

    2017-01-01

    Full Text Available The non-feeding postlarva (puerulus of spiny lobsters actively swims from the open ocean to the coastal habitats where it settles and molts to the first-stage juvenile (JI. Because pueruli use much of their energy reserves swimming and preparing for the post-settlement molt, the survival of JIs presumably depends on resuming feeding as soon as possible. To test this hypothesis, the resistance to starvation of JIs of the Caribbean spiny lobster, Panulirus argus, was evaluated by measuring their point-of-no-return (PNR, minimum time of initial starvation preventing recovery after later feeding and point-of-reserve-saturation (PRS, minimum time of initial feeding allowing for food-independent development through the rest of the molting cycle in a warm and a cold season. Each experiment consisted of eight groups: a continuously fed control (FC group, a continuously starved control (SC group, and six groups subjected to differential periods of either initial starvation and subsequent feeding (PNR experiments or initial feeding and subsequent starvation (PSR experiments. No JIs molted under continuous absence of food (SC. In both PNR experiments (temperature in warm season: 29.79 ± 0.07°C, mean ± 95% CI; in cold season: 25.63 ± 0.12°C mortality increased sharply after 9 d of initial starvation and intermolt periods increased with period of initial starvation, but were longer in the cold season. The PNR50 was longer in the warm season (12.1 ± 1.2 d, mean ± 95% CI than in the cold season (9.5 ± 2.1 d. In PRS experiments (temperature in warm season: 29.54 ± 0.07 °C; in cold season: 26.20 ± 0.12 °C, JIs that molted did so near the end of the feeding period; all JIs initially fed for up to 6 d succumbed, and no JIs molted after 13 d of starvation despite having fed previously. The PRS50 did not differ between the cold (13.1 ± 0.7 d and warm seasons (12.1 ± 1.1 d. JIs of P. argus exhibit a remarkable resistance to

  17. Resistance to starvation of first-stage juveniles of the Caribbean spiny lobster

    Science.gov (United States)

    Lozano-Álvarez, Enrique; Briones-Fourzán, Patricia

    2017-01-01

    The non-feeding postlarva (puerulus) of spiny lobsters actively swims from the open ocean to the coastal habitats where it settles and molts to the first-stage juvenile (JI). Because pueruli use much of their energy reserves swimming and preparing for the post-settlement molt, the survival of JIs presumably depends on resuming feeding as soon as possible. To test this hypothesis, the resistance to starvation of JIs of the Caribbean spiny lobster, Panulirus argus, was evaluated by measuring their point-of-no-return (PNR, minimum time of initial starvation preventing recovery after later feeding) and point-of-reserve-saturation (PRS, minimum time of initial feeding allowing for food-independent development through the rest of the molting cycle) in a warm and a cold season. Each experiment consisted of eight groups: a continuously fed control (FC) group, a continuously starved control (SC) group, and six groups subjected to differential periods of either initial starvation and subsequent feeding (PNR experiments) or initial feeding and subsequent starvation (PSR experiments). No JIs molted under continuous absence of food (SC). In both PNR experiments (temperature in warm season: 29.79 ± 0.07°C, mean ± 95% CI; in cold season: 25.63 ± 0.12°C) mortality increased sharply after 9 d of initial starvation and intermolt periods increased with period of initial starvation, but were longer in the cold season. The PNR50 was longer in the warm season (12.1 ± 1.2 d, mean ± 95% CI) than in the cold season (9.5 ± 2.1 d). In PRS experiments (temperature in warm season: 29.54 ± 0.07 °C; in cold season: 26.20 ± 0.12 °C), JIs that molted did so near the end of the feeding period; all JIs initially fed for up to 6 d succumbed, and no JIs molted after 13 d of starvation despite having fed previously. The PRS50 did not differ between the cold (13.1 ± 0.7 d) and warm seasons (12.1 ± 1.1 d). JIs of P. argus exhibit a remarkable resistance to starvation

  18. Dinámica espacio-temporal del esfuerzo en una pesquería de buceo artesanal multiespecífica y sus efectos en la variabilidad de las capturas: Implicaciones para el manejo sostenible

    Directory of Open Access Journals (Sweden)

    Helven Naranjo Madrigal

    2014-12-01

    Full Text Available Las pesquerías artesanales asociadas a métodos de buceo son fuente de ingreso, empleo y seguridad alimentaria de zonas costeras en muchos países. Los altos precios y la poca movilidad de especies bénticas capturadas por buceo enfrentan retos cada vez mayores en su aprovechamiento y manejo, esto demanda un entendimiento integral de estas pesquerías en diferentes contextos, incluyendo la dinámica espacial y temporal del esfuerzo pesquero, las artes y las especies. En el presente estudio se busca elucidar si existen diferencias en las estrategias de pesca desarrolla- das por pescadores que emplean buceo en dos modalidades (hookah y buceo libre. También se busca conocer si se desarrollan adaptaciones de estas estrategias en el tiempo, bajo qué condiciones y el posible efecto de las estrategias sobre las capturas. Para ese fin se analizó información detallada de las operaciones de pesca de embarcaciones artesanales que operan en la costa del océano Pacífico de Costa Rica durante dos temporadas de pesca. Se analizó información obtenida a bordo de embarcaciones como: sitio de pesca, composición de especies, tiempo de pesca, número de inmersiones por viaje, entre otros; y se aplicaron entrevistas a buzos al momento de las descargas para obtener información de precios, el volumen de las especies capturadas y forma de operación de los pescadores. Para el buceo con hookah se obtuvo una muestra del 69.3% del total de viajes en las dos temporadas de pesca y en el caso del buceo libre se obtuvo una muestra del 41.9% del total de viajes en las dos temporadas de pesca estudiadas (2007-2008 y 2011-2012. Se identificaron más de 15 especies en cada temporada de pesca, dominaron tres categorías en ambas temporadas pero con diferencias en las proporciones obtenidas en cada caso: langosta (Panulirus gracilis, pulpo (Octopus sp y pez loro (Scarus perrico y S. Ghobban. Resalta un componente importante de captura retenida por los pescadores para

  19. Resistance to starvation of first-stage juveniles of the Caribbean spiny lobster.

    Science.gov (United States)

    Espinosa-Magaña, Alí; Lozano-Álvarez, Enrique; Briones-Fourzán, Patricia

    2017-01-01

    The non-feeding postlarva (puerulus) of spiny lobsters actively swims from the open ocean to the coastal habitats where it settles and molts to the first-stage juvenile (JI). Because pueruli use much of their energy reserves swimming and preparing for the post-settlement molt, the survival of JIs presumably depends on resuming feeding as soon as possible. To test this hypothesis, the resistance to starvation of JIs of the Caribbean spiny lobster, Panulirus argus, was evaluated by measuring their point-of-no-return (PNR, minimum time of initial starvation preventing recovery after later feeding) and point-of-reserve-saturation (PRS, minimum time of initial feeding allowing for food-independent development through the rest of the molting cycle) in a warm and a cold season. Each experiment consisted of eight groups: a continuously fed control (FC) group, a continuously starved control (SC) group, and six groups subjected to differential periods of either initial starvation and subsequent feeding (PNR experiments) or initial feeding and subsequent starvation (PSR experiments). No JIs molted under continuous absence of food (SC). In both PNR experiments (temperature in warm season: 29.79 ± 0.07°C, mean ± 95% CI; in cold season: 25.63 ± 0.12°C) mortality increased sharply after 9 d of initial starvation and intermolt periods increased with period of initial starvation, but were longer in the cold season. The PNR50 was longer in the warm season (12.1 ± 1.2 d, mean ± 95% CI) than in the cold season (9.5 ± 2.1 d). In PRS experiments (temperature in warm season: 29.54 ± 0.07 °C; in cold season: 26.20 ± 0.12 °C), JIs that molted did so near the end of the feeding period; all JIs initially fed for up to 6 d succumbed, and no JIs molted after 13 d of starvation despite having fed previously. The PRS50 did not differ between the cold (13.1 ± 0.7 d) and warm seasons (12.1 ± 1.1 d). JIs of P. argus exhibit a remarkable resistance to starvation

  20. A systematic revision of Operclipygus Marseul (Coleoptera, Histeridae, Exosternini

    Directory of Open Access Journals (Sweden)

    Michael Caterino

    2013-02-01

    . panamensis (Wenzel & Dybas, 1941], O. sejunctus group [O. depressus (Hinton, 1935, O. itoupe sp. n., O. juninensis sp. n., O. pecki sp. n., O. punctiventer sp. n., O. sejunctus (Schmidt, 1896 comb. n., O. setiventris sp. n.], O. mortavis group [O. ecitonis sp. n., O. mortavis sp. n., O. paraguensis sp. n.], O. dytiscoides group [O. carinisternus sp. n., O. crenulatus sp. n., O. dytiscoides sp. n., O. quadratus sp. n.], O. dubitabilis group [O. dubitabilis (Marseul, 1889, O. yasuni sp. n.], O. angulifer group [O. angulifer sp. n., O. impressifrons sp. n.], O. dubius group [O. andinus sp. n., O. dubius (Lewis, 1888, O. extraneus sp. n., O. intermissus sp. n., O. lunulus sp. n., O. occultus sp. n., O. perplexus sp. n., O. remotus sp. n., O. validus sp. n., O. variabilis sp. n.], O. hospes group [O. assimilis sp. n., O. belemensis sp. n., O. bulbistoma sp. n., O. callifrons sp. n., O. colombicus sp. n., O. communis sp. n., O. confertus sp. n., O. confluens sp. n., O. curtistrius sp. n., O. diffluens sp. n., O. fusistrius sp. n., O. gratus sp. n., O. hospes (Lewis, 1902, O. ibiscus sp. n., O. ignifer sp. n., O. impositus sp. n., O. incisus sp. n., O. innocuus sp. n., O. inquilinus sp. n., O. minutus sp. n., O. novateutoniae sp. n., O. praecinctus sp. n., O. prominens sp. n., O. rileyi sp. n., O. subterraneus sp. n., O. tenuis sp. n., O. tiputinus sp. n.], O. farctus group [O. atlanticus sp. n., O. bidessois (Marseul, 1889, O. distinctus (Hinton, 1935, O. distractus (Schmidt, 1896 comb. n., O. farctissimus sp. n., O. farctus (Marseul, 1864, O. gilli sp. n., O. impressistrius sp. n., O. inflatus sp. n., O. latemarginatus (Bickhardt, 1920 comb. n., O. petrovi sp. n., O. plicatus (Hinton, 1935 comb. n., O. prolixus sp. n., O. punctifrons sp. n., O. proximus sp. n., O. subrufus sp. n.], O. hirsutipes group [O. guianensis sp. n., O. hirsutipes sp. n.], O. hamistrius group [O. arquus sp. n., O. campbelli sp. n., O. chiapensis sp. n., O. dybasi sp. n., O. geometricus (Casey, 1893 comb. n

  1. Characterization of Sugars and Organic Acids in Commercial Varieties of Table Grapes Caracterización de Azúcares y Ácidos Orgánicos en Variedades Comerciales de Uva de Mesa

    Directory of Open Access Journals (Sweden)

    Pablo Muñoz-Robredo

    2011-09-01

    los atributos primordiales para su consumo fresco. Sin embargo, la mayor��a de los estudios realizados al respecto se han desarrollado en uva para la producción de vino, la cual crece, se cultiva y se procesa de manera diferente a la uva de mesa. Por lo tanto, el objetivo del presente trabajo se centró en caracterizar los cambios en azúcares y ácidos orgánicos a lo largo de su desarrollo en las variedades ‘Thompson Seedless’, ‘Red Globe’, y ‘Crimson Seedless’, producidas bajo las mismas condiciones agroclimáticas. Para cada variedad se realizaron muestreos semanales desde 2 semanas previas a pinta hasta la cosecha comercial. Los azúcares y ácidos orgánicos fueron cuantificados mediante cromatografía líquida de alto rendimiento (HPLC equipados con detectores evaporativos de dispersión de la luz (ELSD y ultra violeta, respectivamente. El rango de concentraciones de ácidos y azúcares encontrados en uva fueron los siguientes: ácido tartárico, 1,28-7,45 g L-1; ácido málico, 0,38-29,92 g L-1, ácido cítrico trazas-1,03 g L-1; fructosa, 0,15-8,74 g (azúcar 100 g (uva-1; glucosa, 0,19-8,71 g (azúcar 100 g (uva-1 and sacarosa 0.02-0.91 g (azúcar 100 g(uva-1. Entre los azúcares, glucosa fue la más abundante en etapas tempranas y luego disminuyó hasta el período de cosecha, cuando la cantidad de fructosa y glucosa converge en un promedio de 47% para cada azúcar. A pesar de que los ácidos orgánicos alcanzaron un nivel constante entre 3 a 4 semanas antes de su cosecha, existen diferencias importantes en el perfil de ácidos orgánicos entre las variedades, con ‘Thompson Seedless’ mostrando la más baja relación de ácidos tartárico/málico de 1,19. Estas diferencias son un punto importante al considerar el sabor general para cada variedad.

  2. Reindeer husbandry and local planning

    Directory of Open Access Journals (Sweden)

    Lars P. Niia

    1986-06-01

    åmna forslag på hur samebyns interessen kan båtre tillvaratas och hur den kan oka sitt inflytande i planeringssammanhang. På grundval av framkomna resultat foreslås: —att samebyn skapar egen kompetens. Det år fråga om att forbereda sig infor forandringar i omgivningen exvis i form av markanvåndnings- och utvecklingsplanering. —att samebyn bygger upp den egna organisationen. —att samebyn får ett mera breddat och fordjupat inflytande i det kommunala planerings- och beslutssystemet. Detta projekt och tidigare erfarenheter visar på att samråd som form for inflytande år svag och osåker.Poronhoito ja kunnallinen suunnittelu.Abstract in Finnish / Yhteenveto: Keskeinen teema poronhoidon yhteydesså on selkkaukset poronhoidon ja muiden taloudellisten hyotyjen vålillå kuten turismin, yhteiskunnan laajennuksen j.n.e. yhteisten pinta-alojen hyvåksikåytosså. Historiallinen, taannehtiva katsaus osoittaa, ettei tårna ongclma ole millåån tavalla joku uusi ilmio, vaan vanha teema vaihdellen ajassa ja alueilla. Sami Instituhttan erååsså tutkimusprojektissa on suoritettu tutkielma pitåen pååmåårånå: 1. koettaa kuvailla poronhoidon suunnitteluedellytykset, 2. koettaa selvittåå, miten poronhoidon edut otetaan talteen kunnallisessa, fyysilliscssa suunnittelussa, 3. loytåå ilmaisumuotoja siitå, miten poronhoidon maa-alueen kåytto voidaan kuvailla, 4. jåttåå ehdotuksia siitå, miten paliskunnan etuja voidaan paremmin ottaa talteen sckå miten se voi lisåtå vaikutusvaltaansa suunnittelun yhteydesså. Esilletulleiden tulosten perusteella ehdotetaan:— ettå paliskunta muodostaa oman toimivallan. On kysymys valmistautua ympåriston muutoksiin esimerkiksi maa-alueen kåyton- ja kehityssuunnittelussa, — ettå paliskunta perustaa oman jårjeston, — ettå paliskunta saa leveåmmån ja syvemmån vaikutusvallan kunnallisessa suunnittelu- ja pååtoselimesså. Tamd projekti ja aikaisempi kokemus osoittaa, ettå neuvottelu vaikutusvaltaisena on hcikkoa ja epåvarmaa.

  3. Macroscopical and microscopical studies of the common bile duct in reindeer (Rangifer tarandus tarandus L

    Directory of Open Access Journals (Sweden)

    Timo Rahko

    1990-08-01

    . Sisäosan muodostaa poimuuntunut limakalvo. Limakalvoa ympäröivät sidekudossäikeet ja serosa, sappikäytävän loppuosassa myös lihassäikeistö. Seinämässä havaittiin yksittäisiä valkosoluja ja imusolukasautumia. Poikkeuksellisena anatomisena piirteenä voidaan pitää haimasaarekkeiden esiintymistä sappikäytäväseinämän kudoksissa jopa läheisessä kosketuksessa pintaepiteeliin. Limakalvon epiteelikudos on sekä pinta- että rauhassolukkoa, joka erittää limaa. Epiteelissä tunnistettiin lukuisia kerässoluja huolimatta siitä, että poroille oli suoritettu loishäätö edellisenä syksynä.Studier av gallgången (ductus hepaticus communis hos ren.Abstract in Swedish / Sammandrag: Den gemensamma gallgångens histologi och sekretoriska funktion hos renen har inte tidigare beskrivits. För att klarlägga den makroskopiska byggnaden och topografin av den gemensamma gallgången (ductus hepaticus communis undersöktes dessa i 25 renar. Väggen i 20 gallgånger granskades histologiskt. Undersökningarna visade att ductus pancreaticus mynnar ut i ductus hepaticus communis bildande en gemensam utforselgång till duodenum. Ductus hepaticus communis är c. 2-3 mm i diameter och 3-5 cm lång. Den elastiska gangens vägg är c. 1 mm tjock delvis omgiven av fett- och pankreasvävnad. Gangens vägg består av serosa, bindvävsfibrer och nära mynningen ses muskelfibrer. Insidan av gången är beklädd med en veckad slemhinna. Lymfatisk vävnad och enstaka lymfocyter observeras. Anmärkningsvärt är att pankreasvävnad förekommer i gallgångens vägg och under slemhinnan. Slemhinnans epitel består av yt- och körtelepitel som avsöndrar slem. De globulära leukocyterna var talrika i epitelet trots att renarna avmaskats på hösten.

  4. Feijoeiro manteiga, planta-teste para os vírus de vira-cabeça e da necrose branca do fumo A bean variety useful as a local-lesion test plant for tomato spotted wilt and Brazilian tobacco streak viruses

    Directory of Open Access Journals (Sweden)

    A. S. Costa

    1957-01-01

    Full Text Available Entre cêrca de 200 variedades de feijoeiro ensaiadas, a Manteiga foi mais sensitiva aos vírus de vira-cabeça e da necrose branca, formando, nas fôlhas primárias, lesões locais adequadas para contagens. Com o vírus de vira-cabeça as lesões locais apareceram de 3 -6 dias após as inoculações, sob a forma de manchas cloróticas, às vezes com anéis necróticos; com o vírus da necrose branca as lesões se manifestaram em 1 - 4 dias, sob a forma de pontuações necróticas, pequenos anéis necróticos ou, em casos de certas estirpes do vírus, como pintas cloróticas. Feijoeiros com as fôlhas primárias tendo 2/3 de sua expansão ou mais desenvolvidas deram melhores resultados para o vírus de vira-cabeça; para o vírus da necrose branca os melhores resultados foram obtidos com fôlhas que tinham 2/3 ou ligeiramente menos de sua expansão total. O vírus de vira-cabeça não se tornou sistêmico em plantas inoculadas mecanicamente. A maioria das estirpes do vírus da necrose branca também não se tornou sistêmica em feijoeiros inoculados mecanicamente. Uma estirpe amarela deste tem a capacidade de se tornar sistêmica em feijoeiros sob determinadas condições. O sulfito de sódio em solução 0,0125 M, usado na extração do inóculo, aumentou ligeiramente o número de lesões formadas nas fôlhas do feijoeiro Manteiga pelo vírus de vira-cabeça; aumento consideravelmente maior foi obtido com a extração em presença de búfer de fosfato 0,1 M com pH 7, sendo êsse efeito atribuído a um aumento da sensitividade da planta-teste. A mistura de ambos causou aumento igual ou ligeiramente menor que o búfer só. Para o vírus da necrose branca a presença de sulfito de sódio 0,0125 M durante a extração aumentou consideravelmente o número de lesões, sendo esse efeito atribuído à diminuição na perda de atividade do vírus, devida à oxidação; o búfer sozinho ocasionou pequeno aumento em comparação com a testemunha, mas a

  5. The Guadalupian Fauna

    Science.gov (United States)

    Girty, George H.

    1908-01-01

    The first descriptions of the Guadalupian fauna were published nearly fifty years ago. This early account of Shumard's was meager enough, but gave promise of a facies interesting and novel among the known Carboniferous faunas of North America. The following pages add largely to our knowledge of Guadalupian life, and I believe more than make good any promise contained in the previous account. Nevertheless, even the collections of the Guadalupian fauna here described fail to do justice to its richness and diversity, and the present report is completed with the hope of returning to the subject after another visit to the Guadalupe Mountains. Although a description of this range and the adjacent region can be found elsewhere, a repetition of the more important facts will conduce to a better understanding of the geologic relations of the fauna described herein and will serve to illustrate the references to localities and horizons necessarily involved in the paleontologic discussion. The Guadalupe Mountains are situated chiefly in southeastern New Mexico, but extend across the border for a short distance into the trans-Pecos region of Texas. Save only for this southern extreme both their geology and their topography are practically unknown, and it should be understood that anything hereafter said of them relates only to that portion. These mountains form a north-south range of considerable height, which rises abruptly from an arid and treeless plain, stretching westward to more mountainous elevations, the Cornudas Mountains and the Sierra Tinaja Pinta. This plain is locally known as Crow Flats and forms a part of the Salt Basin (Pl. I). It is now used as cattle ranges, water being raised by windmills. The only permanent surface water consists of salt lakes - broad, shallow pools incrusted with saline deposits, which in the early days were extensively sought for domestic use. This water is of course unfit for consumption, but cattle seem as a rule not to mind the less

  6. Electron microscopical studies of the common bile duct in reindeer

    Directory of Open Access Journals (Sweden)

    Timo Rahko

    1990-08-01

    Full Text Available In a previous publication the authors have described some ultrastructural characteristics of granulated cells in the common bile duct of the reindeer. On the basis of the same material, electron microscopic observations on other tissue elements of bile duct wall are now reported. The surface and glandular epithelium were composed of tall columnar epithelial cells with villous structures on the luminal surfaces. The parietal cytoplasmic membranes of epithelial cells were equipped with intercellular desmosomes while intraepithelial globule leucocytes did not form any junctional complex with other cells. Apical cytoplasmic areas of superficial epithelial cells showed electron-dense small bodies possibly consisting of mucinous substances. The goblet and deep glandular cells, on the other hand, contained numerous large mucin granules with less electron-dense matrices. It appears that their secretions are more abundant than those in superficial epithelial cells which obviously are absorptive as their main function. The nuclei and other cytoplasmic organelles showed profiles similar to those in epithelial cells generally. The lumen of the bile ducts was usually empty or contained fine-granular or amorphous material. An unusual feature was the presence of parts of globule leucocytes or even almost whole cells occurring freely in ductal secretions.Elektronimikroskooppinen tutkimus yhteisen sappikäytävän rakenteesta porolla.Abstract in Finnish / Yhteenveto: Aikaisemmassa julkaisussa tekijät kuvasivat poron yhteisen sappikäytävän (ductus hepaticus communis seinämän jyväsellisten solujen hienorakennetta. Tässä artikkelissa selostetaan saman aineiston perusteella (6 tervettä teurasporoa elektronimikroskooppisia havaintoja sappikäytäväseinämän muista kudosrakenteista. Sappikäytäväseinämän pinta- ja rauhasepiteeli koostuu korkeista epiteelisoluista. Pinnallisia epiteelisoluja kattavat säännölliset mikrovillukset, ja niillä on vain v

  7. Organic and conventional tomato cropping systems Sistemas de cultivo orgânico e convencional de tomateiro

    Directory of Open Access Journals (Sweden)

    Wagner Bettiol

    2004-06-01

    ência de manchas foliares causadas por Septoria lycopersici e Xanthomonas vesicatoria, entretanto a pinta preta e a podridão de frutos causados por Alternaria solani ocorreram em maiores proporções. Não foram observadas diferenças quanto às comunidades de fungos e bactérias do filoplano e quanto à ocorrência de plantas invasoras.

  8. Régimen espacial y temporal de la captura y el esfuerzo pesquero en la pesquería artesanal de la Isla De San Andrés, Caribe colombiano: inferencias sobre la estructura de la comunidad íctica

    Directory of Open Access Journals (Sweden)

    García Camilo

    2006-06-01

    Full Text Available El diseño conceptual involucró un enfoque sistémico, abarcando los siguientes componentes: a Descripción del sistema pesquero: la población pesquera artesanal fue estimada en 307, y concentra sus actividades en cuatro sitios pesqueros. Los pescadores tienen edades que oscilan en general entre los 41 y 51 años, presentan bajo grado de escolaridad y tienen ingresos entre 1,0 y 2,5 SMLMV. La pesquería es multiespecífica y está dirigida a la extracción de diferentes especies de peces, el molusco Strombus gigas y la langosta Panulirus argus. El arte de pesca dominante es la línea de mano con anzuelo seguido del arpón. La flota artesanal es de 120 embarcaciones. El producto es comercializado en el sitio pesquero y adquirido por intermediarios que se encargan de su venta al consumidor final. b Régimen de pesca: la producción anual de pescado fue estimada en 303.662 kg y el esfuerzo
    en 5.197 faenas de pesca. En la Asociación Mutual de Pescadores, principal sitio pesquero, se estimó una captura de 156.602 kg, siendo las áreas de pesca más importantes Southeast Bank y Northend Bank que aportan el 55,5%. Las capturas estuvieron compuestas por más de 60 especies, de las cuales siete aportan el 86,2%, particularmente: T. atlanticus (23,8%, O. chrysurus (17,9%, A. solandri (11,7%, E. bipinnulata (11,3%, S. barracuda (9,7%, C. sufflamen (7,1% y C. hippurus (4,8%. El esfuerzo anual fue de 3.675 faenas, siendo las áreas más visitadas Northend Bank (53,3% y Southeast Bank (17,3% y los meses de mayor esfuerzo febrero (12,1% y marzo (10,6%. La captura por unidad de esfuerzo (CPUE mostró diferencia entre las áreas de pesca, fue mayor en el meridiano 82 y menor en las áreas adyacentes a San Andrés. La CPUE registró variaciones significativas a lo largo del año con valores altos entre mayo y septiembre, y bajos en noviembre y marzo. No hubo correlación significativa entre las variables meteorológicas y la CPUE, mientras que respecto a

  9. La pesca artesanal en las islas de Providencia y Santa Catalina (Caribe Colombiano: distribución espacial y temporal de los recursos capturados con línea de mano

    Directory of Open Access Journals (Sweden)

    Santos Martínez Adriana

    2004-12-01

    "turbit" Canthidermis sufflamen (1.792 kg. El 45% (8.055 kg de la CT mediante buceo correspondió a peces, 33 especies, seguido por los crustáceos, cuatro especies, con un 39% (7.041 kg y los moluscos, una especie el 16% (2.876 kg, siendo aquellas con mayor CT estimada el "craw fish" Panulirus argus (6.815 kg, el "conch" Strombus gigas (2.876 kg, el "red snapper" Lutjanus jocu (2.715 kg, el "margate" Haemulon album (1.285 kg y el "hog fish"  Lachnolaimus maximus (562 kg. La CT estimada para las nasas fue de 5.608 kg, las especies con mayor captura total fueron H. album (886 kg, el "doctor fish" Acanthurus coeruleus (662,8 kg, el "grunt" H. sciurus (551 kg y el "yellow jack" Caranx bartholomaei (254 kg. El esfuerzo pesquero, la CPUE y las capturas mensuales (estimadas para los diferentes métodos de pesca artesanal utilizados en PSC no están relacionados con la precipitación ni la velocidad del viento. La información ecológica correspondiente a la línea de mano permitió establecer un esquema de distribución de las especies capturadas con línea de mano, en cuatro áreas, dentro de la plataforma insular hasta la isobata de los 200 m y el talud adyacente. Los peces demersales, en general, presentan dos épocas de abundancia relacionadas con los meses de baja precipitación o con la época seca, mientras que la abundancia de los pelágicos y demerso-pelágicos está más relacionada con la épocade lluvias fuertes. En el área definida como de plataforma somera (<5 0 m cinco especies demersales fueron importantes por su abundancia y biomasa en la captura mediante línea de mano, K. incisor, K. sectatrix, H. plumieri, B. vetula y C. calamus. La especie pelágica nerítica S. barracuda es muy importante en todo el complejo arrecifal desde las zonas someras hasta la plataforma y no hay una época marcada en su abundancia. O. chrysurus (demerso-pelágica, presentó sus mayores abundancias en la plataforma intermedia (50-100 m. Se identificaron como especies

  10. Reindeer husbandry and forestry in the reindeer herding district of Poikajärvi during the years 1963 — 1984

    Directory of Open Access Journals (Sweden)

    Katarina Kupiainen

    2010-06-01

    älttää. Laajat metsien avohakkuut ja aurakset ovat supistaneet erityisesti porojen talvilaitumia. Talvclla poro kaivaa jäkälää (Cladina sp.. lumen alta ja siirtyy hangen kovetessa syömään luppoa (Alectoria ja Bryoria spp.. Jäkäliköt ovat kuitenkin kovin kuluneita ja parhaat luppometsät on hakattu. Poikajärven paliskunnan (66°30' — 67°10'N pinta-ala on 2507 km2, josta valtionmaata 1 474.5 km2 (59%. Vuosien 1963 — 1984 keskimääräinen lukuporotiheys on ollut 1.5 poroa/km2. Viimeisen20 vuoden aikana on Poikajärven valtionmaan alasta käsitelty uudistushakkuilla, pääasiassa avohakkuilla, 9.8% ja kasvatushakkuilla 19.6%. Erilaisilla maanmuokkausmenetelmillä on käsitelty 8.7%, valtaosa auraamalla. Tuoreista kankaista on avohakattu ja aurattu noin 24%. Paliskunnan valtionmetsien arvioitu hakkuukertymä on vuodesta 1976, lähtien jatkuvasti kasvanut ja oli vuonna 1984 noin 140 600 m3. Vuodesta 1963 lähtien lukuporojen määrä on vähentynyt keskimäärin 60 porolla vuodessa. Määrä on vaihdellut 4939 ja 2866 poron välillä. Vuosina 1963 — 1984 on teurastettu keskimäärin 1 425 poroa vuodessa. Vasojen osuus teurastetuista on kasvanut ja viime vuosina se on ollut lähes 80%. Poronlihantuotanto on ollut keskimäärin 36 400 kg vuodessa. Porojen lis'äruokintaa on Poikajärven paliskunnassa harjoitettu vuodesta 1969 lähtien. Lisäruokintaan käytetyn heinän määrä on kasvanut noin 5.5 kg:sta lähes 20 kg:an lukuporoa kohti. Samanaikaisesti on lukuporojen ja teurastettujen määrä sekä lihantuotanto laskenut.

  11. Comentario al libro “Creación, Arte y Psiquis”

    Directory of Open Access Journals (Sweden)

    Fernando Sánchez Torres

    2004-06-01

    nchez Medina (Editor Académico Fernando Sánchez Torres psicoanálisis y sus aportaciones al mejor conocimiento de dicho proceso, sean temas abarcados en el libro.

    Por su formación psicoanalítica freudiana, es inevitable que en la explicación de ese enigma Sánchez Medina invoque la intervención de Eros y Tánatos, vida y muerte, que son para él energía del cosmos, y que, viéndolo bien, no es -el enigma de la creación- otra cosa que el ansia de inmortalidad que acompaña al ser viviente, tesis esta de la que se ocupó con profundidad don Miguel de Unamuno en su libro Del sentido trágico de la vida, donde no se habla de ansia sino de “hambre de inmortalidad”. Allí se lee: “El que escribe, pinta o esculpe, quiere, cuando menos, dejar una sombra de su espíritu, algo que sobreviva”. Por su parte, el académico Sánchez se pregunta: “¿Cuál es el papel de la creación ante la perspectiva de la muerte?” Su respuesta es dubitativa: “Tal vez sea permitirnos abandonar la vida en paz, dejando una realización que no muera, que dé continuidad al movimiento, a la transformación, a la vida misma”. Más adelante agrega que el acto creador permite a la personalidad creadora pasar de “la nada” y “el vacío” a ser “algo”. “La nada y el vacío –dice- pueden ser sentidos como miedo a la muerte, lo cual produce la ansiedad básica”. Conociendo lo prolífico que ha sido Guillermo Sánchez para crear libros, no queda duda de que esta ansiedad básica lo ha revestido del afán para superar la nada y el vacío...

  12. A SEM study of the reindeer sinus worm (Linguatula arctica

    Directory of Open Access Journals (Sweden)

    Sven Nikander

    2009-01-01

    remain obscure. Transmission electron microscopy should be employed to gain more information about this fascinating creature and its origin.Abstract in Finnish / Yhteenveto:Elektronimikroskooppinen tutkimus poron kielimadosta (Linguatula arctica Pentastomida (matoäyriäiset ovat ryhmä erikoisia parasiitteihin kuuluvia niveljalkaisia. Niitä kutsutaan usein kielimadoiksi, sillä monet ryhmään kuuluvista lajeista ovat muodoltaan kielimäisiä. Linguatula arctica, poron kielimato, on poron nenäonteloon liittyvissä sivuonteloissa elävä loinen. Se on ainoa tunnettu matoäyriäinen, jolla on sorkkaeläin pääisäntänä ja suora (ilman väli-isäntää tapahtuva elämänkierto. Tässä tutkimuksessa tarkasteltiin L. arctica -loisen pinta- ja sisärakenteita pyyhkäisyelektronimikroskoopin avulla. Loiset kerättiin Suomen lapista talvella 1991–92. Nenän sivuontelot tutkittiin loisten varalta noin 80 porosta, ja niistä löydettiin yhteensä 30 kielimatoa. Kielimatojen ulkonäkö oli tyypillinen Linguatula-suvun loisille. Ne olivat melanmuotoisia, läpikuultavia, vaalean kellertäviä, litteitä, ne vaikuttivat jaokkeisilta ja niillä oli pitkä loppua kohden kapeneva häntä. Suu sijaitsi vatsapuolella lähellä etupäätä, ja suuhun liittyneenä oli selvästi erottuva päämäinen uloke. Suuaukon tuntumassa, suuaukon molemmilla puolilla oli pari voimakkaasti kehittyneitä kynsimäisiä koukkurakenteita. Kielimadon ulkopinta koostui annulaarisista rakenteista, mistä johtuen se vaikutti jaokkeiselta. Loisen sivuissa, kunkin jaokkeen reunassa, oli tuntoelin, joka näkyi pyyhkäisyelektronimikroskoopilla kuppimaisena syvennyksenä. Jaokerenkaiden takareuna oli pienten, taaksepäin suuntautuneiden kitiinipiikkien karhentama. Koko ulkopinnan alueella nähtiin pieniä, pyöreitä painautumia, joiden todettiin olevan loisen pintaan avautuva kärkiosa niin kutsutuista kloridisoluista. Koiraskielimadon sukuaukko sijaitsi vatsapuolella takimmaisen koukkuparin k

  13. 红螯光壳螯虾酚氧化酶原基因的克隆与表达%cDNA cloning and expression analysis of prophenoloxidase in Cherax quadricarinatus

    Institute of Scientific and Technical Information of China (English)

    王丹丽; 左迪; 王兰梅; 李嘉尧; 赵云龙

    2013-01-01

    , H. americanus, H. gammarus and Panulirus longipes were in the same phylogenetic branch;The Realtime-PCR results showed that CqproPO was widely distributed,with the highest expression level in haemocytes, small amount of expression in intestine, antennal gland, gills, ovary and hepatopancreas, detectable expression level in stomach and muscle, while expression was almost undetectable in testis;The expression levels of prophenoloxidase (proPO) in haemocytes, hepatopancreas and gills from C. quadricarinatus were studied and compared by means of artificial WSSV infection. The results indicated that the expression level of CqproPO in the non-immunized infected group ( group Ⅱ ) and immunized infected group (group Ⅲ ) reached the maximum at 12 h and 24h, which was 1.3 -2. 55 times higher than that in the control group, and was noticeably higher than the controls (P < 0. 05). But the expression level of prophenoloxidase gene had sharply declined with the time extending of the infection. The expression level of proPO gene from crayfishes injected by immune polysaccharides before an infected virus (group Ⅲ ) were higher than the directly affected groups ( group Ⅱ ) in haemocytes, hepatopancreas and gills, showing an immunoprotective rate of 51. 86% 7 days after exposure. These observations indicated that the immunopotentiator could improve the innate anti-viral ability of the crustaceans against WSSV.%为深入了解红螯光壳螯虾酚氧化酶原(proPO)基因的非特异性免疫机制,利用RACE技术从红螯光壳螯虾血细胞中克隆到酚氧化酶原基因cqproPO,cqproPO基因cDNA全长为2 962 bp,开放阅读框为1 998 bp,编码665个氨基酸,其结构中含有两个铜离子结合位点,预测分子量为75.86 ku;同源性比对结果显示,红螯光壳螯虾CqproPO与克氏原螯虾酚氧化酶原的同源性最高为79%,其次是淡水螯虾74%、挪威龙虾69%、美国龙虾67%等;进化分析发现CqproPO与克氏原