WorldWideScience

Sample records for piau leporinus elongatus

  1. A new species of Leporinus Agassiz, 1829 from the upper Rio Paraná basin (Characiformes, Anostomidae with redescription of L. elongatus Valenciennes, 1850 and L. obtusidens (Valenciennes, 1837

    Directory of Open Access Journals (Sweden)

    Heraldo A. Britski

    2012-01-01

    Full Text Available Leporinus obtusidens Valenciennes, 1837 and L. elongatus Valenciennes, 1850 are redescribed based on the type specimens, including those of their junior synonyms, and recently collected specimens. Leporinus obtusidens is considered to be widespread, occuring in the river drainages of La Plata, São Francisco, and Parnaíba. Leporinus aguapeiensis Campos, 1945, described from the upper Rio Paraná, and L. silvestrii Boulenger, 1902, described from the Rio Paraguay, are considered junior synonyms of L. obtusidens. Leporinus elongatus is endemic to the Rio Jequitinhonha and Rio Pardo, two eastern Brazilian river basins, and the locality cited for the lectotype, Rio São Fransico, likely to be erroneous. Leporinus crassilabris Borodin, 1929, and L. crassilabris breviceps Borodin, 1929, both described from the Rio Jequitinhonha, are considered junior synynoms of L. elongatus. A new species of Leporinus, endemic to the upper Rio Paraná, very similar and sometimes mistaken with L. obtusidens, is formally described. In addition, comments on Leporinus pachyurus Valenciennes, 1850 and on L. bimaculatus Castelnau, 1855 are provided, and a lectotype for L. bimaculatus is selected.

  2. Cross-amplification of heterologous microsatellite markers in Rhamdia quelen and Leporinus elongatus

    Directory of Open Access Journals (Sweden)

    Nelson Mauricio Lopera-Barrero

    2016-02-01

    Full Text Available Native fish species in Brazil are an asset in fish farming, but their natural stocks have been significantly reduced in recent years. To mitigate this negative impact, studies on fish conservation are being conducted and genetic tools for the discrimination of population parameters are increasingly achieving great importance. Current analysis evaluates a set of microsatellite heterologous primers in the jundiá (Rhamdia quelen and in the piapara (Leporinus elongatus. Samples from the caudal fin of 15 broodstock from each species were analyzed. DNA extraction was performed with NaCl protocol and the integrity of the extracted DNA was checked with agarose gel 1%. Twenty primers developed for Piaractus mesopotamicus, Colossoma macropomum, Prochilodus lineatus, Brycon opalinus and Oreochromis niloticus were evaluated. Cross amplification of four primers of the B. opalinus and P. lineatus species (BoM12, Pli43 and Pli60 in R. quelen and BoM2, Pli43 and Pli60 in L. elongatus was assessed. Primers of P. mesopotamicus, C. macropomum and O. niloticus showed no cross amplification in the two species analyzed. Results revealed the possibility of using the four amplified heterologous primers in genetic studies for R. quelen and L. elongatus.

  3. Heterochromatin analysis in the fish species Liposarcus anisitsi (siluriformes and Leporinus elongatus (characiformes

    Directory of Open Access Journals (Sweden)

    Roberto Ferreira Artoni

    1999-03-01

    Full Text Available The chromosomes of two neotropical freshwater fish species, namely Liposarcus anisitsi (Siluriformes, Loricariidae and Leporinus elongatus (Characiformes, Anostomidae, were investigated by means of C-banding, Ag-NORs, fluorochrome staining and banding by hot saline solution (HSS treatment, to reveal patterns of heterochromatin differentiation. The karyotype of L. anisitsi is described for the first time. Staining with the GC-specific fluorescent antibiotic mithramycin (MM revealed bright signals in some C-banded blocks in both species, suggesting that these MM+ heterochromatin contains GC-rich DNA. Banding by denaturation employing HSS, followed by Giemsa staining, yielded corresponding results documenting the thermal stability of GC-rich DNA part of heterochromatin positive after C-banding. In L. elongatus the Ag-NOR also followed the above banding patterns. However, in L. anisitsi the Ag-NOR was MM+ but negatively stained after C-banding and HSS treatment. L. elongatus also showed C-banded segments that were negative for mithramycin staining and HSS treatment. The results obtained evidence the heterochromatin heterogeneity in these fish species.Cromossomos mitóticos de duas especies de peixes neotropicais, Leporinus elongatus (Characiformes e Liposarcus anisitsi (Siluriformes, foram estudados por diferentes métodos de bandamentos, com o intuito de investigar a diferenciação da heterocromatina. Enquanto que a macroestrutura cariotípica de L. elongatus já foi objeto de estudos anteriores, o cariótipo de L. anisitsi está sendo apresentado pela primeira vez. Em ambas as espécies, a coloração dos cromossomos com a mitramicina (MM, fluorocromo GC específico, evidenciou sinais brilhantes em alguns segmentos heterocromáticos também positivos ao bandamento C, sugerindo ser esta fração da heterocromatina rica em seqüências de bases GC. O tratamento dos cromossomos com solução salina aquecida e posterior coloração com Giemsa

  4. Embriogenesis and larval ontogeny of the "piau-gordura", Leporinus piau (Fowler (Pisces, Anostomidae after induced spawning

    Directory of Open Access Journals (Sweden)

    Fábio Luiz Borçato

    2004-03-01

    Full Text Available Mature males and females of Leporinus piau (Fowler, 1941 were induced to reproduce through a hypophysation process. Extrusion occurred 12 h or 312 hours-degree after the hypophysation, at a water temperature of 26°C. Fertilized eggs were maintained in incubators at 24°C. Embryonic development, was evaluated using every 10 minutes, fresh egg samples which were analyzed under stereoscopic microscope. The larvae were collected at 24-hour intervals for seven days after hatching, fixed in Bouin's fluid and were submitted to routine histological techniques. The eggs of L. piau were slightly gray, non-adhesive and round-shaped. After 1.5 h the embryo was at the 64-blastomere phase and showed a wide yolk region on the vegetative pole. Within 6.25 h, blastopore closure and the end of gastrula was observed. The differentiation of layers occurred after 7.5 h and hatching after 21 h after fertilization at 24°C or 504 hours-degree. During the first three days of the larvae development there was a gradual yolk sac reduction until its complete absorption on the fourth day, indicating the necessity of exogenous feeding. From the fourth to the seventh day, the final development of the heart, gill arches, swimblader, kidney, hepatopancreas, stomach and intestine were observed. The embryonic and larval development of L. piau were similar to other Anastomidae species.Reprodutores de Leporinus piau (Fowler, 1941 foram submetidos à reprodução induzida por hipofisação. A extrusão ocorreu com 312 horas-grau após hipofisação, com temperatura da água a 26ºC. Os ovos, após fertilização, foram mantidos em incubadoras à temperatura de 24ºC. Para acompanhar o desenvolvimento embrionário, coletaram-se amostras de ovos em intervalos de 10 minutos até a eclosão, as quais foram analizadas ao microscópio esteroscópio. As larvas foram coletadas em intervalos de 24 h durante sete dias após a eclosão, fixadas líquido de Bouin e submetidas a t

  5. Suplementação da dieta de alevinos de piauçu (Leporinus obtusidens com vitamina C Vitamin C supplementation of piauçu (Leporinus obtusidens fingerling diet

    Directory of Open Access Journals (Sweden)

    Ricardo Frankein de Mello

    1999-01-01

    Full Text Available O experimento teve como objetivo avaliar a influência da suplementação de vitamina C na dieta sobre o desempenho de alevinos de piauçu (Leporinus obtusidens. Um primeiro ensaio (105 dias testou o efeito da suplementação de níveis crescentes de L-ácido ascórbico (0, 50, 150, 250, 350, 450, 550, 650, 750 e 850 mg/kg na dieta sobre ganho de peso e sobrevivência, num delineamento inteiramente ao acaso. Não houve diferenças significativas (P > 0,4054 entre os tratamentos, tanto para ganho de peso como sobrevivência. Num segundo ensaio avaliou-se a influência da vitamina C na resistência dos alevinos à hipoxia. Grupos de dez peixes aleatoriamente selecionados de cada tratamento do primeiro ensaio foram estocados em gaiolas, num delineamento em blocos ao acaso. A suplementação com vitamina C na dieta não afetou (P > 0,4032 a sobrevivência dos alevinos submetidos a hipoxia (oxigênio dissolvido abaixo de 1,0 mg/L por até 14 horas. Contrariamente aos nossos resultados, a literatura mostra que a suplementação dietética com ácido ascórbico tem efeito benéfico, nos parâmetros avaliados, nas várias espécies de peixes. Assim, sugerimos que novos estudos sejam realizados no sentido de se definir o nível de suplementação de vitamina C em dietas para alevinos de piauçu.Two trials were set up to evaluate the influence of different levels of dietary vitamin C supplementation on growth, performance, survival rate and resistance to low dissolved oxygen (LODO concentration of piauçu fingerlings (Leporinus obtusidens. Trial 1 (105 days evaluated the effect of diet supplementation with L-ascorbic acid (0, 50, 150, 250, 350, 450, 550, 650, 750, 850 mg of vitamin C/kg of diet on weight gain and survival, in a completely randomized design. There was no significant differences among treatments with respect to weight gain (P > 0.4054 and survival rate (P > 0.5657. In Trial 2, groups of 10 fish of each replicate of Trial 1, were stocked in

  6. Diversidade genética de três estoques de piapara (Leporinus elongatus, utilizando RAPD = Genetic diversity of three stocks of piapara (Leporinus elongatus, using RAPD

    Directory of Open Access Journals (Sweden)

    Patrícia Cristina Gomes

    2008-04-01

    Full Text Available Recentemente a produção aquícola brasileira tem apresentado grandeprogresso. Dentre as espécies nativas cultivadas no Brasil, a piapara (Leporinus elongatus tem sido amplamente preconizada. Com objetivo de avaliar os programas de repovoamento, foram analisadas a variabilidade e a divergência genética de três estoques de piapara com a técnica de RAPD (Random Amplified Polymorphic. O primeiro estoque pertence à Estação de Aquicultura e Hidrologia da Duke Energy International (A; o segundo, à piscicultura de Rolândia (B e o terceiro, ao Programa de Repovoamento dos Rios do Paraná (C. Os dezprimers para RAPD utilizados produziram 105 fragmentos polimórficos, conferindo um polimorfismo de 98,1% para os três estoques avaliados. A porcentagem de locos polimórficos e índice de Shannon foi superior para o estoque A. Porém, todos valores foram elevados, indicando alta diversidade intrapopulacional. Os valores de Gst indicam que houvebaixa diferenciação genética entre os estoques A x B e moderada diferenciação entre os demais. O Nm foi maior entre os estoques A x B. A distância genética e o dendrograma indicam que os estoques A x B são menos distantes geneticamente.Latelly, aquiculture production in Brazil has made great strides. Among the native species cultivated in Brazil, piapara (Leporinus elogatus has been widely praised. With the objective of evaluating restocking programs, the variability and genetic divergence ofthree piapara stocks were analyzed using the RAPD (Random Amplified Polymorphic DNA technique. The first stock belongs to the Aquiculture and Hydrology Station of Duke Energy International (A; the second one belongs to a fish farm in the city of Rolândia(B; and the third to the River Restocking Program of Paraná (C. The ten primers used for RAPD produced 105 polymorphic loci, conferring a polymorphism of 98.1% for the three evaluated stocks. Polymorphic loci percentage and Shannon index were higher for stock A

  7. Aspects of the feeding and population structure of Leporinus piau Fowler, 1941 (Actinopterygii, Characiformes, Anostomidae of Taperoá II Dam, semi arid region of Paraíba, Brazil

    Directory of Open Access Journals (Sweden)

    Ana Karla Araujo Montenegro

    2010-06-01

    Full Text Available The aim of this research was to determine the population structure, weight-length relationship and sexual ratio of Leporinus piau. It also attempted to evaluate the relationship between the alimentary activity and the reproductive period, and to identify the diet and alimentary regimen. Six collections were made in the months of October and December of 2005 and March, June, August and October of 2006, using casting, seining and gill nets. Some specimens were sent to the UFPB Ichthyological Collection. The 89 collected individuals presented lengths varying from 6.2cm to 22cm. The growth of the species was of the negative allometric type. There was a significant predominance of males. The alimentary diet of L. piau was apparently variable, suggesting omnivorousness.

  8. Farinha de resíduos da filetagem de tilápia em rações para alevinos de piauçu (Leporinus macrocephalus Effects of feeding tilapia by-products flour for piauçu (Leporinus macrocephalus fingerlings

    Directory of Open Access Journals (Sweden)

    Wilson Rogério Boscolo

    2005-12-01

    Full Text Available Este experimento foi realizado com o objetivo de avaliar o efeito da inclusão de farinha de resíduos da industrialização de tilápia (FT na alimentação de alevinos de piauçu (Leporinus macrocephalus. Cento e vinte e cinco alevinos com peso e comprimento iniciais de 0,19 ± 0,004 g e 2,37 ± 0,2 cm foram distribuídos em delineamento inteiramente casualizado, com cinco tratamentos e cinco repetições. As rações testadas continham 0; 5; 10 e 15% de FT e 0% de FT suplementada com metionina. O arraçoamento foi de 10% da biomassa quatro vezes ao dia (8, 11, 14 e 17 h. As médias dos parâmetros físico-químicos da água foram 7,89 ± 0,05, 89,93 ± 0,42, 7,15 ± 0,10 e 27,10 ± 0,95 para pH, condutividade elétrica (µS.cm-1, oxigênio dissolvido (mg.L-1 e temperatura (ºC, respectivamente. Ao final do período experimental, foram avaliadas as médias de sobrevivência (SO, peso final (PF, comprimento final (CF, ganho de peso (GP, fator de condição (FC e conversão alimentar aparente (CA. Foram observadas diferenças quanto ao CF, CA e FC entre tratamentos, obtendo-se melhores resultados naqueles com inclusão de FT e suplementação de metionina. O CF apresentou aumento linear com platô em 8,56% de FT e a CA apresentou redução linear com platô de 8,19% de inclusão de FT. Os maiores teores de proteína bruta (PB na carcaça foram obtidos nos tratamentos com mais de 5% de FT e 0% de FT suplementado com metionina. Pode-se incluir até 15% de FT em rações para alevinos de piauçu, melhorando seu desempenho e deposição de PB na carcaça, o que torna a FT uma fonte protéica alternativa.This trial was carried out to evaluate the effects of feeding Tilapia fillet by-products meal (TF for piauçu (Leporinus macrocephalus fingerlings. One hundred and twenty-five fingerlings averaging weight of 0.19 ± 0.004 g and length of 2.37 ± 0.28 cm were assigned to a completely randomized design with five treatments of five replicates. The diets

  9. A new species of Tereancistrum (Monogenea, Dactylogyridae) from the gills of three Leporinus species (Characiformes, Anostomidae) and a revised description of Tereancistrum parvus.

    Science.gov (United States)

    Zago, Aline C; Yamada, Fábio H; Franceschini, Lidiane; Bongiovani, Marcela F; Yamada, Priscilla O F; Silva, Reinaldo J DA

    2017-01-01

    The present study describes Tereancistrum flabellum n. sp. (Dactylogyridae, Ancyrocephalinae) from the gills of the anostomid fishes Leporinus friderici, Leporinus amblyrhynchus and Leporinus elongatus from two freshwater ecosystems in the south east of Brazil. This new species is mainly characterized by the morphology of the copulatory complex (such as the MCO base formed by two fan-shaped structures, and accessory piece flattened, curved, rigid and channeled), a dorsal anchor with a well-developed superficial and inconspicuous deep root, and the shape of the accessory anchor sclerite with small spathulate termination. Tereancistrum flabellum n. sp. is the first record of a dactylogyrid from L. amblyrhynchus. The description of Tereancistrum parvus is also emended to correct and complement previous descriptions and the species is reported for the first time in Schizodon nasutus.

  10. Diversidade genética de três estoques de piapara (Leporinus elongatus, utilizando RAPD - DOI: 10.4025/actascianimsci.v30i2.4710 Genetic diversity of three stocks of piapara (Leporinus elongatus, using RAPD - DOI: 10.4025/actascianimsci.v30i2.4710

    Directory of Open Access Journals (Sweden)

    Lauro Vargas

    2008-08-01

    Full Text Available Recentemente a produção aquícola brasileira tem apresentado grande progresso. Dentre as espécies nativas cultivadas no Brasil, a piapara (Leporinus elongatus tem sido amplamente preconizada. Com objetivo de avaliar os programas de repovoamento, foram analisadas a variabilidade e a divergência genética de três estoques de piapara com a técnica de RAPD (Random Amplified Polymorphic. O primeiro estoque pertence à Estação de Aquicultura e Hidrologia da Duke Energy International (A; o segundo, à piscicultura de Rolândia (B e o terceiro, ao Programa de Repovoamento dos Rios do Paraná (C. Os dez primers para RAPD utilizados produziram 105 fragmentos polimórficos, conferindo um polimorfismo de 98,1% para os três estoques avaliados. A porcentagem de locos polimórficos e índice de Shannon foi superior para o estoque A. Porém, todos valores foram elevados, indicando alta diversidade intrapopulacional. Os valores de indicam que houve baixa diferenciação genética entre os estoques A x B e moderada diferenciação entre os demais. O Nm foi maior entre os estoques A x B. A distância genética e o dendrograma indicam que os estoques A x B são menos distantes geneticamente.Latelly, aquiculture production in Brazil has made great strides. Among the native species cultivated in Brazil, piapara (Leporinus elogatus has been widely praised. With the objective of evaluating restocking programs, the variability and genetic divergence of three piapara stocks were analyzed using the RAPD (Random Amplified Polymorphic DNA technique. The first stock belongs to the Aquiculture and Hydrology Station of Duke Energy International (A; the second one belongs to a fish farm in the city of Rolândia (B; and the third to the River Restocking Program of Paraná (C. The ten primers used for RAPD produced 105 polymorphic loci, conferring a polymorphism of 98.1% for the three evaluated stocks. Polymorphic loci percentage and Shannon index were higher for stock A

  11. Circadian changes in thyroid hormones of piau, Leporinus obtusidens Valenciennes, 1847 (Osteichthyes, Anostomidae after feeding = Variações circadianas dos hormônios tireoidianos de piau, Leporinus obtusidens Valenciennes, 1847 (Osteichthyes, Anostomidae após alimentação

    Directory of Open Access Journals (Sweden)

    Walter Dias Junior

    2009-10-01

    Full Text Available To evaluate circadian changes in thyroid hormones of piau, Leporinusobtusidens Valenciennes, 1847, (Osteichthyes, Anostomidae after feeding were determined the plasma levels of thyroid hormones (TH of 128 fishes, same age, immature, both sexes, distributed into four classes of weight. They were kept in 16 aquaria (100 L, with artificial aeration and 2 L min.-1 water flow, from March to August, 1996, in Aquaculture Station of the Universidade Federal de Lavras (UFLA. Daily, feed was supplied at 5% body weight. For blood samples, the fishes were anesthetized with benzocaine 10%, and plasmatic levels of TH were determined at 1, 4, 7, 10, 13, 16 and 22h after food supply during 4 consecutive days in June and in August, period of lowest temperature. The classes of weight 63, 75, 82and 91 g were considered homogeneous, showing that plasmatic concentrations of T3 and T4 were body weight independent for this fish species. The daily cycle of plasma TH were correlated with feed intake, reaching the highest levels 7 h after feeding supply (T3 = 1.75 ± 0.07 ng mL-1 and T4 = 14.9 ± 1.59 ng mL-1. It was also possible to verify that the daily intake is directly correlated with water temperature which is affected by day-light cycle.Para avaliar as variações circadianas dos hormônios tireoidianos do piau, Leporinus obtusidens Valenciennes, 1847, (Osteichthyes, Anostomidae após alimentação, foram determinados os níveis plasmáticos dos hormônios tireoidianos (HT T3 e T4 de 128 peixes, de mesma idade, imaturos, ambos os sexos, distribuídos em quatro classes de peso e mantidos em 16 aquários (100 L, com aeração artificial e fluxo constante de água de 2 L min.-1, de março a agosto de 1996, na Estação de Aquicultura da Universidade Federal de Lavras (UFLA. Diariamente, a ração foi fornecida a 5% do peso corporal. Nas pesagens e amostragens de sangue, os animais foram anestesiados com benzocaína a 10% e os níveis plasmáticos dos HT foram

  12. Genetic variability of wild populations of Leporinus elongatus in the São Domingos River - MS Brazil: a preliminary view on the construction of the hydroelectric plant

    Directory of Open Access Journals (Sweden)

    Ricardo Pereira Ribeiro

    2016-09-01

    Full Text Available Most of the electricity used in Brazil comes from hydroelectric plants, mainly due to the great availability of its water resources. However, the construction of these plants denotes serious problems related to migration of native fish and the genetic conservation of stocks. Current study evaluates two wild population of Leporinus elongatus (piapara located downstream (Population A - PopA and upstream (Population B - PopB of the Cachoeira Branca before the construction of the São Domingos hydroelectric plant (HPP in the Mato Grosso do Sul State, Brazil. Thirty samples from caudal fins were collected and analyzed for each population. Eighty-nine fragments, including 72 polymorphic ones (80.9%, were analyzed. Low fragments (less than 0.100 in both populations (PopA = 2 and PopB = 3 were identified. Nine fixed fragments (frequency 1.000 (PopA = 3 and PopB = 6, and four exclusive fragments (PopA = 3 and PopB = 1 were also reported. The genetic variability within populations, calculated by Shannon Index and by percentage of polymorphic fragments, indicated high rates of intrapopulation variability (PopA = 0.309 and 61.80% and PopB = 0.392 and 71.90%, respectively. Genetic distance and identity rates (0.089 and 0.915, respectively were different between populations, whilst AMOVA showed that most variations lie within the populations and not between them. Fst and Nm rates showed moderate genetic differentiation with low numbers of migrants. Results reveal populations with high intra-population genetic variability and genetic differentiation, with low gene flow. The passage ladders of São Domingos HPP should control fish transposition to preserve genetic variability.

  13. Leporinus trimaculatus, a new species from Amazonia, Brazil, and redescription of the sympatric Leporinus aripuanaensis (Pisces, Characiformes, Anostomidae)

    NARCIS (Netherlands)

    Garavello, Julio Cesar; Santos, dos Geraldo Mendes

    1992-01-01

    Leporinus trimaculatus n.sp. is described, and Leporinus aripuanaensis Garavello & Santos, 1981 is redescribed, both from the Aripuanã river basin, Mato Grosso state, Amazonia, Brazil. A colour pattern of two, three or more dark brown blotches on the lateral sides of the body in both species

  14. Economic viability of the piauçu Leporinus macrocephalus (Garavello & Britski, 1988 production

    Directory of Open Access Journals (Sweden)

    Takahashi Leonardo Susumu

    2004-01-01

    Full Text Available Brazilian fish farms presented an accelerated development during the early 90's, mainly because of the increase in fee-fishing operations. To meet the demand of this market, fish production and supply became excessive and, as a consequence, the number of fee-fishing operations, farmers and the final selling price, decreased. This study analyzes the technical aspects, production cost, profitability and economic viability of the production of piauçu (L. macrocephalus in ponds, based on information from a rural property. Feeding and fingerling costs amount to approximately 47.1% of the total production cost, representing together with the final selling price the most important factor affecting profitability. The payback period was 8.3 years, the liquid present value US$ 291.07, the internal return margin 9%, and the income-outcome ratio was 1.01, which represents an unattractive investment as a projection based on current conditions. The improvement in productive efficiency enhances the economic valuation index, and that the relative magnitude of cost and income are the most important points for the economic viability of the studied farm.

  15. Fauna parasitária de Leporinus lacustris e Leporinus friderici (Characiformes, Anostomidae da planície de inundação do alto rio Paraná, Brasil = Parasite fauna of Leporinus lacustris and Leporinus friderici (Characiformes, Anostomidae from the upper Paraná river floodplain, Brazil

    Directory of Open Access Journals (Sweden)

    Gislaine Guidelli

    2006-07-01

    Full Text Available Foram investigadas as faunas parasitárias de Leporinus lacustris e Leporinus friderici da planície de inundação do Alto rio Paraná, Brasil, objetivando compará-las em composição e estrutura das comunidades seguindo-se metodologias usuais no estudo dos parasitas.Foram observados alguns padrões e as faunas podem ser consideradas semelhantes em estrutura. A principal diferença nas faunas parasitárias refere-se às taxas diferenciais de utilização das espécies hospedeiras por algumas espécies parasitas em comum, representadas pela abundância. Esse indicador diferiu entre as espécies de peixes mostrando que, apesar delas serem hospedeiras apropriadas, sua exploração ocorre de forma distinta.The parasite fauna of Leporinus lacustris and Leporinus friderici from the Upper Paraná River floodplain, Brazil, was investigated aiming to make a comparison in terms of composition and structure of the communities. Usual methodologies in the study of parasite fauna were applied. Some patterns were observed, and the faunas can be considered similar in structure. The main difference in the parasite fauna was the use rate of the host by some shared parasite species, represented by abundance. This indicator differed in the fish speciesshowing that, although all are appropriate hosts, their exploitation occurs in different ways.

  16. Fauna parasitária de Leporinus lacustris e Leporinus friderici (Characiformes, Anostomidae) da planície de inundação do alto rio Paraná, Brasil = Parasite fauna of Leporinus lacustris and Leporinus friderici (Characiformes, Anostomidae) from the upper Paraná river floodplain, Brazil

    OpenAIRE

    Gislaine Guidelli; Washington Luiz Gomes Tavechio; Ricardo Massato Takemoto; Gilberto Cezar Pavanelli

    2006-01-01

    Foram investigadas as faunas parasitárias de Leporinus lacustris e Leporinus friderici da planície de inundação do Alto rio Paraná, Brasil, objetivando compará-las em composição e estrutura das comunidades seguindo-se metodologias usuais no estudo dos parasitas.Foram observados alguns padrões e as faunas podem ser consideradas semelhantes em estrutura. A principal diferença nas faunas parasitárias refere-se às taxas diferenciais de utilização das espécies hospedeiras por algumas espécies para...

  17. A New Environmentally Safe Formulation and of Low Cost for Prolonged Release System of Atrazine and Diuron

    Directory of Open Access Journals (Sweden)

    Gracy karla da Rocha Cortes

    2017-07-01

    Full Text Available Diuron and atrazine were incorporated in new formulations developed with the purpose to improve herbicides action through release systems, as well as to reduce the environmental toxicity. A low cost formulation (ALG/ESC was obtained by combining sodium alginate (ALG with fish scales of the Piau fish (ESC from the Leporinus elongatus species. From the crosslinking of ALG/ESC with CaCl2, the formulation ALG/ESC-CaCl2 was obtained. For ALG/ESC-CaCl2, the results are successful, showing a prolonged release of 3.5 and 4.5 days for atrazine and diuron, respectively. Based on parameters of an empirical equation used to fit the herbicide release data, it appears that the release systems of diuron and atrazine from ALG/ESC-CaCl2 are by diffusion processes due to anomalous transport, which did not follow Fick’s laws of diffusion. DOI: http://dx.doi.org/10.17807/orbital.v9i3.994

  18. Hematologia de teleósteos brasileiros com infecção parasitária. I. Variáveis do Leporinus macrocephalus Garavelo e Britski, 1988 (Anostomidae e Piaractus mesopotamicus Holmberg, 1887 (Characidae Haematology of parasitized Brazilian teleost fishes. I. Parameters of Leporinus macrocephalus Garavelo and Britski, 1988 (Anostomidae and Piaractus mesopotamicus Holmberg, 1887 (Characidae

    Directory of Open Access Journals (Sweden)

    Dilermando Perecin

    1999-07-01

    Full Text Available Espécimes de Leporinus macrocephalus (piauçu e de Piaractus mesopotamicus (pacu foram colhidos em piscicultura do município de Franca (SP para avaliação dos efeitos da infecção parasitária sobre a taxa de hemoglobina e de hematócrito, a concentração de hemoglobina corpuscular média (CHCM, o fator relativo de condição (Kn e a distribuição percentual de células sangüíneas de defesa orgânica (leucócitos e trombócitos. Ambas as espécies apresentavam-se parasitadas por monogenea ou por monogenea e outros parasitas: monogenea e Trichodina sp; monogenea e Lernaea cyprinacea; monogenea e Piscinoodinium pillulare; monogenea e Ichthyophthirius multifiliis; monogenea, I. multifiliis e Trichodina sp. Os resultados demonstraram que os parâmetros estudados em L. macrocephalus e em P. mesopotamicus não foram significativamente (p > 0,05 alterados pelo parasitismo. A análise de regressão linear mostrou correlação negativa (p > 0,05 entre linfócitos e trombócitos em L. macrocephalus e correlação positiva (p > 0,01 da taxa de hemoglobina com o peso e com o comprimento total em P. mesopotamicus.Specimens of cultivated Leporinus macrocephalus (piauçu and Piaractus mesopotamicus (pacu were collected in a fishfarm at Franca, SP. Effects of parasite infection upon hemoglobin, hematocrit, mean corpuscular hemoglobin concentration (MCHC, condition factor (Kn and differential count of defense cells (leucocyte and thrombocyte were evaluated. Both fish species were parasitized by monogenean; monogenean and Trichodina sp; monogenean and Lernaea cyprinacea; monogenean and Piscinoodinium pillulare; monogenean and Ichthyophthirius miltifiliis; monogenean, I. multifiliis and Trichodina sp. Parasitism did not influence (p > 0.05 the studied haematological characteristics in L. macrocephalus and P. mesopotamicus. Linnear regression showed negative correlation (p > 0.05 between lymphocytes and thrombocytes in L. macrocephalus and positive

  19. Fauna parasitária de Leporinus lacustris e Leporinus friderici (Characiformes, Anostomidae da planície de inundação do alto rio Paraná, Brasil - DOI: 10.4025/actascibiolsci.v28i3.228 Parasite fauna of Leporinus lacustris and Leporinus friderici (Characiformes, Anostomidae from the upper Paraná river floodplain, Brazil - DOI: 10.4025/actascibiolsci.v28i3.228

    Directory of Open Access Journals (Sweden)

    Ricardo Massato Takemoto

    2007-11-01

    Full Text Available Foram investigadas as faunas parasitárias de Leporinus lacustris e Leporinus friderici da planície de inundação do Alto rio Paraná, Brasil, objetivando compará-las em composição e estrutura das comunidades seguindo-se metodologias usuais no estudo dos parasitas. Foram observados alguns padrões e as faunas podem ser consideradas semelhantes em estrutura. A principal diferença nas faunas parasitárias refere-se às taxas diferenciais de utilização das espécies hospedeiras por algumas espécies parasitas em comum, representadas pela abundância. Esse indicador diferiu entre as espécies de peixes mostrando que, apesar delas serem hospedeiras apropriadas, sua exploração ocorre de forma distinta.The parasite fauna of Leporinus lacustris and Leporinus friderici from the Upper Paraná River floodplain, Brazil, was investigated aiming to make a comparison in terms of composition and structure of the communities. Usual methodologies in the study of parasite fauna were applied. Some patterns were observed, and the faunas can be considered similar in structure. The main difference in the parasite fauna was the use rate of the host by some shared parasite species, represented by abundance. This indicator differed in the fish species showing that, although all are appropriate hosts, their exploitation occurs in different ways.

  20. A new species of the Anostomid genus Leporinus Spix from Suriname, with redescriptions of two related species (Pisces, Characiformes, Anostomidae)

    NARCIS (Netherlands)

    Garavello, Julio Cesar

    1990-01-01

    Leporinus nijsseni, an anostomid fish species new to science, is described from Suriname. New diagnoses and descriptions are provided for Leporinus granti Eigenmann, 1912 and Leporinus gomesi Garavello & Santos, 1981 from the Aripuanã river basin, state of Mato Grosso, Brazil. The three species are

  1. Parasite fauna of Leporinus lacustris and Leporinus friderici (Characiformes, Anostomidae) from the upper Paraná river floodplain, Brazil - DOI: 10.4025/actascibiolsci.v28i3.228

    OpenAIRE

    Guidelli, Gislaine Marcolino; UEM; Tavechio, Washinhton Luiz Gomes; PUCPR; Takemoto, Ricardo Massato; UEM; Pavanelli, Gilberto Cezar; UEM

    2007-01-01

    Foram investigadas as faunas parasitárias de Leporinus lacustris e Leporinus friderici da planície de inundação do Alto rio Paraná, Brasil, objetivando compará-las em composição e estrutura das comunidades seguindo-se metodologias usuais no estudo dos parasitas. Foram observados alguns padrões e as faunas podem ser consideradas semelhantes em estrutura. A principal diferença nas faunas parasitárias refere-se às taxas diferenciais de utilização das espécies hospedeiras por algumas espécies par...

  2. REPRODUCTIVE CYCLE OF Leporinus copelandii (Pisces: Anostomidae FEMALES FROM THE LOWER PARAÍBA DO SUL RIVER BASIN, RJ – BRAZIL

    Directory of Open Access Journals (Sweden)

    Ana Paula Ribeiro Costa Erthal

    2015-12-01

    Full Text Available The aim of this study were investigate the reproductive biology of the fish Leporinus copelandii, a specie at risk of extinction in the lower Paraíba do Sul River basin. During a period of 14 months, a total of 143 females of red-piau were captured, between Itaocara and Campos dos Goytacazes cities (RJ, Brazil. A histological study shows four stages of the oocyte development (I, II, III and IV and five stages of the reproductive cycle of females: rest (1, initial maturation (2A, intermediary (2B, advanced (2C and spawned (4 were identified. The pattern of L. copelandii oocyte development suggests development type synchronous in two groups, characterizing total spawning. Spawned females were captured in November, two months after the peak of frequency of competent females for reproduction. Histologically, a little occurrence of empty follicles was observed in spawned females. The medium diameter of the type IV oocyte of the spawned females (1475.1 ± 884.3mm was significantly larger (Tukey, P <0.001; VC = 41.73%; n = 259 than advanced maturation females (1202.6 ± 245.3mm, what allows suggesting that the study place probably doesn't represent the reproductive area of L. copelandii.

  3. Padrão de atividade e comportamento de forrageamento do morcego-pescador Noctilio leporinus (Linnaeus (Chiroptera, Noctilionidae na Baía de Guaratuba, Paraná, Brasil Activity pattern and foraging behavior of bulldog-bat Noctilio leporinus (Linnaeus, (Chiroptera, Noctilionidae in Guaratuba Bay, Paraná State, Brazil

    Directory of Open Access Journals (Sweden)

    Marcelo O. Bordignon

    2006-03-01

    Full Text Available Entre 18 de janeiro a 16 de dezembro de 1999 foi estudado o comportamento de forrageamento e o padrão de atividade do morcego-pescador Noctilio leporinus (Linnaeus, 1758, em uma área de manguezal na Baía de Guaratuba, Sul do Brasil. Os grupos de N. leporinus observados permaneceram em atividade ao longo de todo o período noturno, mas com um aparente padrão bimodal. Durante os meses de abril a setembro, N. leporinus inicia a sua atividade geralmente às 18:00 h, uma hora mais cedo do que durante os meses de outubro a março, quando inicia sua atividade geralmente às 19:00 h. O comportamento de predação sobre os cardumes de peixes mostrou variações quanto ao local de forrageamento ao longo do período de atividade. Em baixos níveis de maré, os grupos de morcegos pescaram longe da margem em águas mais profundas, mas nos níveis de maré alta os grupos de morcegos permaneceram pescando sempre junto à margem, em águas mais rasas. Este padrão de comportamento em N. leporinus parece ser determinado pelo padrão de deslocamento dos cardumes de peixes na área de estudo.From January 18 to December 16 of 1999 the foraging behavior and activity pattern of fishing bat Noctilio leporinus (Linnaeus, 1758 were studied in mangrove ecosystem of Guaratuba Bay, southern Brazil. The groups of N. leporinus observed remained active during all nightly period but showed an apparent bimodal pattern. During April and September N. leporinus generally begin their activity at 18:00h, one hour earlier than October to March months, when their activity started at 19:00 h. The foraging behavior on fish shoal varied spatially along all the activity period. During low tide level the bat groups remained fishing distant from margin on deeper water, but during high tide level the bats were always observed fishing close to the margin on flat water. This pattern in foraging behavior of N. leporinus appears to be determined by the fish shoal displacement pattern in

  4. The snake assemblage (Squamata: Serpentes) of a Cerrado-Caatinga transition area in Castelo do Piauí, state of Piauí, Brazil

    OpenAIRE

    Rodrigues, Francílio da Silva; Prudente, Ana Lúcia da Costa

    2011-01-01

    This study records and analyzes the diversity and structure of a snake assemblage in a transition area between Cerrado and Caatinga, in the municipality of Castelo do Piauí, state of Piauí, comparing the distribution and similarity of the species composition with other open localities already studied in Brazil. We used three complementary sampling methods: time constrained search (TCS), pitfall traps with drift fences (PFT), and incidental encounters (IE). During the TCS and PFT, 912 hours/ob...

  5. studies on trace metal concentration pseudotolithus elongatus from ...

    African Journals Online (AJOL)

    DJFLEX

    KEY WORDS: Trace metals, Lead Pollution, Pseudotolithus elongatus, Mbo coastal waters, ..... Analysis of soil heavy metal pollution and ... Pekey, H., Karakas, D., and Bakog'lu, M., 2004. Source apportionment of trace metals in the surface.

  6. Aspects of sexual precocity and morphometry of uterus, placenta and embryos/fetuses in Piau breed and Commercial line gilts.

    Science.gov (United States)

    Montes, José Carlos; Penitente-Filho, Jurandy Mauro; Guimarães, Simone Eliza Facioni; Lopes, Paulo Sávio; Camilo, Breno Soares; Shiomi, Hugo Hideki; Lima, Daniel Araújo; Pinho, Rogério Oliveira; Pereira, Jhonata Vieira Tavares do Nascimento; Okano, Denise Silva; Costa, Karine Assis; Guimarães, José Domingos

    2018-01-01

    In view of the importance of the genetic material of local breeds in the swine industry and the lack of information about reproductive performance of Piau females, two experiments were conducted to evaluate puberty and sexual maturity as well as the morphometry of embryos/fetuses, placenta and uterus during the first 90 days of gestation in Piau breed and Commercial line gilts. In experiment I, 37 Piau and 25 commercial line gilts were used. From the 120 days of age, detection of estrus was performed using mature boars from the first to third estrus of each gilt. Data regarding to age, body weight and estrus duration were recorded. After third estrus, females were slaughtered and ovaries were collected to determine ovulation rate. In experiment II, 36 Piau and 18 commercial line gilts were distributed into three groups according to the mating: Commercial, commercial line females x commercial line male; cross-mated, Piau females x commercial line male; and Piau, Piau females x Piau male. Gilts were slaughtered at 7, 15, 30, 45, 60 and 90 days of pregnancy. Piau females reached puberty and sexual maturity at the same age as commercial line females, but with lower weight; moreover, Piau group showed negative correlations of birth weight with puberty (-0.27) and sexual maturity (-0.29). Commercial gilts presented higher ovulation rate, weight and length of uterus, and length and thoracic circumference of fetuses. Nevertheless, number of fetuses was similar in all groups at 90 days of gestation suggesting that Piau females present higher survival rates of the conceptuses. The results showed differences between the genetic groups related to fetal and placental development, gestational losses, number of ovulations and uterine development. In addition, an intermediate status of fetal weight was observed in Piau/Commercial line crossbred conceptuses; thus, the selection of Piau females on reproductive traits to be mated with commercial line males would be an alternative to

  7. Amplification of a GC-rich heterochromatin in the freshwater fish Leporinus desmotes (Characiformes, Anostomidae

    Directory of Open Access Journals (Sweden)

    Vladimir Pavan Margarido

    2000-09-01

    Full Text Available This is the first description of the karyotype of Leporinus desmotes. The diploid female number was 2n = 54 meta- and submetacentric chromosomes. The nucleolar organizing regions (NORs were studied by silver nitrate staining and rDNA fluorescence in situ hybridization (FISH and were found to be located in the telomeric region of the long arm of the 9th pair. C-banding revealed centromeric and telomeric heterochromatin segments in most chromosomes. Intercalar blocks of heterochromatin were observed in the long arm of six chromosome pairs. Besides a NOR-adjacent heterochromatin, all of the intercalar heterochromatic segments were brightly fluorescent by mithramycin staining. These data suggest that a unique amplification of a primordial GC-rich heterochromatin, probably NOR-associated, may have taken place in the karyotype diversification of this Leporinus species.Esta é a primeira descrição do cariótipo de Leporinus desmotes fêmea. O número diplóide encontrado foi 2n = 54 cromossomos meta- e submetacêntricos. As regiões organizadoras de nucléolos (NORs foram estudadas através da impregnação pela prata e por hibridização in situ com sondas de DNAr (FISH, e foram localizadas na região telomérica do braço longo do 9º par. Heterocromatinas centromérica e telomérica foram reveladas pelo bandamento C na maioria dos cromossomos. Adicionalmente, grande quantidade de heterocromatina intercalar ou subtelomérica foi também observada. Diferenciação composicional na maior parte da heterocromatina identificada em L. desmotes pode ser inferida através da coloração pela mitramicina, caracterizando um caso peculiar de amplificação de segmentos heterocromáticos ricos em bases GC neste grupo de peixes.

  8. Reproductive biology of the Del Norte salamander (Plethodon elongatus).

    Science.gov (United States)

    Clara A. Wheeler; Hartwell H. Welsh Jr.; Lisa M. Ollivier

    2013-01-01

    We examined seasonal reproductive patterns of the Del Norte Salamander, Plethodon elongatus, in mixed conifer and hardwood forests of northwestern California and southwestern Oregon. Seasonal size differences in reproductive structures suggested that maximum spermatogenic activity occurred during the late summer, with spermatozoa transfer to the...

  9. The epidemiology of envenomation via snakebite in the State of Piauí, Northeastern Brazil

    Directory of Open Access Journals (Sweden)

    Nayana da Rocha Oliveira

    2015-02-01

    Full Text Available INTRODUCTION: This communication describes a retrospective study of the epidemiology of snakebite cases that were recorded from 2007 to 2012 in the State of Piauí, northeastern Brazil. METHODS: Data were collected from the Injury Notification Information System database of the State of Piauí's Health Department. RESULTS: A total of 1,528 cases were identified. The cases occurred most frequently in rural areas between January and July. Victims were predominantly male farmers, and were typically 30-39 years old. Most victims were bitten on the foot, and received medical assistance within 1-3h after being bitten. CONCLUSIONS: The epidemiological profile of snakebites in the State of Piauí is similar to that in all of Brazil.

  10. Antibody response between pigs of Piau and a commercial breed naturally infected with Porcine circovirus 2

    Directory of Open Access Journals (Sweden)

    L.H.S. Bulos

    Full Text Available ABSTRACT Brazilian pig population is made up of several naturalized breeds; among them the Piau breed is known for its rusticity and large fat stores. The naturalized breeds, in comparison with commercial ones, may have an increased resistance to diseases circulating in their territory. Thus, this study aimed to verify if there are differences between the serologic profile against Porcine circovirus 2 (PCV2 of Piau pigs and that of a commercial breed from a farm naturally infected by PCV2. The serum viral load was measured by qPCR, and levels of anti-PCV2 antibodies were measured by ELISA. The results showed that the serum viral load was similar across all animals. However, Piau piglets showed higher levels of antibodies compared to commercial piglets (P= 0.05, while sows of the commercial breed showed higher levels than the Piau breed (P< 0.01. There was not a statistical difference between pigs of different production stages in the seroprevalence of PCV2 or the blood viral load. This work demonstrates that, with regard to a natural PCV2 infection, the Piau breed has a different humoral immune response compared to the response developed by the commercial pigs. The results support the importance of conservation of native breeds.

  11. Short-term cold storage of sperm from six neotropical characiformes fishes

    Directory of Open Access Journals (Sweden)

    Simone Marques

    2004-09-01

    Full Text Available Sperm of the following Neotropical Characiformes fish species were tested for cold storage: Brycon lundii, Piaractus mesopotamicus, Leporinus elongatus, Leporinus friderici, Prochilodus lineatus and Prochilodus marggravii. Each sperm sample was split into two aliquots. The first was placed into a plastic bag with air or oxygen and the second, in a plastic tube with air. The samples were maintained at temperatures between 1.7-4.9 ºC. The rate of sperm motility was estimated using a 50 mM NaCl solution as the activating solution. The shortest sperm storage duration (7 h was recorded for L. friderici, when the sperm motility rate reached ~ 30%, whereas the longest duration (20 h was obtained with the sperm of P. lineatus. A fertilisation test using Prochilodus marggravii sperm refrigerated for 8 h yielded 88-90% of viable embryos. The refrigerated storage method could be of practical applications, especially in fish reproductive management at hatchery stations.O sêmen das seguintes espécies de Characiformes neotropicais foi testado para armazenamento em ambiente resfriado: Brycon lundii, Piaractus mesopotamicus, Leporinus elongatus, Leporinus friderici, Prochilodus lineatus e Prochilodus marggravii. Amostras de sêmen, obtidas por massagem da parede celômica, foram armazenadas em saco plástico com ar ou oxigênio ou em tubo plástico com ar, e mantidas resfriadas entre 1,7-4,9º C. A taxa de motilidade espermática foi estimada usando-se NaCl 50 mM como solução ativadora. O sêmen com menor duração de viabilidade (7 h foi o de L. friderici, quando a taxa de motilidade espermática alcançou ~30%, enquanto que o de maior duração (20 h foi o de P. lineatus. A fertilização de ovócitos utilizando sêmen refrigerado por 8 h de Prochilodus marggravii produziu 88-90% de embriões viáveis. O método de armazenamento desenvolvido neste trabalho tem aplicações práticas, especialmente no manejo reprodutivo de peixes em estações de

  12. Records of new localities and hosts for crustacean parasites in fish from the eastern Amazon in northern Brazil.

    Science.gov (United States)

    Oliveira, Marcos Sidney Brito; Corrêa, Lincoln Lima; Oliveira Ferreira, Drielly; Neves, Lígia Rigor; Tavares-Dias, Marcos

    2017-06-01

    The aim of this study was to investigate parasites crustacean fauna in Arapaima gigas , Cichla monoculus , Cichla ocellaris , Cichla jariina , Satanoperca jurupari , Leporinus friderici , Leporinus fasciatus , Hoplias malabaricus , Phractocephalus hemioliopterus , Serrasalmus altispinis , Pseudoplatystoma tigrinum and Potamotrygon motoro of the State Amapá and Pará, in northern Brazil. A total of 242 parasites, including Argulus elongatus , Argulus multicolor, Argulus juparanaensis , Argulus nattereri , Dolops discoidalis , Dolops longicauda , Braga patagonica , Braga fluviatilis , Livoneca guianensis and undetermined Lernaeidae, were collected from these hosts. The Argulus species had the greatest richness among the community of parasitic crustaceans. There was a low abundance of parasites among the hosts, other than D. discoidalis , was most abundant in the integument of A. gigas and P. tigrinum . Finally, the present study reported nine new hosts for the crustacean parasite species and expanded knowledge of the occurrence of some parasite species in the Jari River basin, in eastern Amazon.

  13. Anatomical adaptations of the buccopharyngeal cavity of Leporinus macrocephalus Garavello & Britski, 1988 (Pisces, Characiformes, Anostomidae in relation of alimentary habit

    Directory of Open Access Journals (Sweden)

    Eliane Menin

    2006-03-01

    Full Text Available The aim of this work was to describe the anatomical adaptations of the buccopharyngeal cavity of Leporinus macrocephalus, a fish species of the family Anostomidae, since this cavity presents structural characteristics intimately related with the alimentary habit. Twenty specimens of Leporinus macrocephalus were used, with length-patterns between 22 and 28 cm, supplied by the Station of Hydrobiology and Fish Farming of the Federal University of Viçosa. The results showed that Leporinus macrocephalus presents anatomical adaptations to the omnivorous alimentary habit, such as: a terminal mouth and small oral rift; thick, flexible inferior lips and with papillas, aiding the capture of the prey; an oral mucous membrane which is practically flat, allowing a fast disobstruction of the oral cavity; the presence of papillas in the pharyngeal mucous membrane, facilitating the movement of alimentary particles to the esophagus or aiding the apprehension of the prey; a buccopharyngeal cavity which is relatively large, allowing the passage of whole prey; incisiviform oral teeth that, with the aid of the adjacent oval papilla, accomplish the apprehension of the prey and pre-cardic preparation of vegetable food; unciform pharyngeal teeth, responsible for the apprehension and maceration of the soft-bodied prey; numerous short gill-rackers, present in all the faces of the branchial arches, some of which are inserted inside others to form a filter that prevents the loss of alimentary particles through the branchial rifts and protects the branchial filaments from possible lesions.

  14. Uptake of uranium from sea water by Synechococcus elongatus

    International Nuclear Information System (INIS)

    Horikoshi, Takao; Nakajima, Akira; Sakaguchi, Takashi

    1979-01-01

    Basic features of the uranium uptake by Synechococcus elongatus, and the factors affecting it were examined. Synechococcus elongatus was grown in Roux flasks containing 1 liter of culture solution in light (20,000 lux) and with aeration at 30 deg C. Synechococcus cells in the linear growth phase were collected by centrifugation at 6,000 x g for 5 minutes, washed with sea water, and used for the uranium-uptake experiments. The uptake of uranium from sea water containing 1 ppm of the element was strongly affected by the pH of sea water. The optimum uptake was at pH 5. Presence of carbonate ions markedly inhibited and decarbonation of sea water greatly enhanced the uptake. Absorption of uranium by Synechococcus cells was initially rapid, and reached a plateau within 24 hours. The uranium accumulation capacity of Synechococcus cells was increased by heat treatment, the capacity of scalded cells being about twice as much as that of living cells. Most of the uranium absorbed by Synechococcus was found in the inner space of the cells, and only a small amount was present in the cell walls. (Kaihara, S.)

  15. Atividade de amilase em quimo de três espécies tropicais de peixes teleostei de água doce Amylase activity in the chyme of three teleostei freshwater fish

    Directory of Open Access Journals (Sweden)

    José Teixeira de Seixas Filho

    1999-01-01

    Full Text Available O objetivo deste trabalho foi determinar a atividade de amilase no quimo presente nos intestinos médio e posterior, ou reto, em três espécies tropicais de peixes Teleostei de água doce: piracanjuba, Brycon orbignyanus (Valenciennes, 1849, piau, Leporinus friderici (Bloch, 1794, onívoros, e surubim, Pseudoplatystoma coruscans (Agassiz, 1829, preferencialmente carnívoro, visando fornecer referência à nutrição para o ajuste da alimentação artificial. As atividades de amilase foram determinadas usando-se kit BIOCLIN com metodologia modificada por CARAWAY (1959. Os resultados monstraram atividade específica média (2106,33 UA/mg para amilase do piracanjuba e foram 91,74% menor em comparação ao piau (25.488,14 UA/mg, ambos de hábito alimentar onívoro, enquanto a atividade específica da amilase para o piracanjuba foi 89,06% menor em relação ao surubim (19.246,80 UA/mg, carnívoro, o qual apresentou atividade específica da amilase 24,49% menor em relação à do piau. Os dados sugerem que a grande diferença da atividade específica de amilase entre o piau e o piracanjuba possui ligação com sua morfometria e o complexo arranjo das pregas da mucosa dos intestinos médio e posterior. Além disso, a atividade de amilase do surubim indica possibilidade de uso de ração contendo carboidratos, porém estudos adicionais são necessários para a avaliação do comportamento dessas espécies na alimentação artificial.The objective of this work was to determine the amylase activity in the chyme present in the medium and posterior intestines or in the rectum of three tropical freshwater Teleostei species: piracanjuba, Brycon orbignyanus (Valenciennes, 1849, piau, Leporinus friderici (Bloch, 1974, omnivorous, and surubim, Pseudoplatystoma coruscans (Agassiz, 1829, preferably carnivorous, aiming to provide nutritional reference data for the adjustment of the artificial feeding systems. The amylase activity was determined by the use of

  16. Spermatic Viability of Cryopreserved Semen of Piau swine breed analyzed by Thermo Resistant Test

    Directory of Open Access Journals (Sweden)

    Maurício Hoshino da Costa Barros

    2014-06-01

    Full Text Available ABSTRACT. Barros M.H.C., Shiomi H.H., Amorim L.S., Guimarães S.E.F., Lopes P.S., Siqueira J.B., Pinho R.O. & Guimarães J.D. [Spermatic Viability of Cryopreserved Semen of Piau swine breed analyzed by Thermo Resistant Test.] Viabilidade espermática de sêmen congelado de suínos da raça Piau avaliada pelo Teste de Termorresistência. Revista Brasileira de Medicina Veterinária 36(2:131-136, 2014. Departamento de Veterinária, Universidade Federal de Viçosa, Av. Peter Henry Rolfs, s/n, Viçosa, MG 36571-000, Brasil. E-mail: hugoshiomi@hotmail.com The objective of this study was to verify three protocols of semen cryopreservation on spermatic viability after thawing from Piau swine breed (Sus scrofa, by thermo resistant test (TTR. Twenty two ejaculates from 5 Piau mature boars were collected by glove hand technique. To freezing, the ejaculates was split and submitted to three protocols (P: (P1 freezing method proposed by Furst et al. (2005, altered by diluent media, (P2 freezing method proposed by Furst et al. (2005, altered by cooled curve; and (P3 freezing method proposed by Ohata et al. (2001. After thawing, semen was submitted to TTR, been incubated at 37o C by 2 hours, motility sperm (MOT and vigor (VIG was analyzed at 30 minutes of interval. MOT and VIG after thawing was 20.9±12.4, 29.5±10.9 and 49.5±12.1%; 2.5±0.5, 2.9±0.4 and 3.4±0.4, respectively to P1, P2 and P3. The TTR results show gradually decrease of motility and vigor along 2 hours of test procedure utilized, with best average to protocol 3 at all time of analyze. The protocol 3 tested by Piau boars shows highest values in cellular semen cryopreservation.

  17. Integrated scenarios of regional development in Ceará and Piauí

    NARCIS (Netherlands)

    Döll, Petra; Krol, Martinus S.; Fuhr, Dagmar; Gaiser, T.; Krol, M.S; Frischkorn, H.; de Araújo, J.C.

    2003-01-01

    Scenarios of the future are an important tool for supporting sustainability-oriented regional planning. To assist regional planning in two federal states in semi-arid Northeastern Brazil, Ceará and Piauí, we developed integrated qualitative-quantitative scenarios which show potential developments of

  18. The snake assemblage (Squamata: Serpentes of a Cerrado-Caatinga transition area in Castelo do Piauí, state of Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Francílio da Silva Rodrigues

    2011-08-01

    Full Text Available This study records and analyzes the diversity and structure of a snake assemblage in a transition area between Cerrado and Caatinga, in the municipality of Castelo do Piauí, state of Piauí, comparing the distribution and similarity of the species composition with other open localities already studied in Brazil. We used three complementary sampling methods: time constrained search (TCS, pitfall traps with drift fences (PFT, and incidental encounters (IE. During the TCS and PFT, 912 hours/observer and 6,468 days/trap were used, respectively. We estimated 23 species of snakes for the locality, although only 19 species were recorded. Philodryas nattereri Steindachner, 1870 (n = 10, Liophis poecilogyrus (Schlegel, 1837 (n = 9, Liophis viridis Günther, 1862 (n = 8 and Thamnodynastes sp. (n = 8 were the most abundant species. Terrestrial, cryptozoic, and diurnal snakes predominated in the assemblage (Boidae = 2 species, Dipsadidae = 12, Colubridae = 2, Elapidae = 1, Viperidae = 2. The results indicate that the fauna of the locality is similar with that of other open formations, especially the Caatinga, corroborating previous floristic studies. Comparisons between snake assemblages analyzed by different authors suggest structural differences between the assemblages of the Cerrado and the Caatinga, contradicting the hypothesis of mixed composition of fauna in these biomes.

  19. Myxomycetes do Parque Zoobotânico de Teresina, Piauí, Brasil Myxomycetes of the Parque Zoobotânico - Teresina, Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Márcia Percília Moura Parente Ponte

    2003-03-01

    Full Text Available Visando ampliar o conhecimento sobre a mixobiota do Piauí, foram realizadas coletas no Parque Zoobotânico de Teresina (05º 05' 12'' S, 42º 48' 48'' WG. A vegetação do Parque caracteriza-se como um cerradão com representantes da mata de cocais, que oferecem substratos potencialmente favoráveis ao desenvolvimento de Myxomycetes. Esporocarpos foram coletados no período chuvoso e início da estiagem (março a junho de 1999, identificados e depositados no herbário UFP (Universidade Federal de Pernambuco. Foram obtidas 101 amostras, correspondentes a 19 espécies, distribuídas nas famílias Ceratiomyxaceae (Ceratiomyxa fruticulosa (Mull. Macbr., Clastodermataceae (Clastoderma debaryanum Blytt, Cribrariaceae (Cribraria microcarpa (Schrad. Pers., C. violacea Rex, Dictydium canceilatum* (Batsch. Macbr., Enteridiaceae (Lycogala exiguum* Morgan., Physaraceae (Craterium aureum* (Schum. Rost., Physarum bogoriense* Racib., P. melleum (Berk. & Br. Massee, P. nucleatum Rex, P. pusilium* (Berk. & Curt. G. Lister, Trichiaceae (Arcyria denudata (L. Wett., A. cinerea (Bull. Pers., Hemitrichia calyculata (Speg. Farr, H. serpula (Scop. Rost., Metatrichia vesparium (Batsch Nann.-Brem., Perichaena depressa Lib. e Stemonitaceae (Comatricha typhoides (Bull. Rost., Stemonitis smithii Macbr.. Exceto H. calyculata e H. serpula, todos os táxons são referidos pela primeira vez para o município de Teresina; as espécies assinaladas com um asterisco constituem novos registros para o Piauí.Aiming to increase the knowledge about the myxobiota of Piauí State, Brazil, collections were done in the undertaken Zoobotanical Park of Teresina (05° 05' 12'' S, 42° 48' 48'' WG. The vegetation of the Park is a savanna ("cerradão" with "cocais" forest representative, offering substrates potentially favorable to the development of Myxomycetes. Sporocarps were collected in the rainy season (March to June 1999, identified and deposited at the UFP herbarium (Federal University

  20. A numerical investigation of phytoplankton and Pseudocalanus elongatus dynamics in the spring bloom time in the Gdańsk Gulf

    Science.gov (United States)

    Dzierzbicka-Głowacka, Lidia

    2005-01-01

    A nutrient-phytoplankton-zooplankton-detritus (1D-NPZD) `phytoplankton {Phyt} and Pseudocalanus elongatus {Zoop} dynamics in the spring bloom time in the Gdańsk Gulf. The 1D-NPZD model consists of three coupled, partial second-order differential equations of the diffusion type for phytoplankton {Phyt}, zooplankton {Zoop}, nutrients {Nutr} and one ordinary first-order differential equation for benthic detritus pool {Detr}, together with initial and boundary conditions. In this model, the {Zoop} is presented by only one species of copepod ( P. elongatus) and {Zoop} is composed of six cohorts of copepods with weights ( Wi) and numbers ( Zi); where Zoop= limit∑i=16W iZ i. The calculations were made for 90 days (March, April, May) for two stations at Gdańsk Gulf with a vertical space step of 0.5m and a time step of 900 s. The flow field and water temperature used as the inputs in the biological model 1D-NPZD were reproduced by the prognostic numerical simulation technique using hydrographic climatological data. The results of the numerical investigations described here were compared with the mean observed values of surface chlorophyll- a and depth integrated P. elongatus biomass for 10 years, 1980-1990. The slight differences between the calculated and mean observed values of surface chlorophyll- a and zooplankton biomass are ca. 10-60 mg C m -3 and ca. 5-23 mg C m -2, respectively, depending on the location of the hydrographic station. The 1D-NPZD model with a high-resolution zooplankton module for P. elongatus can be used to describe the temporal patterns for phytoplankton biomass and P. elongatus in the centre of the Gdańsk Gulf.

  1. The distribution of exocrine glands in Lepeophtheirus salmonis and Caligus elongatus (Copepoda: Caligidae)

    NARCIS (Netherlands)

    Bell, S.; Bron, J.E.; Sommerville, C.

    2000-01-01

    The morphology, function and distribution of exocrine glands of copepods have rarely been studied in detail and almost nothing is known about them in the sea lice species L. salmonis and C. elongatus. This study utilised a novel application of a light-microscopy staining technique to reveal a

  2. Estudo morfológico do tecido hepático de Leporinus macrocephalus = Morphological study of the hepatic tissue of Leporinus macrocephalus

    Directory of Open Access Journals (Sweden)

    Maria Terezinha Siqueira Bombonato

    2007-01-01

    Full Text Available O presente trabalho objetivou análise macroscópica e histológica do fígado de Leporinus macrocephalus para avaliar a estrutura do tecido hepático. Os peixes provenientes de um pesqueiro da região de Bauru, Estado de São Paulo, foram anestesiados, mortos, e os fígados foram retirados e encaminhados à rotina histológica, com inclusão em paraplast. A macroscopia mostrou um figado de estrutura homogênea, de coloração marron-avermelhada, localizado na região medial do corpo, caudalmente ao coração e posterior às brânquias, apresentando três lóbos de forma piramidal, sendo um central e dois laterais direito eesquerdo. A análise histológica revelou o tecido hepático constituído por cordões duplos de hepatócitos circundados por sinusóides, denominado de “muralha dupla”. Revelou, ainda, um sistema biliar disperso pelo parênquima hepático mostrando ductos com epitélio cúbicosimples, circundado por fibras musculares e tecido conjuntivo. Células do tecido pancreático exócrino foram observadas, margeando vasos sangüíneos, organizando-se em ácinos apresentando grânulos de zimogênio. Além disso, existem centros melanomacrófagos distribuídos ao longo de todo parênquima, preferencialmente próximos aos vasos sanguíneos, formados por células que acumulam materiais como melanina e lipofucsina, podendo sua presença estar relacionada com o estado nutricional do peixe.The objective of this work was to analyze the liver of Leporinus macrocephalus at the macroscopic and histologic level by evaluating the characteristics of the hepatic tissue. The fishes from a fishery in Bauru, S.P., were collected and sacrificed by destroying the spinalcord; afterwards the collected hepatic tissue was fixed and followed by histological routine. Macroscopic analysis of L. macrocephalus liver showed an organ of homogeneous structure, with red-brown color, located in the medial region of the body, caudal to heart and after the gills. It

  3. Feeding ecology of Leporinus taeniofasciatus (Characiformes: Anostomidae before and after installation of a hydroelectric plant in the upper rio Tocantins, Brazil

    Directory of Open Access Journals (Sweden)

    Miriam P. Albrecht

    Full Text Available The feeding ecology of Leporinus taeniofasciatus in the upper rio Tocantins was characterized before (river phase and after (reservoir phase its impoundment by the Serra da Mesa Hydroelectric Dam. The importance of each food item was given by the Alimentary Index (IAi, which combines the frequency of occurrence and volumetric methods. A significant difference in the diet of L. taeniofasciatus between seasons in the river phase, detected by a multivariate analysis of variance, was not kept when the reservoir was formed. Its feeding activity, verified through the percentage of stomachs with different degrees of fullness, was not affected by the impoundment. Leporinus taeniofasciatus was able to incorporate terrestrial food items to its diet when they became abundantly available at the beginning of reservoir formation. Despite this plasticity, secondary factors such as predation and competition might have affected its adaptation in the new, more homogeneous environment. Its diet was not significantly different in the lotic sites between the distinct phases, suggesting that the remaining upstream lotic environments still provide favorable conditions for this species, reinforcing the need to preserve those habitats, as L. taeniofasciatus, which is apparently endemic to the Tocantins basin, may be threatened.

  4. The zooplankton biodiversity of some freshwater environments in Parnaíba basin (Piauí, Northeastern Brazil

    Directory of Open Access Journals (Sweden)

    JDN. Paranhos

    Full Text Available The plankton fauna of the state of Piauí, Northeastern Brazil, especially in the Parnaíba basin, is still poorly known; the results of most studies of the subject have not been published and can only be found in grey literature (unpublished scientific works, such as course completion work and consulting reports. Thus, this paper presents data from samples taken recently from different water bodies in Piauí and represents the second study to be published on the region's zooplankton since the pioneering work of Spandl (1926. A total of 38 species were recorded, including 23 new occurrences of rotifers, 10 of cladocerans and 2 of copepods for the state of Piauí. The greatest richness was observed for the rotifers, of which the genus Brachionus must be highlighted, especially at the Joana reservoir. Among the crustaceans, the greatest richness was observed at the Bezerra reservoir, where cladocerans of the genus Bosmina were prominent. The rotifers Brachionus havanaensis Rousselet, 1911 and Filinia longiseta (Ehrenberg, 1834; the cladocerans Diaphanosoma spinulosum Herbst, 1967 and Moina micrura Kurz, 1874; and the copepods Notodiaptomus cearensis Wright, 1936 and Thermocyclops decipiens Kiefer, 1927 occurred in all or in most environments in which the respective groups were studied. The results presented here expand the taxonomic list of zooplankton for the state of Piauí, including a total fauna of 30 species of rotifers, 15 of cladocerans and 3 of copepods. The zooplankton richness was considered low in the studied reservoirs compared to other freshwater ecosystems from Northeastern Brazil; however, the few studies developed in the Parnaíba basin suggest that the diversity for these organisms should be higher.

  5. políticas da Secretaria Estadual de Educação do Piauí (2007-2009)

    OpenAIRE

    Teixeira, Petronília

    2013-01-01

    Tese apresentada à Universidade Fernando Pessoa como parte integrante dos requisitos para obtenção do grau de Doutor em Ciências da Informação, especialidade em Marketing e Comunicação Estratégica Este trabalho aborda a Gestão Democrática: políticas públicas educacionais da Secretaria Estadual de Educação do Piauí (2007-2009). Busca investigar as políticas da Secretaria Estadual de Educação e Cultura do Piauí – SEDUC na implementação da prática de uma gestão democrática no ensino ...

  6. The speeches about children’s education and hygienization on the newspapers printed in Piauí, Brazil (1930-1960

    Directory of Open Access Journals (Sweden)

    Vilma da Silva Mesquita Oliveira

    2015-11-01

    Full Text Available During the first half of the twentieth century Piauí, Brazil, was expanding its modernization process. In order to display a picture of full development, it was necessary to educate and take care of children, who were considered the nation's future, because, due to neglect, there was a growth in rates of child mortality. The goal of this study focuses on highlighting the measures adopted by the state to educate and care for children. Considering this context, this study highlights the childhood in Piauí, with the 1930’s beingthe starting point, which is a period in which there great evidence to infancy, and the ending being in 1960, when there were discussions focused on the child-problem, discourses circulated in printed newspapers at that time in Piauí (O Piauhy, Diário Oficial e O Dia. To perform this study, while considering the historical nature of the work, the theoretical research is based on the New Cultural History, which privileges the life history of common people, their daily lives, and their mindsets. The results indicate that social policies were created to improve this framework. The awareness of mothers in the care of their children was held in campaigns promoted by the state, such as robustness contests, courses in childcare, hygiene and nutrition for mothers, as well as advertisements of products that included guidance of this kind of care, in order to improve the vision of development in Piauí.

  7. Diet of the fishing bat Noctilio leporinus (Linnaeus (Mammalia, Chiroptera in a mangrove area of southern Brazil Dieta do morcego-pescador Noctilio leporinus (Linnaeus (Mammalia, Chiroptera em uma área de manguezal do sul do Brasil

    Directory of Open Access Journals (Sweden)

    Marcelo O. Bordignon

    2006-03-01

    Full Text Available From January to December 1999, the diet of Noctilio leporinus (Linnaeus, 1758 was determined in a salt-water ecosystem, by analysing the feces of bats captured in mist nets. Of the 61 samples analyzed, most contained remains of fish (90.2%, followed by insects (70.5% and crustaceous (29.5%. The most frequent fishes species were: silversides Atherinella brasiliensis (Quoy & Gaimard, 1825, anchovies Cetengraulis edentulus (Cuvier, 1829 and scaly sardines Ophisthonema oglinum (Lesueur, 1818. The most frequent insects were moths (Saturniidae and beetles (Cerambycidae, Scarabaeidae and Coccinellidae, as well as two species of bat ectoparasites (Streblidae. Among the crustaceous the shrimp (Palaemonidae and crabs (Gecarcinidae are was present. The consumption of fish, insects and crustaceans was different for the males and females throughout the year.De janeiro a dezembro de 1999, foi estudada a dieta de Noctilio leporinus (Linnaeus, 1758 em um ecossistema de manguezal, através da análise das fezes de morcegos capturados com redes-neblina. Das 61 amostras analisadas, a maioria continha fragmentos de peixes (90.2%, seguido de insetos (70.5% e crustáceos (29,5%. As espécies de peixes mais freqüentes foram: peixe-rei Atherinella brasiliensis (Quoy & Gaimard, 1825, manjuba Cetengraulis edentulus (Cuvier, 1829 e sardinha Ophisthonema oglinum (Lesueur, 1818. Os insetos mais freqüentes foram mariposas (Saturniidae e besouros (Cerambycidae, Scarabaeidae e Coccinellidae, além de duas espécies de ectoparasitas (Streblidae. Entre os crustáceos, houve a presença apenas de camarões (Palaemonidae e siris (Gecarcinidae. O consumo de peixes, insetos e crustáceos foi diferente para machos e fêmeas ao longo do ano.

  8. Metabolic engineering of cyanobacteria for photosynthetic 3-hydroxypropionic acid production from CO2 using Synechococcus elongatus PCC 7942.

    Science.gov (United States)

    Lan, Ethan I; Chuang, Derrick S; Shen, Claire R; Lee, Annabel M; Ro, Soo Y; Liao, James C

    2015-09-01

    Photosynthetic conversion of CO2 to chemicals using cyanobacteria is an attractive approach for direct recycling of CO2 to useful products. 3-Hydroxypropionic acid (3 HP) is a valuable chemical for the synthesis of polymers and serves as a precursor to many other chemicals such as acrylic acid. 3 HP is naturally produced through glycerol metabolism. However, cyanobacteria do not possess pathways for synthesizing glycerol and converting glycerol to 3 HP. Furthermore, the latter pathway requires coenzyme B12, or an oxygen sensitive, coenzyme B12-independent enzyme. These characteristics present major challenges for production of 3 HP using cyanobacteria. To overcome such difficulties, we constructed two alternative pathways in Synechococcus elongatus PCC 7942: a malonyl-CoA dependent pathway and a β-alanine dependent pathway. Expression of the malonyl-CoA dependent pathway genes (malonyl-CoA reductase and malonate semialdehyde reductase) enabled S. elongatus to synthesize 3 HP to a final titer of 665 mg/L. β-Alanine dependent pathway expressing S. elongatus produced 3H P to final titer of 186 mg/L. These results demonstrated the feasibility of converting CO2 into 3 HP using cyanobacteria. Copyright © 2015 International Metabolic Engineering Society. Published by Elsevier Inc. All rights reserved.

  9. Influência da temperatura sobre o desenvolvimento de juvenis de piapara (Leporinus cf. obtusidens - DOI: 10.4025/actascibiolsci.v25i1.2103 Temperature influence on the development of juvenile of Piapara (Leporinus cf. obtusidens - DOI: 10.4025/actascibiolsci.v25i1.2103

    Directory of Open Access Journals (Sweden)

    Gilmar Baumgartner

    2003-04-01

    Full Text Available Este trabalho teve como objetivo analisar os efeitos da temperatura sobre a performance de juvenis de Leporinus cf. obtusidens (Valencienves, 1847 (Characiformes, Anostomidae, em relação a variações no comprimento total, ao peso total, ao incremento em peso, ao peso relativo e à taxa instantânea de crescimento. Para tanto, no período de agosto a setembro de 2001, montou-se experimento com temperaturas controladas (± 1ºC em 14, 18, 22, 26, 30 e 34ºC, com 5 repetições cada. Foram distribuídos, ao acaso, 12 juvenis de piapara Leporinus cf. obtusidens por aquário com capacidade de 250 L e alimentados com ração comercial. Verificou-se que a temperatura que proporcionou maior comprimento total, peso e incremento em peso, situou-se entre 26 e 30ºC; o melhor conforto térmico (peso relativo esteve na faixa de 22 a 26ºC; a taxa instantânea de crescimento aumentou gradativamente desde 14 até 30ºC e, posteriormente, decaiu. Portanto constatou-se que a temperatura influenciou todas as variáveis avaliadasThe aim of this study was to analyze temperature effects on the performance of juveniles Leporinus cf. obtusidens (Valencienves, 1847 (Characiformes, Anostomidae, on the variation of the total length, total body weight, weight increase, relative weight and instantaneous growth rate. For this reason, from August to September of 2001, an experiment with controlled temperature (± 1ºC was set up at 14, 18, 22, 26, 30 and 34ºC, with 5 repetitions each one. Twelve juveniles piapara were placed at random in each aquarium of 250L capacity, and fed with commercial food. We observed that the greatest temperature which provided larger total length, body weight, weight increase was between 26 and 30ºC; the best thermal comfort was between 22 to 26ºC; the instantaneous growth rate increased gradually and the temperature ranged from 14 to 30ºC, when it began to decrease. Therefore, we found that temperature influenced all the analyzed variables

  10. Morbidade da doença de Chagas em áreas do Sertão da Paraíba e da Caatinga do Piauí

    Directory of Open Access Journals (Sweden)

    José Rodrigues Coura

    1996-04-01

    Full Text Available Foram estudados 186 pares de indivíduos sorologicamente positivos e negativos para infecção chagásica, da mesma idade e sexo, do Sertão da Paraíba e 200 indivíduos também sorologicamente positivos nos municípios de Oeiras e Colônia do Piauí. Depois de confirmados por pelo menos dois outros testes sorológicos: imunofluorescência indireta quantitativa, ELISA, hemaglutinação ou fixação do complemento,foi feito o exame clínico, eletrocardiográfico e radiológico nos indivíduos selecionados para o estudo exenodiagnóstico, hemocultura e PCR em amostras representativas dos casos soropositivos. As manifestações clínicas predominantes entre os soropositivos em ambas as áreas foram palpitações, dispnéia aos esforços, disfagia, odinofagia, pirose e obstipação. As freqüências das alterações eletrocardiográficas sugestivas da doença de Chagas foram, respectivamente, na Paraíba e no Piauí: BAV = 3,8 % e 2 %, BRD III = 6,4 % e 7 %, BRD III + HBAE = 10,7 % e 10,5 % e extra-sístoles ventriculares complexas = 2,7 % e 3,% . O xenodiagnóstico foi positivo em 13 % dos casos soropositivos da Paraíba e em 34 % dos casos do Piauí, enquanto que o PCR foi positivo, respectivamente, em 44,6 e 59,5 %. A hemocultura realizada apenas no Piauí foi positiva em 25,7 % dos casos estudados. Foram realizados inquéritos triatomínicos em 132 domicílios e peridomicílios no Sertão da Paraíba e em 159 na Caatinga do Piauí, sendo capturados 16 exemplares de T. brasiliensis não infectados no peridomicílio na Paraíba e 750 exemplares no Piauí, dos quais 625 foram examinados: 49 de T. pseudomaculata não infectados com T. cruzi (19 no intradomicílio e 30 no peridomicílio e 576 de T. brasiliensis (371 no intradomicílio e 205 no peridomicílio entre os quais 32 (5,5% estavam infectados com T. cruzi (31 no intradomicílio e um no peridomicílio.A clinical and electrocardiographic case control study was carried out with 186 pairs of

  11. Carbon-free production of 2-deoxy-scyllo-inosose (DOI) in cyanobacterium Synechococcus elongatus PCC 7942.

    Science.gov (United States)

    Watanabe, Satoru; Ozawa, Hiroaki; Kato, Hiroaki; Nimura-Matsune, Kaori; Hirayama, Toshifumi; Kudo, Fumitaka; Eguchi, Tadashi; Kakinuma, Katsumi; Yoshikawa, Hirofumi

    2018-01-01

    Owing to their photosynthetic capabilities, there is increasing interest in utilizing cyanobacteria to convert solar energy into biomass. 2-Deoxy-scyllo-inosose (DOI) is a valuable starting material for the benzene-free synthesis of catechol and other benzenoids. DOI synthase (DOIS) is responsible for the formation of DOI from d-glucose-6-phosphate (G6P) in the biosynthesis of 2-deoxystreptamine-containing aminoglycoside antibiotics such as neomycin and butirosin. DOI fermentation using a recombinant Escherichia coli strain has been reported, although a carbon source is necessary for high-yield DOI production. We constructed DOI-producing cyanobacteria toward carbon-free and sustainable DOI production. A DOIS gene derived from the butirosin producer strain Bacillus circulans (btrC) was introduced and expressed in the cyanobacterium Synechococcus elongatus PCC 7942. We ultimately succeeded in producing 400 mg/L of DOI in S. elongatus without using a carbon source. DOI production by cyanobacteria represents a novel and efficient approach for producing benzenoids from G6P synthesized by photosynthesis.

  12. [Fungus microbiota in air conditioners in intensive care units in Teresina, Piauí].

    Science.gov (United States)

    Mobin, Mitra; do Amparo Salmito, Maria

    2006-01-01

    With the aim of identifying the fungus microbiota in air conditioners in intensive care units (ICUs) within public and private hospitals in Teresina, Piauí, solid material was collected from ten different ICUs. Thirty-three species of Moniliaceae and Dematiaceae were isolated, which was the first report of these in Piauí. High frequencies of Aspergillus niger Van Tieghem (60%), Aspergillus fumigatus Fres (50%), Trichoderma koningii Oudem (50%) and Aspergillus flavus Link: Fr. (40%) were recorded. The air conditioner cleanliness validity had expired in all the ICUs, and the quantity of colony-forming units exceeded the levels permitted by Law 176/00 from the Ministry of Health. It is important to provide individual protection equipment for professionals, adopt hospital infection control measures, raise the awareness of the presence of fungus infection, improve air circulation around the environment, periodically clean the air conditioners, and make health professionals alert to the importance of these fungi in the hospital environment.

  13. Caracterização do desenvolvimento inicial de Leporinus friderici (Osteichthyes, Anostomidae da bacia do rio Paraná, Brasil Early development of Leporinus friderici (Osteichthyes, Anostomidae from Paraná river basin, Brazil

    Directory of Open Access Journals (Sweden)

    Norma Dulce de Campos Barbosa

    2001-05-01

    Full Text Available O objetivo desse trabalho é caracterizar o desenvolvimento inicial de Leporinus friderici. Os ovos e larvas analisados foram obtidos através de desovas induzidas realizadas junto à estação de Piscicultura de Volta Grande (CEMIG, entre os meses de fevereiro e março de 1995. Os juvenis são provenientes de amostras coletadas na bacia do alto rio Paraná. Foram analisados 30 ovos, 114 larvas e 21 juvenis. Os ovos são esféricos, transparentes e não adesivos, com diâmetro médio de 2,53 mm, espaço perivitelino de 0,74 mm e diâmetro médio do vitelo de 0,94 mm. As larvas eclodem 13h20min. após a fertilização (27,6 ºC. Apresentam dois cromatóforos na região frontal, intestino alcançando a porção distal do corpo, uma linha de cromatóforos dendríticos ao longo da região ventral e número de miômeros totais variando de 35 a 37The early development of Leporinus friderici (Bloch, 1794 is characterized in this research. Eggs and larvae were obtained from artificial spawning performed in Volta Grande hatchery (CEMIG, from February to March 1995. Juveniles were taken from samples of the Upper Paraná River Basin. Thirty eggs, 114 larvae and 21 juveniles were analyzed. Eggs are sphericals, transparents and non-adhesives, mean diameter 2.53 mm, perivitelline space 0.74 mm, mean yolk diameter 0.94 mm. Incubation time was 13h20min. at 27.6ºC. Larvae showed two pigments in frontal region, a long intestine reaching near the caudal fin, and pigments along the ventral margin of the body. Myomere number ranged from 35 to 37

  14. Blueprint for a minimal photoautotrophic cell: conserved and variable genes in Synechococcus elongatus PCC 7942

    Directory of Open Access Journals (Sweden)

    Peretó Juli

    2011-01-01

    Full Text Available Abstract Background Simpler biological systems should be easier to understand and to engineer towards pre-defined goals. One way to achieve biological simplicity is through genome minimization. Here we looked for genomic islands in the fresh water cyanobacteria Synechococcus elongatus PCC 7942 (genome size 2.7 Mb that could be used as targets for deletion. We also looked for conserved genes that might be essential for cell survival. Results By using a combination of methods we identified 170 xenologs, 136 ORFans and 1401 core genes in the genome of S. elongatus PCC 7942. These represent 6.5%, 5.2% and 53.6% of the annotated genes respectively. We considered that genes in genomic islands could be found if they showed a combination of: a unusual G+C content; b unusual phylogenetic similarity; and/or c a small number of the highly iterated palindrome 1 (HIP1 motif plus an unusual codon usage. The origin of the largest genomic island by horizontal gene transfer (HGT could be corroborated by lack of coverage among metagenomic sequences from a fresh water microbialite. Evidence is also presented that xenologous genes tend to cluster in operons. Interestingly, most genes coding for proteins with a diguanylate cyclase domain are predicted to be xenologs, suggesting a role for horizontal gene transfer in the evolution of Synechococcus sensory systems. Conclusions Our estimates of genomic islands in PCC 7942 are larger than those predicted by other published methods like SIGI-HMM. Our results set a guide to non-essential genes in S. elongatus PCC 7942 indicating a path towards the engineering of a model photoautotrophic bacterial cell.

  15. Age validation and variation in growth, mortality and population structure of Liza argentea and Myxus elongatus (Mugilidae) in two temperate Australian estuaries.

    Science.gov (United States)

    Kendall, B W; Gray, C A; Bucher, D

    2009-12-01

    This study investigated variation in the rates of growth and mortality, and age and fork-length (L(F)) compositions of two exploited species of Mugilidae, Liza argentea and Myxus elongatus, in two south-east Australian estuaries (Lake Macquarie and St Georges Basin). An ageing protocol was developed by counting opaque growth zones on sectioned otoliths which was validated by periodically examining the otoliths of captive-reared young-of-the-year fishes, and marginal increment analysis of wild fishes. The maximum recorded age was 17 years for L. argentea and 12 years for M. elongatus, which is greater than generally observed in other species of mugilids. Growth models of each species significantly differed between sexes and, except for male L. argentea, between estuaries. Fishes from Lake Macquarie generally had a greater mean L(F) at age than those from St Georges Basin and females of both species generally attained a greater maximum L(F) and age than males. Gillnet catches of L. argentea were of similar L(F) and age compositions in both estuaries, whereas the age composition of catches of M. elongatus in Lake Macquarie contained a greater proportion of younger fish. Estimates of total, natural and fishing mortality were greater for M. elongatus than L. argentea across both estuaries, and estimates of total mortality were greatest for both species in Lake Macquarie. The data indicate that neither species has been overfished in these estuaries.

  16. First occurrence of the crab Calappa nitida Holthuis, 1958 (Brachyura, Calappidae, Calappinae on the coast of the state of Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Lissandra Corrêa Fernandes-Góes

    2007-03-01

    Full Text Available The present study reports a female of Calappa nitida found at a water-pump station on a shrimp farm, in a mangrove located in Cajueiro da Praia, state of Piauí, within the Parnaíba River Delta Environmental Preservation Area. Although C. nitida occurs in northern and northeastern Brazil, this first record from Piauí fills one of the gaps in its known range.

  17. Using a Microfluidic Gradient Generator to Characterize BG-11 Medium for the Growth of Cyanobacteria Synechococcus elongatus PCC7942

    Directory of Open Access Journals (Sweden)

    Chih-Chun Yang

    2015-11-01

    Full Text Available The photosynthetic cyanobacterium Synechococcus elongatus PCC7942 has recently gained great attention for its ability to directly convert CO2 into renewable chemicals upon genetic engineering. Thus, it is of great interest to increase the growth speed and lower the medium requirement for cultivating this cyanobacterium. The cultivation medium of Synechococcus elongatus PCC7942 has been developed, which consists of many inorganic and metal ingredients with a specific composition, known as the BG-11 medium. In this work, we analyzed the concentration effect of each ingredient and identified the absolutely essential components in BG-11 medium for cyanobacteria growth using the concentration gradient generator chip (CGGC fabricated by MEMS technology. As shown by our results, removal of the individual component sodium nitrate, potassium phosphate, or magnesium sulfate from the BG-11 medium led to severe growth inhibition of Synechococcus elongatus PCC7942. Contrary to our expectation, increasing concentration of the crucial ingredients showed either insignificant or negative impact on cell growth. Overall, standard growth could be achieved without supplementation of ethylenediaminetetraacetic acid (EDTA disodium, sodium carbonate, or sodium citrate to the culture medium. Further improvement of the CGGC-based microfluidic system based on this preliminary study may broaden its application range to analyze more complicated correlations.

  18. Interpretation of the chemical compositions of the cumulates of the gabro-anorthositic massif of Piau River - Bahia State

    International Nuclear Information System (INIS)

    Cruz, M.J.M.; Demange, M.; Fonteilles, M.

    1989-01-01

    The Rio Piau gabbroic and anorthositic complex is an Archean layered body; intrusive in the charnokitic and enderbitic terrains of the Jequie nucleous (Sao Francisco Craton, Bahia State, Brazil). The geochemical data of the Rio Piau massif consists of two magmatic series, better identified by REE, titanium, phosphorous, niobium and gallium contents. These two magmatic series show an evolution following the typical tholeiitic and several types of cumulatic rocks. The evolution of each magmatic series is made up by differentiation and accumulation, from basic terms (MgO = 10%) up to intermediate terms (MgO = 2%) and shows an evolution similar to the Skaergaard trends. (author) [pt

  19. Cerambycidae (Coleoptera do Parque Nacional da Serra das Confusões, Piauí, Brasil: novas espécies e novos registros

    Directory of Open Access Journals (Sweden)

    Maria Helena M. Galileo

    2013-12-01

    Full Text Available Três novas espécies são descritas do Piauí, em Cerambycinae: Compsibidion pictum, sp. nov. (Neoibidionini; em Lamiinae: Adetus differentis sp. nov. (Apomecynini e Mimasyngenes piauiensis sp. nov. (Desmiphorini. De 75 espécies procedentes do Riacho dos Bois (Parque Nacional da Serra das Confusões, 50 são novos registros para o Piauí. Três subfamílias são reconhecidas: uma espécie de Prioninae, 46 espécies de Cerambycinae e 28 espécies de Lamiinae.

  20. Integration of DNA barcoding for the initial recordings of Lessepsian fishes: a case study of the Indo-Pacific slender ponyfish Equulites elongatus.

    Science.gov (United States)

    Sakinan, S; Karahan, A; Ok, M

    2017-03-01

    In this study, the DNA barcode of a regional Lessepsian sighting of the slender ponyfish Equulites elongatus is integrated with morphometric and meristic descriptors as a case study to address further identification problems in the Mediterranean Sea. The study also aims to contribute to the regional mitochondrial cytochrome oxidase I information pool, to support other potential uses. The initial sighting of E. elongatus from the north-eastern Mediterranean coast of Turkey is provided from a trawl survey on 3 June 2015, where 76 specimens were captured during a 15 min tow. © 2016 The Fisheries Society of the British Isles.

  1. Anatomy and systematics of Anodontites Elongatus (Swainson from Amazon and Parana Basins, Brazil (Mollusca, Bivalvia, Unionoida, Mycetopodidae

    Directory of Open Access Journals (Sweden)

    Luiz Ricardo L Simone

    1997-12-01

    Full Text Available The anatomy of Anodontiies elongatus (Swainson, 1823, a rare species restricted to the Amazon and Parana Basins, is described by first time, showing a group of conchological and anatomical characters exclusive of this species that may be analyzed to identify it. Diagnosis of A. elongatus: shell long antero-posteriorly, umbones prominent, periostracum opaque and smooth, two posterior radial striae; middle fold of mantle edge veiy tall; gill long antero-posteriorly and short dorso-ventrally, extending about a half of it total length beyond visceral mass; palps proportionally small, several furrows in its outer surface; stomach without esophageal transversal ridjp, dorsal hood and gastric shield poorly developed, major typhlosole entering in ddd , posterior pouch of sa³ very-long; style sac reduced, without crystalline style; distal region of intestine and rectum with a well developed typhlosole, "T" in section, other intestinal regions without folds; gonad gonochoristic.

  2. Two new species of the Liolaemus elongatus-kriegi complex (Iguania, Liolaemidae) from Andean highlands of southern Chile

    Science.gov (United States)

    Troncoso-Palacios, Jaime; Díaz, Hugo A.; Esquerré, Damien; Urra, Felix A.

    2015-01-01

    Abstract The elongatus-kriegi complex is one of the most diverse clades of the Liolaemus (sensu stricto) subgenus of lizards. There are currently 29 species recognized in this group distributed between Chile and Argentina. Based on molecular evidence, there seem to be five main clades nested within this complex: the elongatus, leopardinus, kriegi, petrophilus and punmahuida clades. Liolaemus buergeri and Liolaemus kriegi, both of the kriegi clade, were believed to inhabit the surroundings of the Laja Lagoon, in the Biobío Region of Chile. Moreover, this Chilean population of Liolaemus kriegi was recently recognized as an undescribed taxon called “Liolaemus sp. A” based on molecular phylogenetics. In this work, we studied these two populations of the Laja Lagoon and provided the morphological diagnosis to describe them as two new species: Liolaemus scorialis sp. n. and Liolaemus zabalai sp. n., previously considered Liolaemus buergeri and “Liolaemus kriegi/Liolaemus sp. A” respectively. Additionally, we identified another population of Liolaemus scorialis in the vicinity of La Mula Lagoon in the Araucanía Region of Chile. Liolaemus scorialis differs from almost all of the species of the elongatus-kriegi complex by its considerably smaller size. Nevertheless, without molecular data we cannot assign it to any particular subclade. Liolaemus zabalai belongs to the kriegi clade based on published molecular phylogenies. Finally, we provide some natural history data on both species and we document for the first time the presence of Liolaemus neuquensis in Chile from a museum specimen from La Mula Lagoon. PMID:25987873

  3. Caracterização do Regime de Ventos no Piauí Para o Aproveitamento de Energia Eólica

    Directory of Open Access Journals (Sweden)

    Marcos Antonio Tavares Lira

    Full Text Available Resumo O presente estudo apresenta uma caracterização do regime de ventos em algumas regiões do estado do Piauí, realizada por meio da análise do perfil da velocidade média horária e mensal dos ventos bem como da freqüência da direção dos mesmos. O objetivo principal do trabalho é identificar possíveis sítios de geração de energia eólica no Piauí a partir do uso de uma ferramenta computacional: o software Windographer®. Utilizando-se a base de dados do ano de 2010 do Instituto Nacional de Meteorologia (INMET foram analisados os municípios de Valença, Floriano, Alvorada do Gurgueia, Oeiras, Caracol, São João do Piauí, Paulistana e Parnaíba. Para cada município são apresentados graficamente o regime de ventos horário e mensal bem como da sua direção predominante no período estudado. Os resultados mostraram que os municípios de Paulistana e Parnaíba se destacaram por apresentarem um potencial eólico satisfatório para o aproveitamento de energia elétrica.

  4. Composição florística e estrutural da vegetação de restinga do Estado do Piauí

    OpenAIRE

    Francisco Soares Santos Filho

    2008-01-01

    Restinga é vegetação assentada sobre neossolos quartzarênicos do Quaternário e sua composição florística é considerada uma extensão da floresta atlântica ou de ecossistemas adjacentes. A presente tese traz dois trabalhos realizados nas restingas do estado do Piauí, cujo litoral pertence à porção setentrional do litoral nordestino. Este estudo foi composto por dois capítulos. O primeiro tratou de verificar se as restingas do Piauí apresentam composição florística originada em seus ecossiste...

  5. Monitoramento de coleobrocas associadas à mangueira no município de José de Freitas, Estado do Piauí Monitoring of coleoborers associated to mango tree in José de Freitas city, state of Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Jean Kelson da Silva Paz

    2008-06-01

    Full Text Available Este trabalho foi desenvolvido de junho de 2004 a maio de 2005, objetivando o reconhecimento de espécies de coleobrocas (Insecta: Coleoptera que se encontram associadas a pomar comercial de manga (Mangifera indica das variedades Tommy Atkins, Keitt, Kent e Palmer, no município de José de Freitas, Estado do Piauí. Foram instaladas duas armadilhas etanólicas modelo Carvalho 47 em cada área das referidas variedades e realizadas coletas semanais. As coleobrocas foram separadas dos resíduos vegetais, secas sob lâmpada e quantificadas. Posteriormente, exemplares de cada morfoespécie coletada foram identificados. Coleobrocas das famílias Bostrichidae, Cerambycidae, Curculionidae estão associadas às variedades de manga cultivadas no município de José de Freitas, Estado do Piauí, onde se destacam as espécies Hylettus seniculus (Germar (Coleoptera: Cerambycidae, Hypothenemus sp. 1 e sp. 2. (Coleoptera: Curculionidae: Scolytinae, apresentando maior expressão numérica e variedade de morfoespécies durante o período de menor precipitação pluviométrica, fator correlacionado positivamente à família Cerambycidae.This research was developed from June 2004 to May 2005, under field conditions, aiming the recognition of species of coleoborers that are associated to commercial mango orchard (Mangifera indica L. of varieties Tommy Atkins, Keitt, Kent and Palmer, in José de Freitas city, state of Piauí. It was installed two ethanolics traps model Carvalho 47 in each area of the related varieties and weekly collections were realized. Coleoborers were separated of the vegetal residues, dried under light bulb and quantified. Samples of each morphspecies were collected and mounted in entomologic pins then sent for identification. Coleoborers of the families, Bostrichidae, Cerambycidae and Curculionidae are associated to the varieties of mangoes cultivated in José de Freitas city, state of Piauí, highlighting the species Hylettus seniculus

  6. Escore de Framingham em motoristas de transportes coletivos urbanos de Teresina, Piauí Framingham score for public transportation drivers in the dity of Teresina, Piauí

    Directory of Open Access Journals (Sweden)

    Maurício Batista Paes Landim

    2006-09-01

    Full Text Available OBJETIVO: Estimar o risco absoluto de contração de doença arterial coronariana, nos próximos 10 anos, em motoristas de transportes coletivos urbanos de Teresina, Piauí, segundo o escore de risco de Framingham. MÉTODOS: Foi realizado um estudo observacional, descritivo, transversal, aplicando-se o escore de Framingham, em 107 motoristas de transportes coletivos urbanos de Teresina, Piauí, para avaliação do grau de risco e sua associação com as variáveis previstas no mesmo, que foram: idade, colesterol total, colesterol HDL, pressão arterial sistólica, pressão arterial diastólica, presença de diabete melito e tabagismo. O teste de significância usado foi o c². Utilizou-se a razão de prevalência como medida de associação. RESULTADOS: O risco médio foi de 5%, com a maior parte situando-se na categoria de baixo risco (85,05%. As médias obtidas foram: 42 anos para a idade, colesterol total 200 mg%, colesterol HDL 49 mg%, pressão arterial sistólica 130 mmHg e pressão arterial diastólica 85 mmHg. As associações diabete melito, tabagismo e colesterol HDL, com o risco, não foram estatisticamente significantes, diferente do ocorrido com as outras variáveis, que tiveram grande influência no risco obtido. CONCLUSÃO: O risco absoluto médio estimado para os próximos 10 anos de doença arterial coronariana, em motoristas de transportes coletivos urbanos de Teresina, calculado pelo escore de Framingham, apresentou-se baixo. Uma parte considerável dos participantes da pesquisa (85,05% situou-se na categoria de baixo risco, ou seja, igual ou inferior a 10%.OBJECTIVE: To estimate the absolute risk of the public transportation drivers in the city of Teresina, Piauí, to develop coronary heart disease over the course of ten years based on the Framingham risk score. METHODS: An observational, descriptive, cross-sectional study using the Framingham score was conducted with 107 public transportation drivers in the city of Teresina

  7. Morbidade da doença de Chagas em áreas do Sertão da Paraíba e da Caatinga do Piauí

    Directory of Open Access Journals (Sweden)

    José Rodrigues Coura

    1996-04-01

    Full Text Available Foram estudados 186 pares de indivíduos sorologicamente positivos e negativos para infecção chagásica, da mesma idade e sexo, do Sertão da Paraíba e 200 indivíduos também sorologicamente positivos nos municípios de Oeiras e Colônia do Piauí. Depois de confirmados por pelo menos dois outros testes sorológicos: imunofluorescência indireta quantitativa, ELISA, hemaglutinação ou fixação do complemento,foi feito o exame clínico, eletrocardiográfico e radiológico nos indivíduos selecionados para o estudo exenodiagnóstico, hemocultura e PCR em amostras representativas dos casos soropositivos. As manifestações clínicas predominantes entre os soropositivos em ambas as áreas foram palpitações, dispnéia aos esforços, disfagia, odinofagia, pirose e obstipação. As freqüências das alterações eletrocardiográficas sugestivas da doença de Chagas foram, respectivamente, na Paraíba e no Piauí: BAV = 3,8 % e 2 %, BRD III = 6,4 % e 7 %, BRD III + HBAE = 10,7 % e 10,5 % e extra-sístoles ventriculares complexas = 2,7 % e 3,% . O xenodiagnóstico foi positivo em 13 % dos casos soropositivos da Paraíba e em 34 % dos casos do Piauí, enquanto que o PCR foi positivo, respectivamente, em 44,6 e 59,5 %. A hemocultura realizada apenas no Piauí foi positiva em 25,7 % dos casos estudados. Foram realizados inquéritos triatomínicos em 132 domicílios e peridomicílios no Sertão da Paraíba e em 159 na Caatinga do Piauí, sendo capturados 16 exemplares de T. brasiliensis não infectados no peridomicílio na Paraíba e 750 exemplares no Piauí, dos quais 625 foram examinados: 49 de T. pseudomaculata não infectados com T. cruzi (19 no intradomicílio e 30 no peridomicílio e 576 de T. brasiliensis (371 no intradomicílio e 205 no peridomicílio entre os quais 32 (5,5% estavam infectados com T. cruzi (31 no intradomicílio e um no peridomicílio.

  8. As políticas sociais na formação graduada do psicólogo no Piauí

    Directory of Open Access Journals (Sweden)

    Clarissa de Andrade e Silva

    Full Text Available A presente pesquisa teve como objetivo investigar a presença das políticas sociais na formação graduada do psicólogo no Piauí. Para tanto, realizou-se uma pesquisa documental, por meio dos projetos pedagógicos dos cursos (PPC, em quatro cursos de graduação em Psicologia no Piauí. Evidenciou-se a presença das políticas sociais no PPC desde o perfil do egresso, nas ênfases, nas disciplinas e nos estágios, embora de maneira periférica. Também se constatou a desarticulação entre a proposta do perfil e a operacionalização da matriz curricular, a fragmentação e a insuficiência dos conteúdos direcionados às políticas sociais e, ainda, o marcante predomínio da clínica nessas formações. Verificou-se que as políticas de saúde são as que mais se destacam no PPC. Discute-se a necessidade de revisão da presença das políticas sociais na formação do psicólogo do Piauí, de modo a proporcionar maior articulação dos conteúdos voltados para as mesmas, assumindo-se uma posição mais central, crítica e política nessas formações.

  9. Description of a new species of the genus Leporinus Spix (Characiformes: Anostomidae from the rio Araguaia, Brazil, with comments on the taxonomy and distribution of L. parae and L. lacustris

    Directory of Open Access Journals (Sweden)

    Heraldo A. Britski

    Full Text Available A new species of the genus Leporinus is described from the rio Araguaia, in Mato Grosso and Goiás states, Brazil. The new species has the dental formula 4/3, a unique feature within the genus; all other species of Leporinus have dental formulae 3/3, 3/4 or 4/4. In addition, the new species can also be distinguished by the following combination of characters: 36 to 37 scales in the lateral line, 4/4.5 or 4/5 series of scales in the transversal line, 16 circumpeduncular scale series, anal fin surpassing base of lower caudal-fin rays and three blotches along the lateral line. The new species shares with L. parae and L. lacustris a rather deep body, terminal mouth, long anal fin, three small dark blotches on the lateral line, the latter two, particularly the last one, usually fading, and preference for lentic habitats. Comments on the taxonomy and distribution of the species L. parae and L. lacustris are provided.

  10. Inclusão do triticale em rações para alevinos de piavuçu, Leporinus macrocephalus (Garavello & Britski, 1988 Inclusion of triticale in meals for piavuçu fry Leporinus macrocephalus (Garavello & Britski, 1988

    Directory of Open Access Journals (Sweden)

    Mariza Yuri Nagae

    2001-05-01

    Full Text Available Objetivando avaliar o triticale, em rações para alevinos de piavuçu, Leporinus macrocephalus (Characiformes, Anostomidae, 240 alevinos com peso inicial médio de 1,70±0,03 g foram distribuídos em um delineamento experimental em blocos casualizados com seis tratamentos e cinco repetições, em 30 tanque-redes (120 L instalados em cinco tanques de cimento amianto (1.000 L, com oito peixes em cada tanque-rede. Utilizaram-se seis teores de inclusão de triticale nas rações que corresponderam a 0,00; 5,14; 10,29; 15,43; 20,58 e 25,72%. Não foi observado efeito (p > 0,05 dos teores de inclusão de milheto sobre o peso final médio, ganho de peso médio, conversão alimentar aparente, taxa de eficiência protéica, sobrevivência e viabilidade econômica (custo/kg ganho. Os parâmetros físicos e químicos estiveram dentro da faixa recomendada para a criação da espécie. Conclui-se que o triticale pode representar 25,72% das rações, sem prejudicar o desempenho dos peixes, porém sua utilização dependerá das oscilações de disponibilidade e preço no mercado.An evaluation of triticale in meals for piavuçu fry Leporinus macrocephalus (Characiformes, Anostomidae is provided. Two hundred and forty fry, initial mean weight 1.70±0.03g, were distributed in randomized blocks with six treatments and five repetitions in 30 120L-compartamentized ponds in five amianthus 1000L-tanks, with eight fishes in each pond. Six inclusion levels of triticale were used in meals: 0.00; 5.14; 10.29; 15.43; 20.58 and 25.72%. Inclusion levels had no influence (p > 0.05 on mean final weight, mean weight gain, apparent food conversion, protein efficiency rate, survival and economic viability (costs/gained kg. Physical and chemical parameters were kept within limits recommended for species. Triticale may therefore represent 25.72% of meal without any impairment in fish development. Nevertheless, its use will depend on availability and market price.

  11. Seasonal changes in food quantity and quality of the common North Sea copepods Temora longicornis and Pseudocalanus elongatus: a bioassay approach

    DEFF Research Database (Denmark)

    Koski, Marja; Dutz, Jörg; Klein Breteler, W.

    2010-01-01

    We evaluated the food quantity and quality over a seasonal cycle for the development and egg production of the common North Sea copepods Temora longicornis and Pseudocalanus elongatus, using a bioassay approach. Seston was sampled from December to October from a well-mixed water column of the Mar......We evaluated the food quantity and quality over a seasonal cycle for the development and egg production of the common North Sea copepods Temora longicornis and Pseudocalanus elongatus, using a bioassay approach. Seston was sampled from December to October from a well-mixed water column...... with the seston from the spring bloom in March-April. The juveniles of both species were able to complete their development only in spring experiments. A multiple regression analyses and comparison to a good-quality standard food of the same concentration suggested that, in an annual scale, the egg production...

  12. Farinha de vísceras de aves na alimentação de alevinos de piavuçu (Leporinus macrocephalus Poultry by products in the feeding of piavuçu (Leporinus macrocephalus fingerlings

    Directory of Open Access Journals (Sweden)

    Arcangelo Augusto Signor

    2007-06-01

    Full Text Available No presente trabalho, objetivou-se avaliar a inclusão de farinha de vísceras de aves (FV na alimentação de alevinos de piavuçu (Leporinus macrocephalus. Foram utilizados 125 alevinos com peso e comprimento inicial médios de 0,26±0,01g e 2,37±0,28cm, respectivamente, distribuídos em 25 aquários com 30 litros de volume útil, em um delineamento inteiramente casualizado, com cinco tratamentos e cinco repetições. As rações foram formuladas de forma a conterem 0; 5; 10; 15 e 20% de FV, sendo as mesmas isoenergéticas e isoprotéicas. O arraçoamento foi realizado às quatro vezes ao dia, às 8, 11, 14 e 17 horas, com base em 10% da biomassa total. Os parâmetros zootécnicos avaliados foram peso final (PF, comprimento final (CF, ganho de peso (GP, conversão alimentar aparente (CA e sobrevivência (SO. Foram observados aumentos lineares (P0,05 entre os tratamentos. O aumento na inclusão de FV em rações até 20% melhora o desempenho de alevinos de piavuçu.The present research aimed at evaluating the inclusion poultry by products of birds viscera flour (FV in the feeding of piavuçu (Leporinus macrocephalus fingerlings. 125 fingerlings with weight and medium initial length of 0.26±0.01g and 2.37±0.28cm, respectively were used, distributed in 25 aquariums (30 liters water capacity each in an entirely casualized delineation with five treatments and five repetitions. The rations were formulated in way to contain 0; 5; 10; 15 and 20% of FV, being the same isoenergetics and isoproteics. The feed giving was realized four times at 8, 11, 14 and 17 hours, with base in 10% of the total biomass. The zootechnics parameters evaluated were the final weight (PF, final length (CF, weight gain (GP, apparent alimentary conversion (CA and survival (SO. There were observed an increase in the lineal differences (P0.05 among the treatments. The increase in the inclusion of FV in rations up to 20%, improves the piavuçu fingerlings performance.

  13. Genetic diversity of pacu and piapara broodstocks in restocking programs in the rivers Paraná and Paranapanema (Brazil

    Directory of Open Access Journals (Sweden)

    Nelson Mauricio Lopera-Barrero

    2016-09-01

    Full Text Available The genetic diversity of Piaractus mesopotamicus (pacu and Leporinus elongatus (piapara broodstocks used in restocking programs in the rivers Paraná and Paranapanema is analyzed. One hundred and twenty specimens (two broodstocks of each species from fish ponds in Palotina PR Brazil and in Salto Grande SP Brazil were assessed. Ten primers produced 96 fragments, comprising 68 (70.83% and 94 (97.92% polymorphic fragments for P. mesopotamicus and L. elongatus broodstocks, respectively. Differences (p < 0.05 in the frequency of 15 and 27 fragments were detected for each species, without exclusive fragments. Shannon Index (0.347 - 0.572 and the percentage of polymorphic fragments (57.3% - 94.8% revealed high intra-population genetic variability for all broodstocks. Results of molecular variance analyses (AMOVA showed that most variations do not lie between the broodstocks but within each broodstock (89%. Genetic (0.088 and 0.142 and identity (0.916 and 0.868 distance rates demonstrated similarity between the broodstocks of each species, corroborated by Fst (0.1023 and 010.27 and Nm (4.18 and 4.33 rates, with a slight genetic difference due to genic flux. High intrapopulation genetic variability and similarity between the broodstocks of each species was also detected, proving a common ancestry.

  14. Morphology, chemistry and function of the postpharyngeal gland in the South American digger wasps Trachypus boharti and Trachypus elongatus.

    Directory of Open Access Journals (Sweden)

    Gudrun Herzner

    Full Text Available Microbes pose severe threats to animals as competitors or pathogens and strongly affect the evolution of life history traits like parental care. Females of the European beewolf Philanthus triangulum, a solitary digger wasp, provision their offspring with paralyzed honeybees and embalm them with the secretion from large postpharyngeal glands (PPG that contain mainly unsaturated hydrocarbons. This coating changes the physico-chemical properties of the prey surface, causes a reduction of water condensation and retards growth of mold fungi. Here we examined the closely related South American genus Trachypus, which shows a life-history similar to Philanthus. We investigated whether Trachypus spp. also possess PPGs and embalm larval provisions. Using histological methods and 3D reconstructions we show that Trachypus boharti and T. elongatus possess PPGs that are similar to P. triangulum but somewhat smaller. The ultrastructure of the gland epithelium suggests that the gland content is at least partly sequestered from the hemolymph. Chemical analyses using gas chromatography / mass spectrometry revealed that both the cuticle and PPGs of Trachypus contain mainly unsaturated long-chain hydrocarbons. The gland of T. boharti additionally contains long-chain ketones. The hydrocarbons from the PPG of T. elongatus occurred on prey bees excavated from nests in the field but not on conspecific control bees. While the embalming only slightly elevated the amount of hydrocarbons on prey bees, the proportion of unsaturated hydrocarbons, which is crucial for the antifungal effect, was significantly increased. The Trachypus species under study possess PPGs that are very similar to the PPG of P. triangulum with regard to morphology, ultrastructure and chemistry. Moreover, we provide clear evidence that T. elongatus females embalm their prey, presumably as a means of prey preservation. The observed differences among Trachypus and Philanthus in gland size and prey

  15. Reproductive biology of Liseta Leporinus muyscorum Steindachner, 1901 in the Sinu River, Colombia

    Directory of Open Access Journals (Sweden)

    Fredys Segura-Guevara

    2017-01-01

    Full Text Available Objective. The reproductive biology of Liseta Leporinus muyscorum (Steindachner, 1901 in the Sinu river, Colombia, was studied. Materials and methods. Individuals were collected between March 2006 and February 2007, with lengths and weights ranging 20.5-41.0 (30.0 ± 3.7 cm of total length and 97.6-728.0 (320.9±117.9 g, respectively. The gonads were placed in Gilson solution, the Vazzoler scale was applicated and sexual proportion, sexual maturity index, spawning season, the length at first maturity, ovocites’s diameter and fecundity were estimated. Results. 344 individuals were collected, of which 249 were females and 95 were males, with sexual proportion female: male of 2.6:1, different from expected. The length at first maturity was estimated in 28.9, 28.1 y 28.8 cm TL for females, males and combined sexes, respectively, ovocites’s diameter was 977 μ and fecundity was estimated in 30793 oocytes. Conclusions. The Liseta is a fish with synchronous oocyte development in two groups, whose spawning season extends from February to September, with large oocytes and high fecundity, strongly associated with ovarian weight.

  16. Estudo morfológico do tecido hepático de Leporinus macrocephalus - DOI: 10.4025/actascibiolsci.v29i1.157 Morphological study of the hepatic tissue of Leporinus macrocephalus

    Directory of Open Access Journals (Sweden)

    Irene Bastos Franceschini Vicentini

    2007-11-01

    Full Text Available O presente trabalho objetivou análise macroscópica e histológica do fígado de Leporinus macrocephalus para avaliar a estrutura do tecido hepático. Os peixes provenientes de um pesqueiro da região de Bauru, Estado de São Paulo, foram anestesiados, mortos, e os fígados foram retirados e encaminhados à rotina histológica, com inclusão em paraplast. A macroscopia mostrou um figado de estrutura homogênea, de coloração marron-avermelhada, localizado na região medial do corpo, caudalmente ao coração e posterior às brânquias, apresentando três lóbos de forma piramidal, sendo um central e dois laterais direito e esquerdo. A análise histológica revelou o tecido hepático constituído por cordões duplos de hepatócitos circundados por sinusóides, denominado de “muralha dupla”. Revelou, ainda, um sistema biliar disperso pelo parênquima hepático mostrando ductos com epitélio cúbico simples, circundado por fibras musculares e tecido conjuntivo. Células do tecido pancreático exócrino foram observadas, margeando vasos sangüíneos, organizando-se em ácinos apresentando grânulos de zimogênio. Além disso, existem centros melanomacrófagos distribuídos ao longo de todo parênquima, preferencialmente próximos aos vasos sanguíneos, formados por células que acumulam materiais como melanina e lipofucsina, podendo sua presença estar relacionada com o estado nutricional do peixeThe objective of this work was to analyze the liver of Leporinus macrocephalus at the macroscopic and histologic level by evaluating the characteristics of the hepatic tissue. The fishes from a fishery in Bauru, S.P., were collected and sacrificed by destroying the spinal cord; afterwards the collected hepatic tissue was fixed and followed by histological routine. Macroscopic analysis of L. macrocephalus liver showed an organ of homogeneous structure, with red-brown color, located in the medial region of the body, caudal to heart and after the gills

  17. Farelo de canola na alimentação do piavuçu, Leporinus macrocephalus (Garavello & Britski, na fase inicial Canola bran in piavuçu Leporinus macrocephalus (Garavello & Britski feeding, during initial phase

    Directory of Open Access Journals (Sweden)

    Valéria Rossetto Barriviera Furuya

    2002-04-01

    Full Text Available O presente estudo teve por objetivo determinar os efeitos da inclusão de farelo de canola (FC em substituição à proteína do farelo de soja (FS na alimentação do piavuçú, Leporinus macrocephalus (Garavello & Britski (Characiformes, Anastomidae, na fase inicial. Foram utilizados 100 alevinos (8,51 ± 0,07g, distribuídos em blocos casualizados com quatro tratamentos, cinco repetições, sendo que cada unidade experimental era constituída por cinco peixes. Foram elaboradas quatro rações isocalóricas (3.000kcal ED/kg e isoprotéicas (30% de PB com base em milho, farelo de soja e farinha de peixe, contendo 0%, 19%,12%; 38%,24% e 57,36% de FC. A análise de variância não apresentou efeitos dos níveis de inclusão de FC sobre as variáveis de consumo, sobrevivência, rendimento e composição química da carcaça, gordura visceral e índice hepatossomático. Foi observado efeito quadrático dos níveis de inclusão sobre a porcentagem de ganho de peso, ocorrendo o ponto máximo no nível de 19,11% de inclusão de FC. Com o aumento nos níveis de FC, foi observado piora linear sobre a conversão alimentar e taxa de eficiência protéica. A inclusão de 11,19% de FC resultou em melhor desempenho e rendimento de carcaça.This research aimed to investigate the effects of canola bran (CB inclusion, replacing the soybean bran crude protein in piavuçu diet, Leporinus macrocephalus (Garavello & Britski (Characiformes, Anastomidae, in initial phase. One hundred fingerlings (8.51 ± 0.07g were assigned to a completely randomized block design with five replications, totalizing 25 fishes per treatment. Four isocaloric (3,000kcal ED/kg and isoproteic (30% CP diets were formulated, based on corn, soybean bran and fish flour, containing 0%; 19.12%; 38.24% and 57.36% CB. Variance analysis showed no effect of CB inclusion on feed intake survival, carcass yield and composition, visceral fat and hepato somatic index. Quadratic effect of CM inclusion was

  18. Estratégia Saúde da Família e internações hospitalares em menores de 5 anos no Piauí, Brasil The Family Health Strategy and hospital admissions of children under five years in Piauí State, Brazil

    Directory of Open Access Journals (Sweden)

    Jorge Otávio Maia Barreto

    2012-03-01

    Full Text Available Internações hospitalares por algumas condições de saúde podem ser reduzidas por uma atenção primária oportuna e com qualidade, especialmente na população infantil. Analisou-se a evolução das internações hospitalares de menores de 5 anos no Piauí, Brasil, de 2000 a 2010, segundo grupos de causas (CID-10 e das internações de 2010, com base na lista brasileira de Internações por Condições Sensíveis à Atenção Primária. O objetivo foi identificar mudanças no perfil de morbidade hospitalar e discutir sua relação com a expansão da ESF no estado. O Piauí apresentou a maior expansão proporcional da ESF, alcançando a cobertura estimada de 97,2%, em 2010. No período de 2000 a 2010, a frequência e as taxas de internações em menores de 5 anos foram reduzidas, porém, a proporção de hospitalizações nos principais grupos de causas se manteve ou aumentou, ao longo da década analisada. Em 2010, 60% das internações em menores de 5 anos foram por causas sensíveis à atenção primária, em especial gastrenterites infecciosas, infecções respiratórias e asma.Hospitalizations for some health conditions can be reduced by timely primary care with appropriate quality, especially in children. This study analyzed the trend in hospitalizations in children under five years of age in Piauí State, Brazil, from 2000 to 2010, according to groups of causes (ICD-10 and hospital admissions in 2010, based on the Brazilian List of Hospitalizations for Primary Care-Sensitive Conditions. The objectives were to identify changes in the hospital morbidity profile and to discuss their relationship to expansion of the Family Health Strategy (FHS in the State. Piauí showed the highest proportional expansion of the FHS in Brazil, reaching an estimated coverage of 97.2% in 2010. From 2000 to 2010, there was a reduction in the hospitalization frequency and rates in children under five years, but the proportion of hospitalizations in the leading

  19. [Demographic and clinical features of patients with rheumatoid arthritis in Piauí, Brazil--evaluation of 98 patients].

    Science.gov (United States)

    Almeida, Maria do Socorro Teixeira Moreira; Almeida, João Vicente Moreira; Bertolo, Manoel Barros

    2014-01-01

    Brazilian epidemiological studies on rheumatoid arthritis are scarce, mainly in the northeast; thus many data currently available originate from the international literature. To describe demographic, clinical and serological characteristics of patients with rheumatoid arthritis (RA) followed-up by the same physician, in state of Piauí, Brazil. Data were collected between August 2010 and March 2013, in three health services of Piauí that provided health care in Rheumatology: a university-affiliated hospital, a public outpatient clinic and a private clinic. The numbers represent mean ± SD or percentage: 47.5±11.03 years-old non-Caucasian woman, non-smoker (59.2%), low educational level, mean disease duration of 7.7 years ± 7.6, and major extra-articular manifestations were rheumatoid nodules (19.4%) and sicca syndrome (46.9%). Features of rheumatoid arthritis obtained in this study are similar to those found in some national and international studies, but we observed higher female preponderance and illiteracy rate, in addition to a moderately severe erosive disease on average, with frequent sicca and other extra-articular manifestations. Copyright © 2014 Elsevier Editora Ltda. All rights reserved.

  20. Parasite infracommunities of Leporinus friderici: A comparison of three tributaries of the Jurumirim Reservoir in southeastern Brazil

    Directory of Open Access Journals (Sweden)

    FÁBIO H. YAMADA

    Full Text Available ABSTRACT The degradation and homogenization of natural habitats is considered a major cause of biotic homogenization. Many studies have been undertaken on the effects of dams on aquatic wildlife, in particular fish assemblages. But how do dams affect the parasitic fauna of such fish? The aim of the present study was to examine parasitic similarity, comparing the diversity and structure of parasite communities of Leporinus friderici (Characiformes, Anostomidae in three upstream tributaries under the influence of the Jurumirim Dam on the Upper Paranapanema River in southeastern Brazil. The present study did not find any significant differences in parasite communities among populations of L. friderici in the three upstream tributaries. This result highlights that dams promote and facilitate the dispersal of organisms between localities, and therefore the spatial homogenization of parasite communities. Overall, the results suggest that fish parasite assemblages can provide suitable data for evaluating biotic homogenization caused by dams.

  1. Composição e estrutura da vegetação de caatinga no sul do Piauí, Brasil

    Directory of Open Access Journals (Sweden)

    Mailson Pereira de Souza

    2017-06-01

    Full Text Available Visando contribuir para o conhecimento mais profundo a respeito da vegetação do sul do Piauí, e em especial às áreas de tensão ecológica, o presente trabalho objetivou inventariar, avaliando qualitativamente, o componente lenhoso de um trecho de Caatinga, no município de Bom Jesus, Piauí, Brasil. Para realização do levantamento foram alocadas 10 parcelas de 50x20 m (1000 m², totalizando 1 ha de área amostrada, dispostas de forma contíguas para minimizar os possíveis efeitos de borda da área. Foram amostrados os indivíduos lenhosos vivos com diâmetro à altura do peito (DAP ≥ 5 cm, independente da altura. No levantamento foram encontradas 11 famílias, 25 gêneros e 27 espécies. Destas, as que se destacaram com os maiores valores de IVI foram: Cenostigma macrophyllum Tul., Combretum duarteanum Cambess., Erythroxylum laetevirens O.E.Schulz, Campomanesia pubescens (Mart. ex DC. O. Berg., e Licania rigida Benth. O índice de diversidade de Shannon-Wiener (H’ foi de 2,7 nats.ind-1. Para todos os efeitos de comparações, observou-se que a área estudada encontra-se em bom estado de conservação, não se constatando evidências diretas de exploração, tão pouco resquícios de incêndios florestais, apesar da proximidade da área de estudo com a zona urbana da cidade de Bom Jesus do Piauí. O fragmento é um ecótono vegetacional, com predomínio de espécies típicas da Caatinga.Composition and structure  caatinga vegetation in south Piauí, BrazilAbstract: To contribute to the deeper knowledge of the southern Piaui vegetation, especially the areas of ecological tension, this study aimed to inventory and qualitatively assess the woody component of a Caatinga stretch in the municipality of Bom Jesus / PI,  Brazil. To perform the survey plots were allocated 10 50x20 m (1000 m² totaling 1 ha of sampled area, arranged contiguous way to minimize the possible edge effects area. They sampled the living woody individuals with

  2. ESTILOS DE APRENDIZAGEM NO ENSINO SUPERIOR: um estudo com universitários ribeirinhos do Piauí

    Directory of Open Access Journals (Sweden)

    Fauston Negreiros

    2017-05-01

    Full Text Available Este artigo resulta de estudos acerca dos estilos de aprendizagem de estudantes do ensino superior do estado do Piauí, residentes em comunidades ribeirinhas. Desse modo, a metodologia utilizada foi a quanto-qualitativa e quanto aos seus objetivos de pesquisa é lassificada como exploratório-descritiva. Essa pesquisa teve a participação de 400 estudantes, sendo 105 do curso de Administração; 91 de Biologia; 94 de Enfermagem; 110 de Pedagogia. O instrumento de coleta de dados foi o questionário Preferências Perceptuais em Estilos de Aprendizagem Joy Reid. O material coletado foi analisado estatisticamente pelo programa GraphPadPrism. Seguidamente os dados foram tratados e confrontados com a técnica da Hermenêutica de Profundidade, seguindo suas três etapas: a análise sócio-histórica; a análise formal ou discursiva; a (re interpretação. Os resultados obtidos podem contribuir para o melhor desenvolvimento dos discentes, com novas propostas metodológicas baseadas no estilo de aprendizado preferencial de cada curso, considerando as singularidades da formação e do mercado de trabalho.  Palavras-chave: Estilos de aprendizagem. Aprendizagem. Ensino superior. LEARNING STYLES IN HIGHER EDUCATION: a study of Piauí bordering university ABSTRACT This article is the result of studies on students’ learning styles of Piauí state of higher education, residents of riverside communities. Thus, the methodology used was quantitative qualitative and about their research objectives is classified as exploratory and descriptive. This survey was attended by 400 students, with 105 Administration course students; 91 Biology course; 94 of the nursing course; 110 from the Faculty of Education. The data collection instrument was a questionnaire Perceptual Preferences Joy Reid Learning Styles. The collected material was analyzed statistically by GraphPadPrism program. Then the data were analyzed and compared with the Depth

  3. Levantamento florístico de Bryopsida de cerrado e mata ripícola do Parque Nacional de Sete Cidades, Piauí, Brasil Bryopsida from the cerrado and gallery forest of the Sete Cidades National Park, in the State of Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Nívea Maria Carneiro Farias Castro

    2002-01-01

    Full Text Available Foi realizado o levantamento florístico das Bryopsida dos ecossistemas de cerrado e de mata ripícola do Parque Nacional de Sete Cidades localizado nos municípios de Piracuruca e Brasileira (04º0515'S e 41º3045'W, Piauí, Brasil. Foram identificadas 22 espécies de musgos pertencentes às famílias: Bartramiaceae (1 sp., Bryaceae (2 sp., Calymperaceae (2 sp., Dicranaceae (3 sp., Erpodiaceae (1 sp., Fissidentaceae (6 sp., Hypnaceae (1 esp., Leucobryaceae (1 sp., Pottiaceae (2 sp., Sematophyllaceae (2 sp. e Stereophyllaceae (1 sp.. Constituem-se novas referências para o Brasil, Weisiopsis nigeriana (Egun. & Olar. Zand.; para o Nordeste, Campylopus heterostachys (Hampe Jaeg. e para o Estado do Piauí: Bryum capillare Hedw., Bryum cruegeri Hampe ex C.Müller, Philonotis uncinata (Schwaegr. Brid., Vesicularia vesicularis (Schwaegr. Broth., Sematophyllum subsimplex (Hedw. Mitt., Trichosteleum fluviale (Mitt. Jaeg., Hyophila involuta (Hook. Jaeg. & Sauerb., Calymperes palisotii Schwaegr. ssp. richardii (C.Müller S.Edwards, Fissidens guianensis Mont., Fissidens intermedius C.Müller, Fissidens prionodesMont., Fissidens goyazensis Broth. eFissidens zollingeri Mont. Aos táxons são indicadas referências de descrições, ilustração e distribuição geográfica.This study is a floristic survey of the Bryopsida from the "cerrado" and from the gallery forest of the Sete Cidades National Park in the municipalities Piracuruca and Brasileira, in the State of Piauí, Brazil (04º0515'S and 41º30-45'W. Twenty-two taxa were determined from the following families: Bartramiaceae (1 esp., Bryaceae (2 esp., Calymperaceae (2 esp., Dicranaceae (3 esp., Erpodiaceae (1 esp., Fissidentaceae (6 esp., Hypnaceae (1 esp., Leucobryaceae (1 esp., Pottiaceae (2 esp., Sematophyllaceae (2 esp. and Stereophyllaceae (1 esp.. Weisiopsis nigeriana (Egun. & Olar. Zand. is the first record of this species to Brazil, Campylopus heterostachys (Hampe Jaeg. is the first of this

  4. Genetic variability in five species of Anostomidae (Ostariophysi - Characiformes

    Directory of Open Access Journals (Sweden)

    Chiari Lucimara

    1999-01-01

    Full Text Available Genetic variability was studied in five fish species (Anostomidae: Schizodon intermedius and S. nasutus and Leporinus friderici, L. elongatus and L. obtusidens, collected at one location on the Tibagi River (Paraná, Brazil. The protein data from seven systems coded collectively for 19 loci in the liver, muscle and heart. Nine of these loci were polymorphic. The estimated proportion of polymorphism loci ( varied from 16.7% in S. intermedius to 36.9% in L. friderici; the mean heterozygosity observed (o was 0.027 ± 0.015 and 0.109 ± 0.042, respectively. The estimated value of the genetic identity among L. friderici and S. intermedius (0.749 and S. nasutus (0.787 suggested that these are "congeneric" species. Morphological characteristics indicate that these species belong to distinct genera, while isoenzymatic data show that they are very similar at the genetic/biochemical level.

  5. Comparison of gene expression of Toll-like receptors and cytokines between Piau and Commercial line (Landrace×Large White crossbred) pigs vaccinated against Pasteurella multocida type D.

    Science.gov (United States)

    Sousa, Katiene Régia Silva; Ribeiro, André Mauric Frossard; Dantas, Waleska de Melo Ferreira; Oliveira, Leandro Licursi de; Gasparino, Eliane; Guimarães, Simone Eliza Facioni

    2017-10-01

    We aimed to compare Toll-like receptors (TLR) and cytokines expression in local Piau breed and a Commercial line (Landrace×Large White crossbred) pigs in response to vaccination against Pasteurella multocida type D. Seronegative gilts for Pasteurella multocida type D and Mycoplasma hyopneumoniae were used, from which peripheral blood mononuclear cells (PBMC) were collected in four time points (T0, T1, T2 and T3; before and after each vaccination dose). For bronchoalveolar lavage fluid cells (BALF), we set groups of vaccinated and unvaccinated animals for both genetic groups. Gene expression was evaluated on PBMC and BALF. In PBMC, when we analyzed time points within breeds, significant differences in expression for TLRs and cytokines, except TGFβ, were observed for Commercial animals. For the Piau pigs, only TGFβ showed differential expression. Comparing the expression among genetic groups, the Commercial pigs showed higher expression for TLRs after first vaccination dose, while for IL2, IL6, IL12 and IL13, higher expression was also observed in T3 and IL8 and IL10, in T1 and T3. Still comparing the breeds, the crossbred animals showed higher expression for TNFα in T1 and T2, while for TGFβ only in T2. For gene expression in BALF, vaccinated Commercial pigs showed higher expression of TLR6, TLR10, IL6, IL8, IL10, TNFα and TGFβ genes than vaccinated Piau pigs. The Commercial line pigs showed higher sensitivity to vaccination, while in local Piau breed lower responsiveness, which may partly explain genetic variability in immune response and will let us better understand the tolerance/susceptibility for pasteurellosis. Copyright © 2017 Elsevier Ltd. All rights reserved.

  6. Fungos filamentosos isolados do solo do Parque Nacional Serra das Confusões, Piauí, Brasil

    OpenAIRE

    Malaquias de Lima Maciel, Josilene

    2008-01-01

    O solo é considerado um dos principais habitats para a comunidade de microrganismos, dentre os quais os fungos. O Parque Nacional Serra das Confusões, Estado do Piauí, Brasil, é considerado área prioritária para a conservação da biodiversidade da Caatinga, devido à sua extrema importância biológica. Com objetivo de isolar e identificar fungos filamentos da Caatinga de modo a ampliar o conhecimento sobre a micota deste bioma, 20 amostras de solo foram coletadas até 20 cm de prof...

  7. Avaliação longitudinal da fluoretação da água de abastecimento público de Teresina-Piauí = Long-term assessment of fluoride level of public water supply in Teresina-Piauí

    OpenAIRE

    Moura, Marcoeli Silva de

    2005-01-01

    A concentração de fluoreto na água de abastecimento público deve ser mantida dentro de uma faixa ideal para contemplar o binômio riscos/benefícios desta medida de saúde publica. Assim, o objetivo deste estudo foi monitorar, mensalmente, a concentração de fluoreto na água de abastecimento público de Teresina, Piauí, Brasil, assim como validar a importância do heterocontrole. Para a coleta das amostras, foram selecionados aleatoriamente cinco bairros representativos das cinco regiões que compõe...

  8. PINTURAS RUPESTRES DO SÍTIO TAMBORIL, BARRAS, PIAUÍ, BRASIL (Rock Paintings from the Tamboril Site, Barras, Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Sônia Maria Campelo Magalhães

    2015-12-01

    Full Text Available Este artigo apresenta o sítio Tamboril, localizado na área rural do município de Barras, estado do Piauí, Brasil. O sítio arqueológico revelou uma coleção excepcional de grafismos puros, motivos zoomórficos e carimbos de mãos humanas, pintados em diferentes tonalidades de vermelho. Há sobreposições e recorrência dos registros rupestres. A conservação das pinturas é afetada por eflorescências salinas, ação de insetos (particularmente cupins e ninhos de vespas e impacto humano (visitação sem acompanhamento e atividade agrícola nas proximidades. ENGLISH: This paper presents the Tamboril site, located in the rural area of the municipality of Barras, Piauí State, Brazil. The archaeological site revealed an exceptional collection of pure graphisms, zoomorphic motifs, and human handprints, painted in different tonalities of red. There are overlaps and recurrence of rock records. The conservation of these rock paintings is affected by saline efflorescences, insect activity (particularly termites and wasp nests and human impact (unaccompanied visitation and agricultural activity nearby.

  9. The structure of allophycocyanin from Thermosynechococcus elongatus at 3.5 Å resolution

    Energy Technology Data Exchange (ETDEWEB)

    Murray, James William; Maghlaoui, Karim; Barber, James, E-mail: j.barber@imperial.ac.uk [Division of Molecular Biosciences, Imperial College, Exhibition Road, London SW7 2AZ (United Kingdom)

    2007-12-01

    The crystal structure of a light-harvesting protein that interacts with photosystem II is reported. Cyanobacteria and red algae use light-harvesting pigments bound by proteins to capture solar radiation and to channel excitation energy into their reaction centres. In most cyanobacteria, a multi-megadalton soluble structure known as the phycobilisome is a major light-harvesting system. Allophycocyanin is the main component of the phycobilisome core, forming a link between the rest of the phycobilisome and the reaction-centre core. The crystal structure of allophycocyanin from Thermosynechococcus elongatus (TeAPC) has been determined and refined at 3.5 Å resolution to a crystallographic R value of 26.0% (R{sub free} = 28.5%). The structure was solved by molecular replacement using the allophycocyanin structure from Spirulina platensis as the search model. The asymmetric unit contains an (αβ) monomer which is expanded by symmetry to a crystallographic trimer.

  10. Coleoborers (Coleoptera: Cerambycidae, Curculionidae associated to culture wastes in mango crops in José de Freitas county – Piauí/ Coleobrocas (Coleoptera: Cerambycidae, Curculionidae associadas a restos culturais da cultura da manga (Mangifera indica L. – Anacardiaceae no município de José de Freitas – Piauí

    Directory of Open Access Journals (Sweden)

    Sávio Silveira Feitosa

    2007-08-01

    Full Text Available The coleoborers use the wood to complete part of their cycle of life. In search for food they can make galleries and cause damages in the structure of the plant, allowing the entrance of pathogenic individuals that will harm the development of the crop. This research was carried out from January to May 2005 aiming to get information on the species of coleoborers associated to crop wastes in the area of mango crop, in José de Freitas county - Piauí. The insects had been collected in areas of Tommy Atkins, Keitt, Kent and Palmer varieties, in 10 fallen branches, with approximately 50 cm long and 2.5 cm of diameter, that were taken to the plant health laboratory of Centro de Ciências Agrárias in Universidade Federal do Piauí. The coleoborers were removed from the wood, assembled in entomologic pins and sent to the Instituto Biológico in São Paulo SP for species identification. The coleoborers Hypothenemus sp. (Coleoptera: Curculionidae: Scolytinae, Xyleborus sp. (Coleoptera: Curculionidae: Scolytinae and Orthostoma chryseis (Bates, 1970 (Coleoptera: Cerambycidae were found.As coleobrocas usam a madeira para realizar o seu ciclo de vida, fazendo galerias e causando danos na estrutura da planta e em certas situações, permitindo a entrada de patógenos. Este trabalho foi realizado de janeiro a maio de 2005 objetivando identificar e obter informações sobre as espécies de coleobrocas associadas a restos de cultura em área de cultivo de manga, no município de José de Freitas-Piauí. Foram coletados em cada área das variedades Tommy Atkins, Keitt, Kent e Palmer, dez ramos caídos, com aproximadamente 50 cm de comprimento e 2,5 cm de diâmetro, que foram levados ao laboratório de Fitossanidade do Centro de Ciências Agrárias da Universidade Federal do Piauí. As coleobrocas adultas foram retiradas da madeira, montadas em alfinetes entomológicos e enviadas ao Instituto Biológico em São Paulo-SP para identificação das espécies. Foram

  11. Spatial genetic structure and mitochondrial DNA phylogeography of Argentinean populations of the grasshopper Dichroplus elongatus.

    Directory of Open Access Journals (Sweden)

    Natalia Rosetti

    Full Text Available Many grasshopper species are considered of agronomical importance because they cause damage to pastures and crops. Comprehension of pest population dynamics requires a clear understanding of the genetic diversity and spatial structure of populations. In this study we report on patterns of genetic variation in the South American grasshopper Dichroplus elongatus which is an agricultural pest of crops and forage grasses of great economic significance in Argentina. We use Direct Amplification of Minisatellite Regions (DAMD and partial sequences of the cytochrome oxydase 1 (COI mitochondrial gene to investigate intraspecific structure, demographic history and gene flow patterns in twenty Argentinean populations of this species belonging to different geographic and biogeographic regions. DAMD data suggest that, although genetic drift and migration occur within and between populations, measurable relatedness among neighbouring populations declines with distance and dispersal over distances greater than 200 km is not typical, whereas effective gene flow may occur for populations separated by less than 100 km. Landscape analysis was useful to detect genetic discontinuities associated with environmental heterogeneity reflecting the changing agroecosystem. The COI results indicate the existence of strong genetic differentiation between two groups of populations located at both margins of the Paraná River which became separated during climate oscillations of the Middle Pleistocene, suggesting a significant restriction in effective dispersion mediated by females and large scale geographic differentiation. The number of migrants between populations estimated through mitochondrial and DAMD markers suggest that gene flow is low prompting a non-homogeneous spatial structure and justifying the variation through space. Moreover, the genetic analysis of both markers allows us to conclude that males appear to disperse more than females, reducing the chance of the

  12. Diversity of the Arthropod edaphic fauna in preserved and managed with pasture areas in Teresina-Piauí-Brazil

    Directory of Open Access Journals (Sweden)

    RA. Luz

    Full Text Available The soil fauna plays an important function over the processes of organic matter decomposition, nutrient cycling, ground aeration and fertility. Thus, studies on the composition and structure of such communities are important, considering moreover the lack of information in different regions of Brazil and mainly related to the state of Piauí. This study aimed to evaluate the density and diversity of the soil arthropod fauna in a Cerrado area in preservation conditions and in a pasture area. Both are situated in the city of Teresina, capital of the state of Piauí. Pitfall traps were used for sampling. Five stations with four traps were placed in each area. The traps were constituted by a 500 mL plastic cup containing a preserving solution made with 70% alcohol and 40% formalin. The traps were weekly changed by occasion of the collections. Eight samples were performed in the period between March and April 2007. The results were evaluated using the following variables: number of orders, number of families, total of species and total number of individuals. Evaluation of the Diversity Index and Similarity Coefficient were also performed. As result, the variables and diversity indices were slightly higher in the preserved area. However, the similarity coefficient showed only 10% similarity between both areas.

  13. Caracterização da violência física sofrida por prostitutas do interior piauiense Caracterización de la violencia física sufrida por prostitutas del interior del estado de Piauí Characterization of physical violence experienced by prostitutes living inside the state of Piauí

    Directory of Open Access Journals (Sweden)

    Jardeliny Corrêa da Penha

    2012-12-01

    Full Text Available Trata-se de um estudo descritivo-exploratório, com abordagem quantitativa, que teve por objetivo caracterizar a violência física sofrida por prostitutas piauienses e identificar a prevalência deste agravo. Participaram do estudo 76 prostitutas cadastradas na Associação das Profissionais do Sexo de Picos, município do estado do Piauí. A coleta de dados foi realizada nas zonas de prostituição e na Associação, no período de setembro a outubro de 2010. Os resultados evidenciaram que a maioria das prostitutas era jovem, de baixa renda, baixa escolaridade, apresentava tempo de prostituição superior há dois anos (50%, sendo acometidas principalmente pela violência psicológica (60,5%, seguida da física (30,2%. Os agressores eram conhecidos das vítimas e as mulheres dificilmente realizaram a denúncia. Os resultados foram esclarecedores e levaram a afirmar que é comum a ocorrência de violência em mulheres prostitutas, já que estas trabalham em lugares determinantes de atos violentos.Es un estudio descriptivo exploratorio con enfoque cuantitativo, cuyo objetivo fue caracterizar la violencia física sufrida por las prostitutas del Piauí y determinar la prevalencia de esta enfermedad. El estudio incluyó 76 prostitutas registradas en la Asociación de Profesionales del Sexo de Picos, município del estado de Piauí, Brasil. La recolección de datos se llevó a cabo en las áreas de la prostitución y la Asociación, entre septiembre y octubre de 2010. Los resultados mostraron que la mayoría de las prostitutas eran jóvenes, con nivel educativo bajo, tienen tiempo en la prostitución mayor que dos años (50%, siendo principalmente afectadas por la violencia psicológica (60,5%, seguido de física (30,2%. Los atacantes eran conocidos de las víctimas y las mujeres rara vez presentan la queja. Los resultados fueron esclarecedores y llevaron a afirmar que la ocurrencia de la violencia en las mujeres prostitutas es común, ya que

  14. Métodos contraceptivos: a prática dos adolescentes das Escolas Agrícolas da Universidade Federal do Piauí Métodos anticonceptivos: la práctica de los adolescentes de las Escuelas Agrícolas de la Universidad Federal de Piauí Contraceptive methods: the practice of adolescents from Agrarian Schools of Federal University of Piauí

    Directory of Open Access Journals (Sweden)

    Rita de Cássia Magalhães Mendonça

    2009-12-01

    Full Text Available Este estudo objetivou analisar a prática relacionada ao uso dos métodos contraceptivos entre adolescentes das escolas agrícolas da Universidade Federal do Piauí. Realizou-se estudo transversal com 652 adolescentes com idades entre 14 e 19 anos. Os resultados mostraram que, no sexo feminino, a idade média na primeira relação sexual foi de 15 anos (37,5%, com parceiro estável (71,9%. No sexo masculino, 76,7% iniciaram sua atividade sexual entre 14 e 15 anos, com parceira casual (73,5%. O contraceptivo mais conhecido por ambos os sexos foi o condom. Observou-se associação entre o conhecimento e uso da pílula (pEl estudio objetivó analizar la práctica de los adolescentes de las Escuelas Agrícolas de la Universidad Federal de Piauí en relación al uso de los métodos anticonceptivos . Es un estudio transversal con 652 adolescentes de 14 a 19 años. Los resultados mostraron que, en las mujeres, la edad promedio en que se presentó la primera relación sexual a los 15 años (37,5%, con un compañero estable (71,9%. En el sexo masculino, 76,7% comenzaron su actividad sexual a los 14-15 años, con una compañera casual (73,5%. El método anticonceptivo más conocido por los adolescentes de ambos los sexos fue el condón. Observamos la asociación entre el conocimiento y el uso de la píldora (pThis study aimed to analyze the practice of adolescents from the Agrarian Schools of the Federal University of Piauí, when it comes to the contraceptive methods. It is a transversal study performed with 652 adolescents aged from 14 to 19 years old. The results showed that the first intercourse happened mostly around 15 years old, in the female gender, (37.5%, with a steady partner (71.9%. When it comes to the male gender, 76.7% have already begun their sexual activity around 14-15 years old, with an unsteady partner (73.5%. The most known contraceptive method by the adolescents from both genders was the condom. The association between the knowledge

  15. Tourism and environmental sustainability in the community of Barra Grande, Cajueiro da Praia, Piauí (PI

    Directory of Open Access Journals (Sweden)

    Anderson Fontenele Vieira

    2015-12-01

    Full Text Available The community of Barra Grande, tourist destination located in Cajueiro da Praia, Piauí (PI, was the object of investigation of this study. Tourism, in this region, increased creating structural, social and environmental change. The aim of the research was to analyze the environmental impacts of tourism in Barra Grande considering the Environmental Sustainability Indicators of BIGS (Brazilian Institute of Geography and Statistics. It was conducted a bibliographic and documentary survey about public politics for tourism and environment, besides the application of semi-structured interviews with eighteen hotels diagnosing three indicators: water supply, sewage disposal, and collection and disposal of solid waste which measure pressure parameters (impacts to the natural environment, qualified the state of that environment and the existence of response mechanisms to minimize the impacts. The scientific relevance consists in the analysis of sustainability through indicators based on Model PER (Pressure-State-Response, adopted by OECD (Organization for Economic Cooperation and Development, in order to conduct strategic actions to solve environmental problems. Regarding the preliminary results, it realizes that the policies have part of their normalizations not carried out in practice. Concerning the field collection in the hotels it was identified that they agree with two of evaluated qualitative parameters, proving that the destination needs to improve as sustainability. Finally, it is expected that data may contribute to tourism planning, as well as building elements to support discussions, new research approaches on the viability and adherence of sustainable tourism segments in Piauí context or in other regions of Brazil.

  16. Substituição parcial e total da proteína do farelo de soja pela proteína dos farelos de canola e algodão em dietas para alevinos de piavuçu, Leporinus macrocephalus (Garavello & Britski, 1988 Partial and total replacement of soybean meal protein by canola or cottonseed meal protein in diets of Leporinus macrocephalus (Garavello & Britski, 1988 fingerlings

    Directory of Open Access Journals (Sweden)

    Anna Christina Esper Amaro de Faria

    2001-05-01

    Full Text Available Com o objetivo de avaliar a substituição da proteína do farelo de soja (FS pela proteína do farelo de canola (FC e farelo de algodão (FA, em dietas para alevinos de piavuçu, Leporinus macrocephalus (Characiformes, Anostomidae, realizou-se um experimento com duração de 60 dias, utilizando-se 300 alevinos, com peso inicial médio de 0,10 g distribuídos em um delineamento em blocos casualizados, com seis tratamentos e cinco repetições. As dietas isoprotéicas foram formuladas de forma a terem o FS, FC, FA, FS+FC, FS+FA e FC+FA como fonte protéica. Os alevinos, alimentados com dietas contendo FS e FS+FA, apresentaram valores de peso final e taxa de eficiência protéica superiores (p 0,05 pelo uso das diferentes dietas. Observou-se redução linear dos valores de peso final, da taxa de eficiência protéica e aumento linear (p The effects of soybean meal (SB protein replacement by canola meal (CN or cottonseed meal (CT protein in diets of Leporinus macrocephalus (Characiformes, Anostomidae fingerlings are provided. Assay was carried out during 60 days. Three hundred fingerlings with mean initial weight of 1.00g were distributed in a block randomized design with six treatments and five replicates. Isoprotein diets contained SB, CN, CT, SB+CN, SB+CT and CN+CT as protein source. Fingerlings fed on diets with SB, SB+CN, SB+CT showed better final mean weight and protein efficiency rate values (p 0.05 by different diets linear reduction (p macrocephalus fingerlings, replacing 50.00% of SB protein.

  17. Ethnobotanical study on medicinal plants in the community of Curral Velho, Luís Correia, Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Jesus Rodrigues Lemos

    2015-03-01

    Full Text Available The use of plants as medication in the state of Piauí, Brazil, has been a common practice passed from generation to generation. This study aimed to analyze the use of medicinal plants by residents of the community Curral Velho, in the municipality of Luís Correia, northern Piauí, Brazil, contributing to register and preserve the traditional botanical knowledge of the community under study and, as a consequence, the state’s. The survey of plant species used as a therapeutic resource was conducted through interviews with a semi-structured questionnaire applied to 38 informants. The plants were collected for scientific identification. Use value (UV, informant consensus factor (ICF, and relative importance (RI of species were determined. We registered 62 species, belonging to 38 families and 57 genera, and the Fabaceae family stood out. Aristolochia triangularis, Petiveria alliaceae, and Stachytarpheta cayennensis had the highest use values (UV = 3.0, and Turnera subulata was the most versatile. Out of the 10 bodily systems identified, those with higher concentration of medicinal species are related to the most ordinary illnesses as general signs (inflammation, fever, respiratory tract diseases, and genitourinary tract diseases. This survey enabled the identification of some relevant aspects concerning the use and knowledge of medicinal plants in the community under study. The diversity of medicinal plants known and the availability of plants in the very community suggest a correlation between use/knowledge of medicinal plants and their availability.

  18. Ethnobotanical study on medicinal plants in the community of Curral Velho, Luís Correia, Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Jairla Lima Araujo

    2015-05-01

    Full Text Available The use of plants as medication in the state of Piauí, Brazil, has been a common practice passed from generation to generation. This study aimed to analyze the use of medicinal plants by residents of the community Curral Velho, in the municipality of Luís Correia, northern Piauí, Brazil, contributing to register and preserve the traditional botanical knowledge of the community under study and, as a consequence, the state’s. The survey of plant species used as a therapeutic resource was conducted through interviews with a semi-structured questionnaire applied to 38 informants. The plants were collected for scientific identification. Use value (UV, informant consensus factor (ICF, and relative importance (RI of species were determined. We registered 62 species, belonging to 38 families and 57 genera, and the Fabaceae family stood out. Aristolochia triangularis, Petiveria alliaceae, and Stachytarpheta cayennensis had the highest use values (UV = 3.0, and Turnera subulata was the most versatile. Out of the 10 bodily systems identified, those with higher concentration of medicinal species are related to the most ordinary illnesses as general signs (inflammation, fever, respiratory tract diseases, and genitourinary tract diseases. This survey enabled the identification of some relevant aspects concerning the use and knowledge of medicinal plants in the community under study. The diversity of medicinal plants known and the availability of plants in the very community suggest a correlation between use/knowledge of medicinal plants and their availability.

  19. Escola Maria Antoinette Blanchot e a institucionalização do ensino auxiliar de enfermagem no Piauí Escuela Maria Antoinette Blanchot y la institucionalización de la enseñanza de enfermería práctica en Piauí Maria Antoinette Blanchot School and the institucionalization of practical nursing education in Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Benevina Maria Vilar

    2008-10-01

    Full Text Available O estudo tem como objeto a primeira escola de enfermagem do Piauí e a institucionalização do ensino auxiliar de enfermagem. Objetivou descrever e analisar seu processo de institucionalização como marco no ensino auxiliar de enfermagem no Estado. Estudo histórico que se utilizou da história oral temática. As fontes primárias de dados foram sete entrevistas realizadas com personagens que trabalharam na escola. Utilizaram-se ainda fontes documentais, como também fontes secundárias. Os resultados retrataram a trajetória da Escola, enfatizando sua criação e dinâmica interna, ressaltando a sua importância como primeiro espaço de formação profissional de enfermagem. O estudo apresentou ainda a importância das irmãs de caridade de São Vicente de Paulo e das primeiras enfermeiras na construção e desenvolvimento da Escola.El estudio tiene por objeto la primera escuela de enfermería de Piauí y la institucionalización de la educación auxiliares de enfermería. El objetivo describir y analizar sus procesos de institucionalización como un hito en la educación de auxiliar de enfermería en el Estado. Estudio de la historia que se ha utilizado la historia oral tema. Las principales fuentes de datos de siete entrevistas con personajes que trabajó en la escuela. Se utilizó incluso fuentes documentales, así como fuentes secundarias. Los resultados describen la trayectoria de la Escuela, haciendo hincapié en su creación y la dinámica interna, destacando su importancia como el primer ámbito de la formación de enfermería. El estudio también puso de manifiesto la importancia de las Hermanas de la Caridad de San Vicente de Paulo y la primera enfermeras en la construcción y el desarrollo de la Escuela.The object of this study is the first nursing school in Piauí and the institutionalization of practical nurse education. The objective was to analyze and describe the process of institutionalization as a mark in practical nursing

  20. The study of desiccation-tolerance in drying leaves of the desiccation-tolerant grass Sporobolus elongatus and the desiccation-sensitive grass Sporobolus pyramidalis.

    Science.gov (United States)

    Ghasempour, Hamid Reza; Kianian, Jahanbakheshe

    2007-03-01

    Hydrated leaves of the resurrection grass Sporobolus elongatus are not desiccation tolerant (DT), but moderate to severe drought stress can induce their DT with the leaves remain attach to drying intact plants. In vivo protein synthesis was studied with SDS-page of extracts of leaves of intact drying plants of S. elongatus (a desiccation-Tolerant grass (DT)) and S. pyramidalis (a desiccation-sensitive species (DS)). Free proline increased in drying leaves. Soluble sugar contents also increased with drying but were less than fully hydrated leaves at 8% RWC. Total protein also showed an increase with an exception at 8% RWC which showed a decrease. SDS-page of extracts of drying leaves of both DT and DS plants were studied as relative water contents (RWC) decreased. In first phase, DT species at 58% RWC (80-51% RWC range), two proteins increased in contents. In the second phase, at 8% (35-4% RWC range) two new bands increased and two bands decreased. In leaves of DS species some bands decreased as drying progressed. Also, as drying advanced free proline increased in DT species. Total protein increased as drying increased but at 8% RWC decreased. All data of results are consistent with current views about studied factors and their roles during drying and induction of desiccation tolerance in DT plants.

  1. Sub-registro de nascimentos vivos em localidade do Estado de Piauí, Brasil Underregistration of live births in city of the State of Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Maria Helena de Rezende Brito Portela

    1989-12-01

    Full Text Available Decorrente de falta de dados que informem de modo fidedigno aos planejadores da área de Saúde, objetivou-se estimar a taxa mínima de sub-registro de nascimentos vivos na cidade de Piripiri, Piauí, no período de 1 de julho de 1983 a 30 de junho de 1984. O método utilizado para medir o sub-registro foi a comparação dos dados oficiais (Cartório de Registro Civil com os não oficiais (Fundação Serviço Especial de Saúde Pública - FSESP e Igreja Católica, cujo resultado mostrou uma taxa mínima de sub-registro muito alta (68,4% quando comparada com taxas de outras localidades brasileiras. Estudou-se a associação entre registro civil e variáveis interveníentes como local do parto, sexo da criança, estado civil e zona de residência da mãe. Concluiu-se ser o sub-registro um problema de Saúde Pública cujos fatores fundamentais como a educação, a conscientização da população e a gratuidade do registro, dentre outros, poderão contribuir para sua diminuição, com a conseqüente melhoria do planejamento das ações na área da Saúde Pública, de benéfica repercussão na vida da população.The minimum rate of underregistration of live births in the city of Piripiri, Piauí, between Jury 1,1983 and June 30,1984, is calculated. The lack of trustworthy data on underregistration of births is of the utmost importance in the area of Public Health, principally to those responsible for planning the Health Services. The method used to measure underregistration was the comparison of official data (Civil Registry Office with unofficial data (Foundation SESP and the Catholic Church, the results of which show a very high minimum rate of underregistration - 68.4% - as compared with the rates of other places in Brazil. The association between the civil register and such variables as place of births, sex of child, civil status and residential zone of mother was also studies. It is concluded that underregistration is a public health problem

  2. Investigation of an outbreak of endemic coccidioidomycosis in Brazil's northeastern state of Piauí with a review of the occurrence and distribution of Coccidioides immitis in three other Brazilian states.

    Science.gov (United States)

    Wanke, B; Lazera, M; Monteiro, P C; Lima, F C; Leal, M J; Ferreira Filho, P L; Kaufman, L; Pinner, R W; Ajello, L

    1999-11-01

    An outbreak of coccidioidomycosis is described that involved three individuals and eight of their dogs, who had engaged in a successful hunt for nine-banded armadillos (Dasypus novemcinctus) in the environs of Oeiras, a community in Brazil's north eastern state of Piauí. Diagnosis was based on clinical, serological and cultural findings. Four of 24 soil samples collected in and around the burrow of an armadillo yielded cultures of Coccidioides immitis, thus establishing the endemicity of that mould in the state of Piauí. A literature review revealed that C. immitis, aside from that state, is endemic in three other Brazilian states--Bahia, Ceará and Maranhão. These four contiguous states have semi-arid regions where climatic conditions and their flora are similar to those that exist in C. immitis's endemic regions in North, Central and South America.

  3. Avaliação da cobertura de vacinação em Teresina - Piauí (Brasil - 1983

    Directory of Open Access Journals (Sweden)

    C.L. Szwarcwald

    1985-03-01

    Full Text Available O presente estudo avaliou a cobertura de vacinação antipólio, DPT, BCG e anti-sarampo em crianças de um ano de idade, na área urbana do municipio de Teresina (Piauí, em 1983. Dois métodos de amostragem, o de Henderson e Sundaresan¹ e uma modificação deste foram utilizados posteriormente comparados quanto aos resultados. A análise de alguns indicadores sociais, como escolaridade dos pais e número de moradores e de crianças do domicílio, nos permitiu estabelecer diferenças entre os grupos de crianças que completaram e as que não completaram o quadro de imunizações. Uma parte do trabalho dirigiu-se para a identificação dos principais motivos apontados pelas mães por não terem completado a vacinação de suas crianças.The objective of the present study was to estimate the immunization coverage of polio, triplice, BCG and measles in children one year of age in the urban area of the municipality of Teresina (Piauí, in 1983. Two sampling methods were used. Henderson and Sundaresan¹ and an adaptation of the first and the results were later compared. An analysis was carried out to discriminate those children who had completed their vaccinations from those who had failed to do so, based on social indicators such as education of the parents and number of residents and children in each household. Part of the study focused on the principal motives given by the mother for not having vaccinated their children.

  4. Distribución geográfica, prevalencia e intensidad de las infecciones de Gregarina ronderosi (Eugregarinorida: Gregarinidae en Dichroplus elongatus (Orthoptera: Acrididae

    Directory of Open Access Journals (Sweden)

    Christian Bardi

    2016-01-01

    Full Text Available regarina ronderosi es un parásito obligado del tracto digestivo del acrídido plaga Dichroplus elongatus y una de las únicas dos eugregarinas de acrídidos argentinos descriptas con su ciclo de vida completo. Dada la falta de conocimiento acerca de aspectos epizootiológicos fundamentales de las infecci- ones causadas por eugregarinas en acrídidos de Argentina, el objetivo de esta contribución es iniciar el registro de la distribución geográfica de G. ronderosi en la región Pampeana, su prevalencia natural y la intensidad de las infecciones en condiciones naturales. Para ello, se colectaron ejemplares de D. elongatus (2008 – 2012 en distintos puntos de la región Pampeana. Se obtuvieron y analizaron un total de 4084 ejemplares provenientes de cuarenta y dos localidades. La prevalen- cia promedio de G. ronderosi para el total de localidades con presencia (diecisiete localidades fue de 29,7 ± EE 6,6% (n = 1071. El total de individuos infectados (n = 396 fue categorizado respecto de la intensidad de las infecciones: tres (0,8% presentaron infecciones muy fuertes, ochenta (20% fuerte, doscientos diez (53% moderadas y ciento tres (26% infecciones leves. Se ha ampliado la distribución ge- ográfica conocida, se han registrado prevalencias elevadas que sugieren la ocur - rencia de epizootias y se han registrado por primera vez en condiciones naturales infecciones de G. ronderosi categorizadas como Fuertes y Muy Fuertes.

  5. Photoautotrophic production of polyhydroxyalkanoates in a synthetic mixed culture of Synechococcus elongatus cscB and Pseudomonas putida cscAB.

    Science.gov (United States)

    Löwe, Hannes; Hobmeier, Karina; Moos, Manuel; Kremling, Andreas; Pflüger-Grau, Katharina

    2017-01-01

    One of the major challenges for the present and future generations is to find suitable substitutes for the fossil resources we rely on today. Cyanobacterial carbohydrates have been discussed as an emerging renewable feedstock in industrial biotechnology for the production of fuels and chemicals, showing promising production rates when compared to crop-based feedstock. However, intrinsic capacities of cyanobacteria to produce biotechnological compounds are limited and yields are low. Here, we present an approach to circumvent these problems by employing a synthetic bacterial co-culture for the carbon-neutral production of polyhydroxyalkanoates (PHAs) from CO 2 . The co-culture consists of two bio - modules : Bio - module I , in which the cyanobacterial strain Synechococcus elongatus cscB fixes CO 2 , converts it to sucrose, and exports it into the culture supernatant; and bio - module II , where this sugar serves as C-source for Pseudomonas putida cscAB and is converted to PHAs that are accumulated in the cytoplasm. By applying a nitrogen-limited process, we achieved a maximal PHA production rate of 23.8 mg/(L day) and a maximal titer of 156 mg/L. We will discuss the present shortcomings of the process and show the potential for future improvement. These results demonstrate the feasibility of mixed cultures of S. elongatus cscB and P. putida cscAB for PHA production, making room for the cornucopia of possible products that are described for P. putida . The construction of more efficient sucrose-utilizing P. putida phenotypes and the optimization of process conditions will increase yields and productivities and eventually close the gap in the contemporary process. In the long term, the co-culture may serve as a platform process, in which P. putida is used as a chassis for the implementation of synthetic metabolic pathways for biotechnological production of value-added products.

  6. Climatologia da pluviometria do município de Teresina, Piauí, Brasil

    Directory of Open Access Journals (Sweden)

    Hudson Ellen Alencar Menezes

    2016-11-01

    Full Text Available As variações nas precipitações refletem claramente a dinâmica atmosférica da região, marcada pela intensa variabilidade, onde se observa a atuação da Zona de Convergência Intertropical (ZCIT com sua atuação entre os meses de janeiro a março, sendo esse período mais chuvoso. As variabilidades espaço temporal no comportamento das chuvas tem sido analisadas e diagnosticadas por vários autores no Nordeste do Brasil (NEB, portanto objetivou-se diagnosticar a variabilidade dos índices pluviométricos em Teresina no Estado do Piauí no período de 1913 a 2010. A análise do comportamento da precipitação nas cidades de grande e médio porte é de extrema importância para o gerenciamento dos recursos hídricos, uma vez que se trata de áreas densamente urbanizadas. Muitas vezes, sem uma estruturação urbana adequada, estas cidades se encaixam perfeitamente nesse contexto. Foram utilizados dados mensais observados e anuais de precipitação pluviométrica no período de 1913 a 2010, com 97 anos de observações. Os resultados mostraram a recorrência de valores máximos de precipitação anual dentro de um intervalo de 18, 11 e 8 anos. Na análise dos desvios-padrões, os resultados mostraram predominância dos desvios negativos em relação aos desvios positivos.Climatology of rainfall in the Teresina city, Piauí state, BrazilVariations in precipitation clearly reflect the atmospheric dynamics of the region, marked by intense variability, where we observe the performance of the Intertropical Convergence Zone (ITCZ with his performance in the months of January-March, this being more rain tem period. The timeline of rainfall variability in behavior has been analyzed and diagnosed by several authors in Northeast Brazil (NEB, so let's study this variability between the periods 1913 to 2010 of Teresina city.  The behavior of rainfall in cities large and medium sized is of utmost importance to the managerial of water resources, since it

  7. HIV-1 transmitted drug resistance and genetic diversity among patients from Piauí State, Northeast Brazil.

    Science.gov (United States)

    Moura, Maria Edileuza Soares; da Guarda Reis, Mônica Nogueira; Lima, Yanna Andressa Ramos; Eulálio, Kelsen Dantas; Cardoso, Ludimila Paula Vaz; Stefani, Mariane Martins Araújo

    2015-05-01

    HIV-1 transmitted-drug-resistance and genetic diversity are dynamic and may differ in distinct locations/risk groups. In Brazil, increased AIDS incidence and related mortality have been detected in the Northeast region, differently from the epicenter in the Southeast. This cross-sectional study describes transmitted-dru- resistance and HIV-1 subtypes in protease/PR and reverse transcriptase/RT regions among antiretroviral naïve patients from Piauí State, Northeast Brazil. Among 96 patients recruited 89 (92.7%) had HIV-1 PR/RT regions sequenced: 44 females and 45 males, 22 self-declared as men who have sex with men. Transmitted-drug-resistance was investigated by CPR tool (Stanford HIV-1 Drug Resistance/SDRM). HIV-1 subtypes were assigned by REGA and phylogenetic inference. Overall, transmitted-drug-resistance rate was 11.2% (10/89; CI 95%: 5.8-19.1%); 22.7% among men who have sex with men (5/22; CI 95%: 8.8-43.4%), 10% in heterosexual men (2/20; CI 95%: 1.7-29.3%) and 6.8% in women (3/44; CI 95%: 1.8-17.4%). Singleton mutations to protease-inhibitor/PI, nucleoside-reverse-transcriptase-inhibitor/NRTI or non-nucleoside-reverse-transcriptase-inhibitor/NNRTI predominated (8/10): PI mutations (M46L, V82F, L90M); NRTI mutations (M41L, D67N) and NNRTI mutations (K103N/S). Dual class resistance mutations to NRTI and NNRTI were observed: T215L (NRTI), Y188L (NNRTI) and T215N (NRTI), F227L (NNRTI). Subtype B prevailed (86.6%; 77/89), followed by subtype F1 (1.1%, 1/89) and subtype C (1.1%, 1/89). B/F1 and B/C intersubtype recombinants represented 11.2% (10/89). In Piauí State extensive testing of incidence and transmitted-drug-resistance in all populations with risk behaviors may help control AIDS epidemic locally. © 2015 Wiley Periodicals, Inc.

  8. Caracterização físico-química de méis produzidos no Estado do Piauí para diferentes floradas Physical and chemical characterization of honeys produced in the State of Piauí - Brazil

    Directory of Open Access Journals (Sweden)

    Claudécia L. da Silva

    2004-12-01

    Full Text Available Este trabalho foi realizado com o objetivo de se caracterizar físico-químicamente méis de Apis mellifera L. produzidos no Estado do Piauí, a partir de floradas típicas da região semi-árida do Nordeste brasileiro e, ao mesmo tempo, avaliar a qualidade desses produtos. Analisaram-se os méis produzidos a partir das floradas de marmeleiro (Croton sonderianus Müll. Arg., jitirana (Hyptis suaveolens, camaratuba (Cratylia mollis Mart. ex Benth, silvestre (Serjania glabrata e angico de bezerro (Piptadenia moniliformis, seguindo-se as metodologias recomendadas pelo Ministério da Agricultura e do Abastecimento, através de Instrução Normativa de outubro/2000. Foram realizadas as seguintes análises: umidade, hidroximetilfurfural (HMF, açúcares redutores, sacarose aparente, cinzas, acidez livre, sólidos insolúveis em água, atividade diastásica, ºBrix e pH. Os valores individuais de cada variável analisada, comparados com os padrões estabelecidos pelo Ministério da Agricultura e do Abastecimento, apresentaram resultados satisfatórios encontrando-se todos os méis analisados, dentro dos padrões exigidos na citada Instrução Normativa.The objective of this work was to evaluate the physical-chemical composition of honeys produced in the Piauí State, located in semi-arid region of Northeast Brazil. The honeys produced from 'marmeleiro' (Croton sonderianus Müll. Arg., 'jitirana' (Hyptis suaveolens, 'camaratuba' (Cratylia mollis Mart. ex Benth, 'silvestre' (Serjania glabrata and 'angico de bezerro' (Piptadenia moniliformis, were analysed following the methods recommended by the Brazilian Ministry of Agriculture and Normative Instruction of October 2000. the following analyses were performed: moisture, hydroxymethylfurfural (HMF, reducing sugars, apparent sucrose, ash, free acidity, insoluble solids in water, diastatic activity, ºBrix and pH. The individual values of each analyzed parameter were compared with the standards established

  9. Effect of different cryo-protectants on the viability of frozen/thawed semen from boars of the Piau breed.

    Science.gov (United States)

    Pinho, R O; Lima, D M A; Shiomi, H H; Siqueira, J B; Silva, H T; Lopes, P S; Guimarães, S E F; Guimarães, J D

    2014-05-01

    The objective of this study was to evaluate the effect of different cryo-protectants (glycerol, dimethylacetamide and dimethylformamide alone or combined and added to lactose-egg yolk extender) on the viability of frozen/thawed semen from the Piau breed as assessed by in vitro testing. Frozen semen samples (n=20) were used from five male swine. Five different freezing extenders, including 2% glycerol (Group 1 - G), 2% glycerol and 3% dimethylacetamide (Group 2 - GA), 2% glycerol and 3% dimethylformamide (Group 3 - GF), 5% dimethylacetamide (Group 4 - A) and 5% dimethylformamide (group 5 - F), were evaluated. To assess post-thawing sperm quality, sperm motility and morphology were evaluated. Sperm viability was determined using the hypoosmotic swelling test, supravital staining, and a fluorescent assay (carboxyfluorescein diacetate and propidium iodide). The mean total sperm motility of semen immediately after thawing was 46.2±1.3, 57.7±1.5, 53.2±2.1, 51.7±1.2, and 46.5±1.6% for groups 1-5, respectively. Groups 2 (GA) and 3 (GF) had greater motility values (P0.05). The other complementary tests (hypoosmotic swelling test and supra-vital staining) demonstrated that sperm in Groups 2 (GA), 3 (GF) and 4 (A) had the greatest viability and there were no significant differences among these three groups (P>0.05). The most effective cryo-protectant combinations likely minimized and controlled the deleterious processes that occur in the sperm cell during freezing/thawing, thus improving post-thawing sperm viability. In conclusion, the combination of amides (3%) and glycerol (2%) or dimethylacetamide (5%) alone were more efficient at cryo-protection than glycerol alone for semen freezing in the Piau swine breed. Copyright © 2014 Elsevier B.V. All rights reserved.

  10. Taxocenoses de serpentes em grupos fitofisionômicos de cerrado no Parque Nacional de Sete Cidades, Piracuruca, Piauí, Brasil

    OpenAIRE

    ROCHA, Wáldima Alves da

    2007-01-01

    Este trabalho teve como objetivo principal inventariar a fauna de serpentes do Parque Nacional de Sete Cidades, Piraracuruca, Piauí, Brasil, enfocando os seguintes aspectos: composição, riqueza e abundância de espécies nos seus diversos habitats, padrões de atividade diária, dieta, reprodução e comparação de composição com outras áreas estudadas por outros autores. Foram realizadas seis expedições ao Parque, entre setembro de 2005 e agosto de 2006, que totalizaram 120 dias de trabalho de c...

  11. Analysis of rainfall in the municipality of Castelo do Piauí, Northeast Brazil

    Directory of Open Access Journals (Sweden)

    Francílio de Amorim dos Santos

    2017-10-01

    Full Text Available The objective of this research was to analyze rainfall in the municipality of Cas- telo do Piauí, located in the Northeast of Brazil, based on descriptive statistics and the Rainfall Anomaly Index (RAI. From an historical series of 39 years (1963 to 2001, a historical average of 1006.3 mm was identi ed for this municipality, whereas the years 1985 and 1983 were considered the most and least rainy, re- spectively. The rainy season is concentrated in the months of January to April, with March being the wettest and August being the least rainy. Rainfall variability values were higher than 40% for all months and asymmetric positive distribution. The RAI allowed to establish the following dry and rainy years: 1963, 1964 and 1989 (very rainy; 1974 and 1985 (extremely rainy; 1976, 1981, 1992, 1993, 1998 and 2001 (very dry; 1983 and 1990 (extremely dry. In summary, the present study found a predominance of dry to extremely dry years in the studied area, with 53.8%.

  12. ppGpp Controls Global Gene Expression in Light and in Darkness in S. elongatus

    Directory of Open Access Journals (Sweden)

    Anna M. Puszynska

    2017-12-01

    Full Text Available The bacterial and plant stringent response involves production of the signaling molecules guanosine tetraphosphate and guanosine pentaphosphate ((pppGpp, leading to global reorganization of gene expression. The function of the stringent response has been well characterized in stress conditions, but its regulatory role during unstressed growth is less studied. Here, we demonstrate that (pppGpp-deficient strains of S. elongatus have globally deregulated biosynthetic capacity, with increased transcription rate, translation rate, and cell size in unstressed conditions in light and impaired viability in darkness. Synthetic restoration of basal guanosine tetraphosphate (ppGpp levels is sufficient to recover transcriptional balance and appropriate cell size in light and to rescue viability in light/dark conditions, but it is insufficient to enable efficient dark-induced transcriptional shutdown. Our work underscores the importance of basal ppGpp signaling for regulation of cyanobacterial physiology in the absence of stress and for viability in energy-limiting conditions, highlighting that basal (pppGpp level is essential in cyanobacteria in the environmental light/dark cycle.

  13. Ocorrência de anticorpos contra Leptospira spp em cães de Teresina, Piauí, Brasil

    Directory of Open Access Journals (Sweden)

    Elís Rosélia Dutra de Freitas Siqueira Silva

    2017-05-01

    Full Text Available Leptospirosis is a systemic disease caused by the species of bacteria Leptospira spp., which affects human beings, domestic and wild animals. The present study searched the presence of antibodies against Leptospira spp. in the canine population of the city Teresina, Piauí, and the most common serovars. Blood samples from 425 stray dogs were collected in the local zoonosis center in Teresina from July 2010 to January 2012 and submitted to the Microscopic Seroagglutination Test (MAT. This study found an average infection rate of 17.41% (IC 95%; 13,8 – 21,0 by 11 different serovars; the four most frequent were Canicola (18.9%, Autumnalis (16.2%, Icterohaemorrhagiae (12.1%, and Butembo (12.1%. The questions raised in this study indicated the occurrence of Leptospira spp infection in dogs of Terezina- Piaui, Brazil.

  14. Estresse no cotidiano acadêmico: o olhar dos alunos de Enfermagem da Universidade Federal do Piauí Estrés en el cotidiano académico: la visión de los estudiantes de enfermería de la Universidad Federal del Piauí - Brasil Stress in the academic daily: a nursing student view from the Federal University of Piauí - Brazil

    Directory of Open Access Journals (Sweden)

    Claudete Ferreira de Souza Monteiro

    2007-03-01

    Full Text Available Este estudo objetivou conhecer situações geradoras de estresse vivenciadas pelos alunos do Curso de Graduação em Enfermagem da Universidade Federal do Piauí UFPI no âmbito acadêmico. A metodologia constou de estudo exploratório, qualitativo, com produção de dados por meio de entrevista semi-estruturada aplicada a 22 alunos.Os resultados possibilitaram a construção das categorias de análise: situações estressoras, sintomas do estresse e desempenho das atividades acadêmicas. Constatou-se que as situações de estresse estão presentes durante o transcorrer do curso, com relevâncias em determinados momentos, como o ingresso na universidade, o cursar da disciplina Farmacologia para Enfermagem e o cumprimento de carga horária semanal irregular em períodos específicos do curso. Constatou-se que os sintomas apresentados pelos alunos foram de aspectos fisiológico e emocional. Por fim, revelou-se que as situações de estresse repercutem de forma negativa no desempenho das atividades acadêmicas desenvolvidas pelos alunos.Este estudio tubo el objetivo de conocer situaciones generadoras de estrés vivenciadas por alumnos del Curso de Graduación en Enfermaría de la Universidad Federal del Piauí (UFPI en el ámbito académico. La metodología constató de un estudio exploratorio, cualitativo, con colecta de dados basada en entrevistas semi-estructurada a 22 alumnos. Los resultados posibilitaron la construcción de categorías de análisis: situaciones de estrés, síntomas de estrés y el desempeño de las actividades académicas. Fue constatado que las situaciones de estrés están presentes durante el transcurso del curso, con relevancia en determinados momentos, tales como el ingreso en la universidad, como el curso de Farmacología para Enfermería y carga horaria semanal irregular en períodos específicos del curso. Los síntomas presentados por alumnos fueran de aspecto fisiológico y emocional. Por fin, se concluye que las

  15. The Transcriptomes of Xiphinema index and Longidorus elongatus Suggest Independent Acquisition of Some Plant Parasitism Genes by Horizontal Gene Transfer in Early-Branching Nematodes

    Science.gov (United States)

    Danchin, Etienne G.J.; Perfus-Barbeoch, Laetitia; Rancurel, Corinne; Thorpe, Peter; Da Rocha, Martine; Bajew, Simon; Neilson, Roy; Sokolova (Guzeeva), Elena; Da Silva, Corinne; Guy, Julie; Labadie, Karine; Esmenjaud, Daniel; Helder, Johannes; Jones, John T.

    2017-01-01

    Nematodes have evolved the ability to parasitize plants on at least four independent occasions, with plant parasites present in Clades 1, 2, 10 and 12 of the phylum. In the case of Clades 10 and 12, horizontal gene transfer of plant cell wall degrading enzymes from bacteria and fungi has been implicated in the evolution of plant parasitism. We have used ribonucleic acid sequencing (RNAseq) to generate reference transcriptomes for two economically important nematode species, Xiphinema index and Longidorus elongatus, representative of two genera within the early-branching Clade 2 of the phylum Nematoda. We used a transcriptome-wide analysis to identify putative horizontal gene transfer events. This represents the first in-depth transcriptome analysis from any plant-parasitic nematode of this clade. For each species, we assembled ~30 million Illumina reads into a reference transcriptome. We identified 62 and 104 transcripts, from X. index and L. elongatus, respectively, that were putatively acquired via horizontal gene transfer. By cross-referencing horizontal gene transfer prediction with a phylum-wide analysis of Pfam domains, we identified Clade 2-specific events. Of these, a GH12 cellulase from X. index was analysed phylogenetically and biochemically, revealing a likely bacterial origin and canonical enzymatic function. Horizontal gene transfer was previously shown to be a phenomenon that has contributed to the evolution of plant parasitism among nematodes. Our findings underline the importance and the extensiveness of this phenomenon in the evolution of plant-parasitic life styles in this speciose and widespread animal phylum. PMID:29065523

  16. The Transcriptomes of Xiphinema index and Longidorus elongatus Suggest Independent Acquisition of Some Plant Parasitism Genes by Horizontal Gene Transfer in Early-Branching Nematodes.

    Science.gov (United States)

    Danchin, Etienne G J; Perfus-Barbeoch, Laetitia; Rancurel, Corinne; Thorpe, Peter; Da Rocha, Martine; Bajew, Simon; Neilson, Roy; Guzeeva, Elena Sokolova; Da Silva, Corinne; Guy, Julie; Labadie, Karine; Esmenjaud, Daniel; Helder, Johannes; Jones, John T; den Akker, Sebastian Eves-van

    2017-10-23

    Nematodes have evolved the ability to parasitize plants on at least four independent occasions, with plant parasites present in Clades 1, 2, 10 and 12 of the phylum. In the case of Clades 10 and 12, horizontal gene transfer of plant cell wall degrading enzymes from bacteria and fungi has been implicated in the evolution of plant parasitism. We have used ribonucleic acid sequencing (RNAseq) to generate reference transcriptomes for two economically important nematode species, Xiphinema index and Longidorus elongatus , representative of two genera within the early-branching Clade 2 of the phylum Nematoda. We used a transcriptome-wide analysis to identify putative horizontal gene transfer events. This represents the first in-depth transcriptome analysis from any plant-parasitic nematode of this clade. For each species, we assembled ~30 million Illumina reads into a reference transcriptome. We identified 62 and 104 transcripts, from X. index and L. elongatus , respectively, that were putatively acquired via horizontal gene transfer. By cross-referencing horizontal gene transfer prediction with a phylum-wide analysis of Pfam domains, we identified Clade 2-specific events. Of these, a GH12 cellulase from X. index was analysed phylogenetically and biochemically, revealing a likely bacterial origin and canonical enzymatic function. Horizontal gene transfer was previously shown to be a phenomenon that has contributed to the evolution of plant parasitism among nematodes. Our findings underline the importance and the extensiveness of this phenomenon in the evolution of plant-parasitic life styles in this speciose and widespread animal phylum.

  17. The Transcriptomes of Xiphinema index and Longidorus elongatus Suggest Independent Acquisition of Some Plant Parasitism Genes by Horizontal Gene Transfer in Early-Branching Nematodes

    Directory of Open Access Journals (Sweden)

    Etienne G.J. Danchin

    2017-10-01

    Full Text Available Nematodes have evolved the ability to parasitize plants on at least four independent occasions, with plant parasites present in Clades 1, 2, 10 and 12 of the phylum. In the case of Clades 10 and 12, horizontal gene transfer of plant cell wall degrading enzymes from bacteria and fungi has been implicated in the evolution of plant parasitism. We have used ribonucleic acid sequencing (RNAseq to generate reference transcriptomes for two economically important nematode species, Xiphinema index and Longidorus elongatus, representative of two genera within the early-branching Clade 2 of the phylum Nematoda. We used a transcriptome-wide analysis to identify putative horizontal gene transfer events. This represents the first in-depth transcriptome analysis from any plant-parasitic nematode of this clade. For each species, we assembled ~30 million Illumina reads into a reference transcriptome. We identified 62 and 104 transcripts, from X. index and L. elongatus, respectively, that were putatively acquired via horizontal gene transfer. By cross-referencing horizontal gene transfer prediction with a phylum-wide analysis of Pfam domains, we identified Clade 2-specific events. Of these, a GH12 cellulase from X. index was analysed phylogenetically and biochemically, revealing a likely bacterial origin and canonical enzymatic function. Horizontal gene transfer was previously shown to be a phenomenon that has contributed to the evolution of plant parasitism among nematodes. Our findings underline the importance and the extensiveness of this phenomenon in the evolution of plant-parasitic life styles in this speciose and widespread animal phylum.

  18. Glyphosate-based herbicide affects biochemical parameters in Rhamdia quelen (Quoy & Gaimard, 1824 and Leporinus obtusidens (Valenciennes, 1837

    Directory of Open Access Journals (Sweden)

    Vania Lucia Loro

    Full Text Available Rhamdia quelen (silver catfish and Leporinus obtusidens (piava were exposed to a commercial formulation Roundup(r, a glyphosate-based herbicide at concentrations of 0.2 or 0.4 mg/L for 96 h. The effects of the herbicide were analyzed on the alanine aminotransferase (ALT and aspartate aminotransferase (AST activities and glucose in plasma, glucose and protein in the mucus layer, nucleotide hydrolysis in the brain, and protein carbonyl in the liver. The parameters were chosen, owing to a lack of information concerning integrated analysis, considering oxidative damage parameters, liver damage, and effects on the mucus layer composition and triphosphate diphosphohydrolase (NTPDase activities. Plasmatic glucose levels were reduced in both species, whereas the transaminase activities (ALT and AST increased after exposure to the herbicide. Herbicide exposure increased protein and glucose levels in the mucus layer in both species. There was a reduction in both NTPDase and ecto-5'-nucleotidase activity in the brain of piava, and increased enzyme activity in silver catfish at both concentrations tested. The species showed an increase in protein carbonyl in the liver after exposure to both concentrations of the glyphosate. Our results demonstrated that exposure to Roundup(r caused liver damage, as evidenced by increased plasma transaminases and liver protein carbonyl in both of the fish species studied. The mucus composition changed and hypoglycemia was detected after Roundup(r exposure in both species. Brain nucleotide hydrolysis showed a different response for each fish species studied. These parameters indicated some important and potential indicators of glyphosate contamination in aquatic ecosystems.

  19. Flutuação populacional de moscas-das-frutas (Diptera: Tephritidae associadas a variedades de manga no município de José de Freitas-Piauí Population dynamics of fruit flies (Diptera: Tephritidae associated to mango varieties in the city of Jose de Freitas - Piauí - Brazil

    Directory of Open Access Journals (Sweden)

    Sávio Silveira Feitosa

    2008-03-01

    Full Text Available O Piauí possui uma área considerável de manga, sendo um grande produtor dessa fruta no Brasil. Contudo, a presença de pragas, como as moscas-das-frutas, tem provocado grandes impactos na cadeia produtiva, pois estes insetos fazem parte de um grupo responsável por grandes prejuízos econômicos na cultura da mangueira. O conhecimento da flutuação populacional e a época de maior ocorrência de uma determinada espécie de inseto de importância econômica são requisitos indispensáveis para o estabelecimento de um controle eficiente e racional. O presente trabalho visou registrar a flutuação populacional das espécies de moscas-das-frutas associadas a variedades de manga, bem como correlacionar a ocorrência das moscas com as médias mensais de temperatura, precipitação e umidade relativa, e também avaliar os atrativos alimentares utilizados na captura dos insetos. A pesquisa foi conduzida de junho de 2004 a maio de 2005, em pomar comercial de manga (Mangifera indica L.-Anacardiaceae, das variedades Tommy Atkins, Keitt, Kent e Palmer, localizado no município de José de Freitas-Piauí-Brasil, na latitude 04º50'S e longitude 42º41'W. Anastrepha obliqua e Anastrepha serpentina são as espécies de tephritídeos predominantes na cultura da manga.Piaui has a considerable mango area, being a great producer of this fruit. However, the presence of plagues like the fruit flies has provoked great impacts in the production chain, so these insects are part of a responsible group of great economic damages in mango tree culture. The knowledge of the population dynamics and the highest occurrence period of specific insect species of economic importance are indispensable requirement to establish an efficient and rational control. The purpose of the present work was to register the population dynamics of the fruit fly species associated to the mango varieties, as well as correlating the fly occurrence with the monthly averages of temperature

  20. Concentrações de hemoglobina e ferritina sérica em escolares da rede pública municipal de Teresina, Piauí, Nordeste do Brasil Hemoglobin and serum ferritin concentrations in public school children from Teresina, in the State of Piauí, in Northeast Brazil

    Directory of Open Access Journals (Sweden)

    Marize Melo dos Santos

    2008-12-01

    Full Text Available OBJETIVOS: avaliar o estado nutricional de ferro em escolares de instituições públicas de ensino de Teresina, Piauí, Brasil. MÉTODOS: corte transversal, envolvendo amostra aleatória, selecionada em duas etapas, de 747 escolares (7-11 anos, de ambos os sexos, no período de agosto / setembro de 2000. A anemia foi rastreada em 747 escolares e para o diagnóstico adotou-se a concentração de hemoglobina (Hb OBJECTIVES: to assess iron nutritional status of public school children in Teresina, Piauí, Brazil. METHODS: a cross-sectional survey was conducted among 747 school children of both sexes, aged between seven and eleven years, who were randomly selected using a two-step sampling procedure, in August/September 2000. Children with hemoglobin (Hb concentrations less than 11.5 g/dL were evaluated as anemic and low body iron (Sfer< 15µg/L was evaluated in 207 children. RESULTS: the prevalence of anemia was 14.3% (95%CI 12.2-17.4 and of low body iron 20.3% (95%CI 15.2-26.6. Anemia and body iron depletion were not correlated with gender (p=0.60; p=0.96, respectively or age group (p=0.85; p=0.53, respectively. SFer was not correlated (r=0.1; p=0.168 with Hb concentrations. The prevalence of iron deficiency anemia (Hb< 11.5g/dL and SFer< 15.0µg/L was 26.3% (95%CI 17.3-37.5. CONCLUSIONS: iron deficiency and anemia seem to be a public health problem among school children in Teresina. Concerted action to prevent and control these conditions is strongly recommended. However, all anemia cannot be explained by iron deficiency. Therefore, it may be wise to consider other etiologies, such as micronutrient status, parasite infestation, hereditary disorders and exposure to environmental pollutants.

  1. Genetic variability of broodstocks of restocking programs in Brazil

    Directory of Open Access Journals (Sweden)

    Nelson Lopera-Barrero

    2015-09-01

    Full Text Available Objective. The aim of this study was evaluate the genetic diversity of the following broodstocks: piapara (Leporinus elongatus, dourado (Salminus brasiliensis, jundiá (Rhamdia quelen and cachara (Pseudoplatystoma fasciatum already useful for restocking programs in the Paranapanema, Iguaçu and Paraná Brazilian Rivers. Materials and methods. Samples from the caudal fin of 122 fish were analyzed. DNA was extracted by NaCl protocol. PCR products were separated by a horizontal agarose gel electrophoresis. The fragments were visualized by staining with ethidium bromide. Results. The amplification of 25 primers generated different fragments in studied species that allowed characterizing 440 fragments of 100-2900 bp. High percentage of polymorphic fragments (66.67 to 86.29, Shannon index (0.365 to 0.486 and genetic diversity of Nei (0.248 to 0.331 were detected. Conclusions. The level of genetic variability in the broodstocks was adequate for allowing their use in restocking programs in the studied Rivers. However, periodical monitoring studies of genetic variability in these stocks, the mating system, reproductive system and general management must be made to guarantee the preservation of wild populations.

  2. Pigmentos de pinturas rupestres pré-históricas do sítio Letreiro do Quinto, Pedro II, Piauí, Brasil

    Directory of Open Access Journals (Sweden)

    Tetisuelma Leal Alves

    2011-01-01

    Full Text Available The Letreiro do Quinto rock shelter is located in the rural area of the city of Pedro II, Piauí, Brazil. The sandstone walls of the shelter are covered with prehistoric rupestrian paintings, painted in patterns of yellow and light and dark red hues. The chemical-mineralogical characterization of the prehistoric pigments was made with energy dispersive spectroscopy, scanning electron microscopy, energy dispersive X-ray fluorescence and 57Fe transmission Mössbauer spectroscopy at 110 K. Results confirm the occurrence of hematite- and goethite-rich ochres and also that the pigment layers are indeed made of a mixture of clay minerals mixed with iron oxides.

  3. Determinação do sistema endócrino difuso nos intestinos de três Teleostei (Pisces de água doce com hábitos alimentares diferentes

    Directory of Open Access Journals (Sweden)

    Seixas Filho José Teixeira de

    2001-01-01

    Full Text Available O objetivo do presente trabalho foi o de verificar a presença de células endócrinas nos intestinos médio e posterior, ou reto, e nos cecos pilóricos de três espécies tropicais de peixes Teleostei de água doce com hábitos alimentares diferentes: piracanjuba, (Brycon orbignyanus e piau (Leporinus friderici, onívoro; e surubim (Pseudoplatystoma coruscans, carnívoro. Para tanto, foram utilizados sete exemplares da piracanjuba, com médias de peso e comprimento-padrão de 410,16 ± 66,33 g e 27,42 ± 1,17 cm, respectivamente, 13 exemplares de piau com médias de 77,71 ± 24,31 g e 14,84 ± 1,56 cm de peso e comprimento-padrão, respectivamente; e cinco exemplares do surubim com médias de peso e comprimento-padrão de 309,91 ± 94,23 g e 32,70 ± 1,79 cm, respectivamente. Pode-se constatar a presença de células endócrinas do "tipo aberto" nos segmentos referentes aos intestinos médio e posterior das espécies onívoras e do "tipo fechado" no intestino médio e no reto da espécie carnívora. As células argirófilas foram observadas entre as células absortivas do epitélio intestinal. Os resultados permitem concluir que a presença de células endócrinas nas espécies estudadas pode indicar que estas atuam no mecanismo de controle da absorção dos nutrientes do alimento.

  4. Diagnosis of maternal and child health situation in the municipality of Tanque do Piauí-PI

    Directory of Open Access Journals (Sweden)

    Lorena Sousa Soares

    2013-03-01

    Full Text Available Objective: To describe the diagnosis of maternal and child health in the city of Tanque do Piauí-PI. Methods: This is a cross-sectional, descriptive study using epidemiological survey by downloading the database for the years of 2007, 2008 and 2009 from the Ministry of Health official systems. The variables analyzed were: demographic and socioeconomic indicators; mortality; morbidity and risk factors; resource and coverage; and SISPRENATAL indicators. Results: With the results, the main epidemiological measures for the municipality were observed, especially regarding maternal and child health situation. It was noted a situation of social vulnerability, with high rates of illiteracy, precarious basic sanitation conditions, high rates of teenage pregnancy and cesarean deliveries, infant mortality and low birth weight rates in significant proportion, and inefficient supply of information systems. Conclusion: An increase in the maternal mortality rate, the percentage of teenage pregnancy, and in the number of low birth weight infants and cesarean deliveries has been verified.

  5. Conhecimento tradicional das marisqueiras de Barra Grande, área de proteção ambiental do delta do Rio Parnaíba, Piauí, Brasil

    OpenAIRE

    Freitas, Simone Tupinambá; Pamplin, Paulo Augusto Zaitune; Legat, Jefferson; Fogaça, Fabíola Helena dos Santos; Barros, Roseli Farias Melo de

    2012-01-01

    Na comunidade de Barra Grande localizada no litoral do Piauí, as mulheres dos pescadores, conhecidas localmente como marisqueiras, extraem do manguezal vários tipos de moluscos para comercialização e em maior escala para a subsistência. Dados sobre a atividade de mariscagem, conceitos de conservação e aspectos socioeconômicos do contexto em que ocorre a atividade de cata dos moluscos, foram revelados após a aplicação de protocolos estruturados e semiestruturados. O molusco bivalve Anomalocard...

  6. Coccidioides immitis isolated from armadillos (Dasypus novemcinctus) in the state of Piauí, northeast Brazil.

    Science.gov (United States)

    Eulálio, K D; de Macedo, R L; Cavalcanti, M A; Martins, L M; Lazéra, M S; Wanke, B

    2001-01-01

    Natural infection of armadillos with Coccidioides immitis was studied in the state of Piauí, northeast of Brazil, endemic for coccidioidomycosis. In 1998, 26 nine-banded armadillos (Dasypus novemcinctus) were captured in 4 different counties. The animals were sacrificed under deep anesthesia with ether. At necropsy fragments of spleen, liver, lungs and heart were homogenized and seeded onto Sabouraud dextrose agar with and without cycloheximide (BBL, USA). Part of each organ was also processed for histological examination. Suspected colonies of filamentous fungi observed after the second week of incubation at room temperature, exhibiting barrel-shaped arthroconidia alternating with empty spaces, were inoculated intraperitoneally into mice. Three armadillos proved to be infected with C. immitis. Mice inoculated with suspected colonies obtained from homogenized spleen of three and liver of two armadillos developed disseminated coccidioidomycosis and immature and mature spherules of C. immitis were disclosed in several organs. For the first time armadillos (D. novemcinctus) were found naturally infected with C. immitis, adding new data on the ecology and on a possible role of these ancestral mammals in the evolutionary life cycle of this fungus.

  7. Electron spin resonance dating of human teeth from Toca da Santa shelter of São Raimundo Nonato, Piauí, Brazil

    Science.gov (United States)

    Kinoshita, A.; Figueiredo, A. M. G.; Felice, G. D.; Lage, M. C. S. M.; Guidon, N.; Baffa, O.

    2008-02-01

    Results of the dating of fossil human teeth excavated from a shelter in the surroundings areas of the Serra da Capivara National Park, São Raimundo Nonato, Piauí, Brazil are presented. This shelter was partially excavated to search for more data that could improve the archaeological context of the Garrincho’s limestone hill sites, where the Toca do Gordo do Garrincho shelter provided two human teeth dated by conventional C-14 in (12,170 ± 40) yBP (years before present) and calibrated age (2 Sigma, 95% probability) 15,245 14,690 yBP (Beta 136204) [E. Peyre, C. Guérin, N. Guidon, I. Coppens, CR Acad. Sci. Paris, Sciences de la terre et des planètes/ Earth & Planetary Sciences 327 (1998) 335, [1

  8. Proximate composition, mineral content and fatty acid profile of two marine fishes from Cameroonian coast: Pseudotolithus typus (Bleeker, 1863 and Pseudotolithus elongatus (Bowdich, 1825

    Directory of Open Access Journals (Sweden)

    J.M. Njinkoue

    2016-10-01

    Full Text Available Background: Knowledge of chemical composition of fish from Cameroon is poor. The genera Pseudotolithus are nutritionally and economically important in Cameroon. Thus the knowledge on their chemical composition could help in functional food elaboration. Purpose: In this study, Proximate composition, fatty acid profiles and mineral composition were determined in two fish species, Pseudotolithus typus and Pseudotolithus elongatus from Cameroonian coasts. Basic procedure: AOAC standard method was used. Fatty acids were identified by GC/MS as N-acylpyrolidides. Mineral compositions were determined by atomic absorption spectrophotometry for Ca, Na, K, Mg, Fe, Zn, Cu, Mn, and by UV spectrophotometry for phosphorus (P. Main finding: Results indicated that chemical composition was not similar in the two fish species. Results also showed that water is the main constituent in the edible parts and in the bones with 76.17% to 78.24% and 51.21% to 55.28% respectively. Pseudotolithus typus and Pseudotolithus elongatus were good sources of proteins with 16.17% and 13.4% respectively. All the fish analyzed for fat were lean with fat contents less than 0.5%. These species of fish were poor in ω6PUFA and were rich in ω3PUFA with about one third of total fatty acids. The main ω3 fatty acids were eicosapentaenoic acid (EPA and docosahexaenoic acid (DHA. The most abundant main elements were the potassium in the edible parts (1.39% and calcium in the bones (18.26%. The most abundant trace elements were Zn and Fe in the edible parts and in the bones. Principal conclusion: The Na/K ratio values and ω3 fatty acids contents suggest that consumption of these two fish species could be recommended to prevent cardiovascular diseases. Keywords: Proximal composition, Mineral content, Fatty acid profiles, Pseudotolithus typus, Pseudotolithus elongates

  9. CRISPR/Cas9 mediated targeted mutagenesis of the fast growing cyanobacterium Synechococcus elongatus UTEX 2973.

    Science.gov (United States)

    Wendt, Kristen E; Ungerer, Justin; Cobb, Ryan E; Zhao, Huimin; Pakrasi, Himadri B

    2016-06-23

    As autotrophic prokaryotes, cyanobacteria are ideal chassis organisms for sustainable production of various useful compounds. The newly characterized cyanobacterium Synechococcus elongatus UTEX 2973 is a promising candidate for serving as a microbial cell factory because of its unusually rapid growth rate. Here, we seek to develop a genetic toolkit that enables extensive genomic engineering of Synechococcus 2973 by implementing a CRISPR/Cas9 editing system. We targeted the nblA gene because of its important role in biological response to nitrogen deprivation conditions. First, we determined that the Streptococcus pyogenes Cas9 enzyme is toxic in cyanobacteria, and conjugational transfer of stable, replicating constructs containing the cas9 gene resulted in lethality. However, after switching to a vector that permitted transient expression of the cas9 gene, we achieved markerless editing in 100 % of cyanobacterial exconjugants after the first patch. Moreover, we could readily cure the organisms of antibiotic resistance, resulting in a markerless deletion strain. High expression levels of the Cas9 protein in Synechococcus 2973 appear to be toxic and result in cell death. However, introduction of a CRISPR/Cas9 genome editing system on a plasmid backbone that leads to transient cas9 expression allowed for efficient markerless genome editing in a wild type genetic background.

  10. Modelling Pseudocalanus elongatus stage-structured population dynamics embedded in a water column ecosystem model for the northern North Sea

    Science.gov (United States)

    Moll, Andreas; Stegert, Christoph

    2007-01-01

    This paper outlines an approach to couple a structured zooplankton population model with state variables for eggs, nauplii, two copepodites stages and adults adapted to Pseudocalanus elongatus into the complex marine ecosystem model ECOHAM2 with 13 state variables resolving the carbon and nitrogen cycle. Different temperature and food scenarios derived from laboratory culture studies were examined to improve the process parameterisation for copepod stage dependent development processes. To study annual cycles under realistic weather and hydrographic conditions, the coupled ecosystem-zooplankton model is applied to a water column in the northern North Sea. The main ecosystem state variables were validated against observed monthly mean values. Then vertical profiles of selected state variables were compared to the physical forcing to study differences between zooplankton as one biomass state variable or partitioned into five population state variables. Simulated generation times are more affected by temperature than food conditions except during the spring phytoplankton bloom. Up to six generations within the annual cycle can be discerned in the simulation.

  11. Ambiente, pessoas e labor: APLs além do desenvolvimento econômico na mineração de opalas em Pedro II, no Piauí

    OpenAIRE

    Milanez, Bruno; Puppim, José Antonio

    2009-01-01

    Este artigo propõe que políticas públicas voltadas para arranjos produtivos lo0cais (APLs) têm um importante potencial para melhorar o desempenho dos pequenos garimpos e minas de gemas no Brasil, desde que integrem questões ambientais e sociais às ações voltadas ao desenvolvimento econômico. Esse argumento é baseado no estudo empírico dos problemas socioambientais enfrentados pelo APL de opalas em Pedro II, no Piauí. O estudo foi desenvolvido através da metodologia de estudos de caso, envolve...

  12. Ochres from rituals of prehistoric human funerals at the Toca do Enoque site, Piauí, Brazil

    Science.gov (United States)

    Cavalcante, Luis Carlos Duarte; da Luz, Maria De Fátima; Guidon, Niéde; Fabris, José Domingos; Ardisson, José Domingos

    2011-11-01

    The archaeological site known as Toca do Enoque (geographical coordinates, 09° 14' 65.3″ S 43° 55' 62.5″ W) is a rock shelter located in the Serra das Andorinhas (Serra das Confusões National Park), rural area of the city of Guaribas, state of Piauí, Brazil. Several rupestrian paintings (anthropomorphic and zoomorphic motifs along with some pure graphisms), predominantly in red, are found on the sandstone walls. Charcoals, lithic materials, necklaces with teeth, animal bones, gastropod shells, ochres and human skeletons (dated from 6,220 ± 40 to 6,610 ± 40 years before present, BP) were identified in recent excavations in this shelter. Red and yellow ochre samples were collected from prehistoric funeral structures and analyzed with powder X-ray diffractometry, Fourier-transform infrared spectroscopy and 57Fe transmission Mössbauer spectroscopy at 298 K and 80 K. Mössbauer data indicate that the red ochre do contain predominantly hematite ( α-Fe2O3) whereas goethite ( α-FeOOH) is the major mineral in the yellow ochre.

  13. Facies architecture and high resolution sequence stratigraphy of an aeolian, fluvial and shallow marine system in the Pennsylvanian Piauí Formation, Parnaíba Basin, Brazil

    Science.gov (United States)

    Vieira, Lucas Valadares; Scherer, Claiton Marlon dos Santos

    2017-07-01

    The Pennsylvanian Piauí Formation records the deposition of aeolian, fluvial and shallow marine systems accumulated in the cratonic sag Parnaíba basin. Characterization of the facies associations and sequence stratigraphic framework was done by detailed description and logging of outcrops. Six facies associations were recognized: aeolian dunes and interdunes, aeolian sandsheets, fluvial channels, tidally-influenced fluvial channels, shoreface and shoreface-shelf transition. Through correlation of stratigraphic surfaces, the facies associations were organized in system tracts, which formed eight high frequency depositional sequences, bounded by subaerial unconformities. These sequences are composed of a lowstand system tract (LST), that is aeolian-dominated or fluvial-dominated, a transgressive system tract (TST) that is formed by tidally-influenced fluvial channels and/or shoreface and shoreface-shelf transition deposits with retrogradational stacking, and a highstand system tract (HST), which is formed by shoreface-shelf transition and shoreface deposits with progradational stacking. Two low frequency cycles were determined by observing the stacking of the high frequency cycles. The Lower Sequence is characterized by aeolian deposits of the LST and an aggradational base followed by a progressive transgression, defining a general TST. The Upper Sequence is characterized by fluvial deposits and interfluve pedogenesis concurring with the aeolian deposits of the LST and records a subtle regression followed by transgression. The main control on sedimentation in the Piauí Formation was glacioeustasy, which was responsible for the changes in relative sea level. Even though, climate changes were associated with glacioeustatic phases and influenced the aeolian and fluvial deposition.

  14. Prevalência de sobrepeso e obesidade entre funcionários plantonistas de unidades de saúde de Teresina, Piauí Overweight and obesity prevalence in employees of healthcare units in Teresina, Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Ruth Maria Rocha de Pádua Sousa

    2007-10-01

    Full Text Available OBJETIVO: O objetivo deste trabalho foi identificar a prevalência de sobrepeso e obesidade, bem como os fatores a eles associados, em funcionários de quatro Unidades de Saúde do Município de Teresina, Piauí. MÉTODOS: Estudo transversal com amostra estratificada proporcional de 207 funcionários plantonistas diurnos das Unidades Básicas de Saúde da Prefeitura Municipal de Teresina, que foram entrevistados e avaliados a partir de dados antropométricos. Para a classificação do estado nutricional foi utilizado o Índice de Massa Corporal e, para a classificação do risco cardiovascular de acordo com a distribuição da gordura corporal, foi utilizada a circunferência da cintura. RESULTADOS: A prevalência de excesso de peso foi de 53,72%, sendo as proporções de sobrepeso e obesidade de 35,75% e 17,70%, respectivamente. O sobrepeso esteve mais presente no sexo masculino (45,16% e a obesidade no sexo feminino (19,31%. As variáveis que se mantiveram associadas significantemente com a obesidade foram: idade, função desempenhada pelo funcionário, obesidade dos pais, renda, fumo e circunferência da cintura. CONCLUSÃO: As elevadas proporções de excesso de peso entre os funcionários das Unidades de Saúde mostram a necessidade de ações de saúde destinadas à prevenção e ao controle, de modo a contribuir para a redução desses índices e para o controle das doenças crônicas.OBJECTIVE: The objective of this study was to identify the prevalence of overweight and obesity and associated factors in employees of four Health Units in the municipality of Teresina, Piauí. METHODS: This was a cross-sectional study with proportionate stratified sampling of 207 day shift employees of Basic Healthcare Units of the city of Teresina, who were interviewed and classified according to their anthropometric data. Nutritional status was determined with body mass index and waist circumference was used to determine cardiovascular risk according to

  15. Simulation of growth and development of irrigated cowpea in Piauí State by CROPGRO model Simulação do crescimento e desenvolvimento do caupi irrigado no Estado do Piauí pelo modelo CROPGRO

    Directory of Open Access Journals (Sweden)

    Edson Alves Bastos

    2002-10-01

    Full Text Available The objective of this work was to adapt the CROPGRO model, which is part of the DSSAT system, for simulating the cowpea (Vigna unguiculata growth and development under soil and climate conditions of the Baixo Parnaíba region, Piauí State, Brazil. In the CROPGRO, only input parameters that define crop species, cultivars, and ecotype were changed in order to characterize the cowpea crop. Soil and climate files were created for the considered site. Field experiments without water deficit were used to calibrate the model. In these experiments, dry matter (DM, leaf area index (LAI, yield components and grain yield of cowpea (cv. BR 14 Mulato were evaluated. The results showed good fit for DM and LAI estimates. The medium values of R² and medium absolute error (MAE were, respectively, 0.95 and 264.9 kg ha-1 for DM, and 0.97 and 0.22 for LAI. The difference between observed and simulated values of plant phenology varied from 0 to 3 days. The model also presented good performance for yield components simulation, excluding 100-grain weight, for which the error ranged from 20.9% to 34.3%. Considering the medium values of crop yield in two years, the model presented an error from 5.6%.O objetivo deste trabalho foi adaptar o modelo CROPGRO, o qual faz parte do sistema DSSAT, para simular o crescimento e desenvolvimento do caupi (Vigna unguiculata nas condições de solo e clima do Baixo Parnaíba, Piauí. No CROPGRO, foram modificados apenas parâmetros que definem os arquivos de espécie, de cultivar e de ecótipo, visando caracterizar a cultura do caupi. Foram criados arquivos contendo as características de solo e de clima do referido local. Na calibração do modelo, foram utilizados experimentos de campo sem restrições hídricas nos quais foram avaliados a matéria seca (MS, o índice de área foliar (IAF, os componentes de produção e a produtividade de grãos da cultivar BR 14 Mulato. Os valores médios dos R² e do erro absoluto médio (EAM

  16. A barrier to upstream migration in the fish passage of Itaipu Dam (Canal da Piracema), Paraná River basin

    Science.gov (United States)

    ,; Fontes Júnior, Hélio Martins; Makrakis, Sergio; Gomes, Luiz Carlos; Latini, João Dirço

    2012-01-01

    The majority of the fish passages built in the Neotropical region are characterised by low efficiency and high selectivity; in many cases, the benefits to fish populations are uncertain. Studies conducted in the Canal da Piracema at Itaipu dam on the Parana River indicate that the system component designated as the Discharge channel in the Bela Vista River (herein named Canal de deságue no rio Bela Vista or CABV), a 200 m long technical section, was the main barrier to the upstream migration. The aim of this study was to evaluate the degree of restriction imposed by the CABV on upstream movements of Prochilodus lineatus and Leporinus elongatus, Characiformes. Fish were tagged with passive integrated transponders (PIT tags) and released both downstream and upstream of this critical section. Individuals of both species released downstream of the CABV took much more time to reach the upper end of the system (43.6 days vs. 15.9 days), and passed in much lower proportions (18% vs. 60.8%) than those tagged upstream of this component. Although more work is needed to differentiate between fishway effects and natural variation in migratory motivation, the results clearly demonstrate passage problems at the CABV.

  17. Eco-eficiência na Produção de Cera de Carnaúba no Município de Campo Maior, Piauí, 2004

    OpenAIRE

    Carvalho, Francisco Prancacio Araujo de; Gomes, Jaira Maria Alcobaca

    2008-01-01

    A Copernicia prunifera (Miller) H.E. Moore ou carnaúba gera um material sobre as folhas usado na fabricação de cera, matéria-prima de inúmeros produtos industriais. O Brasil é o único produtor de cera de carnaúba e o estado do Piauí, um importante influente. Neste, as condições naturais do município de Campo Maior favorecem a incidência da carnaubeira e sua tradição histórica na produção de cera tornaram-no um pólo regional. O objetivo geral é analisar, na produção de cera de carnaúba, os ele...

  18. Educação a distância: possibilidades e desafios na formação de professores em Alegrete do Piauí

    OpenAIRE

    ROCHA, Francisca Telma Maia

    2011-01-01

    Esta dissertação apresenta os resultados de uma pesquisa de campo de caráter qualitativo sobre a formação de professores em Alegrete do Piauí de 2008 a 2011. Onde a ênfase está na análise das formas de apropriação e de aproveitamento das propostas de Educação a Distância (EAD) pelos usuários. Atualmente com o processo de globalização onde as transformações ocorrem de forma rápida, a educação mediada pelas novas Tecnologias de Informação e Comunicação (TIC) por ser é um assunto de relevante de...

  19. Evaluation of three rootstocks root system for acid lime ‘tahiti’ at Piauí state/ Sistema radicular de três porta-enxertos para lima ácida ‘tahiti’ no estado do Piauí

    Directory of Open Access Journals (Sweden)

    Adeodato Ari Cavalcante Salviano

    2007-10-01

    Full Text Available The objective of this work was to evaluate the development of the root system of three rootstocks for ‘Tahiti’acid lime [Citrus latifolia (Yu.Tanaka Tanaka]: Rangpur lime (C. limonia Osbeck; Swingle citrumelo [Poncirus trifoliata (L. Raf. x C. paradisi Macf.]; Flying Dragon trifoliate (P. trifoliata (L. Raf.var. (FD – in the soil and environment conditions of the county of José de Freitas, Piauí, located on 04º 52' latitude S and 42º 42' longitude W and 110 m of altitude, in Aw climate. It was used the trench method. A wooden frame divided into 0.1 x 0.2 m parts was fixed in the soil profile and a digital photograph was taken from each part. These photographs were analyzed by software SIARCS 3.0 for sizing of the root system and the data gotten, submitted to the analysis of variance with Tukey test at the level of 5% of probability. The experimental design was entirely randomized, with three treatments (rootstocks and four replications (trenches. The root systems of the rootstocks had 90% of concentration until the depth of 0,4 m, and it was observed that 60% of the roots were concentrated in the first 0,2 m. The root system of the Rangpur lime demonstrated to be superior, in lenght (cm.200 cm-² to the Flying Dragon trifoliate and Swingle citrumelo root systems.O objetivo deste trabalho foi avaliar o desenvolvimento radicular de três porta-enxertos para lima ácida ‘Tahiti’ [Citrus latifolia (Yu.Tanaka Tanaka]: limão Cravo (C. limonia Osbeck; citrumelo Swingle [Poncirus trifoliata (L. Raf. x C. paradisi Macf.]; trifoliata Flying Dragon (P. trifoliata (L. Raf.var. (FD, no município de José de Freitas, Piauí, localizado a 04º 52’ latitude S e 42º 42’ longitude W, e altitude de 110m, onde predomina clima Aw. Foram abertas trincheiras com quatro repetições, para colocação de quadro-gabarito de madeira, com divisórias de 0,1 m na profundidade por 0,2 m na largura, perfazendo cinco camadas na profundidade e seis posi

  20. Morphological dimorphism in the Y chromosome of "pé-duro" cattle in the Brazilian State of Piauí

    Directory of Open Access Journals (Sweden)

    Carmen M.C. Britto

    1999-09-01

    Full Text Available "Pé-duro" (hard foot is a rare breed of beef cattle of European (Bos taurus taurus origin, originated in northern and northeastern Brazil. Y chromosome morphology, outer genital elements and other phenotypic characteristics were examined in 75 "pé-duro" bulls from the Empresa Brasileira de Pesquisa Agropecuária (Embrapa herd in the Brazilian State of Piauí. The purpose was to investigate possible racial contamination with Zebu animals (Bos taurus indicus in a cattle that has been considered closest to its European origin (B. t. taurus. The presence of both submetacentric and acrocentric Y chromosomes, typical of B. t. taurus and B. t. indicus, respectively, and the larger preputial sheath in bulls with an acrocentric Y chromosome indicated racial contamination of the "pé-duro" herd with Zebu cattle. Phenotypic parameters involving horn, dewlap, ear, chamfer, and coat color characteristics, indicative of apparent racial contamination, were not associated with acrocentric Y chromosome.Um plantel de touros "pé-duro", consistindo de 75 animais do núcleo da Embrapa envolvido com a preservação desse gado no Estado do Piauí, foi examinado quanto à morfologia do seu cromossomo Y, bem como em relação a elementos da genitália externa e outras características fenotípicas dos machos. O objetivo era investigar a contaminação racial por animais zebuínos (Bos taurus indicus num gado bovino que tem sido considerado mais próximo de sua origem européia (Bos taurus taurus. Tanto a forma submetacêntrica quanto a forma acrocêntrica do cromossomo Y, típicas das sub-espécies B. t. taurus e B. t. indicus, respectivamente, bem como maior bainha prepucial nos espécimes portadores do cromossomo Y acrocêntrico, indicativa de contaminação racial por gado zebuíno, foram detectadas no rebanho "pé-duro" mantido no núcleo da Embrapa. Outras características fenotípicas analisadas que podem informar sobre a contaminação racial aparente n

  1. Chapiniella variabilis (Nematoda parasitizing Chelonoidis carbonarius and C. denticulatus (Testudinidae in the state of Piauí

    Directory of Open Access Journals (Sweden)

    Simone Mousinho Freire

    Full Text Available Abstract Chapiniella variabilis (Chapin, 1924, a strongylid nematode, was collected parasitizing the large intestine of the tortoises Chelonoidis carbonarius (Spix, 1824 (Cc and C. denticulatus (Linnaeus, 1766 (Cd in the Zoobotanical Park of the municipality of Teresina, state of Piauí, Brazil. The taxonomic identification was based on morphological and morphometric features, using bright-field and scanning electron microscopy. The present study adds new observations on the morphology, mainly relating to the mouth papillae, external and internal leaf-crown elements, excretory pore, deirids and male and female posterior end. The parasitic indices of prevalence (P, mean intensity (MI, mean abundance (MA and range of infection (RI of C. variabilis in these two tortoise species were: P = 100%, MI = 833.3, MA = 833.3, RI = 500-1,500 (Cc; P = 100%, MI = 472.2, MA = 472.2, RI = 333-500 (Cd. This record expands occurrences of C. variabilis to a new host, C. carbonarius, and to another state in Brazil, in the Neotropical region of South America. Adjustment to host management with the aim of improving hygiene and health conditions is suggested.

  2. Características demográficas e clínicas de pacientes com artrite reumatoide no Piauí, Brasil - avaliação de 98 pacientes

    Directory of Open Access Journals (Sweden)

    Maria do Socorro Teixeira Moreira Almeida

    2014-10-01

    Full Text Available Introdução: São escassos os estudos epidemiológicos brasileiros sobre artrite reumatoide, sobretudo no Nordeste; assim, muitos dados atualmente disponíveis têm sua origem na literatura internacional. Objetivos: Descrever as características demográficas, clínicas e sorológicas de pacientes com artrite reumatoide (AR seguidos pelo mesmo médico no Estado do Piauí, Brasil. Pacientes e métodos: Os dados foram coletados entre agosto de 2010 e março de 2013, em três serviços de saúde do Piauí com atendimento em reumatologia: um hospital universitário, uma clínica ambulatorial pública e uma clínica privada. Resultados: Os números representam média ± DP ou percentual: 98 pacientes com 47.5 ± 11.03 anos de idade; não-brancos; predominância de mulheres; não fumantes (59.2%; baixo nível educacional; duração média da doença de 7.7 ± 7.6 anos; e as principais manifestações extra-articulares foram nódulos reumatoides (19.4% e síndrome sicca (46.9%. Conclusão: As características da artrite reumatoide obtidas neste estudo são similares àquelas encontradas em alguns estudos nacionais e internacionais, mas observamos maior preponderância de mulheres, um nível de analfabetismo maior e, na média, uma doença erosiva moderadamente grave com presença frequente de sicca e de outras manifestações extra-articulares.

  3. Epidemiologia da doença de Chagas na zona rural do Município de Teresina-Piauí, Brasil

    Directory of Open Access Journals (Sweden)

    Dalva Neves da Costa Bento

    1992-03-01

    Full Text Available Na área rural do município de Teresina-Piauí, foram capturados 129 triatomíneos distribuídos em (a ecótopos artificiais: habitações (1 Triatoma brasiliensis, 1 Panstrongylus geniculatus, 1 Rhodnius pictipes e 1 Rhodnius prolixusj e galpão abandonado (7 Rhodnius nasutusj e (b ecótopos naturais: Orbignya martiana (41 Rhodnius neglectus, 33 Rhodnius prolixus e 41 Rhodnius nasutus, e Copernicia cerifera (3 Rhodnius neglectus,. Cerca de 22,6% dos triatomíneos capturados estavam infectados por flagelados, sendo 30% no ambiente artificial e 21,9% no ambiente natural. Dos 28 mamíferos capturados e examinados, 7 Didelphis aibiventris, 2 Rattus rattus e 1 Tamandua tetradacty la apresentavam-se positivos para flagelados. Os flagelados encontrados nos triatomíneos e nos mamíferos eram semelhantes ao Trypanosoma cruzi. Das 123 reações sorológicas, por imunojluorescência indireta, realizadas na população, duas (1,6% foram reativas.

  4. Diminuição do teor de óxido de crômio (III usado como marcador externo Reduction in chromium (III oxide level as an external marker

    Directory of Open Access Journals (Sweden)

    Hermann Bremer Neto

    2003-04-01

    Full Text Available A sensibilidade do método espectrofotométrico da s-difenilcarbazida de determinação do crômio permite que esse metal possa ser determinado em teores e em massas de amostras tão pequenas que as concentrações atualmente usadas de óxido de crômio (III como marcador externo em ensaios biológicos poderiam ser drasticamente diminuídas. Utilizando-se do piauçu (Leporinus macrocephalus para um estudo sobre o coeficiente de digestibilidade aparente (CDA da fração protéica, seis níveis de óxido de crômio (III - 0,01% - 0,02% - 0,03% - 0,05% - 0,1% e 0,2% - foram incorporados em dietas isoprotéica e isoenergética, objetivando-se verificar se o cálculo do CDA seria afetado pela variação do teor do marcador. Os seis tratamentos foram dispostos em um delineamento em blocos inteiramente casualisados, sendo as fezes coletadas durante 16 dias. Verificou-se que os resultados do coeficiente de digestibilidade aparente da fração protéica não apresentaram diferenças estatísticas significativas devidas aos teores incorporados do marcador à ração e aos dias de coleta. Conseqüentemente, e em experimentos dessa natureza, nada impede que seja reduzido o teor de óxido de crômio (III ao menos até 0,01%: além da economia relativa ao consumo do mesmo e da facilidade na manipulação de menor quantidade de amostras de fezes, o método espectrofotométrico da s-difenilcarbazida permite dosar esse nível (e até menor do que 0,01% de modo simples e rápido, com precisão e exatidão.The objective of this study was to reduce the level of the biological marker Cr2O3 in animal diets, due to the sensibility of the sdiphenylcarbazide spectrophotometric method for chromium determination in feces, recently developed. Six levels of marker, chromium (III oxide (0.01% - 0.02% - 0.03% - 0.05% - 0.1% and 0.2%, were incorporated into isoproteic and isoenergetic diets, for the apparent digestibility assay of the "piauçu" (Leporinus macrocephalus, in a

  5. Avaliação longitudinal da fluoretação da água de abastecimento público de Teresina-Piauí = Long-term assessment of fluoride level of public water supply in Teresina-Piauí

    Directory of Open Access Journals (Sweden)

    Moura, Marcoeli Silva de

    2005-01-01

    Full Text Available A concentração de fluoreto na água de abastecimento público deve ser mantida dentro de uma faixa ideal para contemplar o binômio riscos/benefícios desta medida de saúde publica. Assim, o objetivo deste estudo foi monitorar, mensalmente, a concentração de fluoreto na água de abastecimento público de Teresina, Piauí, Brasil, assim como validar a importância do heterocontrole. Para a coleta das amostras, foram selecionados aleatoriamente cinco bairros representativos das cinco regiões que compõem a cidade. As coletas foram realizadas, mensalmente, dos meses de junho-2000 a maio-2001, e as análises foram feitas utilizando-se eletrodo específico. Concentrações abaixo do limite inferior em termos de prevenção de cárie (0,60 ppm foram encontradas, assim como elas diferiram entre os pontos de coleta. Concluiu-se que a população de Teresina esteve submetida a concentrações de fluoreto na água de abastecimento público inferiores à recomendada e irregularmente distribuídas. Isto enfatiza a importância do heterocontrole da concentração de fluoreto na água como medida de vigilância sanitária

  6. Cobertura vacinal dos profissionais de um curso de especialização em Saúde da Família do Piauí Protección vacunal de los profesionales de un curso de especialización en Salud de la Familia de Piauí Vacinal covering of the professionals of the spcecialization course in Family Health of Piaui

    Directory of Open Access Journals (Sweden)

    Telma Maria Evangelista de Araújo

    2006-04-01

    Full Text Available O presente estudo tem como objetivo avaliar a cobertura vacinal dos alunos de um Curso de Especialização em Saúde da Família do Piauí. A população do estudo foi constituída por todos os 43 alunos da turma: 19 enfermeiros, 13 médicos e 11 cirurgiões-dentistas. Os dados foram coletados em 2004, utilizando-se questionários auto-aplicáveis. Encontrou-se uma cobertura vacinal de 81,3% para hepatite B, 76% para a vacina antiamarílica e 65,1% para dT. Além disso, 25 alunos (58,1% relataram desconhecimento acerca das vacinas preconizadas pelo Programa Nacional de Imunização (PNI. Os resultados mostraram que esses profissionais de saúde não estão adequadamente vacinados, reforçando a necessidade da implantação de uma política sistemática de imunização para eles, tendo como base as normas preconizadas pelo PNI.El presente estudio tiene como objetivo evaluar la protección vacunal de los estudiantes de un Curso de Especialización en salud de la Familia de Piauí-Brasil. La problación del estudio fue constituida por todos los 43 alumnos de la Turma: 19 enfermeros, 13 médicos y 11 cirujanos dentitas. Los datos fueron recolectados en 2004, usándose cuestionarios autoaplicables. Fue encontrada una protección vacunal de 81,3% para hepatitis B, 76% para la fiebre amarilla y 65,1% para dT. Además de eso, 25 estudiantes (58,1% relataron ignorancia acerca de las vacunas preconizadas por el Programa Nacional de Inmunización (PNI. Los resultados revelaron que esos profesionales de saul no están adecuadamente vacunados, reforzando la necesidad de la impantación de una política sistemática de inmunización para ellos, teniendo como base las normas preconizadas por el PNI.This study has as objective to evaluates the vacinal covering of the professionals of a Specialization Course in Family Health of Piauí. The study population was constituted by all the 43 students of the group, which are 19 male nurses, 13 doctors and 11 surgeons

  7. Evasão escolar no curso de educação física da Universidade Federal do Piauí Desertion in a physical education program at the Federal University of Piauí

    Directory of Open Access Journals (Sweden)

    Francisca Islandia Cardoso da Silva

    2012-07-01

    Full Text Available O presente estudo teve como objetivo investigar os fatores que motivaram a evasão de alunos ingressantes em 2005 no curso de Licenciatura Plena em Educação Física da Universidade Federal do Piauí. Inicialmente, utilizaram-se informações (nome, contato telefônico, período de egressão e endereço fornecidas pela coordenação do curso a cerca dos 66 alunos ingressantes em 2005 via vestibular. Os demais dados, pessoais e acadêmicos, foram coletados mediante a aplicação de questionários junto aos alunos diplomados em tempo ideal e aos alunos declarados evadidos do curso. A amostra foi composta por 10 alunos diplomados e 11 alunos evadidos. A pesquisa empírica foi realizada no período de agosto a novembro de 2010. Os resultados da pesquisa revelaram que os fatores responsáveis pela evasão dos alunos foram: falta de informações sobre o curso, descontentamento com a profissão, imaturidade ao escolher o curso, pouca interação com o curso, e, simultaneidade de dois cursos. Verificou-se três situações distintas que circundam o processo de evasão do aluno. A primeira é caracterizada pelo abandono do curso de Educação Física para concluir um segundo curso já iniciado; a segunda consiste no abandono do curso para iniciar outro; e a terceira situação caracteriza-se pela evasão total do ensino superior. Conclui-se como principal fator responsável pela evasão do grupo de alunos avaliado, a escolha do curso de maneira equivocada e precipitada por parte do aluno.This study aimed to investigate the factors that led to the desertion of new students in 2005 from the undergraduate Physical Education program at the Federal University of Piauí. Initially, we used information (name, phone contact, time of desertion and address provided by the coordination of the program of about 66 freshmen of the year 2005. Other data, personal and academic, were collected through questionnaires to graduates in optimal time and to students who

  8. Spatial modeling using mixed models: an ecologic study of visceral leishmaniasis in Teresina, Piauí State, Brazil

    Directory of Open Access Journals (Sweden)

    Werneck Guilherme L.

    2002-01-01

    Full Text Available Most ecologic studies use geographical areas as units of observation. Because data from areas close to one another tend to be more alike than those from distant areas, estimation of effect size and confidence intervals should consider spatial autocorrelation of measurements. In this report we demonstrate a method for modeling spatial autocorrelation within a mixed model framework, using data on environmental and socioeconomic determinants of the incidence of visceral leishmaniasis (VL in the city of Teresina, Piauí, Brazil. A model with a spherical covariance structure indicated significant spatial autocorrelation in the data and yielded a better fit than one assuming independent observations. While both models showed a positive association between VL incidence and residence in a favela (slum or in areas with green vegetation, values for the fixed effects and standard errors differed substantially between the models. Exploration of the data's spatial correlation structure through the semivariogram should precede the use of these models. Our findings support the hypothesis of spatial dependence of VL rates and indicate that it might be useful to model spatial correlation in order to obtain more accurate point and standard error estimates.

  9. Alcohol-tolerant mutants of cyanobacterium Synechococcus elongatus PCC 7942 obtained by single-cell mutant screening system.

    Science.gov (United States)

    Arai, Sayuri; Hayashihara, Kayoko; Kanamoto, Yuki; Shimizu, Kazunori; Hirokawa, Yasutaka; Hanai, Taizo; Murakami, Akio; Honda, Hiroyuki

    2017-08-01

    Enhancement of alcohol tolerance in microorganisms is an important strategy for improving bioalcohol productivity. Although cyanobacteria can be used as a promising biocatalyst to produce various alcohols directly from CO 2 , low productivity, and low tolerance against alcohols are the main issues to be resolved. Nevertheless, to date, a mutant with increasing alcohol tolerance has rarely been reported. In this study, we attempted to select isopropanol (IPA)-tolerant mutants of Synechococcus elongatus PCC 7942 using UV-C-induced random mutagenesis, followed by enrichment of the tolerant candidates in medium containing 10 g/L IPA and screening of the cells with a high growth rate in the single cell culture system in liquid medium containing 10 g/L IPA. We successfully acquired the most tolerant strain, SY1043, which maintains the ability to grow in medium containing 30 g/L IPA. The photosynthetic oxygen-evolving activities of SY1043 were almost same in cells after 72 h incubation under light with or without 10 g/L IPA, while the activity of the wild-type was remarkably decreased after the incubation with IPA. SY1043 also showed higher tolerance to ethanol, 1-butanol, isobutanol, and 1-pentanol than the wild type. These results suggest that SY1043 would be a promising candidate to improve alcohol production using cyanobacteria. Biotechnol. Bioeng. 2017;114: 1771-1778. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  10. Determination of chemical elements in africanized Apis mellifera (Hymenoptera: Apidae honey samples from the State of Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Geni da Silva Sodré

    2007-08-01

    Full Text Available Honey is a food used since the most remote times, appreciated for its characteristic flavor, considerable nutritional value and medicinal properties; however, little information exists about the presence of chemical elements in it. The objectives of this work were to determine the chemical elements present in 38 honey samples, collected directly from beekeepers from the State of Piauí, Brazil and to verify whether they presented any contamination. The chemical elements were determined by means of Total Reflection X-ray Fluorescence. The means of three replicates were: K (109.671 ± 17.487, Ca (14.471 ± 3.8797, Ti (0.112 ± 0.07, Cr (0.196 ± 0.11, Mn (0.493 ± 0.103, Fe (1.722 ± 0.446, Co (0.038, Ni (0.728 ± 0.706, Cu (0.179 ± 0.0471, Zn (0.967 ± 0.653, Se (not detected, Br (not detected, Rb (0.371 ± 0.097, Sr (0.145 ± 0.45, Ba (11.681, Hg (not detected, and Pb (0.863 µg g-1.

  11. Plantas medicinais cultivadas em quintais de comunidades rurais no domínio do cerrado piauiense (Município de Demerval Lobão, Piauí, Brasil Medicinal plants cultivated in homegardens of rural communities in the domain of Cerrado in Piaui (Demerval Lobão Municipality, Piauí State, Brazil

    Directory of Open Access Journals (Sweden)

    L.C.G.G. Aguiar

    2012-01-01

    Full Text Available O conhecimento terapêutico acumulado por populações rurais através de séculos de estreito contato com o meio possibilita a obtenção de informações acerca do uso dos recursos naturais. O objetivo do presente trabalho foi realizar um inventário das plantas medicinais cultivadas em quintais do município de Demerval Lobão, Piauí, bem como, conhecer o emprego e a importância dessas espécies na comunidade. Foram amostrados 21 quintais em nove comunidades da zona rural do município de Demerval Lobão com vegetação de cerrado. O trabalho foi conduzido com os mantenedores dos quintais a partir de entrevistas semi-estruturadas e observação direta, associada à técnica de turnê-guiada. As plantas medicinais coletadas foram catalogadas, identificadas, e depositadas no Herbário Graziela Barroso (TEPB da Universidade Federal do Piauí (UFPI. Foram referidas 100 espécies botânicas, predominantemente herbáceas e cultivadas, distribuídas em 49 famílias, sendo Leguminosae, Euphorbiaceae e Lamiaceae as mais representativas em número de espécies. Na preparação dos remédios, as folhas foram as mais utilizadas, sendo a decocção a principal forma de preparo. As doenças mais frequentes tratadas por remédios caseiros referem-se ao sistema respiratório e digestivo. Observou-se que não há rigidez quanto à posologia e a duração do tratamento, ficando este a critério do hábito de cada pessoa entrevistada. As plantas que apresentaram índice de importância relativa e concordância de uso (CUP acima de 60% foram cansansão (Cnidosculus urens, boldo (Plectranthus barbatus Andrews, jurema-preta (Mimosa verrucosa Benth e cidreira (Lippia alba (Mill. N.E.Br. ex Britton & P.Wilson. P. barbatus foi a mais citada e também a que apresentou os índices mais altos de CUP (100%, fator de correção - FC (1,00 e concordância de uso corrigido - CUPc (100% para dores no estômago e problemas no fígado. Observou-se a necessidade de resgatar o

  12. Contribuição ao estudo da distribuição geográfica de triatomíneos no estado do Piauí

    Directory of Open Access Journals (Sweden)

    Paulo Zábulon de Figueirêdo

    1975-08-01

    Full Text Available Os autores apresentam a atual distribuição geográfica dos triatomineos no Estado do Piauí. Dos 28 municípios trabalhados em três diferentes regiões naturais, 18 apresentaram capturas positivas, com as seguintes espécies: Triatoma brasiliensis, T. maculata, T. sórdida, Rhodnius pictepes, R. neglectus e Panstrongylus geniculatus. Das espécies citadas, o T. brasiliensis foi a mais freqüente e de maior distribuição. Os autores admitem ser essa espécie a mais importante transmissora da Doença de Chagas, no Estado. Chamam a atenção, ainda, para o papel que as espécies de R. pictepes e R. neglectus possam desempenhar na manutenção do ciclo silvestre do Trypanosoma cruzi, ao lado do P. geniculatus.

  13. Carbon sources and trophic position of the main species of fishes of Baía River, Paraná River floodplain, Brazil

    Directory of Open Access Journals (Sweden)

    Manetta G. I.

    2003-01-01

    Full Text Available In order to verify the carbon source and trophic position of the main species of fishes, of the Paraná River floodplain, we analysed the proportion of stable carbon (delta13C and nitrogen (delta15N isotopes in muscle of fishes sampled in the rainy season. We analyzed adult individuals of Loricariichthys platymetopon, Schizodon borellii, Leporinus lacustris, Auchenipterus osteomystax, Iheringichthys labrosus, Leporinus friderici, and Serrasalmus marginatus. These data were compared with the results obtained by the analyzing stomach contents. The primary producers found in the Baía River were the C3 plants (riparian vegetation, macrophytes, periphyton, and phytoplankton and the C4 plants (macrophytes. The results of the contribution analysis revealed that the carbon used by the species was derived from C3 plants. According to the trophic position estimates (diet and delta15N, the species primarily consumed Loricariichthys platymetopon, Schizodon borellii, Leporinus lacustris, and Leporinus friderici and, secondarily Auchenipterus osteomystax, Iheringichthys labrosus, and Serrasalmus marginatus. There was no significant difference between the two methods utilized.

  14. Perfil e práticas de saúde bucal do agente comunitário de saúde em municípios piauienses de pequeno porte Profile and procedures of the community health agents regarding oral health in the countryside of Piauí State, Brazil

    Directory of Open Access Journals (Sweden)

    Marcoeli Silva de Moura

    2010-06-01

    Full Text Available O objetivo desta pesquisa foi traçar o perfil demográfico e práticas de saúde bucal do ACS, em cidades de pequeno porte do Estado do Piauí. Foram selecionados quatro municípios: Água Branca, Piracuruca, Queimada Nova e Simões. O método utilizado foi o transversal observacional descritivo. Foram aplicados questionários a 109 ACS, constituídos de 28 perguntas fechadas. Os dados foram transferidos para planilha do programa ExcelÒ, tabulados e analisados. Pelos dados obtidos, foi possível concluir que: (1 o agente comunitário de saúde do interior do Piauí é predominantemente do sexo feminino, casado, com idade entre 20-39 anos, tem em média de um a três filhos, com grau de escolaridade médio acima de nove anos, renda de um salário mínimo, residindo em média há 24 anos na comunidade; (2 a grande maioria dos ACS não foi capacitada, não assistiu palestras educativas sobre saúde bucal; entretanto, quase a metade realiza atividades em saúde bucal, mas não as registra; (3 a autopercepção sobre o conhecimento em saúde bucal pelos ACS predominou entre conceitos regular e bom, o que coincidiu com o percentual de acertos ao questionário aplicado.The aim of this survey was to draw the demographic profile and the actions concerning oral health carried out by the communitarian agents of health, in small towns of Piauí State, Brazil. Four towns were chosen: Água Branca, Piracuruca, Queimada Nova e Simões. The method used was observational descriptive cross-sectional. One hundred and nine agents were assessed through questionnaires, with 28 multiples choice questions. Data was analyzed in Excel. It was possible to conclude that: the communitarian agents on the countryside of Piauí are predominantly females, married, age between 20-39, with one to three children, nine years of formal education, monthly income of one minimum salary, and has been living in their community for 24 years in average; the large majority of the agents

  15. Diagnóstico do perfil dos funcionários e uso de Equipamentos de Proteção Individual (EPI’s em carvoarias no Sul do Piauí

    Directory of Open Access Journals (Sweden)

    Sidney Araujo Cordeiro

    2013-09-01

    Full Text Available A presente pesquisa teve como objetivo identificar o perfil das carvoarias situadas na região Sul do estado do Piauí, bem como de seus funcionários, apresentando principais problemas relacionados à atividade de carbonização da madeira, bem como apresentar recomendações visando à melhoria da qualidade de vida desses funcionários. O estudo foi desenvolvido em duas carvoarias localizadas no sul do estado do Piauí, especificamente nos municípios de Curimatá e Parnaguá. Realizou-se um levantamento de dados acerca dos fatores que englobam a segurança no trabalho, enfocando o uso de Equipamentos de Proteção Individual existentes no mercado para o setor de carvoarias. Feito isto, elaborou-se questionários abertos, estruturados com perguntas que abordavam informações acerca das condições gerais de trabalho, da segurança no trabalho, da saúde e educação do trabalhador e uso de EPI’s. Os mesmos foram aplicados aos funcionários de duas empresas do ramo de carvoaria. Constatou-se que, dentre os entrevistados, 64% afirmam que os Equipamentos de Proteção Individual (EPI’s não incomodam no desenvolvimento das tarefas diárias, e por isso utilizam-nos em todas as atividades. Entretanto, 9% não fazem uso desses equipamentos, pois relatam que alguns causam certos desconfortos e acabam por incomodar na execução de algumas tarefas. O uso dos Equipamentos de Proteção Individual (EPI’s nas carvoarias ainda não é satisfatório, mas nota-se um conhecimento por parte das empresas, dos funcionários e dos órgãos fiscalizadores, sobre a importância do uso desses.

  16. O estabelecimento de colônias agrícolas civis e militares na província do Piauí no pós-guerra do Paraguai (1865-1888 = The establishment of military and civil agricultural colonies in the province of Piauí in after Paraguay war period (1865-1888

    Directory of Open Access Journals (Sweden)

    Araújo, Johny Santana de

    2013-01-01

    Full Text Available O presente artigo pretende analisar a ação do governo imperial e provincial a fim de promover a ocupação do território do sul e sudoeste do Piauí através da criação de colônias civis e militares, processo amplamente desenvolvido entre os anos de 1870 a 1889 cujo um dos objetivos era assentar os ex-combatentes que retornavam da guerra do Paraguai e cujas promessas contidas no decreto 3. 371 de 1865 previam a distribuição de terras em colônias agrícolas civis e militares. Outra questão de relevância na proposta do estudo esta relacionada ao objetivo do governo imperial e provincial em reavivar os antigos projetos de criação de colônias agrícolas, amplamente defendidas pelo General Couto Magalhães e por Francisco Adolfo de Varnhagen

  17. Textural patterns, mineralogy, and chemistry of sandstone-related Calçadinha chalcedony (Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Marcondes Lima da Costa

    Full Text Available ABSTRACT: Paleozoic sandstones of the Parnaíba Basin, in addition to hosting opal deposits, also have occurrences of chalcedonies with potential for mineral and ornamental handicrafts, in addition to assisting the understanding of the geological evolution of the basin. However, the chalcedonies were not investigated yet, and this study intended to fulfill this gap by the investigation of the chalcedonies of Calçadinha in Piauí. Fieldwork, microtexturals analysis, X-ray diffraction and scanning electron microscopy with energy dispersive spectrometry, chemical analysis, and gemological assessments were developed. Four distinct types of chalcedonies have been distinguished. They stand out for their well distribution of Fe and Mn dendrites, which involves opal nodules, and contains microcavities with well-formed microcrystalline quartz, nontronite, and palygorskite. The mesoscopic features of these chalcedonies and cabochon and free forms cutting show potential for use in mineral crafts and semi-jewels. As expected, the chalcedonies are dominated by high contents of SiO2, besides the low and variable contents of Al2O3, Fe2O3, MgO, and TiO2. Among trace elements that show high Ba contents, bound in barite, seem also to be a geochemical signature of the country sandstones in Parnaíba basin. These chalcedonies were formed during the partial solubilization of SiO2 of sandstones, which was promoted during their tectonic formation in faults and fractures zones.

  18. Language & Culture in English as a Foreign Language Teaching: a socio-cultural experience of some exchange students from Piauí Federal Institute

    Directory of Open Access Journals (Sweden)

    Giselda dos Santos Costa

    2018-04-01

    Full Text Available The internationalization of higher education has been dramatically intensified over the last fifteen years in Brazil, creating wide-ranging opportunities as well as threats and limitations in relation to foreign language teaching practices and the teaching of culture. Many linguists and anthropologists (BYRAM, 1997; KRAMSCH, 1993; MCKAY, 2003; JENKINS, 2005 have stated that for communication to be successful the use of language must be associated with other culturally appropriated behavior, not just linguistic rules in the strict sense. In this article, we discuss the problems related to internationalization, more specifically, the discussion revolves around the sociocultural challenges faced by some students of the Federal Institute of Piauí (IFPI regarding their experiences in the Science without Borders program spread through five countries. By using qualitative interviews, the results revealed that students had sociocultural problems which could be avoided if English teachers had worked in the language classroom before the execution of the exchange program.

  19. Intervenção coronária em hospital geral no Piauí

    Directory of Open Access Journals (Sweden)

    Portela Antenor

    1998-01-01

    Full Text Available OBJETIVO: Determinar o índice de sucesso e complicações das intervenções coronárias realizadas em hospital geral do Piauí, em um laboratório de hemodinâmica com baixo volume de procedimentos por ano. MÉTODOS: Cento e vinte e dois pacientes, submetidos a 146 procedimentos de intervenção coronária, de agosto/91 a janeiro/98 tiveram seus dados clínicos e angiográficos analisados retrospectivamente. As cineangiocoronariografias e as intervenções foram realizadas em aparelho com sistema de fluoroscopia com câmara e monitor de TV de 525 linhas. As variáveis analisadas foram o sucesso inicial do procedimento (estenose residual <50% e fluxo TIMI III e as complicações maiores (oclusão aguda, infarto, cirurgia de urgência e óbito. Foram revisados os dados clínicos e as características morfológicas das lesões (ACC/AHA Task Force. RESULTADOS: A média etária foi de 61 anos, variando de 25 a 85, 67% dos pacientes eram do sexo masculino, 85% apresentavam síndrome isquêmica aguda (infarto agudo do miocárdio, angina pós infarto ou angina de repouso, 5% apresentavam-se em choque cardiogênico. 88% das lesões eram tipo B. O índice de sucesso imediato foi de 93%. A taxa de complicações maiores (oclusão aguda, cirurgia de urgência, infarto e óbito foi de 3,5%. CONCLUSÃO: A despeito de um baixo volume de procedimentos por ano e um equipamento de cineangiocoronariografia convencional, o índice de sucesso desta instituição foi excelente em uma população de pacientes diversa e complexa com taxa de complicações semelhante à encontrada na literatura.

  20. Acute leukemias in Piauí: comparison with features observed in other regions of Brazil

    Directory of Open Access Journals (Sweden)

    Rego M.F.N.

    2003-01-01

    Full Text Available Differences in age and sex distribution as well as FAB (French-American-British classification types have been reported for acute leukemias in several countries. We studied the demographics and response to treatment of patients with acute myeloid leukemia (AML and acute lymphoblastic leukemia (ALL between 1989 and 2000 in Teresina, Piauí, and compared these results with reports from Brazil and other countries. Complete data concerning 345 patients (230 ALL, 115 AML were reviewed. AML occurred predominantly in adults (77%, with a median age of 34 years, similar to that found in the southeast of Brazil but lower than the median age in the United States and Europe (52 years. FAB distribution was similar in children and adults and FAB-M2 was the most common type, as also found in Japan. The high frequency of FAB-M3 described in most Brazilian studies and for Hispanics in the United States was not observed. Overall survival for adults was 40%, similar to other studies in Brazil. A high mortality rate was observed during induction. No clinical or hematological parameter influenced survival in the Cox model. ALL presented the characteristic peak of incidence between 2-8 years. Most of the cases were CD10+ pre-B ALL. In 25%, abnormal expression of myeloid antigens was observed. Only 10% of the patients were older than 30 years. Overall survival was better for children. Age and leukocyte count were independent prognostic factors. These data demonstrate that, although there are regional peculiarities, the application of standardized treatments and good supportive care make it possible to achieve results observed in other countries for the same chemotherapy protocols.

  1. Uso e qualidade da água subterrânea para irrigação no semi-árido piauiense Use and quality of groundwater for irrigation in semi-arid region of the Piauí State, Brazil

    Directory of Open Access Journals (Sweden)

    Aderson S. de Andrade Júnior

    2006-12-01

    Full Text Available A região semi-árida do Estado do Piauí é caracterizada por baixa intensidade pluviométrica e elevadas taxas de evapotranspiração. Porém a reserva de água subterrânea torna possível o desenvolvimento de atividades antrópicas, potencializada, na maioria dos casos, pelas características hidrogeológicas do subsolo, que permitem explotações de alta vazão de água com boa qualidade; todavia, alguns poços atingem formações de baixa vazão e qualidade de água com concentração de sais elevada e que, se utilizada para irrigação, pode ocasionar a salinização e a sodificação dos solos. Dessa forma, objetivou-se caracterizar as formas de uso e a qualidade das águas subterrâneas em parte da região semi-árida do Piauí, visando ao seu uso para irrigação. Coletaram-se amostras em 225 poços distribuídos espacialmente, nas quais foram analisadas as seguintes variáveis: condutividade elétrica, sódio, cálcio, magnésio, relação de adsorção de sódio, carbonato, bicarbonato, cloreto e sulfato. Em relação ao uso da água, predominou o uso doméstico (53,61%, seguido pela irrigação (21,17%, com os seguintes métodos: gotejamento (14,03%; microaspersão (3,83%; aspersão convencional (16,11%; canhão e autopropelido (13,66%; superfície (16,76% e outros métodos artesanais (35,52%. Os mapas de classes de risco de uso para irrigação, gerados a partir da qualidade da água subterrânea, evidenciam a ocorrência de sub-áreas com as seguintes classes: nenhuma restrição, moderada restrição e severa restrição.The semi-arid region in the State of Piauí, Brazil, is characterized by low rain fall and high evapotranspiration. However, the groundwater reserves make possible the economic development by underground hydrogeology characteristics, which allow extractions of high water flow with good quality, in most of the cases. However, some wells reached formations that have low discharge and water with high salt

  2. Entre a modernidade e a tradição: a iniciação sexual de adolescentes piauienses universitárias Entre la modernidad y la tradición: la inicialización sexual de los adolescentes de las universidades de Piauí Between modernity and tradition: sexual initiation of university teens originally from Piauí

    Directory of Open Access Journals (Sweden)

    Maria Rosilene Cândido Moreira

    2011-09-01

    Full Text Available A sexualidade, enquanto fenômeno que propicia momentos singulares de descobrimento de si e do outro, permite a realização de práticas permeadas por simbolizações adquiridas na adolescência. Por sofrer influência de fatores genéticos, sociais e culturais, o comportamento sexual adolescente é, por vezes, permeado por situações conflituosas. O presente estudo teve como objetivo desvelar comportamentos sexuais de acadêmicas de Enfermagem da Universidade Federal do Piauí, bem como seus mecanismos de influência, e compreender os aspectos que envolvem a iniciação sexual, considerando os entraves desencadeados pela formação tradicional e aspirações modernizantes. Adotou-se o método etnográfico, aplicando-se entrevistas em profundidade a 12 estudantes, nos meses de outubro e novembro de 2009. As entrevistas relevaram interseção entre comportamento sexual e cultura, permitindo visualizar o poder exercido pelos sistemas de representação social. É importante pontuar sobre a necessidade de mais olhares sobre o assunto por ser emergente nos diversos cenários do existir humano.La sexualidad, como el fenómeno que proporciona momentos singulares de descubrimiento de la propia persona y del otro, permite las prácticas permeadas por símbolos adquiridos en la adolescencia. Por sufrir influencia de factores genéticos, sociales y culturales, el comportamiento sexual adolescente es, muchas veces, permeado por situaciones llenas de conflictos. El presente estudio tuvo como objetivo descubrir comportamientos sexuales de los estudiantes de enfermería de la Universidade Federal do Estado do Piauí, así como sus mecanismos de influencia y comprender los aspectos que envuelven la iniciación sexual, considerando las barreras desencadenadas por la formación tradicional y por las aspiraciones de la modernización. Se adoptó el método etnográfico, aplicándose entrevistas con profundidad a doce estudiantes, en los meses de octubre y

  3. Bosque das mangueiras: projeto paisagístico como ferramenta de reabilitação do entorno da reitoria da Universidade Federal do Piauí

    Directory of Open Access Journals (Sweden)

    Caio Frederico E. Silva

    2007-12-01

    Full Text Available O projeto de reabilitação do “Bosque das Mangueiras” da Reitoria da Universidade Federal do Piauí - UFPI foi desenvolvido como experiência piloto do grupo de estudos do Laboratório Urbano da Paisagem - LUPA e apresenta diagnóstico e pressupostos teóricos para subsidiar intervenções paisagísticas nos espaços livres do campus universitário. Considerando a valorização das áreas verdes e a avaliação bioclimática, integrou-se a este trabalho o projeto de iniciação científica, em andamento, que caracteriza o perfil microclimático da cidade universitária identificando neste espaço livre bons condicionantes de conforto ambiental. A reabilitação do bosque agregará valores ao entorno, proporcionando experiências de contemplação, permanência e contribuindo na legibilidade da Reitoria, símbolo de representatividade.

  4. Determinação de benzeno, tolueno, etilbenzeno e xilenos em gasolina comercializada nos postos do estado do Piauí Determination of benzene, toluene, ethylbenzene and xylenes in commercial gasoline from Piaui state

    Directory of Open Access Journals (Sweden)

    Flamys Lena do N. Silva

    2009-01-01

    Full Text Available Automotive gasoline consists of a complex mixture of flammable and volatile hydrocarbons derived from crude oil with carbon numbers within the range of 4-12 and boiling points range of 30-225 ºC. Its composition varies with the kind of crude oil and the type of refinery process that they undergone. Aromatics hydrocarbons, in particular benzene, toluene, ethylbenzene and isomeric xylenes (BTEX are the toxic group constituents presents. GC-FID was employed to quantify these hydrocarbons in 50 commercial gasoline samples from Piauí state. Statistical analysis techniques, such as PCA and HCA were used to analyze the data. Moreover, several validation parameters were evaluated.

  5. Partos cesáreos no Piauí: tendência e fatores associados no período 2000-2011

    Directory of Open Access Journals (Sweden)

    Alberto Madeiro

    Full Text Available Resumo OBJETIVO: analisar a tendência da proporção de partos cesáreos e fatores associados no Piauí, Brasil, de 2000 a 2011. MÉTODOS: estudo de série temporal e transversal, com dados dos partos hospitalares de primíparas registrados no Sistema de Informações sobre Nascidos Vivos (Sinasc. RESULTADOS: a proporção de partos cesáreos aumentou de 34,4% em 2000 para 52,1% em 2011 (variação percentual anual +4,4; IC95% 3,6;5,1; mulheres brancas (RP=1,72; IC95% 1,63;1,86, com 40 anos ou mais de idade (RP=2,17; IC95% 2,09;2,28, com 12 anos ou mais de estudo (RP=1,86; IC95% 1,77;1,96, que realizaram sete ou mais consultas de pré-natal (RP=2,08; IC95% 1,97;2,18, residentes em municípios com mais de 300 mil habitantes (RP=1,68; IC95% 1,62;1,80 e com índice de desenvolvimento humano mais elevado (RP=1,61; IC95% 1,51;1,73 mostraram maiores proporções de partos cesáreos. CONCLUSÃO: a ocorrência de partos cesáreos foi elevada e mais frequente em mulheres de baixo risco obstétrico.

  6. Soil macrofauna in a Cerrado/Caatinga ecotone under different crops in Southwestern Piauí State, Brazil

    Directory of Open Access Journals (Sweden)

    Djavan Pinheiro Santos

    2017-09-01

    Full Text Available ABSTRACT: The aim of this study was to characterize the soil macrofauna under different crop systems and compare them to the macrofauna under the native vegetation of a Cerrado/Caatinga ecotone in southwestern Piauí State, Brazil. The areas studied included areas under sweetsop cultivation (Annona squamosa L., andropogon grass with three years of use, andropogon grass with six years of use, pivot-irrigated corn, Napier grass, and native vegetation. In each area, soil layers of 0-0.1, 0.1-0.2, and 0.2-0.3m, including the surface litter, were evaluated following the Tropical Soil Biology and Fertility Program (TSBF recommendations. The soil macrofauna from the different land-use systems were identified to the family level, and the mean density of each taxon was calculated for each soil-management type and layer. The structure of the soil macrofauna was negatively altered under the different crops in comparison to the native Cerrado/Caatinga vegetation, with macrofaunal occurrence varying in the different soil layers. A correlation existed between the functional groups and the soil grain-size distribution and moisture. Napier grass cultivation favored greater soil macrofaunal abundance, with a predominance of families belonging to the orders Isoptera and Hymenoptera. Number of soil macrofaunal families under pivot-irrigated corn was more like the number observed with the native vegetation, and corn also had greater family diversity compared to the other crops studied. Therefore, pivot-irrigated corn can reduce the impact of anthropogenic land use on the diversity of soil macrofauna.

  7. The NADPH thioredoxin reductase C functions as an electron donor to 2-Cys peroxiredoxin in a thermophilic cyanobacterium Thermosynechococcus elongatus BP-1

    International Nuclear Information System (INIS)

    Sueoka, Keigo; Yamazaki, Teruaki; Hiyama, Tetsuo; Nakamoto, Hitoshi

    2009-01-01

    An NADPH thioredoxin reductase C was co-purified with a 2-Cys peroxiredoxin by the combination of anion exchange chromatography and electroelution from gel slices after native PAGE from a thermophilic cyanobacterium Thermosynechococcus elongatus as an NAD(P)H oxidase complex induced by oxidative stress. The result provided a strong evidence that the NADPH thioredoxin reductase C interacts with the 2-Cys peroxiredoxin in vivo. An in vitro reconstitution assay with purified recombinant proteins revealed that both proteins were essential for an NADPH-dependent reduction of H 2 O 2 . These results suggest that the reductase transfers the reducing power from NADPH to the peroxiredoxin, which reduces peroxides in the cyanobacterium under oxidative stress. In contrast with other NADPH thioredoxin reductases, the NADPH thioredoxin reductase C contains a thioredoxin-like domain in addition to an NADPH thioredoxin reductase domain in the same polypeptide. Each domain contains a conserved CXYC motif. A point mutation at the CXYC motif in the NADPH thioredoxin reductase domain resulted in loss of the NADPH oxidation activity, while a mutation at the CXYC motif in the thioredoxin-like domain did not affect the electron transfer, indicating that this motif is not essential in the electron transport from NADPH to the 2-Cys peroxiredoxin.

  8. Estudo da infecção e morbidade da doença de Chagas no município de João Costa: Parque Nacional Serra da Capivara, Piauí, Brasil Study of the infection and morbidity of Chagas' disease in municipality of João Costa: National Park Serra da Capivara, Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    José Borges-Pereira

    2002-08-01

    Full Text Available Com o objetivo de investigar aspectos da infecção e morbidade da doença de Chagas no município de João Costa, Piauí, Brasil, realizamos pesquisa sorológica para detectar Ig G anti-T. cruzi em 2.080 moradores através dos testes de imunofluorescência indireta, hemaglutinação indireta e ELISA. Em seguida, 189 pacientes soropositivos e 141 soronegativos foram avaliados pelo exame clínico e eletrocardiograma (ECG, enquanto a parasitemia foi pesquisada em 106 chagásicos pelo xenodiagnóstico indireto e teste da reação polimerásica em cadeia (PCR. A soropositividade total para Ig G anti-T.cruzi foi de 9,8%, com variação de 0,5% em menores de 10 anos a 39,4% em maiores de 59 anos, independentemente do sexo. O percentual de ECG alterados foi de 41,3% entre os chagásicos e de 15,6% entre os não-chagásicos (p In order to investigate aspects of the infection and morbidity of Chagas' disease in the municipality of João Costa, Piauí State, Brazil, we carried out a serological survey to detect anti-Trypanosoma cruzi antibodies in 2,080 individuals, by indirect immunofluorescence, indirect hemagglutination and ELISA. A total of 189 seropositive and 141 seronegative patients were evaluated by anamnesis, physical exam and electrocardiogram (EKG. The parasitaemia of 106 chagasic patients was evaluated by indirect xenodiagnosis and PCR (polymerase chain reaction. The total seropositivity was 9.8%, with intervals of 0.5% in patients younger than 10 years old, and 39.4% among patients older than 59 years old, independently of the sex. The PCR and xenodiagnosis were positive, respectively in 74.5% and 15.1% of the seropositive patients (p < 0.05. The rate of abnormal EKG was 41.3% in chagasic and 15.6% in non-chagasic patients (p < 0.05. In spite of the high prevalence of infection in the investigated population, the low rate of seropositivity among children is indicative of a possible decrease of the active transmission mediated by triatomines

  9. The traditional knowledge about melitophile plants in rural communities in the city of Sigefredo Pacheco, Piauí

    Directory of Open Access Journals (Sweden)

    Ederson de Sousa Martins

    2017-07-01

    Full Text Available The knowledge about plants with melitophile potential is highlighted in the research field, this way; these pieces of information are collected in the rural areas. Thus, ethnobotany, which studies the relation between human groups and plants, is fundamental, because it brings information about the species visited by bees as well as beekeepers and meliponiculturers, helping with environmental protection, especially native tree species and different bee groups. The objective of this study was to conduct an ethnobotanical survey about the knowledge the residents of two rural communities in the city of  Sigrefredo Pacheco, state of Piauí, about melitophile plants. The study was conducted through interviews in every house (41 of the two communities, totalizing 69 interviewees. 31 species were cited, and the family Leguminosae was highlighted.the most cited species were: Croton blanchetianus Baill. (25 and Hyptis suaveolens (L. Poit. (25, in which the native species stood out (77,4%. It is possible to observe that the younger portion had the smaller participation and about gender, it is noticeable that men presented a major number of citation addressing plants than women. The study concludes that the knowledge of melitophile plants is present among the residents of the communities, that they know the profitable practices to the conservation of the melitophile flora, though; they are not overspread in the community. It is necessary to know more and more the knowledge about apicultural flora in rural communities, in order to rescue and value this knowledge, as well as local conservation measures.

  10. Isolation, one-step affinity purification, and characterization of a polyextremotolerant laccase from the halophilic bacterium Aquisalibacillus elongatus and its application in the delignification of sugar beet pulp.

    Science.gov (United States)

    Rezaei, Shahla; Shahverdi, Ahmad Reza; Faramarzi, Mohammad Ali

    2017-04-01

    The aim of the present work was to study the ability of a halophilic bacterial laccase to efficient delignification in extreme conditions. Here, a highly stable extracellular laccase showing ligninolytic activity from halophilic Aquisalibacillus elongatus is described. The laccase production was strongly influenced by NaCl and CuSO 4 and under optimal conditions reached 4.8UmL -1 . The monomeric enzyme of 75kDa was purified by a synthetic affinity column with 68.2% yield and 99.8-fold purification. The enzyme showed some valuable features viz. stability against a wide range of organic solvents, salts, metals, inhibitors, and surfactants and specificity to a wide spectrum of substrates diverse in structure and redox potential. It retained more than 50% of the original activity at 25-75°C and pH 5.0-10.0. Furthermore, the enzyme was found to be effective in the delignification of sugar beet pulp in an ionic liquid that makes it useful for industrial applications. Copyright © 2017 Elsevier Ltd. All rights reserved.

  11. Primeiro registro da utilização medicinal de recursos pesqueiros na cidade de São Félix, Estado da Bahia, Brasil - DOI: 10.4025/actascibiolsci.v27i2.1328 First account on the use of fishing resources as medicines in the city of São Félix, Bahia State, Brazil - DOI: 10.4025/actascibiolsci.v27i2.1328

    Directory of Open Access Journals (Sweden)

    Juliana Nascimento Andrade

    2005-03-01

    Full Text Available Este trabalho discute a utilização medicinal de recursos pesqueiros pelos moradores da cidade de São Félix, Estado da Bahia. O trabalho de campo foi realizado entre maio de 2004 a março de 2005, entrevistando-se 29 indivíduos de ambos os sexos com idades que variaram de 11 a 79 anos. As informações foram obtidas junto a pescadores e a suas famílias por meio de entrevistas abertas e semi-estruturadas. A maior parte das entrevistas foi gravada, usando-se micro-gravador, sempre com o consentimento dos informantes. As transcrições feitas em caderno de campo encontram-se mantidas no Laboratório de Etnobiologia da Universidade Estadual de Feira de Santana, Estado da Bahia. Espécimes de peixes foram coletados, identificados e depositados no Laboratório de Ictiologia da UEFS. Os resultados mostram que, no sistema de classificação etnoictiológico dos pescadores de São Félix, diferentes organismos não sistematicamente relacionados são incluídos no domínio etnozoológico “Peixe”. Por essa razão, sete etnoespécies de peixes foram citadas como recursos medicinais: bagre (Genidens genidens, camarão (Macrobrachium sp., cambotá (Callichthys sp., piau (Leporinus sp., piranha (Serrasalmus branditi, peixe-boi (Trichechus sp. e traíra (Hoplias malabaricus. Esses animais fornecem matérias-primas que são utilizadas na elaboração de medicamentos que visam tratar e/ou curar enfermidades diagnosticadas localmente. O registro escrito da medicina tradicional implica conservação da cultural local, além de permitir que os recursos zooterapêuticos possam ser avaliados quanto à provável existência de compostos biologicamente ativosThis article deals with the medicinal use of fishing resources by the inhabitants of São Félix, Bahia State. Fieldwork was carried out from May 2004 to March 2005 by interviewing 29 individuals of both sexes, whose ages ranged from 11 to 79 years old. Data were obtained by means of open-ended interviews

  12. O desenvolvimento do turismo rural com perspectivas sustentáveis para a comunidade Lagoa da Prata-Parnaíba/Piauí

    Directory of Open Access Journals (Sweden)

    José Maria Alves da Cunha

    2015-07-01

    Full Text Available O trabalho tem como objetivo analisar a possibilidade de desenvolvimento do turismo rural na comunidade Lagoa da Prata, em Parnaíba, Piauí, a partir de uma abordagem sustentável. Além disso, caracterizar a área do objeto de estudo com uma visão holística e estabelecer teoricamente os meios de viabilizar o segmento na localidade. A metodologia empregada partiu da pesquisa bibliográfica (livros e sites, documental e de campo, com aplicação de questionários fechados e a observação simples. A pesquisa revelou singularidades e potencialidades na região quanto à implantação do turismo no espaço rural, com destaque para a população local que se mostrou disposta a participar da atividade, condição que favorece o processo de implementação do turismo em áreas rurais. Assim, conclui-se que o planejamento estratégico e participativo deve existir antes do início da exploração turística, a fim de priorizar a anulação de possíveis impactos negativos sobre a comunidade.

  13. Manifestações cutâneo-mucosas da coccidioidomicose: estudo de trinta casos procedentes dos estados do Piauí e Maranhão Skin and mucous membrane manifestations of coccidioidomycosis: a study of thirty cases in the Brazilian states of Piauí and Maranhão

    Directory of Open Access Journals (Sweden)

    Antônio de Deus Filho

    2010-02-01

    Full Text Available FUNDAMENTOS: A coccidioidomicose é micose sistêmica usualmente manifesta como infecção benigna de resolução espontânea; porém, uma pequena proporção dos infectados desenvolve quadros progressivos potencialmente fatais, podendo atingir a pele com lesões pleomórficas disseminadas. OBJETIVOS: Identificar e descrever as manifestações cutâneo-mucosas da coccidioidomicose, as ocupações de risco relacionadas à doença e o quadro clínico associado. MÉTODOS: Estudo realizado entre os anos 2003 e 2006 em 30 pacientes portadores de coccidioidomicose provenientes dos estados do Piauí e Maranhão e diagnosticados por exame microscópico direto, cultivo do escarro ou sorologia de triagem de imunodifusão dupla em gel de ágar, aliados à anamnese e exame físico. RESULTADOS: Identificaram-se lesões extrapulmonares em 13 casos (43,3%, com predomínio de manifestações dermatológicas de hipersensibilidade: eritema nodoso (26,6%, exantema com lesões eritemato-escamosas (26,6% e eritema multiforme (23,3%, além de úlceras de língua (13,3% e lábio (6,6% e abscesso subcutâneo (3,3%. Tais manifestações foram observadas na fase aguda da doença. CONCLUSÕES: As manifestações cutâneas associadas à infecção respiratória aguda fortalecem a hipótese diagnóstica desta doença, especialmente, em caçadores de tatus ou pessoas expostas à escavação do solo.BACKGROUND: Coccidioidomycosis is a systemic mycosis that usually presents as a benign infection. Patients generally recover spontaneously; however, a small proportion of infected individuals develop progressive complications that may affect the skin in the form of disseminated pleomorphic lesions and may become fatal. OBJECTIVES: To identify and describe skin and mucous membrane manifestations of coccidioidomycosis, to identify occupational hazards associated with the disease and to determine its associated clinical presentation. METHODS: A study conducted between 2003 and 2006

  14. Food insecurity and socioeconomic, food and nutrition profile of schoolchildren living in urban and rural areas of Picos, Piauí

    Directory of Open Access Journals (Sweden)

    Jailane de Souza Aquino

    2014-08-01

    Full Text Available Objective: This study aimed to determine the prevalence of food insecurity among schoolchildren living in urban and rural areas of Picos, Piauí associated with the socioeconomic profile of families and their food intake and nutritional status. Methods: Study participants were families with children aged 7-10 years enrolled in municipal schools, totaling 342 families/schoolchildren. The study was conducted at school facilities through interviews with mothers - or guardians - using a questionnaire based on the Brazilian Food Insecurity Scale and socioeconomic variables and food frequency questionnaire. The nutritional status of children was assessed using the following indexes: weight/age, height/age and body mass index/age. Results: The prevalence of food insecurity was high and similar for rural and urban areas, 84.3% and 83.3%, respectively. In general, lower income and consumption of untreated water was associated with greater frequency of food insecurity (p≤0.01. In urban areas, higher percentage of food insecurity was associated to lower educational levels (p≤0.05. Dietary intake and nutritional status of schoolchildren were not associated with food insecurity condition of families. Conclusion: The percentage of families at food insecurity, as well as the food consumption and nutritional status of schoolchildren were similar between urban and rural areas, characterized as a homogeneous population in terms of socioeconomic conditions.

  15. Confiabilidade e validade das Declarações de Óbito por câncer de boca no Município de Teresina, Piauí, Brasil, no período de 2004 e 2005 Reliability and validity of death certificates specifying oral cancer as cause of death in Teresina, Piauí State, Brazil, 2004-2005

    Directory of Open Access Journals (Sweden)

    Luciana Tolstenko Nogueira

    2009-02-01

    Full Text Available A política de saúde brasileira depende da precisão dos dados contidos no sistema de informação em saúde. Com objetivo de avaliar a confiabilidade e validade da causa básica de morte por uma neoplasia específica, no Município de Teresina, Piauí, Brasil, foram utilizadas todas as Declarações de Óbito (DO que possuíam como causa básica de morte o câncer de boca nos anos de 2004 e 2005, contabilizando um total de 23 DO. Elas foram submetidas à nova codificação da causa básica mediante utilização de formulário direcionado à coleta de dados clínicos e de exames complementares para a confirmação do diagnóstico nos prontuários médicos. O diagnóstico foi confirmado pelo exame histopatológico e história clínica. Observou-se uma concordância simples de 91,3% e coeficiente kappa de 0,84. O valor preditivo positivo correspondeu a 90,9%. Assim, pode-se afirmar que as referidas estatísticas de mortalidade são válidas e confiáveis. Este estudo teve como limitação possíveis sub-registros de casos que tiveram como causa básica de morte a referida patologia, visto que tais dados não constam no sistema de informação em mortalidade de Teresina.Brazilian health policy depends on the accuracy of data in the health information system. This study aimed to assess the reliability and validity of data on underlying cause of death due to a specific neoplasm in the Municipality of Teresina, Piauí State, Brazil, based on all the death certificates from 2004 and 2005 that reported oral cancer as the underlying cause of death (total of 23 death certificates. The death certificates were recoded for underlying cause of death by using a form targeted at collecting clinical and laboratory data to confirm the medical diagnosis on patient charts. Diagnosis was confirmed by histopathologic examination and clinical history. Simple agreement was 91.3%, kappa coefficient 0.84, and positive predictive value 90.9%. Based on the findings, the

  16. Evapotranspiration and crop coefficient of drip irrigated watermelon in Piaui coastline, Brazil Evapotranspiração e coeficiente de cultivo da melancia irrigada por gotejamento no litoral do Piauí

    Directory of Open Access Journals (Sweden)

    Edson A. Bastos

    2012-06-01

    Full Text Available The knowledge of the evapotranspiration (ETc and crop coefficient (Kc is fundamental to plan and to manage the irrigation of any crop. The aim of this study was to determine the daily and hourly evapotranspiration of drip irrigated watermelon (Citrullus Lanatus, var. Crimson Sweet and crop coefficient (Kc in each crop development phase. The experiment was carried out in an experimental area of 1.27 ha of Embrapa Mid-North, localized in Parnaíba (02°54'S, 41°47'W and 46 m above of sea, State of Piauí, Brazil, from September to November, 2006. Electronic weighing lysimeters of 1.5 m x 1.5 m wide and long and 1.0 m deep were used to obtain the evapotranspiration. The plants were drip irrigated with a lateral row per plant row and drippers spaced 0.5 m from each other. The reference evapotranspiration (ETo was estimated using the Penman-Monteith equation from the climatic data obtained by electronic sensors. The total evapotranspiration during the watermelon crop cycle cultivated in the state of Piauí was 233.87 mm, with mean values of 3.7 mm day-1, minimum of 1.18 and maximum of 8.14 mm day-1. The Kc of the drip irrigated watermelon was 0.18 in the initial stage of crop growth; 0.18 to 1.3, in crop development stage; 1.3 in the intermediate stage and 0.43 in the final stage.O conhecimento da evapotranspiração e do coeficiente de cultivo (Kc é fundamental para dimensionar e manejar a irrigação de qualquer cultura. O objetivo deste trabalho foi determinar a evapotranspiração (ETc diária e horária da melancia (Citrullus lanatus Schrad, var. Crimson Sweet irrigada por gotejamento e o Kc em cada fase de desenvolvimento da cultura. O estudo foi conduzido em uma área experimental de 1,27 ha da Embrapa Meio-Norte, localizada em Parnaíba - PI (02° 54'S, 41° 47'W e 46 m de altitude, no período de setembro a novembro de 2006. Utilizaram-se quatro lisímetros de pesagem eletrônica de 1,5 m x 1,5 m de largura e comprimento com 1,0 m de

  17. Red and yellow ochres from the archaeological site Pedra do Cantagalo I, in Piripiri, Piauí, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Duarte Cavalcante, Luis Carlos, E-mail: cavalcanteufpi@yahoo.com.br; Sousa Bezerra da Silva, Heralda Kelis [Federal University of Piauí (UFPI), Center of Natural Sciences (Brazil); Fabris, José Domingos [Federal University of Minas Gerais (UFMG), Department of Chemistry – ICEx (Brazil); Ardisson, José Domingos [Center for the Development of the Nuclear Technology (CDTN) (Brazil)

    2017-11-15

    The archaeological site Pedra do Cantagalo I is a sandstone shelter displaying rupestrian inscriptions. It is located in the rural area of the municipality of Piripiri, in the northern region of the Piauí state, Brazil. The site was found as being originally decorated with more than 1,900 prehistoric rupestrian paintings, along with engravings, lithics, ceramic fragments and mineral pigments forming reddish and yellowish ochres. Materials of these ochres, collected from recent excavations in this archaeological site, were analyzed by energy dispersive X-ray fluorescence (EDXRF); backscattering and transmission {sup 57}Fe-Mössbauer spectroscopy at 298 K and 25 K and powder X-ray diffraction (XRD), in an effort to assess the chemical and mineralogical characteristics of these sources of pigments that composed the ancient paint materials of the site. The iron contents (expressed as Fe {sub 2}O{sub 3}) for the reddish ochres were found to range from ∼60 to ∼68 mass%; for the yellowish ochres the corresponding content was ∼34 mass%, as determined by EDXRF. From the Mössbauer spectra for these red ochre samples, hematite (αFe {sub 2}O{sub 3}) or a mixture of hematite and goethite (αFeOOH) were identified. Actually, the spectra at room temperature for the yellow ochres are rather complex, as it is usual for most soil clay materials. At least part of the intense central doublet was assumed to be from superparamagnetic iron oxides in very small particles. The Mössbauer patterns at 25 K allowed confirming this assumption, as the superparamagnetic relaxation effects were virtually suppressed; the spectral contributions due to goethite could be thus more easily separated.

  18. Red and yellow ochres from the archaeological site Pedra do Cantagalo I, in Piripiri, Piauí, Brazil

    Science.gov (United States)

    Duarte Cavalcante, Luis Carlos; da Silva, Heralda Kelis Sousa Bezerra; Fabris, José Domingos; Ardisson, José Domingos

    2017-11-01

    The archaeological site Pedra do Cantagalo I is a sandstone shelter displaying rupestrian inscriptions. It is located in the rural area of the municipality of Piripiri, in the northern region of the Piauí state, Brazil. The site was found as being originally decorated with more than 1,900 prehistoric rupestrian paintings, along with engravings, lithics, ceramic fragments and mineral pigments forming reddish and yellowish ochres. Materials of these ochres, collected from recent excavations in this archaeological site, were analyzed by energy dispersive X-ray fluorescence (EDXRF); backscattering and transmission 57Fe-Mössbauer spectroscopy at 298 K and 25 K and powder X-ray diffraction (XRD), in an effort to assess the chemical and mineralogical characteristics of these sources of pigments that composed the ancient paint materials of the site. The iron contents (expressed as Fe 2 O 3) for the reddish ochres were found to range from ˜60 to ˜68 mass%; for the yellowish ochres the corresponding content was ˜34 mass%, as determined by EDXRF. From the Mössbauer spectra for these red ochre samples, hematite ( αFe 2 O 3) or a mixture of hematite and goethite ( αFeOOH) were identified. Actually, the spectra at room temperature for the yellow ochres are rather complex, as it is usual for most soil clay materials. At least part of the intense central doublet was assumed to be from superparamagnetic iron oxides in very small particles. The Mössbauer patterns at 25 K allowed confirming this assumption, as the superparamagnetic relaxation effects were virtually suppressed; the spectral contributions due to goethite could be thus more easily separated.

  19. Gene banking of the neotropical fish Leporinus obtusidens (Valenciennes, 1836): a protocol to freeze its sperm in the field.

    Science.gov (United States)

    Taitson, P F; Chami, E; Godinho, H P

    2008-05-01

    A practical sperm cryopreservation protocol using a dry-shipper and a diluent of simple composition is described for the neotropical fish Leporinus obtusidens (Valenciennes, 1836). The cooling rate of the dry-shipper and its period of useful time, established under laboratory conditions, were respectively 25.7-30.8 degrees C/min (between 0 and -60 degrees C) and 9 days after charging. Sperm donors were selected on the basis of their hyperemic genital papilla and the ability to ooze milt under gentle manual pressure, during the reproductive months of November to January. Milt volume (1.3+/-0.3 mL; n=9 fish), fresh sperm motility rate (93.3+/-2.5%; n=6 fish), and sperm concentration (10.9+/-3.0 x 10(9)spermatozoa/mL of milt) were obtained. The sperm cryopreservation experiments were conducted with the following cryoprotectants (all at 10%, before mixing with milt): dimethyl sulphoxide (DMSO; n=10 fish), methanol (n=6 fish), propanediol (n=6 fish) and ethylene glycol (n=5 fish). Glucose (5%) and hen's egg yolk (10%) made up the diluents containing DMSO, ethylene glycol or propanediol. Milk powder (10%) replaced hen's egg yolk in the diluent containing methanol. Distilled water (up to 100%) completed the diluent solutions. Milt freezing (in 0.5-mL straws) was performed in the dry-shipper after 1:5 (milt:diluent) dilution. Thawed sperm cryopreserved in DMSO-containing diluent and activated by 119 mM NaHCO(3) gave the highest motility rate (62+/-14%). The fertilizing capacity of L. obtusidens sperm was tested using the combination of DMSO-containing diluent as the cryoprotectant and 119 mM NaHCO(3) as the activating solution. Oocytes were obtained from artificial spawning and fertilized with different proportions of spermatozoa. The greatest rate of fertilization (74%) occurred when the ratio of about 112,000 motile spermatozoa:oocyte was used. Thus, a protocol to freeze L. obtusidens sperm can be elaborated as follows. Milt (fish(-1)) was readily available only in

  20. Cantar e seguir a canção ou para não dizer que não esgrimi a palavra: guerra de sentidos e estética da contestação nas canções de protesto em Teresina (1975-1985 * War of senses and aesthetic of refusal in the protest songs in Teresina (1975-1985

    Directory of Open Access Journals (Sweden)

    PAULO RICARDO MUNIZ SILVA

    2014-02-01

    Full Text Available Resumo: A música de protesto, categoria já consolidada no âmbito dos estudos sobre música brasileira, marcou a produção musical em Teresina, a capital do Estado do Piauí, durante a década de 1970. Neste contexto, o Festival Estudantil de Música do Piauí (FEMPI, e o Festival do Parque Piauí (FESPAPI, ambos ocorridos entre as décadas de 1970 e 1980, tiveram importância fundamental para a constituição deste quadro histórico. Responsáveis pela popularização de expressivos nomes da arte piauiense, tais como Geraldo Brito, Zé Rodrigues, João Berchmans, Achylles Costa Júnior e Williams Costa, estes festivais acabariam por gerar uma cultura musical de protesto, universo no interior do qual se destacam músicas como Biotema, Arames e Fuzis, Medusa e Represália. O propósito do presente artigo é, apoiado na análise das letras das músicas e, bem como, com o recurso à História Oral, re-conhecer este período e este ambiente da história da música piauiense.Palavras-chave: Música de protesto – Festivais – Piauí. Abstract: The protest song, a consolidated category of studies on Brazilian music, marked the music production in Teresina, the capital of Piauí State, during the 1970s. In this context, the “Festival Estudantil de Música do Piauí” [Piauí Student Music Festival] (FEMPI, and the “Festival do Parque Piauí” [Piauí Park Festival] (FESPAPI, both of which occurred between the 1970’s and 1980’s, were crucial for the formation of this historical framework. Expressive names in the Piauí art scene, such as Geraldo Brito, Zé Rodrigues, João Berchmans, Achylles Costa Júnior and Williams Costa, were popularized by these festivals that would eventually generate a musical culture of protest, within a universe in which stands out songs like “Biotema”, “Arames e Fuzis”, “Medusa” and “Represália”. The aim of this article is to re-discover this environment and this period of piauiense music

  1. Directory of Open Access Journals (Sweden)

    José L. O. Birindelli

    2013-03-01

    Full Text Available Two new species of Leporinus are described from coastal rivers of southern Bahia, Brazil. One of the new species has a bright red blotch immediately dorsal to the pectoral-fin origin in life, three dark blotches along the lateral line that distinctly increase in size posteriorly, and dark longitudinal lines between scale rows on the side of body. The second new species possesses a single broad dark midlateral stripe, encompassing one or two scale rows of depth on the body and centered on the scale row below the lateral line, a dark adipose fin, and a conspicuous dark blotch on the caudal peduncle. The first new species is known only from the rio de Contas and the second from the rio das Almas and rio Jiquiriçá. In addition, Leporinus melanopleura is redescribed based on a designated lectotype and additional specimens collected in the rio Una. Leporinus melanopleura has a single broad dark midlateral stripe, encompassing one or two scale rows of depth on the body, centered on the scale row below lateral line, a hyaline adipose fin (red in life, and an inconspicuous dark blotch on the caudal peduncle.Duas espécies novas de Leporinus são descritas com base em exemplares de rios costeiros do sudeste da Bahia, Brasil. Uma das espécies novas possui uma mancha vermelho-viva imediatamente dorsal à origem da nadadeira peitoral em vida, três manchas escuras sobre a linha lateral que aumentam de tamanho para trás, e linhas escuras longitudinais entre as séries de escamas na lateral do corpo. A segunda espécie nova apresenta uma única faixa escura sobre o corpo, com altura de uma ou duas fileiras de escamas e centrada na série de escamas da linha lateral, nadadeira adiposa escura, e uma conspícua mancha escura sobre o pedúnculo caudal. A primeira espécie nova é conhecida somente do rio de Contas e a segunda dos rios das Almas e Jiquiriçá. Além disso, Leporinus melanopleura é redescrita com base no lectótipo, designado no presente

  2. Saúde infantil em áreas pobres: resultados de um estudo de base populacional nos municípios de Caracol, Piauí, e Garrafão do Norte, Pará, Brasil Child health in poor areas: findings from a population-based study in Caracol, Piauí, and Garrafão do Norte, Pará, Brazil

    Directory of Open Access Journals (Sweden)

    Juraci A. Cesar

    2009-04-01

    Full Text Available Este estudo teve por objetivo conhecer indicadores básicos de saúde infantil nos municípios de Caracol, Piauí, e Garrafão do Norte, Pará, Brasil. Mediante visitas domiciliares por amostragem sistemática, aplicaram-se questionários às mães de menores de cinco anos, investigando nível sócio-econômico, condições de habitação e saneamento da família, características demográficas, padrão de morbidade, de utilização de serviços de saúde e de assistência recebida durante a gestação e o parto. A análise consistiu da comparação de indicadores entre os dois municípios e foi avaliada através dos testes t e qui-quadrado. Das 1.728 crianças estudadas, 60% de suas famílias possuíam renda inferior a um salário mínimo mensal; 41% não contavam com qualquer tipo de sanitário; 10% de suas mães não realizaram uma única consulta de pré-natal; 30% nasceram no domicilio; 30% foram levadas à consulta médica nos últimos três meses; 20% apresentavam déficit > 2 desvios-padrão para o indicador altura/idade. Todos os indicadores estudados foram ruins em ambos os municípios, sobretudo em Garrafão do Norte. Aumentar a oferta de cuidados em saúde e melhorar as condições de habitação e saneamento deveriam ser prioridades nessas localidades.The aim of this study was to evaluate child health indicators in the municipalities (counties of Caracol, Piauí State, and Garrafão do Norte, Pará State, Brazil. Through household visits using systematic sampling, previously trained interviewers applied a standard questionnaire to mothers of under-five children, investigating socioeconomic status, housing and environmental sanitation, demographic characteristics, disease patterns, and prenatal and childbirth care. The analysis used the t-test and chi-square test to compare indicators between the two municipalities. Of the 1,728 children studied, 60% were from families with incomes less than one monthly minimum wage (approximately U

  3. The herpetofauna of the Estação Ecológica de Uruçuí-Una, state of Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Francisco Dal Vechio

    2013-01-01

    Full Text Available This work was carried out with the main objective of sampling the herpetofauna of a Cerrado site in the state of Piauí, Brazil, that is influenced by neighboring biomes and one of the least known regions of the domain. The herpetofauna of the different habitats present at Estação Ecológica de Uruçuí-Una (EEUU was sampled intensively during three campaigns (two during the wet season and one during the dry season. We recorded 90 species, 64 reptiles and 26 anurans, a high local richness when compared to other well-sampled localities of the Cerrado. The rarefaction curve for both anurans and lizards shows that the observed richness is close to real and the richness estimators indicate that undetected species should be added with higher sampling effort. Analysis of co-occurrence shows that the species are not randomly distributed in the landscape, indicating that they use preferentially particular types of habitat. Despite being located in a transitional area and influenced by neighboring biomes, the cluster analysis of similarity suggests that the herpetofauna of the EEUU is typical of the Cerrado. Thereby, the results of this study indicate that the EEUU presents a rich herpetofauna that plays an important role in the conservation of a regional faunistic pool.

  4. Eco-eficiência na produção de cera de Carnaúba no município de Campo Maior, Piauí, 2004

    Directory of Open Access Journals (Sweden)

    Francisco Prancacio Araújo de Carvalho

    2008-06-01

    Full Text Available A Copernicia prunifera (Miller H.E. Moore ou carnaúba gera um material sobre as folhas usado na fabricação de cera, matéria-prima de inúmeros produtos industriais. O Brasil é o único produtor de cera de carnaúba e o estado do Piauí, um importante influente. Neste, as condições naturais do município de Campo Maior favorecem a incidência da carnaubeira e sua tradição histórica na produção de cera tornaram-no um pólo regional. O objetivo geral é analisar, na produção de cera de carnaúba, os elementos e indicadores de eco-eficiência - associação de eficiência econômica com baixo impacto ambiental -, os específicos são: avaliar qualitativamente o consumo de materiais e de energia, emissão de substâncias tóxicas, existência de reciclagem de materiais e uso de recursos renováveis; construir e analisar indicadores de ecoeficiência. As informações e dados originaram-se de pesquisa direta em indústria de cera que representasse o padrão técnico e a participação no mercado no estado. Os resultados mostram que a produção industrial de cera impacta o meio ambiente com uso intenso de água, utilização da lenha e diesel como fonte energética, consumo de produtos químicos e emissão de poluentes, entretanto, atende importantes elementos de eco-eficiência como a reutilização de materiais e consumo de materiais renováveis.The Copernicia prunifera (Miller H.E. Moore or "carnauba" generates a material from the leaves used in the wax production, raw material of countless industrial products. Brazil is the only producer of carnauba wax and the state of Piauí, an important influential. In this, the natural conditions of the district of Campo Maior favor the incidence of the carnauba and its historical tradition in the wax production, turned it a regional pole. The general goal is to analyze, in the carnauba wax production, the elements and the eco-efficiency indicators - economical efficiency associated with low

  5. Faunistic analysis of the insects associated to sugar-cane production in transition area amazon rain forest – cerrado (palm jungle União region, state of Piauí – Brazil Análise faunística de insetos associados à cultura da cana-de-açúcar, em área de transição floresta amazônica – cerrado (mata de cocal, no município de União – Piauí – Brasil

    Directory of Open Access Journals (Sweden)

    Paulo Roberto Ramalho Silva

    2010-02-01

    Full Text Available The objective of the project was to study the entomofauna associated to the sugar-cane commercial cultivation in União region, state of Piauí, Brazil. The insects were collected with light traps, model “Luiz de Queiroz” supplied with fluorescent lamps, ultraviolet, model F15 T8 BL posicioned in a height of 1,5m, at the geographic coordinates 21° 22’ 30” S and 48° 13’ 0” W. The traps were turned on at 18:00 and turned of 6:00 of the day after, from December, 2006 to December, 2007, coming down 52 samples. Weekly 287 species that were evaluated by using faunistic analysis of dominance, frequency, constancy and abundance, with 30 species distinguishing in these indexes. Astaena sp with 3.313 specimen collected in 44 from the 52 samples, Cyclocephala sp2 with 2415 collected in 51 from the 52 samples and Linepithema humile with 2299 in 18 samples.O presente trabalho teve como objetivo estudar a entomofauna associada ao cultivo comercial de cana-de-açúcar, no município de União, Estado do Piauí. Os insetos foram coletados com armadilha luminosa, modelo “Luiz de Queiroz”, provida de lâmpada F 15 T 8 BL. As coletas foram realizadas uma vez por semana, com a armadilha sendo ligada às 18:00 horas e desligada às 6:00 horas do dia seguinte, no período de dezembro de 2006 a dezembro de 2007, totalizando 52 coletas. Foram coletadas 287 espécies, submetidas à análise faunística de dominância, freqüência, abundância e constância, com 30 espécies se sobressaindo nestes índices. Astaena sp, apresentando 3.313 indivíduos, coletados em 44 das 52 coletas, Cyclocephala sp2 com 2.415 coletados em 51 das 52 e Linepithema humile com 2.299 presentes em 18 coletas.

  6. Projeto de Mecanismo de Desenvolvimento Limpo: Um Estudo de Caso na Empresa de Energia Eólica do Estado do Piauí

    Directory of Open Access Journals (Sweden)

    Henrique César Melo Ribeiro

    2012-08-01

    Full Text Available In recent decades the problems with environmental accidents has become a concern due to the consequences it generates on a global scale. The concept of sustainability had as a starting point the ECO-92 Conference, which prompted the search for development models with social and environmental prevalence. The low-carbon economics appears as an option to stop the growth of the Greenhouse Gases Emissions. The third strategy of the Kyoto Protocol refers to the Clean Development Mechanism (CDM that allows countries and organizations to develop projects aimed at sustainable development. According to this situation, the paper aims to investigate how the use of clean energy, such as wind, contributes to the promotion of local sustainability. It establishes, as objective, the investigation of the wind farm installed in Piauí regarding the meet of the Kyoto Protocol requirement. As to its methodological aspects, this is a bibliographical, documentary and case study research. The literature review allowed us to deepen theoretical assumptions related to the topic. The analysis of documents obtained in the case study has shown the state's participation in clean energy generation and use of CDM strategies in the enterprise. The research reveals that the studied wind farm meets the guidelines contained in the Kyoto Protocol and makes use of CDM strategies. It is still verified the contributive work to local sustainability through the concern for education, environmental management and support on social projects in areas related to children, education and environment.

  7. Development of a high-frequency in vivo transposon mutagenesis system for Synechocystis sp. PCC 6803 and Synechococcus elongatus PCC 7942.

    Science.gov (United States)

    Watabe, Kazuyuki; Mimuro, Mamoru; Tsuchiya, Tohru

    2014-11-01

    Synechocystis sp. PCC 6803 (Synechocystis) is the first sequenced photosynthetic organism and has two advantages: natural transformation and light-activated heterotrophic growth. Such characteristics have mainly promoted reverse genetic analysis in this organism, however, to date approximately 50% of genes are still annotated as 'unknown protein' or 'hypothetical protein'. Therefore, forward genetic analysis is required for the identification of significant genes responsible for photosynthesis and other physiological phenomena among the genes of unknown function. The in vivo transposon mutagenesis system is one of the major methods for random mutagenesis. However, present in vivo transposon mutagenesis systems for cyanobacteria face problems such as relatively low frequency of transposition and repeated transposition in the host cells. In this study, we constructed vectors based on a mini-Tn5-derived vector that was designed to prevent repeated transposition. Our vectors carry a hyperactive transposase and optimized recognition sequence of transposase, which were reported to enhance frequency of transposition. Using the vector, we succeeded in highly frequent transposition (9×10(-3) per recipient cell) in Synechocystis. Transposon insertion sites of 10 randomly selected mutants indicated that the insertion sites spread throughout the genome with low sequence dependency. Furthermore, one of the 10 mutants exhibited the slow-growing phenotype, and the mutant was functionally complemented by using our expression vector. Our system also worked with another model cyanobacterium, Synechococcus elongatus PCC 7942, with high frequency. These results indicate that the developed system can be applied to the forward genetic analysis of a broad range of cyanobacteria. © The Author 2014. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  8. Educação para o turismo: o programa “Mais cultura nas escolas” em uma escola de Parnaíba/Piauí

    Directory of Open Access Journals (Sweden)

    André Riani Costa Perinotto

    2016-07-01

    Full Text Available This job wanted to reflect the role of the Education for Tourism, having the Heritage Education as a starting point for the tourist reflections about doing in the city of Parnaíba-Piauí. The goal to analyze consist as the Heritage Education has helped the students of Municipal School Borges Machado to know and value to the local culture and therefore education for tourism, in this sense adopted a line of contents about Heritage Education, the project More Culture in Schools, about tourism, education and hospitality. The delineation of the research was characterized as a case study, so the research was classified as exploratory and descriptive, it was used bibliographical research and documental. For the collection of the data using one of the interview not standardized and application of questionnaire. Given the results can be realized the Heritage Education has contributed to validate the experience and knowledge of the reality of the people involved, and with that creates a sense of belonging and affectivity with your capital actives. However you noticed the limitations existing in the project, so help is believed that the education for tourism can beyond adding values in relation to the exercise of citizenship, as well as her to wake from a sense of belonging to the local community, what you watch on the preservation of your traditions.

  9. Effect of cyclodextrin-loaded cholesterol conjugates on plasma membrane viability of Piau swine breed frozen/thawed spermatozoa.

    Science.gov (United States)

    Pinho, R O; Lima, D M A; Shiomi, H H; Siqueira, J B; Silveira, C O; Faria, V R; Lopes, P S; Guimarães, S E F; Guimarães, J D

    2016-08-01

    The objective of this study was to investigate the effect of cyclodextrin-loaded cholesterol conjugates addition to freezing extenders on plasma membrane viability of frozen-thawed spermatozoa of the Piau swine breed. Twenty semen samples were used from five males. The freezing extender was based on lactose-egg yolk extender, added to 2% glycerol, 3% dimethylacetamide. The addition of cyclodextrin-loaded cholesterol conjugates was performed after centrifugation, when semen was diluted with the cooling extender. Four groups were subjected to the following treatment: without addition (group 1); 1.5 mg of cyclodextrin-loaded cholesterol/120 × 10(6) sperm (group 2); 1.5 mg of cyclodextrin-loaded cholestanol/120 × 10(6) sperm (group 3); 1.5 mg of cyclodextrin-loaded desmosterol/120 × 10(6) sperm (group 4). To check post-thawing sperm quality sperm motility and sperm morphology evaluation were used. Additionally, to check sperm viability the hypoosmotic swelling test, supravital staining, and fluorescent assay were used. The mean values recorded for total sperm motility of semen immediately after thawing were 54.5 ± 5.8, 55.5 ± 5.3, 53.7 ± 6.7, and 52.5 ± 6.6% respectively for groups one to four, without difference between themselves (p > 0.05). Regarding fluorescent assay the results were 28.3 ± 13.2, 26.9 ± 12.2, 22.2 ± 11.4, and 32.0 ± 15.3% respectively for groups one to four, also without difference between groups (p > 0,05). Similarly, complementary tests for evaluating the integrity and functionality of the plasma membrane showed no difference between treatments (p > 0.05). In conclusion, use of cyclodextrin-loaded cholesterol conjugates added to the plasma membrane of sperm did not demonstrate any additive effect on increasing and/or maintaining sperm motility. Copyright © 2016 Elsevier Inc. All rights reserved.

  10. Diversidade e uso de recursos medicinais do carrasco na APA da Serra da Ibiapaba, Piauí, Nordeste do Brasil Diversity and use of medicinal resources of "carrasco" in the EPA of Serra da Ibiapaba, Piauí, Northeast Brazil

    Directory of Open Access Journals (Sweden)

    E.M.F. Chaves

    2012-01-01

    Full Text Available O presente estudo foi realizado na Área de Proteção Ambiental da Serra da Ibiapaba no município de Cocal, Piauí. Objetivou-se realizar o levantamento das plantas utilizadas pela comunidade, das partes usadas, das indicações, das formas de uso e de administração dessas plantas. Foram realizadas 80 entrevistas com 100% dos moradores de notório saber, residentes no município que utilizavam e/ou comercializavam plantas de uso medicinal. Para definição da amostra utilizou-se o método de bola de neve. Em incursões guiadas por membros da comunidade, foram coletadas as etnoespécies citadas. Após essa etapa, as espécies foram identificadas em laboratório e calculado o Fator de Consenso dos Informantes (FCI para cada categoria de doença. O material foi incorporado ao acervo do Herbário Graziela Barroso (TEPB/UFPI. Foram identificadas 76 espécies, distribuídas em 61 gêneros e 36 famílias. Sobresairam-se Leguminosae com 22 espécies (28,9%, seguida por Euphorbiaceae com 6 (7,8%, e Solanaceae 4 (5,2%. Os gêneros Croton L. e Hymenaea L. obtiveram o maior destaque, somando 8 (10,5% do total de espécies. As espécies mais presentes nas indicações de uso foram Ximenia americana com 14 (5,9%, Tabebuia impetiginosa com 9 (3,9% e Anacardium occidentale com 7 (2,9%. Observou-se que 80,5% dos entrevistados tinham mais de 50 anos e residiam no município a mais de 20 anos, sendo que 70% possuíam apenas ensino fundamental incompleto e 20 % eram analfabetos. Houve maior consenso entre os informantes para tratamento das doenças do sistema respiratório (0,66 e do aparelho digestório (0,65. A maioria das indicações de usos 81 (34,17% relatados para 28 (36,8% das espécies visavam curar males do sistema respiratório, tais como asma, bronquite, gripe, inflamação na garganta, pneumonia e sinusite. Para o preparo dos remédios, as partes mais utilizadas foram as cascas (30,5%, as folhas (29,4% e as raízes (12,6%. As preparações mais

  11. Dengue virus 2 American-Asian genotype identified during the 2006/2007 outbreak in Piauí, Brazil reveals a Caribbean route of introduction and dissemination of dengue virus in Brazil.

    Directory of Open Access Journals (Sweden)

    Leandra Barcelos Figueiredo

    Full Text Available Dengue virus (DENV is the most widespread arthropod-borne virus, and the number and severity of outbreaks has increased worldwide in recent decades. Dengue is caused by DENV-1, DENV- 2, DENV-3 and DENV-4 which are genetically distant. The species has been subdivided into genotypes based on phylogenetic studies. DENV-2, which was isolated from dengue fever patients during an outbreak in Piaui, Brazil in 2006/2007 was analyzed by sequencing the envelope (E gene. The results indicated a high similarity among the isolated viruses, as well as to other DENV-2 from Brazil, Central America and South America. A phylogenetic and phylogeographic analysis based on DENV-2E gene sequences revealed that these viruses are grouped together with viruses of the American-Asian genotype in two distinct lineages. Our results demonstrate the co-circulation of two American-Asian genotype lineages in northeast Brazil. Moreover, we reveal that DENV-2 lineage 2 was detected in Piauí before it disseminated to other Brazilian states and South American countries, indicating the existence of a new dissemination route that has not been previously described.

  12. Prevalência de deficiência de vitamina A e fatores associados em pré-escolares de Teresina, Piauí, Brasil

    Directory of Open Access Journals (Sweden)

    Paiva Adriana de Azevedo

    2006-01-01

    Full Text Available A deficiência de vitamina A constitui um problema de saúde pública no Nordeste brasileiro. O objetivo deste estudo foi determinar a prevalência da deficiência de vitamina A e os fatores associados em pré-escolares de Teresina, Piauí, Brasil. Os níveis de retinol sérico foram determinados por HPLC, e foram investigadas as características sócio-econômicas e demográficas de 631 crianças com idade de 36 a 83 meses. Investigou-se a associação entre os níveis de retinol e as variáveis de interesse por análise de regressão linear uni e multivariada. O nível médio de retinol foi de 1,21mmol/L (IC95%: 1,17-1,25µmol/L, independente do sexo (p = 0,259. A hipovitaminose A (retinol < 0,69µmol/L foi observada em 15,4% das crianças (IC95%: 12,7-18,4, com tendência à diminuição com o avanço da idade; 29% das crianças (IC95%: 25,2-32,4 tinham valores aceitáveis de retinol, mas não adequados (0,70 a 1,04µmol/L. Encontrou-se associação positiva entre níveis de retinol e idade, renda per capita, suplementação prévia com vitamina A e escolaridade materna. A prevalência de hipovitaminose A representa um problema moderado de saúde pública, ressaltando a importância das estratégias de combate a essa carência na região.

  13. Removable partial denture models and comunication among dentists and laboratory technicians in the city of de Teresina, Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Carmem Dolores Vilarinho Soares de Moura

    2009-10-01

    Full Text Available Objective: To evaluate the quality of models for making removable partial dentures. Methods: In this Study, 140 models were analysed in 05 dental prosthesis laboratories in the city of Teresina, Piauí, Brazil, registered with the Conselho Regional de Odontologia. A form containing 14 closed questions was applied, and the data collected were submitted to statistical analysis using the SPSS program. The models were analysed under natural or artificial light and photographed for record and illustration purposes. Results: The results showed that in 100% of the cases the molding material used was alginate, and 93.43% of the models were poured by the dentist. Of these, 64.47% were poured in stone plaster and 36.43% in special plaster. According to criteria such as surface quality, reproduction of details, presence of bubbles and/or nodules, adequate reproduction of the edentulous area, 78.57% of the models were considered inadequate. The majority of the models (96.43%, were mounted in an articulator by the Dental Laboratory Technician, but only 1 dentist sent the record for mounting the models. The hinge type articulator was used in 97.14% of the mountings. In 94.29% of the cases, the planning and design were not executed by the dentist and in 87.86% of the cases no evidence of mouth preparation was found. In 80% of the cases, communication between the dentist and the Dental Laboratory Technician was done by telephone. Conclusion: Thus it was verified that the removable partial denture continues to be neglected as regards its clinical and laboratorial fabrication, through an excessive transfer of responsibilities from the dentist to the Dental Laboratory Technician and an inefficient communication between the two.

  14. Mapeamento da flora apícola arbórea das regiões pólos do estado do Piauí

    Directory of Open Access Journals (Sweden)

    Divane de Lima Aleixo

    2015-06-01

    Full Text Available O conhecimento da flora apícola de uma determinada região constitui uma ferramenta essencial para que o apicultor otimize a sua produção. O presente estudo desenvolvido no Estado do Piauí teve como objetivo identificar e catalogar as espécies apícolas arbóreas existentes nas regiões consideradas polo do Estado (Regiões Norte, Serra da Capivara, Picos e Simplício Mendes, bem como observar o período de florescimento e sua aptidão a néctar e/ou pólen pelas abelhas.  O levantamento apibotânico foi realizado entre os meses de agosto de 2009 a dezembro de 2010. Foram feita coleta do material vegetal mensalmente, de acordo com o período de floração, e para verificar a presença de abelhas. O material vegetal foi herborizado conforme as técnicas usuais em botânica, e encaminhado para o Laboratório de Zootecnia da Universidade Federal de Campina Grande – Campus de Pombal para serem identificadas. Foram catalogadas 38 espécies de plantas arbóreas, sendo que destas, 11 espécies apresentaram floração na estação da seca, sete plantas com floração na estação da chuva e 18 plantas apresentaram floração passando de uma estação para outra, e 16 espécies que apresentam aptidão a pólen e a néctar pelas abelhas. Entre as 17 famílias das espécies identificadas e catalogadas nas microrregiões do semi-árido temos: Anacardiaceae, Bignoniaceae, Burseraceae, Chrysobalanaceae, Euphorbiaceae, Fabaceae, Fabaceae-Faboideae, Fabaceae-Mimosoideae, Lecythydaceae, Leguminosae-Caesalpinoideae, Leguminosae- Mimosoideae, Leguminosae, Mimosaceae, Moringaceae, Myrtaceae, Rhamnaceae, e Sapindaceae.

  15. In vitro kinetics of P700+ reduction of Thermosynechococcus elongatus trimeric Photosystem I complexes by recombinant cytochrome c 6 using a Joliot-type LED spectrophotometer.

    Science.gov (United States)

    Nguyen, Khoa; Vaughn, Michael; Frymier, Paul; Bruce, Barry D

    2017-01-01

    The reduction rate of photo-oxidized Photosystem I (PSI) with various natural and artificial electron donors have been well studied by transient absorption spectroscopy. The electron transfer rate from various donors to P 700 + has been measured for a wide range of photosynthetic organisms encompassing cyanobacteria, algae, and plants. PSI can be a limiting component due to tedious extraction and purification methods required for this membrane protein. In this report, we have determined the in vivo, intracellular cytochrome c 6 (cyt c 6 )/PSI ratio in Thermosynechococcus elongatus (T.e.) using quantitative Western blot analysis. This information permitted the determination of P 700 + reduction kinetics via recombinant cyt c 6 in a physiologically relevant ratio (cyt c 6 : PSI) with a Joliot-type, LED-driven, pump-probe spectrophotometer. Dilute PSI samples were tested under varying cyt c 6 concentration, temperature, pH, and ionic strength, each of which shows similar trends to the reported literature utilizing much higher PSI concentrations with laser-based spectrophotometer. Our results do however indicate kinetic differences between actinic light sources (laser vs. LED), and we have attempted to resolve these effects by varying our LED light intensity and duration. The standardized configuration of this spectrophotometer will also allow a more uniform kinetic analysis of samples in different laboratories. We can conclude that our findings from the LED-based system display an added total protein concentration effect due to multiple turnover events of P 700 + reduction by cyt c 6 during the longer illumination regime.

  16. The impact of a biomanipulation experiment on the ichthyofauna diet from a neotropical reservoir in Brazilian semiarid

    Directory of Open Access Journals (Sweden)

    Cristiane de Carvalho Ferreira Lima Moura

    2018-04-01

    Full Text Available Abstract Aim To evaluate the impact of a biomanipulation experiment on the feeding of fish species from a neotropical semiarid reservoir, before and after the removal of the exotic species Oreochromis niloticus. Methods The values of Food Index were analyzed for six species: Oreochromis niloticus , Prochilodus brevis Steindachner,1875, Hypostomus cf. paparie Fowler,1941, Hoplias gr. malabaricus Bloch,1794, Astyanax bimaculatus Linnaeus,1758 and Leporinus piau Fowler,194. All data were obtained in two periods, before of the removal O. niloticus (May 2012 to January 2013 and after its removal (April 2013 to November 2013. The Morisita-Horn index was used to evaluate the feeding similarity among the six species and determine trophic categories (insectivorous, omnivorous, iliophaga and piscivora. To establish the probable variations due the presence of O. niloticus species, the Food Index of the six species was used in a Bray-Curtis similarity matrix. Through the Non-metric Multidimensional Scaling (NMDS we could not observe any differences among items consumed by different species. The Canonical Correspondence Analysis (CCA was used to assay the influence of environmental variables on the dietary, from the Food Index data. Results All species were classified in four trophic categories that do not shown any variation among the formed groups during studied periods. After the removal of Nile tilapia some species showed changes in food items, according to NMDS. The CCA indicated low association among the monthly Food Index of species and the environmental changes. Conclusion The process of biomanipulation on the Ecological Station from Serra Negra reservoir, which compares the dietaries from five local species before and after removal of exotic species Oreochromis niloticus, resulted in modification of dietary composition from three of five studied species.

  17. Variety of DNA Replication Activity Among Cyanobacteria Correlates with Distinct Respiration Activity in the Dark.

    Science.gov (United States)

    Ohbayashi, Ryudo; Yamamoto, Jun-Ya; Watanabe, Satoru; Kanesaki, Yu; Chibazakura, Taku; Miyagishima, Shin-Ya; Yoshikawa, Hirofumi

    2017-02-01

    Cyanobacteria exhibit light-dependent cell growth since most of their cellular energy is obtained by photosynthesis. In Synechococcus elongatus PCC 7942, one of the model cyanobacteria, DNA replication depends on photosynthetic electron transport. However, the critical signal for the regulatory mechanism of DNA replication has not been identified. In addition, conservation of this regulatory mechanism has not been investigated among cyanobacteria. To understand this regulatory signal and its dependence on light, we examined the regulation of DNA replication under both light and dark conditions among three model cyanobacteria, S. elongatus PCC 7942, Synechocystis sp. PCC 6803 and Anabaena sp. PCC 7120. Interestingly, DNA replication activity in Synechocystis and Anabaena was retained when cells were transferred to the dark, although it was drastically decreased in S. elongatus. Glycogen metabolism and respiration were higher in Synechocystis and Anabaena than in S. elongatus in the dark. Moreover, DNA replication activity in Synechocystis and Anabaena was reduced to the same level as that in S. elongatus by inhibition of respiratory electron transport after transfer to the dark. These results demonstrate that there is disparity in DNA replication occurring in the dark among cyanobacteria, which is caused by the difference in activity of respiratory electron transport. © The Author 2016. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  18. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Universidade Federal do Piauí, Campus Universitário Ministro Petrônio Portella, Ininga, Teresina, PI, 64049-550, Brazil; Universidade Federal do Piauí, Northeast Biotechnology Network RENORBIO, Teresina, PI, 64049-550, Brazil; Department of Biology, Dalhousie University, Halifax, NS, B3H 4J1, Canada; Empresa ...

  19. NMSBA: Aken Technologies Final Report: Toxicity Testing of Liquidoff

    Energy Technology Data Exchange (ETDEWEB)

    Ruffing, Anne [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Jensen, Travis [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Strickland, Lucas [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2015-02-01

    To determine the effect of Liquidoff on bacteria, three bacterial strains were tested: Escherichia coli DH5α, Synechococcus sp. PCC 7002, and Synechococcus elongatus PCC 7942. E. coli DH5α is a Gram-negative, aerobic bacterium that is often found in normal gut flora and is commonly used the laboratory due to its fast growth rate. Synechococcus sp. PCC 7002 and S. elongatus PCC 7942 are Gram-negative, aquatic, autophototrophic cyanobacteria. Synechococcus sp. PCC 7002 is a marine cyanobacterium isolated from ‘fish pens’ on Magueyes Island, Puerto Rico in 1962, while S. elongatus PCC 7942 is a freshwater cyanobacterium. It should be noted that no Gram-positive bacterium was tested in this study.

  20. Characterization of mutants expressing thermostable D1 and D2 polypeptides of photosystem II in the cyanobacterium Synechococcus elongatus PCC 7942.

    Science.gov (United States)

    Haraguchi, Norihisa; Kaseda, Jun; Nakayama, Yasumune; Nagahama, Kazuhiro; Ogawa, Takahira; Matsuoka, Masayoshi

    2018-06-08

    Photosystem II complex embedded in thylakoid membrane performs oxygenic photosynthesis where the reaction center D1/D2 heterodimer accommodates all components of the electron transport chain. To express thermostable D1/D2 heterodimer in a cyanobacterium Synechococcus elongatus PCC 7942, we constructed a series of mutant strains whose psbA1 and psbD1 genes encoding, respectively, the most highly expressed D1 and D2 polypeptides were replaced with those of a thermophilic strain, Thermosynechococcus vulcanus. Because the C-terminal 16 amino acid sequences of D1 polypeptides should be processed prior to maturation but diverge from each other, we also constructed the psbA1ΔC-replaced strain expressing a thermostable D1 polypeptide devoid of the C-terminal extension. The psbA1/psbD1-replaced strain showed decreased growth rate and oxygen evolution rate, suggesting inefficient photosystem II. Immunoblot analyses for thermostable D1, D2 polypeptides revealed that the heterologous D1 protein was absent in thylakoid membrane from any mutant strains with psbA1, psbA1ΔC, and psbA1/psbD1-replacements, whereas the heterologous D2 protein was present in thylakoid membrane as well as purified photosystem II complex from the psbA1/psbD1-replaced strain. In the latter strain, the compensatory expression of psbA3 and psbD2 genes was elevated. These data suggest that heterologous D2 polypeptide could be combined with the host D1 polypeptide to form chimeric D1/D2 heterodimer, whereas heterologous D1 polypeptide even without the C-terminal extension was unable to make complex with the host D2 polypeptide. Since the heterologous D1 could not be detected even in the whole cells of psbA1/psbD1-replaced strain, the rapid degradation of unprocessed or unassembled heterologous D1 was implicated. Copyright © 2018 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  1. ANÁLISE ARQUEOMÉTRICA DE PINTURAS RUPESTRES PRÉ-HISTÓRICAS DO SÍTIO TAMBORIL, BARRAS, PIAUÍ, BRASIL (Archaeometric Analysis of Prehistoric Rock Paintings from the Tamboril Site, Barras, Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Luis Carlos Duarte Cavalcante

    2016-03-01

    Full Text Available O sítio arqueológico Tamboril, localizado na área rural do município de Barras, estado do Piauí, Brasil, é um bloco arenítico que apresenta um nicho decorado com pinturas rupestres, principalmente grafismos puros, motivos zoomórficos e carimbos de mãos humanas, pintados em diferentes tonalidades de vermelho. A conservação das pinturas é afetada por eflorescências salinas, resíduos decorrentes da atividade de insetos (como cupins e vespas e impacto humano (visitação sem acompanhamento de guias e atividade agrícola nas proximidades. A análise arqueométrica de pigmentos dessas pinturas rupestres foi realizada no laboratório com fluorescência de raios X por dispersão de energia e espectroscopia Mössbauer do 57Fe em geometria de retroespalhamento de raios γ à temperatura ambiente. Os teores de Fe (como Fe2O3 encontrados nas pinturas variam de 2,953(1 massa% a 17,23(1 massa%. Os parâmetros hiperfinos Mössbauer revelaram que o pigmento vermelho-escuro das pinturas rupestres é composto de hematita (αFe2O3 e de um Fe3+ (superparamagnético. Os teores de P (como P2O5 variam de 21,70(1 massa% a 25,92(1 massa% e foram atribuídos às eflorescências salinas e aos resíduos orgânicos de atividades de insetos que cobrem as inscrições pré-históricas. ENGLISH: The archaeological site known as Tamboril, located in the rural area of the municipality of Barras, Piauí State, Brazil, is a sandstone block that contains a niche decorated with rock paintings. These paintings are mainly composed of pure graphisms, zoomorphic motifs, and human handprints, painted in different tonalities of red. Their conservation has been affected by saline efflorescences, residues of insect activities (such as wasps and termites and human impact (unguided visitors and nearby agricultural activity. The archaeometric analysis of pigments from these rock paintings was performed in the laboratory with energy dispersive X-ray fluorescence and room

  2. Global cardiovascular risk stratification among hypertensive patients treated in a Family Health Unit of Parnaíba, Piauí - doi: 10.5020/18061230.2012.p287

    Directory of Open Access Journals (Sweden)

    Elce de Seixas Nascimento

    2012-11-01

    Full Text Available Objective: To stratify the global cardiovascular risk among hypertensive patients attended in a Family Health Unit (FHU. Methods: A quantitative, cross-sectional and descriptive study with population of hypertensive patients undergoing treatment in a FHU, module 34, in Parnaíba, Piauí, Brazil, in the period from July to August 2011. The sample consisted of 45 volunteers, selected by free demand conglomerate, who filled a form with questions that support the analysis and Global Cardiovascular Risk stratification (GCR, according to the VI Brazilian Guidelines on Hypertension (VI BGH - 2010, The European Society of Cardiology (ESC and European Society of Hypertension (ESH - 2007. The subjects were then submitted to measurement of blood pressure (BP, waist circumference (WC and body mass index (BMI. Results: The most evident risk factor in the sample was overweight/obesity in 75.5% (n=34, followed by sedentary lifestyle in 73.3% (n=33 and hypercholesterolemia in 55.5% (n=25. The data collected resulted in a stratification in which 84.4% (n=38 presented high added risk and 15.5% (n=7 a very high added risk of presenting cardiovascular events in the next 10 years. Conclusion: The stratification in the population studied indicated high incidence of such factors, pointing to the need of interfering in this population segment, in order to promote changes in lifestyle that generate prevention and control of cardiovascular diseases.

  3. A revised geographical range for Liolaemus elongates Koslowsky, 1896 (Squamata: Liolaemini in Argentina: review of reported and new-data based distribution with new localities

    Directory of Open Access Journals (Sweden)

    Ignacio Minoli

    2013-12-01

    Full Text Available Estimating the effective geographical ranges of species is central to species-oriented conservation and management. In this paper, we review the geographical distribution of Liolaemus elongatus Koslowsky, 1896 with three new records for northern Chubut and southern Río Negro provinces, Argentina. Based on detailed locality records pooled from multiple data sources, including new records obtained for this study, we revise the range of L. elongatus sensu stricto and provide geographical distribution maps comparing the previously recognized range to that proposed herein. Our results show that L. elongatus possesses a much more limited geographic distribution than previously thought, being restricted to areas south of 38°S latitude; the newly proposed range is merely half the species formerly recognized geographical distribution.

  4. Seasonal dynamics of Pseudocalanus minutus elongatus and Acartia spp. in the southern Baltic Sea (Gdańsk Deep – numerical simulations

    Directory of Open Access Journals (Sweden)

    L. Dzierzbicka-Głowacka

    2006-01-01

    Full Text Available A population dynamics model for copepods is presented, describing the seasonal dynamics of Pseudocalanus minutus elongatus and Acartia spp. in the southern Baltic Sea (Gdańsk Deep. The copepod model was coupled with a one-dimensional physical and biological upper layer model for nutrients (total inorganic nitrogen, phosphate, phytoplankton, microzooplankton, and an early juvenile of herring as a predator. In this model, mesozooplankton (herbivorous copepods has been introduced as an animal having definite patterns of growth in successive stages, reproduction and mortality. The populations are represented by 6 cohorts in different developmental stages, thus assuming that recruitment of the next generation occurs after a fixed period of adult life. The copepod model links trophic processes and population dynamics, and simulates individual growth within cohorts and the changes in biomass between cohorts. The simulations of annual cycles of copepods contain one complete generation of Pseudocalanus and two generations of Acartia in the whole column water, and indicate the importance of growth in the older stages of 6 cohorts of each species, to arrive at a total population biomass. The peaks of copepods' biomass are larger at the turn of June and July for Pseudocalanus and smaller in July for Acartia, lagging that of phytoplankton by ca. two mouths, due to the growth of cohorts in successive stages and egg production by females. The numerical results show that the investigated species could not be the main factor limiting the spring phytoplankton bloom in the Gdańsk Deep, because the initial development was slow for Acartia and faster for Pseudocalanus, but the main development formed after the bloom, in both cases. The phytoplankton bloom is very important in the diet of the adults of the copepods, but it is not particularly important for the youngest part of new generation (early nauplii. However, the simulated microzooplankton biomass was

  5. Atributos químicos e estoques de carbono em Latossolo sob plantio direto no cerrado do Piauí Chemical attributes and carbon stocks in an Oxisol under no-tillage in savannah of Piauí state

    Directory of Open Access Journals (Sweden)

    Luiz F. C. Leite

    2010-12-01

    Full Text Available O sistema de plantio direto é uma alternativa viável para o uso sustentável dos solos. O objetivo do presente trabalho foi avaliar a influência do sistema plantio direto com diferentes tempos de implantação e do plantio convencional sobre os atributos químicos e os estoques de C de um Latossolo Vermelho-Amarelo do cerrado piauiense. Amostras de solo foram coletadas nas camadas de 0-5, 5-10, 10-20 e 20-40 cm em sistema de plantio convencional (PC e plantio direto (PD com 2 (PD2, 4 (PD4 e 6 (PD6 anos de implantação, além de uma área sob floresta nativa de cerrado (FNC. Foram determinados o pH em água, P extraível (Pext, bases trocáveis, Al, acidez potencial (H+Al, carbono orgânico total (COT e carbono da biomassa microbiana (Cmic. A adoção do sistema plantio direto aumentou o pH, os teores de P e de bases trocáveis do solo, em comparação com o PC. Em relação ao PC, os estoques de COT e Cmic aumentaram 34 e 99% no PD2, 47 e 92% no PD4 e 61 e 108% no PD6, respectivamente, na camada superficial de 0-20 cm. A implantação do sistema plantio direto melhora os atributos químicos e aumenta os estoques de carbono orgânico total e microbiano do solo e seu uso contínuo contribui para a qualidade do solo em áreas do cerrado piauiense.No-tillage adoption has been considered a viable alternative for sustainable soil use. This work aimed to evaluate the influence of no-tillage system with different times of adoption and conventional tillage on chemical attributes and carbon stocks in an Oxisol of the savannah of Piauí in Northeastern Brazil. Soil samples in the 0-5, 5-10, 10-20 and 20-40 cm layers were collected in conventional tillage (CT no-tillage (NT with 2 (NT2, 4 (NT4 and 6 (NT6 years of adoption and native forest (NF. The following chemical properties were evaluated: pH, extractable P, exchangeable cations, Al, potential acidity (H+Al, total organic carbon (TOC and microbial biomass carbon (Cmic. NT adoption increased p

  6. Association between pluviometric index and the occurrence of acute appendicitis

    Directory of Open Access Journals (Sweden)

    Djalma Ribeiro Costa

    2017-10-01

    Full Text Available Background: Epidemiological studies demonstrate, for unknown reasons, the prevalence of appendicitis in the summer and in young male adults, and there are controversies about its association with the rainy season. There are no studies in the State of Piauí about such association. Objective: To establish an association between the occurrence of appendicitis and the pluviometric precipitation index. Methodology: This is a cross-sectional study that was carried out using the database of the pathology service at a public emergency hospital in Piauí, and the pluviometric precipitation index in the State of Piauí from January 2009 to April 2014, with data from the National Institute of Meteorology. Descriptive statistics and association measures were applied using the Pearson correlation coefficient and the χ2 test. Results: We found a predominance of appendicitis cases in male subjects, from 11 to 20 years of age, with a predominance of the monthly mean of appendicitis cases in the second semester, which conforms to the dry season in the State of Piauí. Pearson's correlation coefficient was −0.260. Conclusion: There is an association between the occurrence of appendicitis and the months of the year; however, this is a weak negative correlation between the monthly mean of cases of appendicitis and monthly pluviometric precipitation average in the State of Piauí. Resumo: Contexto: Estudos epidemiológicos demonstram, por razões desconhecidas, o predomínio dos casos de apendicite no verão e em adultos jovens do sexo masculino, havendo controvérsias sobre sua associação com o período chuvoso. Não há estudos realizados no Piauí sobre esta associação. Objetivo: Estabelecer uma associação entre a ocorrência de apendicite e o índice de precipitação pluviométrica. Metodologia: Realizou-se um estudo transversal através do banco de dados do serviço de patologia de um hospital de emergência público do Piauí e do índice de

  7. Rastreamento do câncer do colo do útero em Teresina, Piauí: estudo avaliativo dos dados do Sistema de Informação do Câncer do Colo do Útero, 2006-2013

    Directory of Open Access Journals (Sweden)

    Andressa Moura Damacena

    Full Text Available Resumo OBJETIVO: avaliar o rastreamento do câncer do colo do útero em Teresina, Piauí, Brasil. MÉTODOS: estudo avaliativo do Sistema de Informação do Câncer do Colo do Útero (Siscolo de Teresina no período 2006-2013, com base em análises estatísticas descritivas. RESULTADOS: foram registradas no sistema 604.331 citologias de mulheres residentes em Teresina; 1,8% apresentaram alterações citológicas pré-malignas ou malignas (atipias, lesões intraepiteliais e câncer; a positividade dos exames foi maior para as mulheres >64 anos de idade; verificou-se redução de 43,9% no número de exames realizados na faixa etária-alvo do programa de rastreamento; também cresceu o percentual de amostras insatisfatórias, de 0,33 para 0,89%. CONCLUSÃO: em Teresina, o programa de rastreamento de colo uterino apresenta limitações que precisam ser superadas, destacando-se a oferta inadequada de exames, sua baixa proporção de positividade e o crescimento do número de amostras insatisfatórias.

  8. The role of lantern fish (Myctophidae) in the life-cycle of cetacean parasites from western Mediterranean waters

    Science.gov (United States)

    Mateu, Paula; Nardi, Valentina; Fraija-Fernández, Natalia; Mattiucci, Simonetta; Gil de Sola, Luis; Raga, Juan Antonio; Fernández, Mercedes; Aznar, Francisco Javier

    2015-01-01

    Myctophids (lantern fish) and cephalopods play a key role in trophic webs from the continental slope and oceanic waters linking the zooplankton to top predators. Many cetaceans feed on both lantern fish and cephalopods, and such prey would thus be expected to bridge the trophic gap in the life-cycles of helminths infecting cetaceans. However, information on the life-cycles of most of these helminths is extremely scanty. We examined the parasite fauna of myctophids and cephalopods in two areas from the western Mediterranean where at least 21 helminth taxa from cetaceans have been reported and both cetacean diversity and abundance is high. A total of 1012 individuals of 8 lantern fish species, namely, Ceratoscopelus maderensis, Lampanyctus crocodilus, Notoscopelus elongatus, Benthosema glaciale, Myctophum punctatum, Lobianchia dofleini, Diaphus holti and Hygophum benoiti, and 792 individuals of 2 cephalopod species, Alloteuthis media and Sepietta oweniana, were collected from the Gulf of Valencia and Alboran Sea (Spanish Mediterranean) during 2010-2012 and examined for larval helminths. All these species have been reported as prey for at least some cetacean species in the area. Only five helminth taxa were found. The nematodes Anisakis pegreffii and Anisakis physeteris were detected in N. elongatus and C. maderensis (overall prevalence for Anisakis: 8.1% and 0.5%, respectively). Their prevalence in N. elongatus was significantly higher than that from the other three myctophid species with n>50 individuals. A single individual of Hysterothylacium sp. was found in N. elongatus (prevalence: 0.5%) and Raphidascarididae gen. spp. in N. elongatus and L. crocodilus (prevalence: 20.3% and 0.7%, respectively). Juvenile didymozoid digeneans (Torticaecum type) were detected in N. elongatus and L. crocodilus (prevalence: 18.5% and 4.3%, respectively). Two unidentified cestode plerocercoids were collected from N. elongatus. Our study suggests, for the first time, that myctophids

  9. Plantas tóxicas para ruminantes e eqüídeos no Norte Piauiense Toxic plants for ruminants and equidae in Northern Piauí

    Directory of Open Access Journals (Sweden)

    Gustavo W.S. Mello

    2010-01-01

    Full Text Available Este trabalho teve por objetivo realizar um levantamento sobre as plantas tóxicas para ruminantes e equídeos na Mesorregião Norte do Piauí. Foram feitas 71 entrevistas a médicos veterinários, engenheiros agrônomos, técnicos agrícolas e produtores de 16 municípios, entrevistando pelo menos quatro pessoas por município. As plantas comprovadamente tóxicas que foram apontadas com maior frequência na região estudada foram Ipomoea asarifolia, que causa intoxicações em pequenos ruminantes em todas as áreas visitadas. Stryphnodendron coriaceum pelas mortes que ocasiona é, aparentemente, a planta que causa maiores perdas econômicas na mesorregião estudada. Enterolobium contortisiliquum também foi citada como causa importante de sinais digestivos, abortamentos e fotossensibilização em bovinos da região. Os entrevistados confirmaram a ocorrência de surtos de intoxicação em bovinos por Thiloa glaucocarpa no inicio do período chuvoso. Manihot spp. e Piptadenia macrocarpa são plantas cianogênicas apontadas como causa de mortes superagudas em bovinos. Outras plantas relatadas como tóxicas pelos entrevistados, mas sem que haja comprovação de sua toxicidade, foram Buchenavia tomentosa, Caesalpinia sp., Brunfelsia sp., Luetzelburgia sp., Hybantus ipecaconha, Phisalys angulata e Spondias luta. De acordo com os entrevistados os frutos de Buchenavia tomentosa causam sinais digestivos e abortos em caprinos, ovinos e bovinos. Produtores relatam surtos de intoxicação em caprinos que apresentam sinais digestivos e morte após a ingestão de favas de Luetzelburgia sp. Brunfelsia sp. é relatada como causa de alterações nervosas, no começo das chuvas, quando os animais ingerem as folhas e flores e os asininos são aparentemente mais afetados. Os frutos de Spondias luta foram mencionados como causa de diarréia em caprinos. Experimentos não publicados demonstraram a toxicidade de Brunfelsia sp. em ovinos e de Luetzelburgia sp. como

  10. Ambiente, pessoas e labor: APLs além do desenvolvimento econômico na mineração de opalas em Pedro II, no Piauí

    Directory of Open Access Journals (Sweden)

    Bruno Milanez

    Full Text Available Este artigo propõe que políticas públicas voltadas para arranjos produtivos lo0cais (APLs têm um importante potencial para melhorar o desempenho dos pequenos garimpos e minas de gemas no Brasil, desde que integrem questões ambientais e sociais às ações voltadas ao desenvolvimento econômico. Esse argumento é baseado no estudo empírico dos problemas socioambientais enfrentados pelo APL de opalas em Pedro II, no Piauí. O estudo foi desenvolvido através da metodologia de estudos de caso, envolvendo extensa revisão bibliográfica, pesquisa em documentos do APL e entrevistas com vários integrantes do arranjo. Entre os resultados da pesquisa, foram identificadas algumas questões que vêm inibindo o pleno desenvolvimento do APL, como as condições de trabalho e a mitigação dos impactos ambientais, cujas melhorias dependem de recursos humanos e financeiros, bem como de vontade política. Entretanto, um segundo grupo de questões suscita um debate mais amplo, que envolve outros APLs de base mineral, como o equilíbrio de forças entre os diferentes elos da cadeia produtiva, a criação de alternativas econômicas no caso da exaustão das jazidas existentes, a tributação das atividades minerais e o redesenho dos procedimentos de licenciamento de atividades minerais, para que estas se dêem de maneira mais sustentável.

  11. Recombinant thermoactive phosphoenolpyruvate carboxylase (PEPC) from Thermosynechococcus elongatus and its coupling with mesophilic/thermophilic bacterial carbonic anhydrases (CAs) for the conversion of CO2 to oxaloacetate.

    Science.gov (United States)

    Del Prete, Sonia; De Luca, Viviana; Capasso, Clemente; Supuran, Claudiu T; Carginale, Vincenzo

    2016-01-15

    With the continuous increase of atmospheric CO2 in the last decades, efficient methods for carbon capture, sequestration, and utilization are urgently required. The possibility of converting CO2 into useful chemicals could be a good strategy to both decreasing the CO2 concentration and for achieving an efficient exploitation of this cheap carbon source. Recently, several single- and multi-enzyme systems for the catalytic conversion of CO2 mainly to bicarbonate have been implemented. In order to design and construct a catalytic system for the conversion of CO2 to organic molecules, we implemented an in vitro multienzyme system using mesophilic and thermophilic enzymes. The system, in fact, was constituted by a recombinant phosphoenolpyruvate carboxylase (PEPC) from the thermophilic cyanobacterium Thermosynechococcus elongatus, in combination with mesophilic/thermophilic bacterial carbonic anhydrases (CAs), for converting CO2 into oxaloacetate, a compound of potential utility in industrial processes. The catalytic procedure is in two steps: the conversion of CO2 into bicarbonate by CA, followed by the carboxylation of phosphoenolpyruvate with bicarbonate, catalyzed by PEPC, with formation of oxaloacetate (OAA). All tested CAs, belonging to α-, β-, and γ-CA classes, were able to increase OAA production compared to procedures when only PEPC was used. Interestingly, the efficiency of the CAs tested in OAA production was in good agreement with the kinetic parameters for the CO2 hydration reaction of these enzymes. This PEPC also revealed to be thermoactive and thermostable, and when coupled with the extremely thermostable CA from Sulphurhydrogenibium azorense (SazCA) the production of OAA was achieved even if the two enzymes were exposed to temperatures up to 60 °C, suggesting a possible role of the two coupled enzymes in biotechnological processes. Copyright © 2015 Elsevier Ltd. All rights reserved.

  12. CARTOGRAFIAS DO PIAUÍ: RELACIONANDO INFRAESTRUTURA E DESENVOLVIMENTO SOCIAL

    Directory of Open Access Journals (Sweden)

    Paulo Antônio Barbosa Júnior

    2016-08-01

    Full Text Available Durante as décadas de 50 a 90, o Piauí foi o Estado mais pobre do Brasil. Recentemente, o Piauí tem apresentado acelerado crescimento econômico, devido em parte ao fortalecimento dos setores de comércio e construção, e a implantação da agricultura moderna na porção do Cerrado piauiense da região MAPITOBA. Apesar do recente incremento econômico, percebe-se que no Piauí, assim como em outros estados do Brasil, o desenvolvimento se dá de forma irregular com relação aos aspectos sociais e seus padrões de distribuição no território. Neste sentido, o presente trabalho busca mostrar que no Piauí a concentração de bens e pessoas está em parte condicionada a infraestrutura de transporte, com exceção da mesorregião Sudoeste Piauiense, onde o modelo de desenvolvimento adotado é essencialmente diferente do modelo das demais regiões. Desta forma, a baixa integração regional no Piauí tem contribuído para o surgimento de duas porções territoriais distintas e isoladas: uma ao norte, com características predominantemente urbanas e relativa concentração de bens e pessoas; e outra ao sul, onde se estabeleceu a última fronteira agrícola do país, com a implantação da agricultura moderna em áreas de vazios demográficos e baixos índices de desenvolvimento social. Assim, partindo-se da demanda por estudos que melhor descrevam as especificidades do território e que contribuam para a elaboração de políticas públicas adjetivadas ao local, o trabalho faz uso da Cartografia Temática e da Análise Espacial para descrever a situação atual do estado do Piauí com relação a Renda e Educação.

  13. Unique attributes of cyanobacterial metabolism revealed by improved genome-scale metabolic modeling and essential gene analysis

    Science.gov (United States)

    Broddrick, Jared T.; Rubin, Benjamin E.; Welkie, David G.; Du, Niu; Mih, Nathan; Diamond, Spencer; Lee, Jenny J.; Golden, Susan S.; Palsson, Bernhard O.

    2016-01-01

    The model cyanobacterium, Synechococcus elongatus PCC 7942, is a genetically tractable obligate phototroph that is being developed for the bioproduction of high-value chemicals. Genome-scale models (GEMs) have been successfully used to assess and engineer cellular metabolism; however, GEMs of phototrophic metabolism have been limited by the lack of experimental datasets for model validation and the challenges of incorporating photon uptake. Here, we develop a GEM of metabolism in S. elongatus using random barcode transposon site sequencing (RB-TnSeq) essential gene and physiological data specific to photoautotrophic metabolism. The model explicitly describes photon absorption and accounts for shading, resulting in the characteristic linear growth curve of photoautotrophs. GEM predictions of gene essentiality were compared with data obtained from recent dense-transposon mutagenesis experiments. This dataset allowed major improvements to the accuracy of the model. Furthermore, discrepancies between GEM predictions and the in vivo dataset revealed biological characteristics, such as the importance of a truncated, linear TCA pathway, low flux toward amino acid synthesis from photorespiration, and knowledge gaps within nucleotide metabolism. Coupling of strong experimental support and photoautotrophic modeling methods thus resulted in a highly accurate model of S. elongatus metabolism that highlights previously unknown areas of S. elongatus biology. PMID:27911809

  14. Two new Liolaemus lizards from the Andean highlands of Southern Chile (Squamata, Iguania, Liolaemidae)

    Science.gov (United States)

    Troncoso-Palacios, Jaime; Diaz, Hugo A.; Puas, German I.; Riveros-Riffo, Edvin; Elorza, Alvaro A.

    2016-01-01

    Abstract Liolaemus is a diverse genus of lizards, subdivided into two subgenera: Liolaemus (sensu stricto) and Eulaemus, distributed mainly in Chile and Argentina. The Liolaemus elongatus-kriegi complex is the most diverse group within Liolaemus (sensu stricto), especially the species closely related to Liolaemus elongatus, which form a clade currently comprising nine species. Several Chilean species of this group have been recently described, mainly from volcanoes and poorly explored mountains. Here molecular and morphological evidence are provided for a new species of the Liolaemus elongatus clade, which is characterized by its small size and lack of dorsal pattern, unusual features for the species of this group of lizards. Additionally, the lack of precloacal pores in males of Liolaemus (sensu stricto) is a trait found in few species, which do not constitute a monophyletic group. A second new southern Chilean species is also described, without precloacal pores and supported by molecular phylogenetics to be related to Liolaemus villaricensis. Both new species were found in the same locality, near a lake located in a pre-Andean zone with Araucaria and Nothofagus forest. The two species are dedicated to prominent Lonkos (tribal chiefs) of the Mapuche and Pehuenche people: Janequeo and Leftraru. Additionally, the phylogenetic results suggest that Liolaemus lonquimayensis is a synonym of Liolaemus elongatus. PMID:27920609

  15. Curso de Odontología de la UFPI: 50 años de interacción con la educación y la salud en Piauí

    Directory of Open Access Journals (Sweden)

    Plínio da Silva MACEDO

    2011-12-01

    Full Text Available La Odontología, como es propio de cualquier profesión, tiene peculiaridades en lo que toca a su desarrollo que, al ser revisadas por medio de una retrospectiva en la Historia, es un valioso instrumento para comprender su actual papel dentro de la sociedad contemporánea. Así, el presente trabajo se propone rememorar la historia de la creación del curso de Odontología en el Estado del Piauí, tercero curso superior de este Estado, desde la época de la Facultad de Odontología, cuya origen es de 15/07/1960, hasta cuando tal curso fue incorporado a la UFPI, en 1971. Intentase, por otra parte, hacerse un breve panorama acerca del ingreso de estudiantes en el curso, basándose en una escala temporal, y centrarse también en la calificación del cuadro docente de la Facultad entre las últimas décadas del siglo XX y la primera década del siglo XXI, considerando la importancia del cuerpo docente como un preeminente contribuyente para el nivel de calidad del curso. En 2010, el curso contaba con 19 doctores y 11 maestros, entre los 32 docentes, con 80 clases concluyentes y cerca de 1500 alumnos graduados. La conclusión general del análisis crítica de los indicadores y parámetros abordados es que las actividades académicas, científicas e culturales pueden influir decisivamente en el cambio de las estructuras sociales, contribuyendo para el desarrollo y el progreso.

  16. Composição e dinâmica da avifauna da usina eólica da praia da Pedra do Sal, Delta do Parnaíba, Piauí, Brasil

    Directory of Open Access Journals (Sweden)

    Anderson Guzzi

    2015-06-01

    Full Text Available RESUMO O impacto dos parques eólicos sobre as aves é um dos temas menos estudados no Brasil, o que contrasta com a importância dessa nova fonte de energia renovável. O presente estudo buscou caracterizar a composição e dinâmica ecológica das espécies de aves residentes e migratórias presentes na área da Usina Eólica da Pedra do Sal, em Parnaíba, Estado do Piauí. O estudo foi desenvolvido por meio de trinta e três amostragens distribuídas em dois ciclos sazonais completos (setembro de 2011 a agosto de 2013, através do método do ponto de escuta, dispostos na base de cada um dos aerogeradores. Foram registrados 6.843 contatos de aves pertencentes a 67 espécies distribuídas em 22 famílias e 13 ordens, e a espécie com maior número de contatos foi a batuíra-de-coleira (Charadrius collaris. As categorias tróficas predominantes foram as das aves insetívoras, representadas por 18 espécies, seguidas pelas aves que se alimentam de invertebrados aquáticos (17 espécies. A maioria das aves registradas é de ambiente aquático. Durante o desenvolvimento desse estudo não foram registradas colisões entre as aves e os aerogeradores.

  17. PREVALÊNCIA E ETIOLOGIA DA MASTITE BOVINA NO MUNICÍPIO DE TERESINA, PIAUÍ ETIOLOGY AND PREVALENCE BOVINE MASTITIS IN THE TEREZINA CITY, PI

    Directory of Open Access Journals (Sweden)

    Nicodemus Alves de Macedo

    2007-07-01

    Full Text Available Estudou-se a prevalência e a etiologia da mastite em rebanhos leiteiros pertencentes à bacia leiteira do mu¬nicípio de Teresina, Piauí. Analisaram-se 852 amostras de leite, provenientes de vacas em período médio de lactação pertencentes a oito propriedades produtoras de leite tipo C. Verificou-se que 41,10% das amostras foram reagentes à prova de CMT nos mais variados graus (+, ++ e +++. Desse total, 252 (72,83% foram positivas ao exame bac¬teriológico, sendo o gênero Staphylococcus o mais preva¬lente (74,60%. PALAVRAS-CHAVES: CMT, epidemiologia, leite, Piauí (PI, Staphylococcus. The aim of present study was to verify the etiology and prevalence of bovine mastitis in the Terezina, city. A total of 852 quarters from cows during avery lactating pe¬riod raised on 8 dairy farms in Terezina, Piauí, were exa¬mined. Out of 346 (41.10% positive cows by CMT (+, ++ e +++. A total of 252 (72.83% were confirmed though bacteriological methods. From the agents isolated in pure or mixed cultures, the Staphylococcus was most frequen¬tly observed (74.60%. KEY-WORDS: CMT, epidemiology, milk, Piauí, Staphylococcus.

  18. Cerambycidae (Coleoptera do Museu de Zoologia da Universidade Estadual de Feira de Santana, Bahia

    Directory of Open Access Journals (Sweden)

    Ubirajara R. Martins

    2013-09-01

    Full Text Available Novas espécies em Cerambycinae são descritas do Brasil, Piauí: Compsibidion paragraphycum sp. nov. (Neoibidionini. Em Lamiinae, - do Piauí: Trichohippopsis vestita sp. nov. (Agapanthiini; Oncioderes piauiensis sp. nov. (Onciderini; Cotycicuiara caracolensis sp. nov. (Desmiphorini; Xenofrea peculiaris sp. nov. (Xenofreini; Mariliana bellula sp. nov. (Hemilophini; - da Paraíba: Ataxia arenaria sp. nov. (Pteropliini; Dadoychus atrus sp. nov. (Hemilophini. Novos registros em Cerambycinae para o Piauí: Methia longipennis Martins, 1997 (Methiini; Tropidion sipolisi (Gounelle, 1909, Compsibidion decoratum (Gounelle, 1909, Cycnidolon obliquum Martins, 1969 (Neoibidionini; - para o Ceará: Paranyssicus conspicillatus (Erichson, 1847 (Elaphidiini; Aglaoschema collorata (Napp, 1993 (Compsocerini; - para a Bahia: Stizocera phtisica Gounelle, 1909 (Elaphidiini. Novos registros em Lamiinae para o Piauí: Dolichosybra tubericollis Breuning, 1942 (Apomecynini; Ceiupaba lineata Martins & Galileo, 1998, Cicuiara striata (Bates, 1866, Desmiphora pallida Bates, 1874 (Desmiphorini; Nesozineus apharus Galileo & Martins, 1996, Psapharochrus nigrovittatus (Zajciw, 1969 (Acanthoderini; - para o Ceará: Trichohippopsis rufula Breuning, 1958 (Agapanthiini; Ataxia parva Galileo & Martins, 2011 (Pteropliini; Desmiphora cirrosa Erichson, 1847 (Desmiphorini; - para a Paraíba: Eudesmus rubefactus Bates, 1865 (Onciderini; Laraesima ochreoapicalis Breuning, 1973 (Compsosomatini; Psapharochrus itatiayensis (Melzer, 1935 (Acanthoderini; - para a Bahia: Brasiliosoma tibialis (Breuning, 1948 (Compsosomatini; Adesmus hemispilus (Germar, 1821 (Hemilophini.

  19. The Canal da Piracema at Itaipu Dam as a fish pass system

    Directory of Open Access Journals (Sweden)

    Sérgio Makrakis

    Full Text Available The Canal da Piracema is the longest (nearly 10 km fish pass system in the world. The construction of this fish pass was somehow controversial, because it connected two distinct ichthyofaunistic provinces. This study evaluated the ichthyofauna present in the Canal da Piracema and the abundance and distribution of long-distance migratory fish species along this fish pass system (evaluated possible selectivity. The Canal da Piracema was shown to be difficult to sample because of its environmental heterogeneity: artificial ponds, ladders and nature-like fish pass. To solve this problem, we used several fishing gears, adequate for the several biotopes present (unstructured and structured littoral were sampled with seining nets and electrofishing; lentic were sampled with gillnets and longlines (deeper areas; and rapid water areas were sampled with cast nets. The ichthyofauna of the Canal da Piracema followed the pattern for South America and the Paraná River, with a predominance of Characiformes and Siluriformes. The most representative families were Characidae, Anostomidae, Pimelodidae and Loricariidae. We captured 116 species (17 were long-distance migratory during the period studied. Small-sized species were predominant in unstructured and structured littoral areas, especially Bryconamericus exodon and Apareiodon affinis.The most abundant species was Hypostomus spp. in lentic areas, followed by Iheringichthys labrosus. Hoplias aff. malabaricus predominated in deeper lentic areas. Long-distance migratory species were abundant in rapid waters; they were Prochilodus lineatus and Leporinus elongatus. The sharp reduction in the number of species, including migratory ones, is an indication that the Canal da Piracema is selecting the species that ascend it. Therefore, the search for information on the efficiency of the various fish passes present in the Canal da Piracema is fundamental, to facilitate upward movements of fish. If this is reached, this

  20. Influence of weather variables and plant communities on grasshopper density in the Southern Pampas, Argentina.

    Science.gov (United States)

    de Wysiecki, María Laura; Arturi, Marcelo; Torrusio, Sandra; Cigliano, María Marta

    2011-01-01

    A study was conducted to evaluate the influence of weather (precipitation and temperature) and plant communities on grasshopper density over a 14-year period (1996-2009) in Benito Juárez County, Southern Pampas, Argentina. Total density strongly varied among plant communities. Highest values were registered in 2001 and 2003 in highly disturbed pastures and in 2002 and 2009 in halophilous grasslands. Native grasslands had the lowest density values. Seasonal precipitation and temperature had no significant effect on total grasshopper density. Dichroplus elongatus (Giglio-Tos) (Orthoptera: Acridoidea), Covasacris pallidinota (Bruner), Dichroplus pratensis Bruner, Scotussa lemniscata Stål, Borellia bruneri (Rehn) and Dichroplus maculipennis (Blanchard) comprised, on average, 64% of the grasshopper assemblages during low density years and 79% during high density years. Dichroplus elongatus, S. lemniscata and C. pallidinota were the most abundant species in 2001, 2002 and 2003, while D. elongatus, B. brunneri and C. pallidinota in 2009. Dichroplus elongatus and D. pratensis, mixed feeders species, were positively affected by summer rainfall. This suggests that the increase in summer precipitation had a positive effect on the quantity and quality forage production, affecting these grasshopper populations. Scotussa lemniscata and C. pallidinota were negatively affected by winter and fall temperature, possibly affecting the embryonic development before diapause and hatching. Dichroplus elongatus and D. pratensis were associated with highly disturbed pastures, S. lemniscata with pastures and B. bruneri and D. maculipennis with halophilous grasslands. Covasacris pallidinota was closely associated with halophilous grasslands and moderately disturbed pastures. Weather conditions changed over the years, with 2001, 2002 and 2003 having excessive rainfall while 2008 and 2009 were the driest years since the study started. We suggest that although seasonal precipitation and

  1. Estudo soroepidemiológico da cisticercose humana em um município do Estado do Piauí, Região Nordeste do Brasil Seroepidemiological survey of human cysticercosis in a municipality of Piaui State, Northeast Brazil

    Directory of Open Access Journals (Sweden)

    Alberto Novaes Ramos Jr.

    2004-12-01

    Full Text Available Integrando as pesquisas sobre parasitoses na região do entorno do Parque Nacional Serra da Capivara, Piauí, Brasil, realizadas entre 1999 e 2001, o presente estudo tem como objetivo avaliar a situação epidemiológica da cisticercose humana no Município de João Costa, no Nordeste do Brasil. Foram obtidas informações clínico-epidemiológicas e coletadas amostras de sangue para testes sorológicos imunoenzimáticos (ELISA e Western blot, empregando cisticercos de Taenia crassiceps como antígeno. Na primeira etapa, em 1999, foram investigadas 169 pessoas com história confirmada ou suspeita de infecção/doença pelo complexo teníase-cisticercose, e seus familiares. Na análise, 13,6% das pessoas apresentaram soros reagentes para cisticercose pelo método ELISA. Na segunda etapa, em 2001, foram avaliadas 92 amostras de soro de indivíduos reativos para cisticercose detectados no primeiro momento e seus familiares, sendo que 24,0% das amostras de soro foram reagentes para cisticercose pelo ELISA, e 29,0%, pelo WB. Nessa mesma etapa, realizou-se inquérito coprológico em 701 pessoas, incluindo voluntários. A prevalência de parasitoses intestinais foi de 51,0%, tendo sido observada uma maior prevalência de protozoários (95,0% em relação aos helmintos (5,0%. Os resultados do estudo indicam o caráter endêmico da cisticercose na área, além da elevada freqüência de protozooses intestinais.As part of parasitological studies in the area surrounding the Serra da Capivara National Park, Piauí State, Northeast Brazil, from 1999 to 2001, the current study aimed to evaluate the epidemiological profile of human cysticercosis in the Municipality of João Costa. Clinical and epidemiological data were obtained, and blood samples were drawn for immunoenzymatic serological tests (ELISA and Western blot, using Taenia crassiceps as the antigen. The first stage, in 1999, investigated 169 individuals with a confirmed history or suspicion of

  2. Structural determinants of the outer shell of β-carboxysomes in Synechococcus elongatus PCC 7942: roles for CcmK2, K3-K4, CcmO, and CcmL.

    Directory of Open Access Journals (Sweden)

    Benjamin D Rae

    Full Text Available Cyanobacterial CO(2-fixation is supported by a CO(2-concentrating mechanism which improves photosynthesis by saturating the primary carboxylating enzyme, ribulose 1, 5-bisphosphate carboxylase/oxygenase (RuBisCO, with its preferred substrate CO(2. The site of CO(2-concentration is a protein bound micro-compartment called the carboxysome which contains most, if not all, of the cellular RuBisCO. The shell of β-type carboxysomes is thought to be composed of two functional layers, with the inner layer involved in RuBisCO scaffolding and bicarbonate dehydration, and the outer layer in selective permeability to dissolved solutes. Here, four genes (ccmK2-4, ccmO, whose products were predicted to function in the outer shell layer of β-carboxysomes from Synechococcus elongatus PCC 7942, were investigated by analysis of defined genetic mutants. Deletion of the ccmK2 and ccmO genes resulted in severe high-CO(2-requiring mutants with aberrant carboxysomes, whilst deletion of ccmK3 or ccmK4 resulted in cells with wild-type physiology and normal ultrastructure. However, a tandem deletion of ccmK3-4 resulted in cells with wild-type carboxysome structure, but physiologically deficient at low CO(2 conditions. These results revealed the minimum structural determinants of the outer shell of β-carboxysomes from this strain: CcmK2, CcmO and CcmL. An accessory set of proteins was required to refine the function of the pre-existing shell: CcmK3 and CcmK4. These data suggested a model for the facet structure of β-carboxysomes with CcmL forming the vertices, CcmK2 forming the bulk facet, and CcmO, a "zipper protein," interfacing the edges of carboxysome facets.

  3. Myxomycetes on carnaubeira (Copernicia prunifera (Miller H. E. Moore, Arecaceae Myxomycetes em carnaubeira (Copernicia prunifera (Miller H. E. Moore, Arecaceae

    Directory of Open Access Journals (Sweden)

    Mitra Mobin

    2000-04-01

    Full Text Available Entre dezembro/1994 e setembro/1995 foram realizadas sete excursões (2 a 4 dias cada ao Parque Nacional de Sete Cidades (4º5'-4º15'S, 41º30'-41º40'W, 450m alt., em Piripiri, Piauí, visando coletar frutificações de Myxomycetes em indivíduos de Coperniciaprunifera (Miller H. E. Moore, estabelecidos em área de cerrado, na localidade Lagoa Seca. As amostras foram herborizadas e incorporadas ao herbário UFP (Universidade Federal de Pernambuco, Recife, PE, com duplicatas no herbário TEPB (Universidade Federal do Piauí, Teresina, PI. Registrou-se apreciável incidência (70% de Myxomycetes na carnaubeira, em estipe vivo e folhas mortas. Dezesseis espécies, pertencentes às Ceratiomyxaceae (Ceratiomyxa lsp., Didymiaceae (Diachea lsp., Didymium 2spp., Physaraceae (Craterium 1sp., Physarum 4spp., Trichiaceae (Arcyria 2spp. e Stemonitaceae (Comatricha 3spp., Macbrideola lsp., Stemonitis lsp. foram registradas. Ceratiomyxaceae, representada por Ceratiomyxafruticulosa (Mull. Macbr., constitui primeira referência para o Estado do Piauí.From December, 1994 to September, 1995, seven collecting trips (2-4 days each were carried out in the "Parque Nacional de Sete Cidades" (4º5'-4º15'S, 41º30"-41º40'W, 450m alt., Piripiri, Piauí State, Brazil, in order to collect Myxomycetes fruiting bodies on carnauba palm trees (Coperniciaprunifera (Miller H. E. Moore, established in a place called "Lagoa Seca" (savanna-like stunted vegetation. The samples were herborized and included in the UFP Herbarium (Universidade Federal de Pernambuco, Recife, PE and the TEPB Herbarium (Universidade Federal do Piauí, Teresina, PI. In relation to the substrate, the "carnaubeira" showed a high incidence of Myxomycetes (70% on living stipitis and dead leaves. Sixteen species belonging to Ceratiomyxaceae (Ceratiomyxa lsp., Didymiaceae (Diachea lsp., Didymium 2spp., Physaraceae (Craterium lsp., Physarum 4spp., Trichiaceae (Arcyria 2spp. and Stemonitaceae (Comatricha 3spp

  4. Protein (Cyanobacteria): 71044 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available erase Synechococcus elongatus PCC 6301 MSDYSDRSDFSERQDRSSDDRPNFRRFDRDRPSEGRRLEGRSEGGYRGRDDRGGSGGYRQNRDDRGGFRGRDDRG...GYRGGDRDRPSEGRRFEGRSEGGYRGRDDRGGSGGYRQNRDDRGGFRGRDDRGGYRGGDRDRPSEGRRFEGRSEGGFRGRDDRGGSGGYRGRDDRGGFRGRDDRGGFRGRDDRGSSGSYRGRDDRG

  5. ORF Sequence: NC_006576 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ferase [Synechococcus elongatus PCC 6301] MSDYSDRSDFSERQDRSSDDRPNFRRFDRDRPSEGRRLEGRSEGGYRGRDDRGGSGGYRQNRDDRGGFRGRDDRG...GYRGGDRDRPSEGRRFEGRSEGGYRGRDDRGGSGGYRQNRDDRGGFRGRDDRGGYRGGDRDRPSEGRRFEGRSEGGFRGRDDRGGSGGYRGRDDRGGFRGRDDRGGFRGRDDRG...SSGSYRGRDDRGGFRGRDDRRDDRDNFRPSRDRELNREVNTSPAGDQEATDHELIYGRHAVLAALQ

  6. Active prey selection in two pelagic copepods feeding on potentially toxic and non-toxic dinoflagellates

    DEFF Research Database (Denmark)

    Schultz, Mette; Kiørboe, Thomas

    2009-01-01

    Grazing on two red tide dinoflagellates, the potentially toxic Karenia mikimotoi and the non-toxic Gyrodinium instriatum, was examined in two species of marine copepods, Pseudocalanus elongatus and Temora longicornis. Both copepods cleared K. mikimotoi at rates that were a little lower but compar......Grazing on two red tide dinoflagellates, the potentially toxic Karenia mikimotoi and the non-toxic Gyrodinium instriatum, was examined in two species of marine copepods, Pseudocalanus elongatus and Temora longicornis. Both copepods cleared K. mikimotoi at rates that were a little lower...

  7. Avaliação sazonal e espacial da qualidade das águas superficiais da bacia hidrográfica do rio Longá, Piauí, Brasil

    Directory of Open Access Journals (Sweden)

    Waneska Maria Vasconcelos Medeiros

    2018-05-01

    Full Text Available Este artigo teve como objetivo avaliar a qualidade das águas superficiais da bacia hidrográfica do rio Longá no Estado do Piauí, Brasil. Sete pontos foram monitorados, com base na proximidade de estações meteorológicas e acessibilidade, para obter melhores caracterizações espaciais e de ocupação da bacia hidrográfica. As amostras de água foram coletadas mensalmente (01/2015-12/2015. Foram medidas as variáveis: temperatura, pH, turbidez, condutividade elétrica, sólidos totais, fósforo total, nitrato, oxigênio dissolvido, demanda bioquímica de oxigênio (DBO e Escherichia coli (E. coli. Os resultados foram avaliados individualmente e comparados aos padrões brasileiros para águas doces de classe 2, conforme Resolução nº 357/2005 do Conselho Nacional do Meio Ambiente (CONAMA. Os dados foram avaliados utilizando-se análises multivariadas (agrupamento e análise de componentes principais - ACP. As variáveis E. coli, pH, turbidez, nitrato, DBO e condutividade elétrica variaram entre os dois períodos analisados (seco e chuvoso. As variáveis DBO, E. coli estiveram em desacordo com os padrões do CONAMA nos pontos urbanos P2, P3 e P5, devido à poluição difusa observada no período chuvoso. O agrupamento mostrou uma tendência espacial, apresentando dois grupos distintos (rural e urbano. A ACP identificou quatro componentes principais que explicaram uma variação de 58,64% nos dados. O Componente 1 (CP1 refletiu uma contribuição de poluentes relacionados à poluição difusa de áreas agrícolas e urbanas. O Componente 2 (CP2 foi fortemente associado à poluição, especialmente por esgoto doméstico não tratado. As outras ACPs também refletiram pressões de atividades antropogênicas nos corpos d’água.

  8. Flood-dominated fluvio-deltaic system: a new depositional model for the Devonian Cabeças Formation, Parnaíba Basin, Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Luiza Corral M.O. Ponciano

    2009-12-01

    Full Text Available The depositional model of the Cabeças Formation is re-evaluated in the context of the Devonian paleogeography of the Parnaíba Basin, and with particular reference to similarities between the formation's facies associations on the eastern border of the basin and the flood-dominated fluvio-deltaic system facies that have been discussed in recent literature. The widespread occurrence and nature of sigmoidal clinoforms (with asymptotic cross-stratification and climbing ripples of the Cabeças Formation are here considered as strong evidence of flood-influenced depositional settings. Sandy strata of the Passagem Member, in the vicinity of Pimenteiras and Picos (Piauí State, are interpreted as the distal part of fine-grained mouth-bar deposits interbedded with delta-front sandstone lobes showing hummocky cross-stratification. Richly fossiliferous levels, with diverse megainvertebrates and plant cuticles, occur within the delta-front lobes and the distal mouth-bar deposits, reflecting continuation of shallow marine conditions.O modelo deposicional da Formação Cabeças é reinterpretado no presente estudo com base no contexto paleogeográfico da Bacia do Parnaíba durante o Devoniano e na similaridade entre as fácies encontradas na Formação Cabeças com as fácies características dos sistemas flúvio-deltaicos dominados por inundações. O tipo das clinoformas sigmoidais (com estratificação cruzada assintótica e laminação cruzada cavalgante, e a sua predominância na Formação Cabeças, são consideradas como as principais evidências da influência de inundações nesta unidade. Depósitos do Membro Passagem, localizados nos arredores das cidades de Pimenteiras e Picos, são interpretados como o componente distal de um tipo de barra de desembocadura com a predominância de arenitos finos a conglomeráticos, intercalados com lobos arenosos tabulares de frente deltaica com estratificação cruzada hummocky. Diversos intervalos fossil

  9. ORF Alignment: NC_006576 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ECEASDVKSLLEALEQSFPGIKARLCDEQGQLRRFLNVYVN 62 ... ITVLIPTPLQKFTNNQASLECEASDVKS...LLEALEQSFPGIKARLCDEQGQLRRFLNVYVN Sbjct: 1 ... ITVLIPTPLQKFTNNQASLECEASDVKSLLEALEQSFPGIKARLCDEQGQLRRFLNVYVN 60 ... ...subunit ... [Synechococcus elongatus PCC 7942] ... Length = 89 ... Query: 3 ... ITVLIPTPLQKFTNNQASL

  10. ORF Alignment: NC_004113 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available se ... [Thermosynechococcus elongatus BP-1] ... Length = 99 ... Query: 9 ... PWKRTPVKTWRFPIKTTIRIGRAADNDVI...LNDILVSRYHAELSCYRDPENLGRWFLKSLG 68 ... PWKRTPVKTWRFPIKTTIRIGRAADNDVI...LNDILVSRYHAELSCYRDPENLGRWFLKSLG Sbjct: 1 ... PWKRTPVKTWRFPIKTTIRIGRAADNDVILNDILVSRYHAELSCYRDPENLGRWFLKSLG 60 ...

  11. CARACTERÍSTICAS QUÍMICO-MINERALÓGICAS DE FONTES DE PIGMENTOS MINERAIS EM DEPÓSITOS NATURAIS DO ENTORNO DO SÍTIO ARQUEOLÓGICO PEDRA DO CANTAGALO I, EM PIRIPIRI, PIAUÍ, BRASIL (Chemical-Mineralogical Features of Mineral Pigments Sources in Natural Deposits Surrounding the Pedra do Cantagalo I Archaeological Site, in Piripiri, Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Heralda Kelis Sousa Bezerra da Silva

    2017-12-01

    Full Text Available Pigmentos minerais de jazidas existentes no entorno do sítio arqueológico Pedra do Cantagalo I, localizado em Piripiri, Piauí, Brasil, foram investigados por fluorescência de raios X por dispersão de energia (EDXRF, difratometria de raios X (DRX pelo método do pó, análise elementar CHN e espectroscopia Mössbauer do 57Fe. O teor de ferro, determinado por EDXRF, expresso na forma de Fe2O3, é de ~15 massa% no pigmento cinza, ~12 massa% no amarelo e de ~19 a ~21 massa% no vermelho. Espectros Mössbauer mostram sextetos atribuíveis à hematita e dupletos de Fe3+ para os pigmentos cinza e vermelho. Alguns campos magnéticos hiperfinos relativamente baixos para a hematita sugerem que frações desse óxido de ferro têm pequenos tamanhos de partículas. O espectro Mössbauer para o pigmento amarelo mostrou apenas dois dupletos de Fe3+, atribuíveis a espécies superparamagnéticas, muito provavelmente incluindo goethita, de pequenos tamanhos de partículas, ou a ferro paramagnético na estrutura cristalina de aluminossilicatos. Os padrões de DRX mostram reflexões características de quartzo, muscovita, caulinita, ilita, albita, hematita, rutilo e anatásio. ENGLISH: Mineral pigments from deposits surrounding the Pedra do Cantagalo I archaeological site, in the municipality of Piripiri, Piauí-Brazil, were investigated by energy dispersive X-ray fluorescence (EDXRF, powder X-ray diffractometry (XRD, CHN elemental analysis and 57Fe Mössbauer spectroscopy. The iron contents, as determined by EDXRF, expressed as Fe2O3, is ~15 mass% for the gray, ~12 mass% for the yellow and from ~19 to ~21 mass% for the red pigment. Mössbauer spectra show sextets attributed to hematite and Fe3+ doublets, for the gray and red pigments. Even appearing as relatively low values, the hyperfine magnetic fields are assignable to hematite occurring in fractions of small particle sizes. The Mössbauer spectrum for the yellow pigment showed only two Fe3+ doublets

  12. Perfil sociodemográfico e adesão ao tratamento de dependentes de álcool em CAPS-ad do Piauí Perfil socio-demográfico y la adhesión al tratamiento de la dependencia del alcohol en CAPS-ad do Piauí Sociodemographic profile and adhesion to treatment for alcohol dependents at CAPS-ad in Piauí state

    Directory of Open Access Journals (Sweden)

    Claudete Ferreira de Souza Monteiro

    2011-03-01

    Full Text Available A pesquisa tem como objetivo levantar o perfil sociodemográfico e a adesão ao tratamento de dependentes do álcool no Centro de Atenção Psicossocial Álcool e Drogas. Trata-se de um estudo de natureza quantitativa, realizado no município de Teresina-PI. Os dados foram colhidos através do levantamento de informações presentes nos prontuários dos 227 sujeitos participantes desta pesquisa. Verificou-se que a maioria dos usuários era do sexo masculino (88,9%, com idade entre 19 e 59 anos (87,6%, solteiros (50,2%, com ensino fundamental (40%, empregados (48,6% e católicos (42,7%. A maior parte dos sujeitos faz uso diário de bebida alcoólica (55,% e 29% fazem uso de drogas ilícitas, sendo a maconha a mais consumida (95,3%. Em relação à adesão, 43,1% permaneceram em tratamento após três meses de admissão no CAPSad. Portanto, constatou-se a grande importância desse centro, com base em uma quantidade satisfatória de pacientes que aderem e que permanecem com o tratamento.El presente estudio tiene como objetivo analizar el perfil socio-demográfico e y la adhesión al tratamiento de la dependencia del alcohol en CAPS-ad. Se trata de un estudio de naturaleza cuantitativa, realizada en el CAPS-ad localizado en el municipio de Teresina, Piauí. Los datos fueron colectados analizando informaciones presentes en los prontuarios de los 227 sujetos participantes de esta investigación. Se verificó que la mayoría de los usuarios era del sexo masculino (el 88,9%, con edad entre 19 a 59 años (el 87.6% y solteros (el 50,2%, con enseñanza fundamental (el 40%, empleados (el 48,6%, y católicos (el 42,7%. La mayor parte de los sujetos hace uso diario de bebida alcohólica (el 55,%, y el 29% hace uso de drogas ilícitas, siendo la marihuana la más consumida (el 95,3%. En relación a la adhesión (el 43,1% permanecieron en tratamiento después de tres meses a partir de la admisión a CAPS-ad. Por lo tanto, se constató la gran importancia de ese

  13. ORF Alignment: NC_004113 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... elongatus BP-1] ... Length = 211 ... Query: 1 ... MATLEFLTFPDPAIAADHTLLLLHGWGANAADLISLGPLLAPHAQIYAAEAPF...PHPYVAQ 60 ... MATLEFLTFPDPAIAADHTLLLLHGWGANAADLISLGPLLAPHAQIYAAEAPFPHPYVA...Q Sbjct: 1 ... MATLEFLTFPDPAIAADHTLLLLHGWGANAADLISLGPLLAPHAQIYAAEAPFPHPYVAQ 60 ... Query: 121 AVGLRLPLAGLLVFSGYLV

  14. ORF Alignment: NC_006576 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available occus ... elongatus PCC 6301] ... Length = 168 ... Query: 361 RTIAERQRAIILRSDAVRKHLAGISLLERGGPEIY...SPEMSDRTXXXXXXXXXXXXXXXXX 420 ... RTIAERQRAIILRSDAVRKHLAGISLLERGGPEIYSPEMS...DRT ... Sbjct: 17 ... RTIAERQRAIILRSDAVRKHLAGISLLERGGPEIYSPEMSDRTYGRLLYLGLGLAQAGYR 76 ... Query: 481

  15. ORF Alignment: NC_006576 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ccus ... elongatus PCC 6301] ... Length = 155 ... Query: 2 ... AKTASTMLALGTAAPDFALPDVVSGRTVQLADFSDR...AGLLVMFICQHCPFVKHVEEELAA 61 ... AKTASTMLALGTAAPDFALPDVVSGRTVQLADFSDRAGLLVM...FICQHCPFVKHVEEELAA Sbjct: 1 ... AKTASTMLALGTAAPDFALPDVVSGRTVQLADFSDRAGLLVMFICQHCPFVKHVEEELAA 60 ... Query: 122 DF

  16. [Evaluation of ten fish species to be included as part of renal diet, due to their protein, phosphorus and fatty acids content].

    Science.gov (United States)

    Castro-González, Maria Isabel; Maafs-Rodríguez, Ana Gabriela; Pérez-Gil Romo, Fernando

    2012-06-01

    Because renal disease is highly complex, its nutritional treatment is complicated and many foods are restricted, including fish because its phosphorus content. The aim of the present study was to analyze ten fillet fish species, commonly consumed in Mexico (Cyprinus carpio carpio, Ophichthus rex, Symphurus elongatus, Eucinostomus entomelas, Chirostoma patzcuaro, Bairdiella chrysoura, Salmo salar Oreochromis urolepis hornorum, Sphyraena guachancho, Istiophorus albicans), to determine their phosphorus (P), protein (Pr), cholesterol, sodium, potassium, vitamins D3 and E, and n-3 PUFA (EPA+DHA) according to the AOAC techniques, in order to identify which species could be included in renal diet; particularly because of their risk:benefit relations (calculated with those results). Protein values ranged from 16.5 to 33.5g/100 g of fillet; the specie with the highest phosphorus contest was Salmo salar, and with the lowest, Symphurus elongatus. EPA+DHA quantity ranged from 79.64 mg/100 g to 1,381.53 mg/100 g. Considering de P/Pr relation recommended to renal patients, all analyzed species (except Salmo salar, Ophichthus rex and Istiophorus albicans) could be included in their diet. As for the P/EPA+DHA relation, the species most recommended to renal patients are Symphurus elongatus, Bairdiella chrysoura and Sphyraena guachancho.

  17. Análise da mudança da vegetação nativa ocasionada pela expansão agrícola no município de Uruçuí, Piauí

    Directory of Open Access Journals (Sweden)

    Julianna Lima Queiroz

    2016-03-01

    Full Text Available Atualmente, a agricultura moderna no Brasil, que antes era concentrada na região Centro-Sul, difundiu-se nos estados do Nordeste. O Piauí vivenciou uma rápida ocupação do Cerrado, devido a introdução de grandes projetos de agricultura e o município de Uruçuí se destaca na produção de grãos, principalmente a soja. O objetivo dessa pesquisa foi analisar a mudança da vegetação nativa ocasionada pela expansão agrícola do município de Uruçuí por meio do sensoriamento remoto. O processo foi dividido em fases, tais como: aquisição de dados, pré-processamento, extrapolação e classificação de imagens. Foram utilizadas imagens dos anos de 2003 do satélite Landsat 5 TM e de 2013 do Landsat 8 TM. As imagens desses dois anos foram georreferenciadas e fundidas através da técnica de mosaico com o programa QGIS. Por fim, foi produzido um mapa temático área degradada, para avaliar a evolução do processo de substituição da vegetação. Os dados obtidos nesse estudo indicaram que ocorreu a evolução das áreas de lavouras de grãos no município de Uruçuí. A análise das figuras revelou a substituição da vegetação nativa da região ocasionada principalmente pela crescente expansão agrícola. É de extrema importância o monitoramento dessas grandes áreas, para que seja possível quantificar o nível de exploração e reduzir os impactos ambientais.

  18. Conhecimento tradicional das marisqueiras de Barra Grande, área de proteção ambiental do delta do Rio Parnaíba, Piauí, Brasil

    Directory of Open Access Journals (Sweden)

    Simone Tupinambá Freitas

    2012-08-01

    Full Text Available Na comunidade de Barra Grande localizada no litoral do Piauí, as mulheres dos pescadores, conhecidas localmente como marisqueiras, extraem do manguezal vários tipos de moluscos para comercialização e em maior escala para a subsistência. Dados sobre a atividade de mariscagem, conceitos de conservação e aspectos socioeconômicos do contexto em que ocorre a atividade de cata dos moluscos, foram revelados após a aplicação de protocolos estruturados e semiestruturados. O molusco bivalve Anomalocardia brasiliana (Gmelin, 1791, popularmente denominado de marisco, é caracterizado por ser um importante recurso para a subsistência, sendo o mais coletado pela comunidade, seguido da Mytella charruana (d'Orbigny, 1842, o sururu, explorado para a comercialização por ter o maior valor de mercado. O conhecimento das marisqueiras sobre A. brasiliana foi comparado com literatura especializada, muitas vezes mostrando-se em harmonia com esta. Demonstra-se assim que o conhecimento tradicional deve ser valorizado para delineamento de programas de gestão de recursos pesqueiros da região. Quanto aos modos de pensar, foi revelado que 82,81% das marisqueiras praticam manejo para a conservação da A. brasiliana ao coletar apenas os indivíduos de maior tamanho, e 80,86% consideram que não existe poluição nos pontos de coletas. O surgimento de uma Associação exclusiva e cooperativa para as marisqueiras é necessário para a valorização do trabalho por elas desenvolvido, visto que há uma média estimada de 351 kg de carne sendo extraídos mensalmente.En la comunidad de Barra Grande, situada en la costa del estado de Piaui, las esposas de los pescadores, localmente llamadas de "marisqueiras", extraen de los manglares diversos tipos de moluscos para su comercialización, haciendo de esta actividad en una fuente de subsistencia. Informaciones detalladas y sistemáticas sobre la actividad de cosecha de mariscos, del contexto en el que se desarrolla la

  19. Influence of seasonal, diel, lunar, and other environmental factors on upstream fish passage in the igarapava fish ladder, Brazil

    Science.gov (United States)

    Bizzotto, P.M.; Godinho, Alexandre L.; Vono, V.; Kynard, B.; Godinho, Hugo P.

    2009-01-01

    Upstream fish passage was evaluated during 12 months in the vertical-slot Igarapava Fish Ladder constructed around Igarapava Dam, in the heavily dammed Grande River, Southeast Brazil. A video monitoring system was used to observe 61,621 fish that passed the ladder, of which 93.5% were identified to 15 taxa. Among the migratory species, the most abundant were Pimelodus maculatus (33.6% of all fish), Leporinus octofasciatus (31.4%), Leporinus friderici (4.5%), and Prochilodus lineatus (3.1%). Seven taxa were classified as nonmigratory, and of these taxa, the small Bryconamericus stramineus was the most abundant (12.7%) of all fishes. Passage of the 'nonmigratory' taxa upstream in the ladder shows they are migratory in this system and have a strong behavioural drive to move to upstream habitat. Passage of most taxa had a strong seasonal pattern. While some species passed primarily during the day, others showed a distinct nocturnal pattern. Lunar phase and water temperature also strongly affected passage of some taxa. Rainfall and dam discharge had a small or null influence on most taxa; perhaps due to the fairly small catchment area of the reservoir and the highly regulated discharge at Igarapava Dam. ?? 2009 John Wiley & Sons A/S.

  20. Tipos polínicos encontrados em amostras de méis de Apis mellifera em Picos, Estado do Piauí Pollinic types found in honey samples of Apis mellifera from Picos, State of Piaui

    Directory of Open Access Journals (Sweden)

    Geni da Silva Sodré

    2008-06-01

    Full Text Available Com o objetivo de determinar os tipos polínicos de méis produzidos por Apis mellifera L., 1758, no município de Picos, Estado do Piauí, foram realizadas análises polínicas de 35 amostras de méis coletadas entre novembro e dezembro de 2001 no Laboratório de Apicultura do Departamento de Entomologia, Fitopatologia e Zoologia Agrícola da Escola Superior de Agricultura "Luiz de Queiroz", Universidade de São Paulo. A identificação dos tipos polínicos foi realizada por meio de descrições obtidas em literatura especializada. Os resultados demonstraram que foram encontrados 36 tipos polínicos, distribuídos em 18 famílias botânicas, sendo consideradas como pólen dominante Piptadenia sp. (Mimosaceae, Mimosa caesalpiniiaefolia Benth. (Mimosaceae, M. verrucosa Benth. (Mimosaceae e Croton urucurana Baill. (Euphorbiaceae.This research deals with the pollinic types of honeys produced by Apis mellifera L., 1758 in the municipality of Picos, State of Piaui were determined in the Laboratory of Apiculture, Department of Entomology, Phytopathology and Agricultural Zoology, College of Agriculture ‘Luiz de Queiroz', University of São Paulo, in Piracicaba, State of São Paulo, pollinic analysis of 36 honey samples collected in November and December of 2001. The identification of e pthollinic made by types was specialized literature. The results showed that 36 types of pollen were found, distributed in 18 botanical families, and the following plant species were considered as dominant Piptadenia sp. (Mimosaceae, Mimosa caesalpiniiaefolia Benth. (Mimosaceae, M. verrucosa Benth. (Mimosaceae and Croton urucurana Baill. (Euphorbiaceae.

  1. PREVALENCE OF AMERICAN TRYPANOSOMIASIS AND LEISHMANIASES IN DOMESTIC DOGS IN A RURAL AREA OF THE MUNICIPALITY OF SÃO JOÃO DO PIAUÍ, PIAUÍ STATE, BRAZIL

    Science.gov (United States)

    PEREZ, Taliha Dias; FIGUEIREDO, Fabiano Borges; JUNIOR, Artur Augusto Mendes VELHO; SILVA, Valmir Laurentino; MADEIRA, Maria de Fátima; BRAZIL, Reginaldo Peçanha; COURA, José Rodrigues

    2016-01-01

    SUMMARY Chagas disease and the leishmaniases are endemic zoonoses of great importance to public health in the state of Piauí, Brazil. The domestic dog (Canis familiaris) is a major reservoir, host of Trypanosoma cruzi and Leishmania spp. in both urban and rural areas, playing an important role in the transmission of these parasites. The present study evaluated the prevalence of both infectious diseases in dogs of a rural area in the municipality of São João do Piauí, Piauí State. One hundred twenty-nine blood samples were collected for serological assessment: for the leishmaniases, 49 (38%) animals tested positive by the Dual-Path Platform technology (DPP), nine (6%) by the Enzyme-linked Immunosorbent Assay (ELISA), and 19 (14.7%) by the Indirect Fluorescent Antibody test (IFA); while for American Trypanosomiasis, 36 (28%) dogs were reagent by ELISA and 21 by IFA. Of the 129 dogs sampled, 76 were submitted to xenodiagnosis, bone marrow aspiration and skin biopsy to perform parasitological tests whose results showed only one (2.3%) positive skin sample for Trypanosoma caninum and one positive xenodiagnosis for T. cruzi, both results confirmed by molecular assays. Three hundred triatomines of the species Triatoma brasiliensis and 552 phlebotomines - 509 (97%) of the species Lutzomyia longipalpis, were also captured. PMID:27828620

  2. Caracterización de las comunidades de acridios (Orthoptera: Acridoidea del partido de Benito Juárez, sudeste de la provincia de Buenos Aires, Argentina Grasshopper (Orthoptera: Acridoidea community structure in Benito Juárez county, in outhern Buenos Aires province, Argentina

    Directory of Open Access Journals (Sweden)

    María Laura de Wysiecki

    2004-12-01

    Full Text Available Se analizó la riqueza, densidad, constancia y distribución de especies de acridios, en distintas comunidades vegetales (1997-2002 en el partido de Benito Juárez, sudeste de la provincia de Buenos Aires. Las comunidades vegetales se categorizaron en pastizales nativos, comunidades halófilas, pasturas sin disturbio, pasturas con moderado disturbio y pasturas con alto disturbio. En total se registraron 23 especies de acridios. Los melanoplinos dominaron en casi todas las comunidades vegetales, excepto en las halófilas que se caracterizaron por la presencia de un acridino, Covasacris pallidinota (Bruner. La riqueza de especies promedio por sitio por año, varió entre 2,10 ± 0,60 especies en las pasturas con moderado disturbio y 6,20 ± 0,58 especies en las comunidades halófilas. La riqueza de especies acumulada fue de 17 en los pastizales nativos, 14 en las comunidades halófilas, 19 en las pasturas sin disturbio, 18 en las pasturas con moderado disturbio y 14 en las pasturas con alto disturbio. La densidad promedio de acridios fue máxima en el 2001 y 2002. Dichroplus pratensis Bruner y Dichroplus elongatus Giglio-Tos dominaron en los pastizales nativos y en las pasturas con alto disturbio, C. pallidinota en las comunidades halófilas, D. elongatus y Scotussa lemniscata (Stål en las pasturas sin disturbio y en las pasturas con moderado disturbio. La estructura taxonómica de las comunidades de acridios fue constante en los pastizales nativos, las comunidades halófilas y las pasturas. Hubo pocas especies de amplia distribución e intermedias y las raras fueron las más numerosas. De las 23 especies registradas en todos los sitios, D. elongatus fue la única de amplia distribución. Históricamente, para la zona de estudio, Dichroplus maculipennis (Blanch fue señalada como la especie dominante. Sin embargo, nuestros resultados sugieren que en la actualidad la especie dominante es D. elongatus. Si bien resulta imposible conocer las causas

  3. Mobile acoustic telemetry data - Lingcod Stock Enhancement: ecological interactions, fishery contributions, and life history

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Lingcod (Ophiodon elongatus) populations along the West Coast of North America have recovered from overfishing, but the status of genetically distinct lingcod in...

  4. Tag effect data - Lingcod Stock Enhancement: ecological interactions, fishery contributions, and life history

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Lingcod (Ophiodon elongatus) populations along the West Coast of North America have recovered from overfishing, but the status of genetically distinct lingcod in...

  5. Coccidioidomycosis: an unusual cause of acute respiratory distress syndrome

    Directory of Open Access Journals (Sweden)

    Kelson Nobre Veras

    2003-01-01

    Full Text Available A male farmer, 20 years old, from the countryside of the State of Piauí, developed acute respiratory infection. Despite adequate antimicrobial therapy, his conditions worsened, requiring mechanical ventilation. His X-rays showed diffuse pulmonary infiltrates. His PaO2/FiO2 ratio was 58. Direct microscopy and culture of tracheal aspirates showed the presence of Coccidioides immitis. Autochthonous cases of coccidioidomycosis have only recently been described in Brazil, most of them from the State of Piauí. C. immitis has been isolated from humans, dogs and armadillos (Dasypus novemcinctus, and also from soil samples of armadillo's burrows. Failure to respond to antimicrobial therapy and a patient's origin from recognized endemic areas should alert to the possibility of acute pulmonary coccidioidomycosis.

  6. Description of a new genus and species of the Coleopterous family Colydidae

    NARCIS (Netherlands)

    Reitter, E.

    1882-01-01

    Corpus valde elongatum, convexum. Antennae 11-articulatae, sub frontis margine ante oculos insertae, apicem versus sensim incrassatae, articulo ultimo rotundato. Fronte tateribus elevata. Oculi antice emarginati. Prothorax elongatus, carinatus. Scutellum minutum. Elytra punctatostriata, interstitiis

  7. Removal of triazine herbicides from freshwater systems using photosynthetic microorganisms

    International Nuclear Information System (INIS)

    Gonzalez-Barreiro, O.; Rioboo, C.; Herrero, C.; Cid, A.

    2006-01-01

    The uptake of the triazine herbicides, atrazine and terbutryn, was determined for two freshwater photosynthetic microorganisms, the green microalga Chlorella vulgaris and the cyanobacterium Synechococcus elongatus. An extremely rapid uptake of both pesticides was recorded, although uptake rate was lower for the cyanobacterium, mainly for atrazine. Other parameters related to the herbicide bioconcentration capacity of these microorganisms were also studied. Growth rate, biomass, and cell viability in cultures containing herbicide were clearly affected by herbicide uptake. Herbicide toxicity and microalgae sensitivity were used to determine the effectiveness of the bioconcentration process and the stability of herbicide removal. C. vulgaris showed higher bioconcentration capability for these two triazine herbicides than S. elongatus, especially with regard to terbutryn. This study supports the usefulness of such microorganisms, as a bioremediation technique in freshwater systems polluted with triazine herbicides

  8. Removal of triazine herbicides from freshwater systems using photosynthetic microorganisms

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez-Barreiro, O. [Laboratorio de Microbiologia, Facultad de Ciencias, Universidad de A Coruna, Campus da Zapateira s/n. 15071 A Coruna (Spain); Rioboo, C. [Laboratorio de Microbiologia, Facultad de Ciencias, Universidad de A Coruna, Campus da Zapateira s/n. 15071 A Coruna (Spain); Herrero, C. [Laboratorio de Microbiologia, Facultad de Ciencias, Universidad de A Coruna, Campus da Zapateira s/n. 15071 A Coruna (Spain); Cid, A. [Laboratorio de Microbiologia, Facultad de Ciencias, Universidad de A Coruna, Campus da Zapateira s/n. 15071 A Coruna (Spain)]. E-mail: cid@udc.es

    2006-11-15

    The uptake of the triazine herbicides, atrazine and terbutryn, was determined for two freshwater photosynthetic microorganisms, the green microalga Chlorella vulgaris and the cyanobacterium Synechococcus elongatus. An extremely rapid uptake of both pesticides was recorded, although uptake rate was lower for the cyanobacterium, mainly for atrazine. Other parameters related to the herbicide bioconcentration capacity of these microorganisms were also studied. Growth rate, biomass, and cell viability in cultures containing herbicide were clearly affected by herbicide uptake. Herbicide toxicity and microalgae sensitivity were used to determine the effectiveness of the bioconcentration process and the stability of herbicide removal. C. vulgaris showed higher bioconcentration capability for these two triazine herbicides than S. elongatus, especially with regard to terbutryn. This study supports the usefulness of such microorganisms, as a bioremediation technique in freshwater systems polluted with triazine herbicides.

  9. Gênero, vulnerabilidade das mulheres ao HIV/Aids e ações de prevenção em bairro da periferia de Teresina, Piauí, Brasil Gender, women's vulnerability to HIV/Aids and preventive actions at a neighborhood on the periphery of Teresina, Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Maria da Consolação Pitanga de Sousa

    2008-06-01

    taken by the government concerning these matters. This article reports the findings of a qualitative research conducted with adult women who had stable marital relationships and lived on the poor periphery of the city of Teresina, state of Piauí. This paper identified the group's vulnerability to HIV based on the use of condoms, as well as the relations of this aspect to the gender relations experienced by the partners and the role of the Family Health Program in this context. It was verified that most of the women do not continuously use condoms because they are living a stable relationship with a single partner; nevertheless, they consider themselves vulnerable since they do not trust their partners' sexual behavior. The negotiation with the partner about the use of condoms is nearly always difficult, and at times, it is necessary to mention the need to avoid unwanted pregnancy. It is important to highlight that the Family Health Program does not approach the discussion about sexuality and gender relations in the health education of the woman, for it focuses on prenatal care and on the reduction of gynecologic cancer.

  10. Association of level of digestible energy in total length, weight of gonads and gonadosomatic index of female Piauçu (“Leporinus macrocephalus”, SPIX 1829 Associação do nível de energia digestível no comprimento total, peso das gônadas e índice gonadossomático de fêmeas de Piauçu (“Leporinus macrocephalus”, SPIX 1829 em estágio pós-larval

    Directory of Open Access Journals (Sweden)

    Fernanda Keley Silva Pereira

    2010-03-01

    Full Text Available The objective of this work was to associate the energy digestible level of the diet to ovary development in post larval stage. Twenty-four female fish were used with weight and average initial length of 0.33 ± 0.11 g and 2.94 ± 0.39 cm, respectively. There were four treatments: 2600, 2700, 2800, and 2900 kcal of DE/kg of ration. Digestible energy levels influenced the final weight up to the estimated level of 2757.142kcal/kg. However, there was no significant effect for total length, gonad weight, and gonadossomatic index in females. The level of digestible energy did not provide better initial development of the ovary. This information may guide new experiments, to improve the conditions of cultivation, to value the activity on the economic sense as well as increase the number of fingerlings for aquaculture.Objetivou-se associar o nível de energia digestível da dieta com o desenvolvimento ovariano em estagio pós-larval. Foram usadas 24 fêmeas com peso e comprimento médio inicial de 0,33 ± 0,11g e 2,94 ± 0,39cm, respectivamente. Foram realizados 4 tratamentos: 2600; 2700; 2800 e 2900kcal de ED/Kg de ração. No presente estudo, o nível de energia digestível influenciou no peso final até o nível estimado de 2757,142kcal/kg. Entretanto, não apresentou efeito significativo para comprimento total, peso da gônada e índice gonadossomático das fêmeas. O nível de energia digestível não proporcionou melhor desenvolvimento inicial do ovário. Essas informações poderão nortear novos experimentos, melhorar as condições de cultivo, valorizar a atividade no sentido econômico, assim como aumentar o número de alevinos destinados à aquicultura.

  11. ORF Alignment: NC_006576 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006576 gi|56750058 >1v7zA 4 251 11 256 7e-49 ... ref|YP_170759.1| creatinine amido...hydrolase [Synechococcus elongatus PCC 6301] ... dbj|BAD78239.1| creatinine amidohydrolase [Synechoco

  12. PipY, a Member of the Conserved COG0325 Family of PLP-Binding Proteins, Expands the Cyanobacterial Nitrogen Regulatory Network

    Directory of Open Access Journals (Sweden)

    José I. Labella

    2017-07-01

    Full Text Available Synechococcus elongatus PCC 7942 is a paradigmatic model organism for nitrogen regulation in cyanobacteria. Expression of genes involved in nitrogen assimilation is positively regulated by the 2-oxoglutarate receptor and global transcriptional regulator NtcA. Maximal activation requires the subsequent binding of the co-activator PipX. PII, a protein found in all three domains of life as an integrator of signals of the nitrogen and carbon balance, binds to PipX to counteract NtcA activity at low 2-oxoglutarate levels. PII-PipX complexes can also bind to the transcriptional regulator PlmA, whose regulon remains unknown. Here we expand the nitrogen regulatory network to PipY, encoded by the bicistronic operon pipXY in S. elongatus. Work with PipY, the cyanobacterial member of the widespread family of COG0325 proteins, confirms the conserved roles in vitamin B6 and amino/keto acid homeostasis and reveals new PLP-related phenotypes, including sensitivity to antibiotics targeting essential PLP-holoenzymes or synthetic lethality with cysK. In addition, the related phenotypes of pipY and pipX mutants are consistent with genetic interactions in the contexts of survival to PLP-targeting antibiotics and transcriptional regulation. We also showed that PipY overexpression increased the length of S. elongatus cells. Taken together, our results support a universal regulatory role for COG0325 proteins, paving the way to a better understanding of these proteins and of their connections with other biological processes.

  13. DNA BARCODING IKAN HIAS INTRODUKSI

    Directory of Open Access Journals (Sweden)

    Melta Rini Fahmi

    2017-05-01

    Full Text Available Identifikasi spesies menjadi tantangan dalam pengelolaan ikan hias introduksi baik untuk tujuan budidaya maupun konservasi. Penelitian ini bertujuan untuk melakukan identifikasi molekuler ikan hias introduksi yang beredar di pembudidaya dan pasar ikan hias Indonesia dengan menggunakan barcode DNA gen COI. Sampel ikan diperoleh dari pembudidaya dan importir ikan hias di kawasan Bandung dan Jakarta. Total DNA diekstraksi dari jaringan sirip ekor dengan menggunakan metode kolom. Amplifikasi gen target dilakukan dengan menggunakan primer FishF1, FishF2, FishR1, dan FishR2. Hasil pembacaan untai DNA disejajarkan dengan sekuen yang terdapat pada genbank melalui program BLAST. Identifikasi dilakukan melalui kekerabatan pohon filogenetik dan presentasi indeks kesamaan dengan sekuen genbank. Hasil identifikasi menunjukkan sampel yang diuji terbagi menjadi lima grup, yaitu: Synodontis terdiri atas lima spesies, Corydoras: empat spesies, Phseudoplatystoma: tiga spesies, Botia: tiga spesies, dan Leporinus: tiga spesies dengan nilai boostrap 99-100. Indeks kesamaan sekuen menunjukkan sebanyak 11 spesies memiliki indeks kesamaan 99%-100% dengan data genbank yaitu Synodontis decorus, Synodontis eupterus, Synodontis greshoffi, Botia kubotai, Botia lohachata, Rasbora erythromicron, Corydoras aeneus, Gyrinocheilus aymonieri, Eigenmannia virescens, Leporinus affinis, Phractocephalus hemioliopterus. Dua spesies teridentifikasi sebagai hasil hibridisasi (kawin silang yaitu Leopard catfish (100% identik dengan Pseudoplatystoma faciatum dan Synodontis leopard (100% identik dengan Synodontis notatus. Hasil analisis nukleotida penciri diperoleh tujuh nukleotida untuk Synodontis decora, 10 nukleotida untuk Synodontis tanganyicae, 13 nukleotida untuk Synodontis euterus, empat nukleotida untuk Synodontis notatus, dan 14 untuk Synodontis grashoffi. Kejelasan identifikasi spesies ikan menjadi kunci utama dalam budidaya, perdagangan, manajemen, konservasi, dan pengembangan

  14. Toward solar biodiesel production from CO2 using engineered cyanobacteria.

    Science.gov (United States)

    Woo, Han Min; Lee, Hyun Jeong

    2017-05-01

    Metabolic engineering of cyanobacteria has received attention as a sustainable strategy to convert carbon dioxide to various biochemicals including fatty acid-derived biodiesel. Recently, Synechococcus elongatus PCC 7942, a model cyanobacterium, has been engineered to convert CO2 to fatty acid ethyl esters (FAEEs) as biodiesel. Modular pathway has been constructed for FAEE production. Several metabolic engineering strategies were discussed to improve the production levels of FAEEs, including host engineering by improving CO2 fixation rate and photosynthetic efficiency. In addition, protein engineering of key enzyme in S. elongatus PCC 7942 was implemented to address issues on FAEE secretions toward sustainable FAEE production from CO2. Finally, advanced metabolic engineering will promote developing biosolar cell factories to convert CO2 to feasible amount of FAEEs toward solar biodiesel. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  15. Description d’une nouvelle espèce de Gyrinide du Musée de Leyde

    NARCIS (Netherlands)

    Regimbart, M.

    1884-01-01

    Long. 6 3/4 mm. (ano excepto). — Oblongo-ovalis, elongatus, mediocriter convexus; supra in regionibus glabris purpureocupreus, nitidus, subtilissime reticulatus, in regionibus punctato-tomentosis obscure cœruleus et subopacus, anguste pallide testaceo limbatus; infra pallide testaceus, pedibus

  16. New synonymy in Cuban Tilloclytus (Coleoptera: Cerambycidae: Anaglyptini)

    Science.gov (United States)

    Examination of holotypes of Tilloclytus (Coleoptera: Cerambycidae: Anaglyptini) in the Fernando de Zayas collection (Havana, Cuba) and the Museum of Comparative Zoology, Harvard University reveals that T. elongatus Zayas (1975) is a new synonym of T. rufipes Fisher (1942)....

  17. Species-specific differences of the spectroscopic properties of P700 - Analysis of the influence of non-conserved amino acid residues by site-directed mutagenesis of photosystem I from Chlamydomonas reinhardtii

    NARCIS (Netherlands)

    Witt, H.; Bordignon, E.; Carbonera, D.; Dekker, J.P.; Karapetyan, N.; Teutloff, C.; Webber, A.; Lubitz, W.; Schlodder, E.

    2003-01-01

    We applied optical spectroscopy, magnetic resonance techniques, and redox titrations to investigate the properties of the primary electron donor P700 in photosystem I (PS I) core complexes from cyanobacteria (Thermosynechococcus elongatus, Spirulina platensis, and Synechocystis sp. PCC 6803), algae

  18. Cyanobacterial photosystem II at 2.9-A resolution and the role of quinones, lipids, channels and chloride

    NARCIS (Netherlands)

    Guskov, Albert; Kern, Jan; Gabdulkhakov, Azat; Broser, Matthias; Zouni, Athina; Saenger, Wolfram

    Photosystem II (PSII) is a large homodimeric protein-cofactor complex located in the photosynthetic thylakoid membrane that acts as light-driven water:plastoquinone oxidoreductase. The crystal structure of PSII from Thermosynechococcus elongatus at 2.9-A resolution allowed the unambiguous assignment

  19. Genome Engineering of the 2,3-Butanediol Biosynthetic Pathway for Tight Regulation in Cyanobacteria.

    Science.gov (United States)

    Nozzi, Nicole E; Atsumi, Shota

    2015-11-20

    Cyanobacteria have gained popularity among the metabolic engineering community as a tractable photosynthetic host for renewable chemical production. However, though a number of successfully engineered production systems have been reported, long-term genetic stability remains an issue for cyanobacterial systems. The genetic engineering toolbox for cyanobacteria is largely lacking inducible systems for expression control. The characterization of tight regulation systems for use in cyanobacteria may help to alleviate this problem. In this work we explore the function of the IPTG inducible promoter P(L)lacO1 in the model cyanobacterium Synechococcus elongatus PCC 7942 as well as the effect of gene order within an operon on pathway expression. According to our experiments, P(L)lacO1 functions well as an inducible promoter in S. elongatus. Additionally, we found that gene order within an operon can strongly influence control of expression of each gene.

  20. Phenotypic characterization of naturalized swine breeds in Brazil, Uruguay and Colombia

    Directory of Open Access Journals (Sweden)

    Concepta McManus

    2010-06-01

    Full Text Available Morphometric data was collected on 859 naturalized swine in Brazil (Piau, Tatu, Nilo, Caruncho, Casco de Burro, Moura, Monteiro and Rabo de Peixe, Colombia (Criolla Zungo, Sanpedreño and Casco de Mula and Uruguay (Mamellado, both on farm and in published material. Information was collected on breed, sex and age, as well as various morphometric measurements. Analysis of variance was carried out using PROC MIXED of SAS ® on phenotypic data. The coefficients of variance varied between 11.50 and 83.81%, and the coefficient of determination was medium to high. Females were in general smaller for most measurements than males, showing sexual dimorphism. The Moura was the closest naturalized breed to the commercial breeds, followed by the Piau, while the Monteiro was the furtherest. The dendrogram obtained from morphological information showed a division of the pigs into three groups. Characterization was possible using morphological and morphometric data.Foram colhidos dados morfométricos de 859 suínos naturalizados do Brasil (Piau, Tatu, Nilo, Caruncho, Casco de Burro, Moura, Monteiro e Rabo de Peixe, Colômbia (Criolla Zungo, Sanpedreño e Casco de Mula e Uruguai (Mamellado Dados sobre raça, sexo e idade foram coletados, assim como varias avaliações morfométricas. A análise de variância foi realizada utilizando-se o procedimento PROC GLM do SAS sobre os dados morfométricos. Os coeficientes de variância oscilaram de 11,50 a 83,81% e o coeficiente de determinação foi de moderado a alto. As fêmeas foram em geral menores na maioria das avaliações em relação aos machos, indicando dimorfismo sexual. A Moura foi a raça naturalizada mais próxima das raças comerciais, seguida da Piau, enquanto a Monteiro apresentou-se mais distante. O dendograma obtido a partir de informações morfológicas apresentou divisão dentro de três grupos. A caracterização foi possível utilizando-se dados morfológicos e morfométricos.

  1. Coléoptères nouveaux de l’Afrique du Musée de Leyde

    NARCIS (Netherlands)

    Fairmaire, L.

    1888-01-01

    Long. 22 à 25 mill. — Elongatus, convexus, fuscus aut brunneo-castaneus, modice nitidus, fulvo-pubescens; capite dense punctato, inter oculos sat late impresso, antice declivi, margine obtuse rotundato; antennis fuscis, medium corporis attingentibus, articulo 1° punctato, 2° minuto, 3° vix majore,

  2. Electric field effects on red chlorophylls, b-carotenes and P700 in cyanobacterial photosystem I complexes.

    NARCIS (Netherlands)

    Frese, R.N.; Palacios, M.A.; Azzizi, A.; van Stokkum, I.H.M.; Kruip, J.; Rögner, M.; Karapetyan, N.V.; Schlodder, E.; van Grondelle, R.; Dekker, J.P.

    2002-01-01

    We have probed the absorption changes due to an externally applied electric field (Stark effect) of Photosystem I (PSI) core complexes from the cyanobacteria Synechocystis sp. PCC 6803, Synechococcus elongatus and Spirulina platensis. The results reveal that the so-called C719 chlorophylls in S.

  3. Some Silurian (Llandovery) monograptids from Saudi Arabia

    NARCIS (Netherlands)

    El-Khayal, A.A.

    1985-01-01

    Three species of Monograptus are recognized from Qusayba, Al-Qasim Province, Saudi Arabia. The Qusayba Shales Member of the Tabuk Formation in central Saudi Arabia contains M. decipiens decipiens, M. ex gr. barrandei and M. elongatus, associated with other graptolites. This assemblage is indicative

  4. Annual and spatial variability in endo- and ectoparasite infections of North Sea cod (Gadus morhua Linnaeus, 1758) larvae, post-larvae and juveniles

    DEFF Research Database (Denmark)

    Mehrdana, Foojan; Bahlool, Qusay Z. M.; Skovgaard, Alf

    2014-01-01

    A parasitological investigation was performed on a total of 5380 Atlantic cod larvae, post-larvae and small juveniles sampled from the North Sea during a period of five years. The copepod Caligus elongatus (Von Nordmann, 1832) and the nematode Hysterothylacium aduncum (Rudolphi, 1802) were found ...

  5. Integrated Scenarios of Regional Development in Two Semi-Arid States of North-Eastern Brazil

    NARCIS (Netherlands)

    Döll, Petra; Krol, Martinus S.

    2002-01-01

    Scenario analysis of the future is an important tool for supporting sustainability-oriented regional planning. To assist regional planning in two federal states in semi-arid North-eastern Brazil, Ceará and Piauí, we developed integrated qualitative¿quantitative scenarios that show potential

  6. Two new species of Colletteidae (Crustacea: Tanaidacea: Tanaidomorpha from Bransfield Strait, Antarctica

    Directory of Open Access Journals (Sweden)

    Juliana L. Segadilha

    2017-11-01

    Full Text Available Samples from deep benthic areas in the Bransfield Strait, Antarctica, revealed the presence of two new species of Colletteidae: Filitanais elongatus sp. nov. and Macrinella lavradoae sp. nov. Filitanais elongatus sp. nov. resembles F. moskalevi in its habitus; it can, however, be distinguished by characters such as the pleonites and pleotelson with lateral margins parallel and the uropod exopod being longer than half of the first endopod article. Macrinella lavradoae sp. nov. differs from the other species of Macrinella in the shape of the uropod and the pleotelson, with the uropod exopod shorter than the first article of the endopod, the uropod about as long as the pleotelson and the pleotelson with a rounded tip. The number of species of Tanaidacea recorded from Antarctica increases to 162, while the colletteids are now represented by 16 species. Moreover, the diagnosis of the genus Filitanais is herein modified.

  7. Acute oral toxicity and cytotoxicological evaluation of the ethanol ...

    African Journals Online (AJOL)

    Lucas Nicolau

    2015-02-02

    Feb 2, 2015 ... Piauí, Brazil. 2Medicinal .... at 24 ± 1°C and 12 h light dark cycle with water and food (FRI-LAB .... (OECD, 2001), acute treatment with distilled water and .... Farm. 2:50-. 53. OECD (Organisation for Economic Co-operation and ...

  8. Seleção preliminar de genótipos de pinheira em Bom Jesus-PI Preliminary selection of sugar apple genotypes in Bom Jesus county, Piauí state, Brazil

    Directory of Open Access Journals (Sweden)

    Ítalo Herbert Lucena Cavalcante

    2011-01-01

    Full Text Available A pinheira (Annona squamosa L. ocorre espontaneamente no Nordeste Brasileiro, onde é explorada de forma extrativista, caracterizando-se pela falta de manejo adequado e material genético selecionado. Nesse sentido, foi realizado um experimento com objetivo de avaliar a produtividade, as características físicas e químicas de frutos de dez genótipos de pinheira no município de Bom Jesus, PI. Adotou-se delineamento inteiramente casualizado, com tratamentos representados por dez genótipos de pinheira e três repetições. Foram avaliadas as seguintes variáveis: vitamina C, acidez titulável, sólidos solúveis, relação SS/AT "ratio", diâmetros longitudinal e transversal, relação DL/DT, número se sementes por fruto, massa dos frutos e produção por planta. Os genótipos apresentam diferenças quanto às características químicas, físicas e produtivas dos frutos. Os genótipos foram agrupados em sete grupos, com destaque para o grupo III (Gen-02 e grupo IV (Gen-05, fato que explicitou as diferenças entre os genótipos de pinheira quanto às características produtivas e químicas e físicas dos frutos. Genótipos Gen-01 e Gen-02 apresentam potencial para instalação em plantios comerciais, pela produtividade, formato do fruto ou por caracterizarem fontes naturais de vitamina C.The sugar apple (Annona squamosa L. is native to tropical America, occurring spontaneously in Northeastern Brazil, where it is exploited mainly as subsistence without adequate management and without genetic material selection. An experiment was developed aiming to evaluate yield, physical and chemical characteristics of the fruits of ten sugar apple genotypes in Bom Jesus, Piauí State, Brazil. A completely randomized design with treatments represented by ten genotypes and three replications was adopted. The following variables were evaluated: vitamin C, titratable acidity, soluble solids, SS/TA ratio, longitudinal diameter and transverse, LD/TD, number of

  9. Redescription of Prosthenhystera obesa (Diesing, 1850 (Callodistomidae, Digenea with New Host Records and Data on Morphological Variability

    Directory of Open Access Journals (Sweden)

    Anna Kohn

    1997-03-01

    Full Text Available Prosthenhystera obesa (Diesing,1850 Travassos, 1922 from the gall bladder of Astyanax bimaculatus, Caranx gibbosus, Galeocharax humeralis, Leporinus copelandii, Pimelodus fur, Pseudopimelodus roosevelti, Salminus brevidens, Salminus maxillosus and from the new hosts, Cynopotamus amazonum and Triurobrycon lundii is redescribed, demonstrating a large morphological variation, mainly in body and testes size and shape. New hosts harbouring immature specimens of P. obesa are presented: Brycon sp., Leporellus vittatus, Pachyurus squamipinnis, Pimelodus clarias, Pseudoplatystoma corruscans and Salminus hilarii. Scanning electron microscopy micrographies, original figures and measurements of adult and immature specimens from different Brazilian hosts and localities are presented

  10. Água levemente salinizada aumenta a eficiência da larvicultura de peixes neotropicais

    Directory of Open Access Journals (Sweden)

    Rosângela Kiyoko Jomori

    2013-08-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito de água levemente salinizada sobre a larvicultura intensiva do tambaqui, matrinxã, apaiari e piau, durante os dias iniciais de alimentação. As larvas foram mantidas em água artificialmente salinizada, em concentrações de 0 (água doce a 14 g L-1 de NaCl (intervalo de 2,0 g L-1, e foram alimentadas com duas porções diárias de náuplios de Artemia, de acordo com protocolo para cada espécie, em delineamento inteiramente casualizado, com três repetições. Larvas de tambaqui, matrinxã e apaiari podem ser cultivadas em até 2 g L-1 de concentração salina, sem prejuízos ao crescimento e à sobrevivência. Larvas de piau foram mais tolerantes e suportaram até 4 g L-1 de concentração salina. Acima disto, a mortalidade dos peixes aumentou e chegou a 100% à concentração de 6 g L-1 (matrinxã e apaiari e de 10 g L-1 (tambaqui. A salinização da água a 2 g L-1 proporcionou maior taxa de sobrevivência a larvas de matrinxã e maior crescimento a larvas de tambaqui, apaiari e piau. Estas duas últimas espécies apresentaram melhor crescimento com a maior quantidade de náuplios. Água salinizada a 2 g L-1 é benéfica para as espécies estudadas, pois otimiza o potencial de crescimento das larvas e o uso de náuplios de Artemia como alimento vivo.

  11. Participação social e luta anticorrupção na gestão pública: ganhos e limitações (Social participation and anti-corruption fight in public management: gains and limitations

    Directory of Open Access Journals (Sweden)

    Teresa Cristina Coelho Matos

    2017-12-01

    Full Text Available RESUMO O artigo aborda as ações empreendidas na sociedade brasileira para o enfrentamento da corrupção, prática recorrente no Brasil, considerada como um dos principais problemas do mundo atual. Focaliza o protagonismo da Sociedade Civil, destacando êxitos e barreiras para o controle e a fiscalização dos investimentos públicos, sem a intermediação de representantes. Traz como ilustração a experiência da Força Tarefa Popular (FTP, um movimento de articulação da Sociedade Civil que atua no Estado do Piauí, utilizando como principal estratégia de ação a “Marcha Contra a Corrupção e pela Vida”, a fim de sensibilizar e mobilizar pessoas e entidades para a luta anticorrupção, sendo, a Marcha, o ambiente empírico da pesquisa de Doutorado em Políticas Públicas, pela Universidade Federal do Piauí (UFPI, utilizando o estudo de caso como método de análise e como instrumentos metodológicos as entrevistas narrativas e a observação direta, à luz da observação participante.   Palavras-chave: Participação social. Sociedade civil. Luta anticorrupção.   ABSTRACT The article deals with actions taken in the Brazilian society to face the corruption, a recurring practice in Brazil which is considered one of the main problems of the world nowadays. It focuses on the protagonism of the civil society, highlighting successes and barriers toward the control and monitoring of the public investments, without the intermediation of representatives. It is an illustration of the experience of the Popular Task Force (FTP, a civil society movement that has been active in the State of Piauí using as main action strategy the "March Against Corruption and for Life", to raise to awareness and mobilize people and organizations to the anti-corruption fight, being the March, the empirical environment of the PhD research in Public Policies, by the Federal University of Piauí (UFPI, using the case study as its method of analysis, and

  12. Pollen analysis in honey samples from the two main producing regions in the Brazilian northeast

    Directory of Open Access Journals (Sweden)

    Geni da S. Sodré

    2007-09-01

    Full Text Available Knowledge about the botanical source of honey is very important for the beekeeper while it indicates adequate and abundant supply sources of nectar and pollen for the bees, thus contributing toward improved yield. The present study means to identify the pollen types occurring in 58 samples of honey produced in two states of the northeastern region of Brazil, Piauí (38 samples and Ceará (20 samples, and to verify the potential of the honey plants during the months of February to August. The samples were obtained directly from beekeepers in each state and analyzed at the Apiculture Laboratory of the Entomology Section of Escola Superior de Agricultura "Luiz de Queiroz", USP, Piracicaba, State of São Paulo, Brazil. The pollen analysis was performed using the acetolysis method. The samples were submitted to both a qualitative and a quantitative analysis. The dominant pollen in the State of Ceará is from Mimosa caesalpiniaefolia, M. verrucosa, Borreria verticillata, Serjania sp., and a Fabaceae pollen type, while in the State of Piauí it is from Piptadenia sp., M. caesalpiniaefolia, M. verrucosa, Croton urucurana and Tibouchina sp.O conhecimento da origem botânica do mel é de grande importância para o apicultor por indicar fontes adequadas e de abundante suprimento de néctar e pólen para as abelhas, contribuindo, desta forma, para uma melhor produção. O presente estudo teve como objetivo identificar os tipos polínicos em 58 amostras de méis produzidos em dois estados da região nordeste do Brasil, Piauí (38 amostras e Ceará (20 amostras, verificando o potencial das plantas apícolas durante os meses de fevereiro a agosto. As amostras foram obtidas diretamente de apicultores de cada Estado e analisadas no Laboratório de Apicultura do Setor de Entomologia da Escola Superior de Agricultura "Luiz de Queiroz", USP, Piracicaba, Estado de São Paulo. A análise polínica foi realizada utilizando-se o método da acetólise. As amostras foram

  13. Detection of quantitative trait loci on chromosomes 1,2,3,12,14,15, X in pigs: performance characteristics

    NARCIS (Netherlands)

    Paixao, D.M.; Carneiro, P.L.S.; Paiva, S.R.; Sousa, K.R.S.; Verardo, L.L.; Braccini Neto, J.; Pinto, A.P.G.; Marubayashi Hidalgo, A.; Nascimento, C.; Périssé, I.V.; Lopes, P.S.; Guimaraes, S.E.F.

    2013-01-01

    The accomplishment of the present study had the objective of mapping Quantitative Trait Loci (QTL) related to performance traits in a F2 pig population developed by mating two Brazilian Piau breed sires with 18 dams from a commercial line (Landrace × Large White × Pietrain). The linkage map for this

  14. Mapping of QTL on chromosomes 1, 2, 3, 12, 14, 15 and X in pigs: characteristics carcass and quality of meat

    NARCIS (Netherlands)

    Paixao, D.M.; Carneiro, P.L.S.; Paiva, S.R.; Sousa, K.R.S.; Verardo, L.L.; Braccini Neto, J.; Pinto, A.P.G.; Marubayashi Hidalgo, A.; Nascimento, C.; Périssé, I.V.; Lopes, P.S.; Guimaraes, S.E.F.

    2012-01-01

    The accomplishment of the present study had as objective to map Quantitative Trait Loci (QTL) associated to carcass and quality traits in a F2 pig population developed by mating two Brazilian Piau breed sires with 18 dams from a commercial line (Landrace × Large White × Pietrain). The linkage map

  15. Minimal tool set for a prokaryotic circadian clock.

    Science.gov (United States)

    Schmelling, Nicolas M; Lehmann, Robert; Chaudhury, Paushali; Beck, Christian; Albers, Sonja-Verena; Axmann, Ilka M; Wiegard, Anika

    2017-07-21

    Circadian clocks are found in organisms of almost all domains including photosynthetic Cyanobacteria, whereby large diversity exists within the protein components involved. In the model cyanobacterium Synechococcus elongatus PCC 7942 circadian rhythms are driven by a unique KaiABC protein clock, which is embedded in a network of input and output factors. Homologous proteins to the KaiABC clock have been observed in Bacteria and Archaea, where evidence for circadian behavior in these domains is accumulating. However, interaction and function of non-cyanobacterial Kai-proteins as well as homologous input and output components remain mainly unclear. Using a universal BLAST analyses, we identified putative KaiC-based timing systems in organisms outside as well as variations within Cyanobacteria. A systematic analyses of publicly available microarray data elucidated interesting variations in circadian gene expression between different cyanobacterial strains, which might be correlated to the diversity of genome encoded clock components. Based on statistical analyses of co-occurrences of the clock components homologous to Synechococcus elongatus PCC 7942, we propose putative networks of reduced and fully functional clock systems. Further, we studied KaiC sequence conservation to determine functionally important regions of diverged KaiC homologs. Biochemical characterization of exemplary cyanobacterial KaiC proteins as well as homologs from two thermophilic Archaea demonstrated that kinase activity is always present. However, a KaiA-mediated phosphorylation is only detectable in KaiC1 orthologs. Our analysis of 11,264 genomes clearly demonstrates that components of the Synechococcus elongatus PCC 7942 circadian clock are present in Bacteria and Archaea. However, all components are less abundant in other organisms than Cyanobacteria and KaiA, Pex, LdpA, and CdpA are only present in the latter. Thus, only reduced KaiBC-based or even simpler, solely KaiC-based timing systems

  16. Rectal prolapse in agouti (Dasyprocta aguti - Case report

    Directory of Open Access Journals (Sweden)

    Wagner Costa Lima

    2014-12-01

    Full Text Available ABSTRACT. Lima W.C., Lima D.A.S.D., Rodrigues M.C., Quessada A.M., Último A.P. & Pinheiro B.C. [Rectal prolapse in agouti (Dasyprocta aguti - Case report.] Prolapso retal em cutia (Dasyprocta aguti - Relato de caso. Revista Brasileira de Medicina Veterinária, 36(4:409-411, 2014. Curso de Pós-Graduação em Ciência Animal, Centro de Ciências Agrárias, Universidade Federal do Piauí, Campus Socopo, Teresina, PI 64049-550, Brasil. E-mail: atsocamil@yahoo.com.br The clinical signs and treatment of rectal prolapse in agouti (Dasyprocta agouti are described in the present report. The animal, coming from the Nucleus of wild animals of the Federal University of Piauí, was admited in Veterinary Hospital of the institution with a reddish and shiny mass out of the anus. At the clinic examination rectal prolapse was diagnosed. The rectum was manually repositioned and was made a purse-string suture. However, the prolapse relapsed, then was performed colopexy following celiotomy, which was efficient to reduce rectal prolapse in the agouti.

  17. A AVALIAÇÃO DE IMPLEMENTAÇÃO CURRICULAR POR MEIO DA CONSTRUÇÃO DE CENÁRIOS PROSPECTIVOS

    Directory of Open Access Journals (Sweden)

    Germaine Elshout de Aguiar

    2013-05-01

    Full Text Available O presente texto, parte integrante de um relatório em nível de pós-doutoramento concluído em 2010, trata da construção de cenários prospectivos para avaliar a implementação das diretrizes curriculares do ensino médio no estado do Piauí. Por meio da etnopesquisa com abordagem multirreferencial realizada com a equipe escolar da única instituição pública do Estado que as adotou de fato desde 2008, e especialistas em educação da Universidade Federal do Piauí, elaboramos uma matriz estrutural segundo Godet (2000 para definimos as variáveis de ligação, explicativas, autônomas e as de resultados, o que nos possibilitou compreender quais as com maior condicionamento e com grau significativo de dependência, para chegarmos aos cenários tendencial e normativo para o estabelecimento, servindo, dessa forma, como meio unificador para encaminhar estratégias de planejamento participativo.

  18. Ictiofauna and fishing in the surroundines of Penedo, Alagoas

    Directory of Open Access Journals (Sweden)

    Emerson Carlos Soares

    2011-02-01

    Full Text Available Twenty-eight months of data collection revealed the profile of fishing production in the region of lower São Francisco. Catches consist of up to approximately 22 species, of which five are the most common: Prochilodus argenteus, Leporinus spp., Anchoviella vaillantii, Centropomus spp. and Eugerres brasilianus. The fishing fleet that is active in the region is made up of non-motorized canoes, motorized canoes and boats, and the vast majority employ the most common types of fishing nets and other fishing gear. The CPUE (Catch per Unit Effort ranged from 2.5kg/fisherman/day to 4.5kg/fisherman/day during the months analyzed.

  19. A PÓS-GRADUAÇÃO EM ENFERMAGEM DO NORDESTE EM DISCUSSÃO NA UFPI

    Directory of Open Access Journals (Sweden)

    Maria do Livramento Fortes Figueiredo

    2007-07-01

    Full Text Available O Programa de Pós-Graduação em Enfermagem da Universidade Federal do Piauí realizou no período de 28 a 30 de junho de 2017 o V Encontro de Pós-Graduação em Enfermagem do Nordeste (V ENPGENE, com o tema central: “A Pós-Graduação em Enfermagem do Nordeste”. O evento contou com o apoio do “Programa de Apoio a Eventos no País – PAEP/CAPES” e da Universidade Federal do Piauí, atém de parceiros locais: Centro Universitário UNINOVAFAPI e o Conselho Regional de Enfermagem do Piauí (COREn-PI. Esta iniciativa visou resgatar a sequência cronológica deste importante encontro para nossa região, considerando que a última edição ocorreu no ano de 2009, na cidade de Natal/RN. Além do mais os eventos regionais mostram-se como uma oportunidade de fortalecimento e intercâmbios entre os programas de pós-graduação e na melhoria dos indicadores de qualidade dos cursos já existentes. O V ENPGENE reuniu alunos de graduação, de pós-graduação e pesquisadores em nível de excelência, o que propiciou a socialização do conhecimento produzido nos programas de pós-graduação brasileiros, permitindo a adoção de novas metodologias, tecnologias e inovações nas pesquisas em enfermagem, tornando desta forma, os resultados das mesmas aplicáveis no ensino e na assistência à saúde da população. Tivemos a participação de palestrantes de várias instituições de ensino da enfermagem: da Escola de Enfermagem de Ribeirão Preto da Universidade de São Paulo (EERP/USP, da Escola Paulista de Enfermagem da Universidade Federal de São Paulo (EPE/UNIFESP, da Universidade Federal de Tocantins (PPGEnf/TO, da Universidade Federal do Estado do Rio de Janeiro (PPGEnf/UNIRIO, da Universidade Federal de Pernambuco (PPGEnf/PE, da Universidade Federal do Ceará (PPGEnf/UFC, da Universidade Federal da Paraíba (PPGEnf/UFPB, da Universidade Federal do Maranhão (PPGEnf/UFMA, do Centro Universitário UNINOVAFAPI, da Universidade Federal do

  20. Toward the crystallization of photosystem II core complex from Pisum sativum L

    Czech Academy of Sciences Publication Activity Database

    Prudnikova, T.; Gavira, J. A.; Řezáčová, Pavlína; Molina, E.P.; Hunalová, Ivana; Sviridova, E.; Schmidt, V.; Kohoutová, J.; Kutý, Michal; Kaftan, D.; Vácha, F.; Garcia-Ruiz, J. M.; Kutá-Smatanová, Ivana

    2010-01-01

    Roč. 10, č. 8 (2010), s. 3391-3396 ISSN 1528-7483 R&D Projects: GA MŠk(CZ) LC06010 Institutional research plan: CEZ:AV0Z50520514; CEZ:AV0Z50510513; CEZ:AV0Z60870520; CEZ:AV0Z40550506 Keywords : crystal-structure * cyanobacterial * elongatus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.390, year: 2010

  1. Towards a synthetic chloroplast.

    Directory of Open Access Journals (Sweden)

    Christina M Agapakis

    2011-04-01

    Full Text Available The evolution of eukaryotic cells is widely agreed to have proceeded through a series of endosymbiotic events between larger cells and proteobacteria or cyanobacteria, leading to the formation of mitochondria or chloroplasts, respectively. Engineered endosymbiotic relationships between different species of cells are a valuable tool for synthetic biology, where engineered pathways based on two species could take advantage of the unique abilities of each mutualistic partner.We explored the possibility of using the photosynthetic bacterium Synechococcus elongatus PCC 7942 as a platform for studying evolutionary dynamics and for designing two-species synthetic biological systems. We observed that the cyanobacteria were relatively harmless to eukaryotic host cells compared to Escherichia coli when injected into the embryos of zebrafish, Danio rerio, or taken up by mammalian macrophages. In addition, when engineered with invasin from Yersinia pestis and listeriolysin O from Listeria monocytogenes, S. elongatus was able to invade cultured mammalian cells and divide inside macrophages.Our results show that it is possible to engineer photosynthetic bacteria to invade the cytoplasm of mammalian cells for further engineering and applications in synthetic biology. Engineered invasive but non-pathogenic or immunogenic photosynthetic bacteria have great potential as synthetic biological devices.

  2. Algal and invertebrate bioindicators detect sewage effluent along the coast of Titahi Bay, Wellington, New Zealand

    International Nuclear Information System (INIS)

    Dudley, B.D.; Shima, J.S.

    2010-01-01

    Sewage effluent contains both dissolved and particulate matter that can affect coastal ecosystems and cascade through food webs. We used δ 15 N and δ 13 C ratios to explore performance of a kelp (Carpophyllum maschalocarpum) and two invertebrates (a grazing isopod, Amphoroidea media, and a filter-feeding crab, Petrolisthes elongatus) as bioindicators along a gradient of sewage exposure. These species vary in trophic status and, consequently, are likely to assimilate sewage constituents differently into food webs. δ 15 N values in C. maschalocarpum and A. media were highest near the sewage outfall and decreased with increasing distance from the outfall. δ 13 C values in these two species did not appear to be reliable predictors of sewage concentrations in seawater. In contrast, δ 13 C ratios for P. elongatus were consistently depleted at sites nearest the sewage outfall, indicating the consumption of δ 13 C-depleted sewage particulates. These results suggest there is value in multiple-isotope and multi-species bioindicator approaches both for detecting sewage dispersal patterns and understanding the incorporation of sewage-derived nutrients into food webs. (author). 79 refs., 3 figs.

  3. Lego clocks: building a clock from parts.

    Science.gov (United States)

    Brunner, Michael; Simons, Mirre J P; Merrow, Martha

    2008-06-01

    A new finding opens up speculation that the molecular mechanism of circadian clocks in Synechococcus elongatus is composed of multiple oscillator systems (Kitayama and colleagues, this issue, pp. 1513-1521), as has been described in many eukaryotic clock model systems. However, an alternative intepretation is that the pacemaker mechanism-as previously suggested-lies primarily in the rate of ATP hydrolysis by the clock protein KaiC.

  4. A new species of Parichoronyssus (Acari: Dermanyssoidea: Macronyssidae) from bats of the genus Phyllostomus (Chiroptera: Phyllostomidae) in Peru and Venezuela, with keys to the species of Parichoronyssus.

    Science.gov (United States)

    Morales-Malacara, Juan B; Guerrero, Ricardo

    2007-01-01

    Parichoronyssus bakeri new species was found on two phyllostomid bats species, the greater spear-nosed bat, Phyllostomus hastatus (Pallas), and the lesser spear-nosed bat, Phyllostomus elongatus (E. Geoffroy), in Pakitza, National Park Manu, Madre de Dios, Peru, including additional material examined from Venezuela. The female, male, deutonymph, and protonymph are described and illustrated. A key to the seven species of Parichoronyssus is provided.

  5. Live microbial cells adsorb Mg2+ more effectively than lifeless organic matter

    Science.gov (United States)

    Qiu, Xuan; Yao, Yanchen; Wang, Hongmei; Duan, Yong

    2018-03-01

    The Mg2+ content is essential in determining different Mg-CaCO3 minerals. It has been demonstrated that both microbes and the organic matter secreted by microbes are capable of allocating Mg2+ and Ca2+ during the formation of Mg-CaCO3, yet detailed scenarios remain unclear. To investigate the mechanism that microbes and microbial organic matter potentially use to mediate the allocation of Mg2+ and Ca2+ in inoculating systems, microbial mats and four marine bacterial strains ( Synechococcus elongatus, Staphylococcus sp., Bacillus sp., and Desulfovibrio vulgaris) were incubated in artificial seawater media with Mg/Ca ratios ranging from 0.5 to 10.0. At the end of the incubation, the morphology of the microbial mats and the elements adsorbed on them were analyzed using scanning electronic microscopy (SEM) and energy diffraction spectra (EDS), respectively. The content of Mg2+ and Ca2+ adsorbed by the extracellular polysaccharide substances (EPS) and cells of the bacterial strains were analyzed with atomic adsorption spectroscopy (AAS). The functional groups on the surface of the cells and EPS of S. elongatus were estimated using automatic potentiometric titration combined with a chemical equilibrium model. The results show that live microbial mats generally adsorb larger amounts of Mg2+ than Ca2+, while this rarely is the case for autoclaved microbial mats. A similar phenomenon was also observed for the bacterial strains. The living cells adsorb more Mg2+ than Ca2+, yet a reversed trend was observed for EPS. The functional group analysis indicates that the cell surface of S. elongatus contains more basic functional groups (87.24%), while the EPS has more acidic and neutral functional groups (83.08%). These features may be responsible for the different adsorption behavior of Mg2+ and Ca2+ by microbial cells and EPS. Our work confirms the differential Mg2+ and Ca2+ mediation by microbial cells and EPS, which may provide insight into the processes that microbes use to

  6. A configuração da via pública interferindo na apreensão da praça: o caso de conjuntos habitacionais em Teresina

    Directory of Open Access Journals (Sweden)

    Wilza Gomes Reis Lopes

    2007-06-01

    Full Text Available Commerce and spaces of leisure already had been together for much time, in the Average Age the market assumed the role that today fits to the square of collective space of leisure. Today the market acquires the consumption function eminently, more is not lived deeply the environment and the people. The incessant search for the profit, or same for the survival, moves our society and each place that can potentially relieve money is explored to the maximum. Located houses next to moving streets are changedded quickly into commercial points, modifying the configuration of a space created for housing in commerce environment. But these ways are not populated only by private establishments, them also present public spaces, that suffer the consequences of these alterations. The present work presents a study of three squares located in the habitacionais sets Itararé, Piauí Park and Promorar Park, in the city of Teresina, Piauí, observing as the changes in the original function of the streets of entorno, that they had been projected, initially, as surrounding residential, have modified the performance of the public spaces.

  7. Pollen analysis in honey samples from the two main producing regions in the Brazilian northeast.

    Science.gov (United States)

    Sodré, Geni da S; Marchini, Luís C; Carvalho, Carlos A L de; Moreti, Augusta C de C C

    2007-09-01

    Knowledge about the botanical source of honey is very important for the beekeeper while it indicates adequate and abundant supply sources of nectar and pollen for the bees, thus contributing toward improved yield. The present study means to identify the pollen types occurring in 58 samples of honey produced in two states of the northeastern region of Brazil, Piauí (38 samples) and Ceará (20 samples), and to verify the potential of the honey plants during the months of February to August. The samples were obtained directly from beekeepers in each state and analyzed at the Apiculture Laboratory of the Entomology Section of Escola Superior de Agricultura "Luiz de Queiroz", USP, Piracicaba, State of São Paulo, Brazil. The pollen analysis was performed using the acetolysis method. The samples were submitted to both a qualitative and a quantitative analysis. The dominant pollen in the State of Ceará is from Mimosa caesalpiniaefolia, M. verrucosa, Borreria verticillata, Serjania sp., and a Fabaceae pollen type, while in the State of Piauí it is from Piptadenia sp., M. caesalpiniaefolia, M. verrucosa, Croton urucurana and Tibouchina sp.

  8. ¿La práctica de la siembra directa en cultivos de soja favorece las poblaciones de acridios (Orthoptera: Acrididae en el partido de Benito Juárez? Does the direct tillage practice in soybean crops favour grasshopper populations (Orthoptera: Acrididae, in Benito Juárez county?

    Directory of Open Access Journals (Sweden)

    Daniel Scuffi

    2012-12-01

    Full Text Available Considerando el desarrollo del cultivo de soja en siembra directa en el partido de Benito Juárez, y que algunos autores sostienen que esta práctica favorece los acridios, se evaluó la riqueza de especies y la abundancia en soja con siembra directa y convencional. Se registraron siete especies (Aleuas lineatus Stål, Covasacris pallidinota (Bruner, Baeacris pseudopunctulatus (Ronderos, Dichroplus elongatus Giglio-Tos, Dichroplus maculipennis (Blanchard, Dichroplus pratensis Bruner y Scotussa lemniscata (Stål. La riqueza de especies acumulada en los diferentes cultivos fue similar (p> 0,05. En soja de primera con siembra directa, se registraron 2,3 ± 0,19 especies, en soja de primera con siembra convencional 1,45 ± 0,15 especies y en soja de segunda con siembra directa 2,25 ± 0,28 especies. Dichroplus elongatus fue la especie más abundante en todos los cultivos y en todos los momentos. Las restantes presentaron baja abundancia y se registraron en algunos momentos. No existió diferencia (p> 0,05 en la abundancia de tucuras entre los cultivos y en las diferentes fechas de muestreo. La baja riqueza de especies registrada estaría relacionada con la baja diversidad vegetal de los cultivos. Este estudio no mostró diferencias en la abundancia y riqueza de especies de acuerdo a la labranza utilizada.Considering the development of the soybean crops using direct tillage in Benito Juárez county, and taking into account that for some authors this practice favours the grasshopper populations, the abundance and species richness in soybean with direct and conventional tillage were evaluated. Seven species were registered (Aleuas lineatus Stål, Covasacris pallidinota (Bruner, Baeacris pseudopunctulatus (Ronderos, Dichroplus elongatus Giglio-Tos, Dichroplus maculipennis (Blanchard, Dichroplus pratensis Bruner and Scotussa lemniscata (Stål. The accumulated richness was similar (p> 0.05, along the different crops; 2.3 ± 0.19 species were registered in

  9. European Science Notes Information Bulletin Reports on Current European/ Middle Eastern Science

    Science.gov (United States)

    1988-07-01

    multilayered published (Brazier-Smith, 1987). aluminum plate. Felsen used this problem to show the M. Piau (Institute de Mdchanique de Grenoble, utility of...outstanding institu- based on small thermometric elements such as thin wires tional arrangement of world class in SUP’AERO...DERA is a sor investigations are not limited to thermometric center of excellence in robotics and automization of elements, and, in the case of

  10. Intervalo hídrico ótimo utilizado como indicador da qualidade física em perímetro irrigado.

    Directory of Open Access Journals (Sweden)

    Thiago Lima da Silva

    2016-12-01

    Full Text Available Um dos principais parâmetros para se avaliar as condições físicas do solo é o Intervalo Hídrico Ótimo (IHO que tem como conceito a incorporação de uma faixa de quantidade de água, as limitações ao desenvolvimento das plantas por aeração, água disponível e resistência do solo à penetração das raízes. O objetivo neste trabalho foi avaliar o intervalo hídrico ótimo de um Latossolo amarelo distrófico com diferentes usos e manejos no perímetro irrigado Piauí, município de Lagarto-SE. Foram selecionados 4 (quatro  diferentes tipos de usos do solo que tivessem diferentes manejos agrícolas no perímetro irrigado Piauí e três profundidades 0-0,15 m; 0,15-0,30 m e 0,30-0,45 m avaliadas nesses sistemas. Os usos distintos consistiram em: a área sob cultivo de pimenteira malagueta (Capsicum frutensens L; b área sob cultivo de maracujazeiro amarelo (Passiflora edulis sims; c área sob cultivo de maracujazeiro em consórcio com pimenteira malagueta; d área sob pastagem (Brachiaria decumbens. O intervalo hídrico ótimo foi determinado por meio da curva de resistência à penetração e da curva de retenção da água no solo e mostrou-se importante indicador para avaliação da qualidade física do solo avaliado sob diferentes usos no perímetro irrigado Piauí, onde o manejo empregado no solo afetou a qualidade física deste, já que, em profundidades maiores todos os usos apresentam restrições ao desenvolvimento do sistema radicular, sendo que, a pastagem e o consórcio maracujá e a pimenteira apresentam essa restrição já na profundidade superficial 0-0-15m.

  11. SELEÇÃO MASSAL EM VARIEDADES DE MILHO CRIOULO NO SUL DO PIAUÍ

    Directory of Open Access Journals (Sweden)

    Rejane Teixeira do Nascimento

    2014-06-01

    Full Text Available O objetivo deste trabalho foi realizar a seleção massal de duas variedades de milho crioulo no sul do Piauí, disponibilizando-se populações melhoradas para que possam ser utilizadas em programas de melhoramento. O experimento foi conduzido na área experimental da Universidade Federal do Piauí (UFPI/CPCE. Utilizou-se o método de seleção massal dentro de populações, com dois ciclos de seleção, período 2011/2013, utilizando-se sementes de duas variedades de milho crioulo: milho roxo peruano e milho palha roxa (procedência Espírito Santo (ES e procedência São Paulo (SP. As características avaliadas foram: altura da planta, altura da espiga, massa da espiga e produção. As populações foram submetidas a intensidades de seleção de 10%, nos dois ciclos de seleção. O índice econômico de seleção foi calculado baseando-se no método de Mulamba & Mock. A seleção massal para as variedades de milho crioulo foi eficiente pelas altas variabilidades encontradas para os caracteres estudados, sendo que a variedade Milho Palha Roxa SP, por apresentar maior produtividade e ser responsiva a seleção massal, pode ser indicada para agricultores familiares com baixo emprego de tecnologia da região. Palavras-chave: zea mays, variabilidade genética, melhoramento, amplitude.  MASS SELECTION IN VARIETIES OF LANDRACE MAIZE IN SOUTHERN PIAUÍ ABSTRACT The objective of this work was to perform the mass selection of two varieties of landrace maize in southern Piauí, with available improved populations to can be used in breeding programs. Experiment was conducted in the experimental area of Federal University of Piauí (UFPI/CPCE. We used the method of mass selection within populations, with two cycles of selection, period 2011/2013, using  two maize landrace varieties seeds: Peruvian purple maize and purple straw maize (from Espírito Santo (ES and from São Paulo (SP. The evaluated characteristics were: plant height, ear height, mass of

  12. Production of organic sesame in family agriculture in Northeast Brazil. = Produção de gergelim orgânico em agricultura familiar no Nordeste brasileiro.

    Directory of Open Access Journals (Sweden)

    Vicente de Paula Queiroga

    2011-08-01

    Full Text Available This study aimed to present a broad overview of technology used or intended for family farmers of Piauí, in order to encourage and expand the cultivation of sesame in organized rural communities assisted by the FFA, Fraternity of São Francisco de Assis (FFA. Because it is an offer of employment and income for the semiarid region of Northeast, Embrapa Cotton identified important technological processes for the production system and marketing, which maximize yield and improve grain quality sesame required by the international market, whichhas, organic sesame seeds, the higher price compared to its value in the domestic market. Based on the results obtained with the production of organic sesame seeds, harvested in the communities of family farmers of state of the Piaui in the years 2008 (10 Mg, 2009 (17 Mg and 2010 (24 Mg, it was concluded that there was expansion inthe cultivation of sesame in the state of Piaui, through the adoption, by farmers, planting of appropriate technology,management and harvesting, and improved marketing system, which were represented by white seed variety of greater market acceptance, soil preparation semi-mechanized, use of manual mechanical seeder exempting thethinning of the production and marketing through cooperative prepayment of yield.ResumoEste trabalho teve como objetivo apresentar o amplo panorama tecnológico utilizado ou previsto para os produtores familiares do Piauí, visando incentivar e expandir o cultivo do gergelim nas comunidades rurais organizadas, assistidas pela Fraternidade de São Francisco de Assis (FFA. Por ser uma proposta de emprego erenda para a região semiárida do Nordeste, a Embrapa Algodão identificou importantes processos tecnológicos referentes ao sistema de produção e à comercialização, que potencializam o rendimento e melhoram a qualidade dos grãos de gergelim exigida pelo mercado internacional, que tem, no gergelim orgânico, mais alto preço comparado ao seu valor no

  13. First report of two species of scarab beetles (Coleoptera, Scarabaeidae inside nests of Azteca cf. chartifex Forel (Hymenoptera, Formicidae in Brazilian Amazonian Rainforest

    Directory of Open Access Journals (Sweden)

    João Rafael Alves-Oliveira

    Full Text Available ABSTRACT We report for the first time the occurrence of two species of scarab beetles, Phileurus carinatus declivis Prell, 1914 (Scarabaeidae: Dynastinae and Cyclidius elongatus (Olivier, 1789 (Cetoniinae: Cremastocheilini inside nests of Azteca cf. chartifex Forel, 1896, a neotropical arboreal ant species. This report indicates that these two beetle species are associated, at least as inquilines, to this ant species, although the nature of this relationship remains unclear.

  14. Identification of soybean cultivars for the southwestern region of the Cerrado in Piauí=Indentificação de cultivares de soja para a região sudoeste do Cerrado piauiense

    Directory of Open Access Journals (Sweden)

    Nerison Pedro Bohn

    2016-06-01

    Full Text Available The soybean in the southwestern region of the Cerrado in Piaui occupies a prominent position in agricultural production. However, levels of productivity are still below the national average, a fact due, among other factors, to the inappropriate choice of cultivar. The aim of this study was to select the most productive soybean cultivars to be used in the region of the Cerrado in Piauí. The work was carried out in the 2010/2011 agricultural year. The experimental design was of randomised blocks with four replications. The treatments comprised 15 cultivars: Soy Tech 820; AS 8197; P98 Y70; P99R03; Nidera 8843; Nidera 8279; Monsoy 8867 RR; Monsoy 9056 RR; Monsoy 8766 RR; Monsoy 8849 RR; Monsoy 8527 RR; Monsoy 9144 RR; MABR 33135; MABR 2936 RR and MABR 1029 CV. The following variables were evaluated: plant height, first pod insertion, number of branches, number of pods with 1, 2 and 3 beans, total number of pods on each plant and bean yield. Of the 15 cultivars tested, 10 had a productivity greater than 3,500 kg ha-1, and only Monsoy 8527 RR had a productivity of less than 3,000 kg ha-1. The greatest contributions to an increase in productivity were seen in the P98 Y70 and Nidera 8843 cultivars, with 51% and 62% respectively.= A soja no Cerrado do sudoeste piauiense ocupa posição de destaque na produção agrícola. No entanto, os níveis de produtividades ainda estão abaixo da média nacional, fato associado, entre outros fatores, à escolha inadequada da cultivar. Objetivou-se selecionar as cultivares de soja mais produtivas a serem utilizadas na região do Cerrado piauiense. O trabalho foi conduzido no ano agrícola 2010/2011. O delineamento experimental utilizado foi o de blocos casualizados, com quatro repetições, tendo como tratamentos 15 cultivares: Soy Tech 820; AS 8197; P98 Y70; P99R03; Nidera 8843; Nidera 8279; Monsoy 8867 RR; Monsoy 9056 RR; Monsoy 8766 RR; Monsoy 8849 RR; Monsoy 8527 RR; Monsoy 9144 RR; MABR 33135; MABR 2936 RR e

  15. Study on the Tribe Ochyromerini (Coleoptera, Curculionidae) from East Asia I, Descriptions of New Species of the Genera Endaeus and Endaenidius

    OpenAIRE

    Kojima, Hiroaki; Morimoto, Katsura

    1995-01-01

    This is the first part of our systematic study on the tribe Ochyromerini (=Endaeini) from East Asia with descriptions of 28 new species of the weevils in the genera Endaeus Schoenherr and Endaenidius Morimoto as follows: Endaeus albolineatus sp. nov. (E. Malaysia), Endaeus niger sp. nov. (E. Malaysia), Endaeus zonatus sp. nov. (E. Malaysia), Endaeus robustus sp. nov. (Thailand), Endaeus longipes sp. nov. (E. Malaysia), Endaeus formosanus sp. nov. (Taiwan), Endaeus elongatus sp. nov. (Taiwan),...

  16. Iron Limitation and the Role of Siderophores in Marine Synechococcus

    Science.gov (United States)

    2009-06-01

    an equilibrium exists between free metal ions in solution and metal ions bound to a cell’s transport enzymes . In this model the metal shifts between...cyanobacterium Synechococcus PCC 6301 and the thermophilic cyanobacterium Synechococcus elongatus. Planta 205: 73-81. Michel, K.P., Pistorius, E.K., and...and nitrogen metabo- lism enzymes (Dean et al., 1993; Geider and La Roche, 1994; Lin and Stewart, 1998), it is a key element with the potential to

  17. CENTRO RURAL UNIVERSITÁRIO DE TREINAMENTO E AÇÃO COMUNITÁRIA - UM RESGATE HISTÓRICO 1975-1986

    Directory of Open Access Journals (Sweden)

    Maria da Trindade Ferreira Leite

    2009-01-01

    Full Text Available El objetivo del estudio es analizar el desarrollo de la práctica rural realizada en la Universidad Federal de Piauí de 1975 a 1986, y discutir la trayectoria del Centro Rural Universitario de Entrenamiento y Acción Comunitaria. La metodología es cualitativa con abordaje socio-histórico, utilizando la historia oral temática. Las fuentes primarias fueron las declaraciones de 16 sujetos, documentos escritos y fuentes secundarias como libros y artículos que abordan la temática. Los resultados muestran la historia de la extensión universitaria vivida por los alumnos y docentes de la Universidad Federal de Piauí en el interior del estado en las décadas de 70 y 80, en el marco de la Reforma Universitaria. El entrenamiento de los alumnos en las acciones comunitarias reveló aspectos de la realidad nacional y del contexto local en la visión de los sujetos que vivieron ese proceso. Los profesores consolidaron el proyecto atenuando la fuerza de la práctica asistencial vigente. La política de extensión perdió relevancia al final de la década de 70 y las prácticas rurales fueron canceladas.

  18. Do edaphic aspects alter vegetation structures in the Brazilian restinga?

    Directory of Open Access Journals (Sweden)

    Francisco Soares Santos-Filho

    2013-09-01

    Full Text Available The vegetation of the Brazilian restinga (coastal woodland presents a variety of species and different characteristics, encompassing fields, fruit groves and forests on quartzarenic neosols. We hypothesised that the structure of the restinga landscape along the coast of the state of Piauí is influenced by edaphic factors and presents a pattern similar to that of other northeastern restingas. We evaluated three restingas in Piauí, using the quarter method to determine their structure. Composite soil samples were collected to determine their chemical and physical properties. Edaphic variables were correlated with plant species by canonical correspondence analysis (CCA. Phytosociological data for all three areas indicated regenerating vegetation comprising several small individuals, 82.5% of which showed a diameter at ground level < 13 cm. We also observed considerable tillering. In two of the areas, there was a predominance of Fabaceae species, such as Caesalpinia pyramidalis and Copaifera martii. Although the structural characteristics of the restingas studied were similar to those of other northeastern restingas, the former showed lower Shannon diversity indices (2.18-2.44. The CCA indicated that species distribution was influenced by edaphic factors such as pH, aluminium content and amount of organic matter. The restingas studied were similar to others along the Brazilian coast.

  19. Evaluation of the effects of pressure gradients on four Brazilian freshwater fish species

    Directory of Open Access Journals (Sweden)

    Paulo dos Santos Pompeu

    2009-02-01

    Full Text Available This work aimed to experimentally evaluate the behavior of Brazilian freshwater fish species when submitted to a gradual increase in pressure, as well as sudden decompression's effects simulating the passage through a hydroelectric turbine. Four species from the São Francisco river basin were tested: Astyanax bimaculatus, Hypostomus sp., Leporinus reinhardti and Prochilodus costatus. For all of them mortality rates due to decompression were extremely low. However, the symptoms related to decompression, such as bulged eyes and hemorrhage, were not observed only in Hypostomus sp., and were more frequent the larger the pressure values were, considering the values from which decompression was performed. All these symptoms decreased significantly after 24 h of observation. With the increase in pressure inside the apparatus, the four tested species moved towards the upper levels. This behavior could make possoble the implementation of bypass downstream fish passages in dams constructed in Brazil.Este trabalho teve como objetivo avaliar experimentalmente o comportamento de espécies brasileiras quando submetidas a um aumento gradual na pressão, bem como os efeitos de uma descompressão rápida simulando a passagem por uma turbina hidrelétrica. Quatro espécies da bacia do rio São Francisco foram testadas: Astyanax bimaculatus, Hypostomus sp., Leporinus reinhardti e Prochilodus costatus. Para todas elas as taxas de mortalidade devido à descompressão foram extremamente baixas. No entanto, sintomas relacionados à descompressão, como exoftalmia e hemorragia só não foram observados em Hypostomus sp., sendo mais freqüentes quanto maior o valor de pressão a partir do qual realizou-se a descompressão. Todos estes sintomas diminuíram significativamente após 24 horas de observação. Com o aumento da pressão no aparato, as espécies testadas se movimentaram em direção aos níveis superiores. Este comportamento sugere a possibilidade de se

  20. Expansão da agricultura e sua vinculação com o processo de urbanização na Região Nordeste/Brasil (1990-2010

    Directory of Open Access Journals (Sweden)

    Humberto Miranda

    2012-05-01

    Full Text Available O processo de urbanização brasileiro tem se modificado nos últimos vinte anos. Os estudos em economia regional têm apontado para a forte influência da expansão da agricultura de exportação em territórios de fronteira como um dos principais determinantes da nova dinâmica urbana no período 1990-2010. Utilizam-se dados estatísticos para, primeiro, descrever a expansão da agricultura na área do bioma do cerrado na Região Nordeste do Brasil e, segundo, para analisar os possíveis efeitos que ela teve sobre o processo de urbanização no período. A análise dos efeitos sobre a urbanização em decorrência da expansão da agricultura é consequência do crescimento do plantio da soja para exportação nas áreas adjacentes dos Estados da Bahia (oeste baiano, Maranhão (sul maranhense e Piauí (sudoeste piauiense. Conclui-se que o padrão de urbanização na Região Nordeste caracteriza-se por uma dinâmica urbana periférica devido ao aprofundamento das heterogeneidades socioespacias em anos recentes.The process of Brazilian urbanization has changed in the last twenty years. Studies in the regional economy have pointed to the strong influence of the expansion of export agriculture in areas of the border as a major determinant of the new urban dynamics in the period 1990-2008. Statistics are used to describe the expansion of agriculture in the area of Savannah in northeastern Brazil, and to examine the possible effects it had on the process of urbanization in the period. The analysis of the effects of urbanization due to the expansion of agriculture is a consequence of growth for soybean exports to adjacent areas of the provinces of Bahia (western Bahia, Maranhão (south Maranhão and Piauí (southern Piauí. We conclude that the pattern of urbanization in the Northeast is characterized by a dynamic urban peripheral consequence of deepening social and spatial heterogeneity in recent years.

  1. Analysis of possible food/nutrient and drug interactions in hospitalized patients

    OpenAIRE

    Lopes, Everton Moraes; Carvalho, Rumão Batista Nunes de; Freitas, Rivelilson Mendes de

    2010-01-01

    ABSTRACT Objective: To evaluate the prescription in relation to the possible interactions between drugs and foods/nutrients in the diets of patients in the Hospital Regional Justino Luz in the municipality of Picos, Piauí, Brazil. Methods: The sample consisted of 60 medical records of patients admitted at the hospital. The records were analyzed according to the presence or absence of interactions between drugs and foods/nutrients of the prescribed diets. Results: Of the 82 drugs prescribed...

  2. Leishmania (infantum) chagasi in canine urinary sediment

    OpenAIRE

    Mendonça, Ivete Lopes de; Batista, Joilson Ferreira; Alves, Leucio Camara

    2015-01-01

    Canine visceral leishmaniasis (CVL) is difficult to diagnosis, mainly due to the presence of asymptomatic animals, the diversity of clinical symptoms and the difficulty in obtaining diagnostic evidence of high sensitivity and specificity. The purpose of this study was to diagnose CVL in urinary sediment of 70 dogs of different breeds, sexes and ages from the veterinary hospital of the Federal University of Piauí and Zoonosis Control Center of Teresina, Brazil. The serological tests were TR DP...

  3. Coccidioidomycosis: an unusual cause of acute respiratory distress syndrome

    OpenAIRE

    Veras, Kelson Nobre; Figueirêdo, Bruno C. de Souza; Martins, Liline Maria Soares; Vasconcelos, Jayro T. Paiva; Wanke, Bodo

    2003-01-01

    A male farmer, 20 years old, from the countryside of the State of Piauí, developed acute respiratory infection. Despite adequate antimicrobial therapy, his conditions worsened, requiring mechanical ventilation. His X-rays showed diffuse pulmonary infiltrates. His PaO2/FiO2 ratio was 58. Direct microscopy and culture of tracheal aspirates showed the presence of Coccidioides immitis. Autochthonous cases of coccidioidomycosis have only recently been described in Brazil, most of them from the Sta...

  4. Sea lice population and sex differences in P-glycoprotein expression and emamectin benzoate resistance on salmon farms in the Bay of Fundy, New Brunswick, Canada.

    Science.gov (United States)

    Igboeli, Okechukwu O; Burka, John F; Fast, Mark D

    2014-06-01

    Parasitic sea lice are a major challenge for salmon aquaculture. This is especially due to the recent development of resistance to emamectin benzoate (EMB) in the parasite. We investigated: (1) whether EMB treatment success in Grand Manan, Bay of Fundy, NB, Canada can be explained through EMB bioassay and P-glycoprotein (P-gp) mRNA expression studies; (2) if other populations of sea lice not under EMB selective pressure possess similar EMB sensitivity as Grand Manan sea lice populations; and (3) the heritability of EMB resistance in Lepeophtheirus salmonis. EMB bioassay results indicated population, species, sex and temporal differences in EMB EC50 values. RT-qPCR analyses revealed population and sex differences in P-gp mRNA levels, correlating with the bioassay results. Laboratory-reared sea lice maintained their EMB sensitivity status up to the F3 generation. Caligus elongatus, collected from Grand Manan showed more than twofold lower EMB EC50 values compared with L. salmonis collected from the same site. Concurrent exposure to EMB and verapamil yielded no increase in C. elongatus sensitivity to the parasiticide. Sea lice bioassay and P-gp mRNA studies can be used to track EMB resistance and sex differences in EMB sensitivity and P-gp mRNA levels exist in the parasite. © 2013 Society of Chemical Industry.

  5. ¿La práctica de la siembra directa en cultivos de soja favorece las poblaciones de acridios (Orthoptera: Acrididae en el partido de Benito Juárez?

    Directory of Open Access Journals (Sweden)

    Daniel SCUFFI

    2012-01-01

    Full Text Available Considerando el desarrollo del cultivo de soja en siembra directa en el partido de Benito Juárez, y que algunos autores sostienen que esta práctica favorece los acridios, se evaluó la riqueza de especies y la abundancia en soja con siembra directa y convencional. Se registraron siete especies (Aleuas lineatus Stål, Covasacris pallidinota (Bruner, Baeacris pseudopunctulatus (Ronderos, Dichroplus elongatus Giglio-Tos, Dichroplus maculipennis (Blanchard, Dichroplus pratensis Bruner y Scotussa lemniscata (Stål. La riqueza de especies acumulada en los diferentes cultivos fue similar (p> 0,05. En soja de primera con siembra directa, se registraron 2,3 ± 0,19 especies, en soja de primera con siembra convencional 1,45 ± 0,15 especies y en soja de segunda con siembra directa 2,25 ± 0,28 especies. Dichroplus elongatus fue la especie más abundante en todos los cultivos y en todos los momentos. Las restantes presentaron baja abundancia y se registraron en algunos momentos. No existió diferencia (p> 0,05 en la abundancia de tucuras entre los cultivos y en las diferentes fechas de muestreo. La baja riqueza de especies registrada estaría relacionada con la baja diversidad vegetal de los cultivos. Este estudio no mostró diferencias en la abundancia y riqueza de especies de acuerdo a la labranza utilizada.

  6. Actividad reproductiva en tres especies simpátricas del género Liolaemus (Reptilia: Sauria: Tropiduridae Actividad reproductiva en tres especies simpátricas del género Liolaemus (Reptilia: Sauria: Tropiduridae

    Directory of Open Access Journals (Sweden)

    Ramírez Pinilla Martha Patricia

    1992-09-01

    Full Text Available Sympatric species Liolaemus bibroni (oviparous, Liolaemus elongatus and Liolaemus ruibali (viviparous have partial fall reproductive activity for males and females. Males are reproductively active between fall and spring, females are vitellogenic especially during this season, they are gravid in spring and the oviposition/parturition occur at the end of spring and early summer. Reproductive cycles of males and females have not a long rest phase, and apparently are continuous. The incidence of  environmental and endogenous factors over the partial fall reproductive pattern in Liolaemus species is discussed. Machos y hembras de las especies simpátricas Liolaemus bibroni (ovípara, Liolaemus elongatus y Liolaemus ruibali (vivíparas tienen actividad reproductiva parcial de otoño. Los machos son reproductivos entre otoño y primavera, período en el que las hembras son vitelogénicas; las hembras están grávidas en primavera y el parto/oviposición sucede al final de esta estación y verano temprano. Los ciclos reproductivos de machos y hembras no tienen un período de receso prolongado, y tienden a ser continuos. Se discute la incidencia de factores ambientales y endógenos en el patrón reproductivo parcial de otoño en especies de Liolaemus.

  7. Perfil do atendimento à população feminina nos serviços públicos de saúde

    Directory of Open Access Journals (Sweden)

    Inez Sampaio Nery

    1996-12-01

    Full Text Available O estudo tem por objeto a atenção à mulher em Teresina. Pretende refletir e buscar soluções para a alta morbi-mortalidade desta população no Piauí. visto que a maioria dos óbitos ocorrem por fatores passíveis de prevenção, dentre eles: aborto, infecções, hemorragias e toxemias. A pesquisa foi realizada em 42 instituições prestadoras de assistência à saúde da mulher, em 1993, em Teresina-Piauí. Os resultados mostraram que a maioria dos atendimentos ocorre em ginecologia, seguida da assistência pré-natal. Os serviços carecem de profissionais especializados e, entre as atividades menos realizadas, encontram-se os grupos de discussão e palestras. O sistema de registro de dados é precário, não discriminando o atendimento por faixa etária e/ou por grupo específicos, tais como mulheres idosas, em climatério, violentadas e adolescentes. Pouca ou nenhuma avaliação é feita nas instituições de saúde que assiste a mulher. Assim, avaliações da qualidade dos serviços e treinamentos constantes de capacitação de profissionais devem ser realizados se o desejo é erradicar ou reduzir a morbi-mortalidade feminina.

  8. UMBUZEIRO DOS DEFUNTOS: UM MARCO NA HISTÓRIA DE SÃO LOURENÇO DO PIAUÍ

    Directory of Open Access Journals (Sweden)

    Celito Kestering

    2014-10-01

    Full Text Available This article refers to research that is done by the umbuzeiro dos defuntos, landmark of the municipality of São Lourenço do Piauí. It is known by the oral history that, next to a leafy umbuzeiro were buried many Indians who refused to be slaves on the farms of southeastern Piauí State. On formulates the hypothesis that there were buried nearly five hundred Indians killed by the Portuguese in the latter half of the seventeenth century, as reported by Priest Martin de Nantes. Interviews were conducted with elderly people in the city of São Lourenço to rescue fragments of oral tradition about umbuzeiro dos defuntos and the origin of the present city of São Lourenço. Information did not match the catastrophe narrated by Franciscan missionary however indicate that there lie the bodies of many dead Indians in a state of utter despair. It is said that the high stress experienced at the time of his murder is preserved and manifested in hauntings that translate regionally as aleivosias. It is hoped that with the opening of polls and excavations, meet organic remains and material culture to corroborate the hypothesis that on formulates in the current stage of research.

  9. New species and new records of Notonecta (Hemiptera: Heteroptera: Notonectidae from Brazil

    Directory of Open Access Journals (Sweden)

    Julianna F. Barbosa

    2013-12-01

    Full Text Available Notonecta itatiaia sp. nov. is described from the state of Rio de Janeiro. Like other Notonecta species that occurs in Brazil, N. itatiaia has no remarkable diagnostic features than the shape of genital capsule. Along with the first description of a Notonecta from Brazil in eighty years, N. disturbata is newly recorded from the states of Pará, Piauí and São Paulo, and N. pulchra from Pará. A key to species of Notonecta (males occurring in Brazil is given.

  10. Inhibitory activities of microalgal extracts against Epstein-Barr Virus (EBV antigen expression in lymphoblastoid cells

    Directory of Open Access Journals (Sweden)

    Koh Yih Yih

    2014-01-01

    Full Text Available The inhibitory activities of microalgal extracts against the expression of three EBV antigens, latent membrane protein (LMP1, Epstein-Barr nuclear antigen (EBNA1 and Z Epstein-Barr reactivation activator (ZEBRA were assessed by immunocytochemistry. The observation that the methanol extracts and their fractions from Ankistrodesmus convolutus, Synechococcus elongatus and Spirulina platensis exhibited inhibitory activity against EBV proteins in three Burkitt’s lymphoma cell lines at concentrations as low as 20 μg/ml suggests that microalgae could be a potential source of antiviral compounds against EBV.

  11. REPTILE SPECIES COMPOSITION IN THE MIDDLE GURGUÉIA AND COMPARISON WITH INVENTORIES IN THE EASTERN PARNAÍBA RIVER BASIN, STATE OF PIAUÍ, BRAZIL

    Directory of Open Access Journals (Sweden)

    CLÁUDIA RENATA MADELLA-AURICCHIO

    Full Text Available ABSTRACT The reptile diversity of the Middle Gurguéia River Basin in southern Piauí, Brazil, is little known. The rapid expansion of agriculture in the region is converting the Cerrado and Caatinga into large farming areas, which threatens biodiversity and hastens its loss. In this study, 68 specimens of reptiles from a university collection were examined, comprising 29 species: ten lizards, one amphisbaenian, 15 snakes, two turtles and one crocodilian. They were collected from five locations in the Middle Gurguéia Basin, a region not previously evaluated for reptiles. The most abundant species is a member of Tropidurus. Comparison with eight other areas in the eastern Parnaíba Basin indicated that the diversity of reptiles in the Middle Gurguéia is similar to that in other Caatinga-Cerrado ecotone areas. The reptile assemblage in the eastern Parnaíba Basin comprises 100 species of reptiles: 39 lizards, five amphisbaenians, 50 snakes, four chelonians and two crocodilians. This study expanded the known distributions of some reptiles and recorded the first occurrence of Helicops leopardinus (Schlegel, 1837 for Piauí. A cluster analysis showed that the reptile composition concords with the habitat where species were found, i.e. Cerrado, Caatinga or ecotone. Studies that associate habitat structure with each species are essential to propose efficient strategies for reptile management and conservation for the entire Parnaíba River Basin, mostly in areas that are not yet protected.

  12. Trilha ecológica do Cavalo-Marinho: Ecoturismo em Barra Grande/PI

    Directory of Open Access Journals (Sweden)

    Andrea Geisa Pereira Barbosa

    2010-06-01

    Full Text Available Na comunidade Barra Grande, localidade do município de Cajueiro da Praia - PI existe uma trilha ecológica muito bem planejada pelos moradores locais da própria comunidade: A Trilha do Cavalo - Marinho. Essa trilha consiste em um passeio ecológico, onde se trabalham comutantemente o turismo, a sustentabilidade e a educação ambiental.  A área de estudo - a localidade Barra Grande - pertence à Área de Proteção Ambiental (APA do Delta do Parnaíba (APA do Delta do Parnaíba, que visa proteger os ecossistemas costeiros, localizados nos estados do Maranhão, Piauí e Ceará. A referente pesquisa tem como principal objetivo inter-relacionar o termo ecoturismo, educação ambiental, sustentabilidade, e a trilha do cavalo marinho, realizado na pequena localidade do Piauí, Barra Grande. A metodologia utilizada no trabalho em estudo foi pesquisa bibliográfica: constituída de um conjunto de obras escritas referente ao turismo, desenvolvimento sustentável, desenvolvimento local sustentável, meio ambiente e educação ambiental e pesquisa de campo não participativa: realizada para obtenção das informações sobre a situação da área de estudo e analisar os aspectos trabalhados pelos moradores tanto na questão de educação ambiental como da sustentabilidade.

  13. A ATIVIDADE COMERCIAL E A CONSTITUIÇÃO DO MOCAMBINHO COMO NOVA CENTRALIDADE URBANA EM TERESINA – PI

    Directory of Open Access Journals (Sweden)

    Poliana Santos Ferraz de Oliveira

    2017-07-01

    Este artículo tiene como objeto de estudio el Mocambinho, un barrio periférico de la zona Norte de Teresina, capital del estado de Piauí, donde se analizó la actividad comercial y su papel en la constitución del dicho barrio como una de los nuevos centros urbanos de Teresina. Él trató de comprender el papel de las actividades comerciales para la producción de un nuevo centro urbano, identificando sus dinámicas y desarrollos comerciales y sus contribuciones para el proceso de valoración del dicho barrio. La propuesta vino del análisis de concentración de actividades comerciales en áreas centrales y su expansión en las últimas décadas para áreas periféricas de la ciudad. El artículo ha sido producido a partir de la realización de investigaciones bibliográficas, documental y de campo, con la aplicación de cuestionarios y entrevistas. Es evidente que el crecimiento comercial del distrito reúne parcial y en algunos casos totalmente, a las necesidades comerciales de sus habitantes, si evitando el desplazamiento al centro de Teresina. Por lo tanto se espera que contribuya para los estudios urbanos de la ciudad de Teresina y con comprensión de las nuevas dinámicas de la urbanización en la capital de Piauí. Palabras claves: Centro Urbano; Comercio; Mocambinho.

  14. A implantação do princípio do destino na cobrança do ICMS e suas implicações dinâmicas sobre os Estados

    Directory of Open Access Journals (Sweden)

    Nelson Leitão Paes

    2009-09-01

    Full Text Available Neste artigo, utilizou-se um modelo de equilíbrio geral dinâmico para estimar os efeitos econômicos e sobre a arrecadação dos Estados da adoção do princípio do destino na tributação do ICMS, de longe o principal tributo brasileiro. Os resultados mostram impactos importantes sobre a arrecadação dos Estados, com ganhos de quase 40% no Piauí, e perda de mais de 13% no Espírito Santo, o maior prejudicado. De maneira geral, os Estados menos desenvolvidos são beneficiados pela nova sistemática, contribuindo para a redução das desigualdades na distribuição da arrecadação na federação, mas com pouco efeito sobre o produto e o consumo.In this paper, we used a dynamic general equilibrium model to estimate the effects of the adoption of destination principle at ICMS, the most important Brazilian tax, on the states public finance. The results had shown that Piauí could increase its revenue from ICMS by almost 40%, while Espírito Santo could suffer a loss by more than 13%. In general, less developed states will gain with the adoption of destination principle, contributing to reduce the inequality of tax revenues between states in Brazil, with little effect in output and consumption.

  15. Estado nutricional e produção da pimenteira com uso de biofertilizantes líquidos

    OpenAIRE

    Oliveira,José R. de; Gomes,Regina L. F.; Araújo,Ademir S. F.; Marini,Fillipe S.; Lopes,João B.; Araújo,Raul M.

    2014-01-01

    Os biofertilizantes podem melhorar a sanidade das plantas e incrementar a produtividade das culturas, com baixo custo. Objetivou-se, com este trabalho, avaliar o estado nutricional e características relacionadas à produtividade do fruto de pimenteira em resposta à aplicação de biofertilizantes líquidos na variedade de pimenta Dedo de Moça (Capsicum baccatum var. pendulum L.). O trabalho foi realizado em campo, no município de Teresina, Piauí, Brasil, no período de dezembro de 2010 a setembro ...

  16. BURNOUT SYNDROME IN NURSING PROFESSIONALS OF EMERGENCY MEDICAL CARE SERVICE

    OpenAIRE

    Fernandes, Márcia Astrês; UNIVERSIDADE FEDERAL DO PIAUI; Sousa, Fábbio Kleyton de; NOVAFAPI; Santos, Jairo Silva dos; NOVAFAPI; Rodrigues, Joiciane de Andrade; NOVAFAPI; Marziale, Maria Helena Palucci; USP

    2012-01-01

    Objetivo: Identificar a presença da Síndrome de Burnout nos profissionais de enfermagem do Serviço de Atendimento Móvel de Urgência de Teresina - Piauí. Método: Trata-se de um estudo quantitativo e descritivo. Os sujeitos foram 17 Enfermeiros e 33 Auxiliares/Técnicos de Enfermagem. Utilizou-se o instrumento de Maslach Burnout Inventary (MBI) e um questionário sócio demográfico e profissional. Resultados: Os resultados apontaram que a maioria dos profissionais apresenta graus de baixo a modera...

  17. RAPTURE OF WOMEN: STRATEGY IN TRAINING FAMILY NUCLEI, CAPITANIA DO PIAUÍ, CENTURY XVIII

    Directory of Open Access Journals (Sweden)

    TANYA MARIA PIRES BRANDÃO

    2011-12-01

    Full Text Available This text deals with the formation of Piauí society at the when the process of territorial conquest was in the stage of consolidation. It analyzes criminal processes involving the kidnapping of women during the 18 th century; a practice witch constituted a stratagem for the formation of family nuclei. The text proposes that this practice derived from both the numerical superiority of males among the free population and the expectations of both men and women who fought to improve their social positions for themselves and their descendants.

  18. Aspectos epidemiológicos, clínicos e laboratoriais da leishmaniose visceral em cães (Canis familiaris) (Linnaeus, 1758) provenientes da zona urbana do município de Bom Jesus- PI e região metropolitana do Recife- PE, Brasil.

    OpenAIRE

    Jamile Prado dos Santos

    2010-01-01

    A Leishmaniose Visceral Canina (LVC) no Brasil é causada por Leishmania infantum a qual é relatada em várias regiões. O objetivo desta pesquisafoi verificar aspectos epidemiológicos, clínicos e laboratoriais da leishmaniose visceral em cães (Canis familiaris) (Linnaeus, 1758) provenientes da zona urbana do município de Bom Jesus PI e Região Metropolitana de Recife - PE, Brasil. Cães do município de Bom Jesus, Piauí, e do bairro de Muribeca, município de Jaboatão dos Guararapes, Pernambuco...

  19. POBREZA, DESIGUALDADES SOCIAIS E POLÍTICAS PÚBLICAS NO BRASIL E CHILE

    Directory of Open Access Journals (Sweden)

    Maria D\\u2019Alva Macedo Ferreira

    2007-01-01

    Full Text Available Poverty, social inequalities and public policies is a thematic table coordinated and proposed by the Public Policies Post-Graduation Program of Federal University of Piauí that gather together the reflections of five researchers of Social Work area. The studies pointed by this researchers had explored the poverty comprehension through its multifaces which express, in synthesis, the deep inequalities and antagonisms of Brazilian and Latin-American societies. The surveys also indicates the need for effective and substantial answers, compromised with this population rights and citizenship, from the State.

  20. RENTABILIDADE DE PLANTIOS DE ACÁCIA-AUSTRALIANA E DE SISTEMA DE INTEGRAÇÃO LAVOURA-PECUARIA-FLORESTA NO SUDOESTE DO PIAUÍ

    OpenAIRE

    Araújo, Emanuel França; Universidade Federal do Piauí; Aguiar, Adriano Saraiva; Mestrando em Ciências Florestais do Departamento de Engenharia Florestal da Universidade Brasília; Barbosa, Marcus Vinícius Ribeiro; Graduado em Engenharia Florestal, Universidade Federal do Piauí, Campus Professora Cinobelina Elvas, Bom Jesus, Piauí; de Brito, Wédison Campos; Graduado em Engenharia Florestal, Universidade Federal do Piauí, Campus Professora Cinobelina Elvas, Bom Jesus, Piauí; Cordeiro, Sidney Araújo; Professor Doutor em Ciência Florestal, Universidade Federal dos Vales do Jequitinhonha e Mucuri, Diamantina, Minas Gerais.

    2015-01-01

    Objetivou-se com este trabalho realizar análise comparativa dos rendimentos de sistemas agroflorestais e monocultivo com Acacia mangium Willd, em uma área de 10 hectares no município de Bom Jesus no Sudoeste do Estado do Piauí. Foram realizadas análises comparativas das simulações de receitas da venda do carvão vegetal para o sistema de monocultivo, sistema Taungya e integração Lavoura-Pecuária-Floresta (iLPF) aos sete anos. Foram coletadas informações levantadas pelos autores, artigos cientí...

  1. Representaçoes das genitálias femininas e masculinas nas pinturas rupestres no Parque Nacional Serra da Capivara, PI, Brasil

    OpenAIRE

    Justamand, Michel; Funari, Pedro Pablo

    2016-01-01

    O Parque Nacional Serra da Capivara localiza-se no estado brasileiro do Piauí. Desde os anos 70 do século passado se intensificaram as pesquisas no Parque, conduzidas por Niède Guidon. Ainda hoje uma missão científica francesa atua na região, agora liderada por Eric Boeda. As pinturas rupestres foram o deflagrador do investimento científico no local. Esse fato permitiu ao Parque o reconhecimento nacional e internacional. Tornando-se patrimônio universal da humanidade reconhecido pela UNESCO, ...

  2. Variação temporal e espacial de ovos e de larvas das espécies de interesse para a pesca na sub-bacia do rio Miranda, Pantanal, Estado do Mato Grosso do Sul, Brasil - DOI: 10.4025/actascibiolsci.v27i3.1314 Temporal and spatial variation of fish eggs and larvae of the main exploited species in the sub-basin of Miranda River, Pantanal wetland, State of Mato Grosso do Sul, Brazil - DOI: 10.4025/actascibiolsci.v27i3.1314

    Directory of Open Access Journals (Sweden)

    Keshyiu Nakatani

    2005-03-01

    Full Text Available Foi analisada a variação temporal de ovos e de larvas das principais espécies exploradas no Pantanal: Piaractus mesopotamicus; Prochilodus lineatus; Salminus maxillosus; Leporinus macrocephalus e Pseudoplatystoma spp., no rio Miranda. As coletas foram realizadas nos meses de outubro a março, quinzenalmente, de 1996 a 1999. O rio foi dividido em trecho superior, médio e inferior, com 15 pontos de coleta. Foram utilizadas rede de plâncton cônico-cilindrica, com fluxômetro, e as amostras fixadas em formol 4%. Para a identificação, utilizaram-se características morfológicas e merísticas, grau de flexão da notocorda e elementos da nadadeira caudal. No primeiro período, foram capturadas 5.979 larvas e 1.075 ovos; no segundo, 108.912 larvas e 1.836 ovos; no terceiro, 13.465 larvas e 1.855 ovos. A ANOVA, entre os anos e trechos do rio, foi significativa (F= 6.5, p >0,05 no trecho médio, indicando que a reprodução ocorre do trecho médio para o superior, nos meses de novembro a janeiroThe aim of this study was to analyze temporal variation of fish eggs and larvae of the main exploited species in Miranda river, Pantanal wetland (Piaractus mesopotamicus, Prochilodus lineatus, Salminus maxillosus, Leporinus macrocephalus, and Pseudoplatystoma spp., which were collected from October to March, biweekly, from 1996 to 1999. The river was divided into superior, medium and inferior sections, of 15 collection sites. Conical-cylindrical plankton net with a fluxometer and samples fixed in formol 4% were utilized. Morphological and meristic characteristics, notochord flexion degree and caudal fin elements were utilized for identification. A total of 5,979 larvae and 1,075 eggs were collected in the first period; 108,912 larvae and 1,836 eggs in the second; 13,465 larvae and 1,855 eggs in the third. Results showed that ANOVA, between the years and the river stretches, was significant (F = 6.5, p >0.05 in the medium section, which indicates that the

  3. Composição em tamanho dos peixes (Actinopterygii, Teleostei de ribeirões da bacia do rio Tibagi, Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    Shibatta Oscar A.

    2003-01-01

    Full Text Available The standard length of 7610 specimens of 43 species from eight streams of rio Tibagi basin was obtained in order to analyze the means of fish sizes. The higher mean size was observed in Gymnotus carapo Linnaeus, 1758 (165,5 mm and the smaller, in Phalloceros caudimaculatus (Hensel, 1868 (16,25 mm. Some fish like Acestrorhynchus lacustris (Reinhardt, 1874, Leporinus obtusidens (Valenciennes, 1836, Gymnotus carapo Linneus, 1758 and Synbranchus marmoratus Bloch, 1795 can reach big or medium size when adults but were collected only young, evidencing they use some streams in beginning of life. The mean size of total species was 49,81mm, what shows the small size composition of fishes in the streams. The Kolmogov-Smirnov test comparing the mean size of all streams showed significant similar size both in upstream and downstream regions, independent to the different environmental conditions.

  4. New agnostina (Trilobita from the Llanvirn (Ordovician of Spain

    Directory of Open Access Journals (Sweden)

    Rábano, I.

    1985-12-01

    Full Text Available The agnostids from the Lower Llanvirn shales of the Southern Central-Iberian Zone (Mounts of Toledo, Villuercas and Almadén district are described. Seven localities are new for Ordovician agnostids and two are revised. Three new species, belonging to the genera Geragnostella and Geragnostus, are described: Geragnostella gilcidae n. sp., Geragnostus hispanicus n. sp. and Geragnostus ninhursagae n. sp. The new names Geragnostus pilleti nom. nov. and Geragnostus abdullaevi nom. nov. are proposed to rename, respectively, the species G. howelli PILLET, 1978 and G. elongatus ABDULLAEV, 1972, regarded herein as junior objective homonyms of other previously defined species.

    Se estudian los trilobites agnóstidos procedentes de nueve localidades, siete de ellas nuevas para estas faunas, situadas en las pizarras del Llanvirn inferior de la parte meridional de la Zona Centroibérica (Montes de Toledo, Villuercas y región de Almadén. Se determina la presencia de los géneros Geragnostella y Geragnostus, y se describen tres nuevas especies: Geragnostella gilcidae n. sp., Geragnostus hispanicus n. sp. y Geragnostus ninhursagae n. sp. Se proponen también los nuevos nombres Geragnostus pilleti nom. nov. y Geragnostus abdullaevi nom. nov. para designar, respectivamente, las especies G. howelli PILLET, 1978, y G. elongatus ABDULLAEV, 1972, consideradas ambas homónimos objetivos primarios de otras especies definidas con anterioridad.

  5. Culturing photosynthetic bacteria through surface plasmon resonance

    Energy Technology Data Exchange (ETDEWEB)

    Ooms, Matthew D.; Bajin, Lauren; Sinton, David [Department of Mechanical and Industrial Engineering and Centre for Sustainable Energy, University of Toronto, Toronto M5S 3G8 (Canada)

    2012-12-17

    In this work, cultivation of photosynthetic microbes in surface plasmon enhanced evanescent fields is demonstrated. Proliferation of Synechococcus elongatus was obtained on gold surfaces excited with surface plasmons. Excitation over three days resulted in 10 {mu}m thick biofilms with maximum cell volume density of 20% vol/vol (2% more total accumulation than control experiments with direct light). Collectively, these results indicate the ability to (1) excite surface-bound cells using plasmonic light fields, and (2) subsequently grow thick biofilms by coupling light from the surface. Plasmonic light delivery presents opportunities for high-density optofluidic photobioreactors for microalgal analysis and solar fuel production.

  6. Population dynamics of calanoid copepods and the implications of their predation by clupeid fish in the Central Baltic Sea

    DEFF Research Database (Denmark)

    Möllmann, C.; Köster, Fritz

    2002-01-01

    . Additionally this study investigated the effect of predation by the major planktivorous fish species herring (Clupea harengus) and sprat (Sprattus sprattus) for the period 1977-1996 in the Gotland Basin (Central Baltic Sea). Examination of consumption by these fish species in relation to copepod production...... by sprat on CV/CVI of both copepod species in spring resulted in higher copepod mortality rates. In consequence, based on these results we suggest that the increase in the sprat stock since the late 1980s contributed to a decline of P. elongatus, and additionally prevented an even more pronounced...

  7. Effects of elevated pH on marine copepods in mass cultivation systems

    DEFF Research Database (Denmark)

    Hansen, Benni Winding; Hansen, Per Juel; Nielsen, Torkel Gissel

    2017-01-01

    both Acartia spp. and C. typicus had higher mortality at pH 9.5 than at the other pH regimes while E. affinis nauplii were not affected by pH. Wild Acartia spp. and A. tonsa from a culture showed some differences in response although of minor practical importance for aquaculture; both produced no eggs......Female tolerance to pH (8.0–9.5) by six marine copepods, Oithona similis, Temora longicornis, Acartia spp., Centropages typicus, Pseudocalanus elongatus and Eurytemora affinis was investigated to identify robust species for live feed production. The species with the most oceanic...

  8. Anthropization on the Cerrado biome in the Brazilian Uruçuí-Una Ecological Station estimated from orbital images.

    Science.gov (United States)

    Pereira, A C; Gama, V F

    2010-11-01

    In this study we analysed the dynamics of deforestation and burnings during the dry seasons from 2003 to 2008 in the Uruçuí-Una Ecological Station (UUES) and its buffer zone, located in the Cerrado biome of the southwest of Piauí, a Brazil's State, based on images from the orbital sensors CCD/CBERS-2 and TM/Landsat-5. Two dates from each of the years were interpreted and analysed: one in the middle of the dry season and one at the end. The deforested areas were expanded through the period analysed and were larger in the buffer zone, suggesting a relative protection of the UUES. New cut-offs were predictable because of the early opening of roads that would become their limits. The burning scars were larger at the end of the dry season as a consequence of the management and implementation of agricultures and pastures. In 2004 and 2007 these scars were larger probably because of the increase of dry phytomass that every three years is big enough to spread the fire originated in the anthropogenic burnings through the native vegetation. This scenario reaffirms the need for: stronger enforcement in order to stop anthropisation in the UUES and a management plan, absent for this unit so far. These proceedings are urgent also because the UUES is located in one of the most preserved regions of the Cerrado and controversially where intense anthropisation in ongoing, which stresses the lack, need and urgency of biological conservation proceedings for the Piauí's southeastern Cerrado.

  9. Potencial ornamental de acessos de pimenta

    Directory of Open Access Journals (Sweden)

    Leane Fialho de Melo

    2014-11-01

    Full Text Available O objetivo deste trabalho foi avaliar o potencial ornamental de dez acessos de pimenta Capsicum spp. procedentes da Coleção de Germoplasma da Universidade Federal do Piauí, Brasil. O experimento foi conduzido em casa de vegetação, no Departamento de Fitotecnia, do Centro de Ciências Agrárias, no município de Teresina, Piauí, obedecendo ao delineamento experimental inteiramente casualizado, com três repetições. Na caracterização morfoagronômica dos acessos, conforme orientação do Bioversity International, utilizaram-se os seguintes descritores qualitativos e quantitativos para o gênero Capsicum: forma da folha, hábito de crescimento da planta, antocianina no nó da planta, posição da flor, cor da corola, cor do fruto no estado intermediário e maduro, forma do fruto, forma do ápice do fruto, textura da epiderme do fruto, comprimento do fruto, comprimento do pedicelo, persistência do fruto maduro e altura da planta. Dentre os dez acessos avaliados, sete foram considerados com potencial ornamental: CGC-06 (C. chinense, CGC-07 (C. chinense, CGC-11 (C. annuum var. glabriusculum, CGC-23 (C. chinense, CGC-36 (C. annuum var. glabriusculum, CGC-59 (C. annuum var. glabriusculum e CGC-67 (C. annuum var. glabriusculum. O CGC 11 apresentou estética mais harmoniosa, com flores eretas, as quais são de fácil percepção; frutos eretos e vistosos e folhas de formato lanceolado.

  10. Anthropization on the Cerrado biome in the Brazilian Uruçuí-Una Ecological Station estimated from orbital images

    Directory of Open Access Journals (Sweden)

    AC. Pereira

    Full Text Available In this study we analysed the dynamics of deforestation and burnings during the dry seasons from 2003 to 2008 in the Uruçuí-Una Ecological Station (UUES and its buffer zone, located in the Cerrado biome of the southwest of Piauí, a Brazil's State, based on images from the orbital sensors CCD/CBERS-2 and TM/Landsat-5. Two dates from each of the years were interpreted and analysed: one in the middle of the dry season and one at the end. The deforested areas were expanded through the period analysed and were larger in the buffer zone, suggesting a relative protection of the UUES. New cut-offs were predictable because of the early opening of roads that would become their limits. The burning scars were larger at the end of the dry season as a consequence of the management and implementation of agricultures and pastures. In 2004 and 2007 these scars were larger probably because of the increase of dry phytomass that every three years is big enough to spread the fire originated in the anthropogenic burnings through the native vegetation. This scenario reaffirms the need for: stronger enforcement in order to stop anthropisation in the UUES and a management plan, absent for this unit so far. These proceedings are urgent also because the UUES is located in one of the most preserved regions of the Cerrado and controversially where intense anthropisation in ongoing, which stresses the lack, need and urgency of biological conservation proceedings for the Piauí's southeastern Cerrado.

  11. Epidemiologia do envelhecimento: dinamização, problemas e consequências

    Directory of Open Access Journals (Sweden)

    Luis Fernando Viana Furtado

    2012-03-01

    Full Text Available O presente trabalho objetiva descrever o perfil multidimensional dos idosos da cidade de Parnaíba, Piauí, frente aos hábitos de vida, condições de moradia, saneamento e outros indicadores de saúde. Foram recrutados 454 indivíduos com idade igual ou superior a 65 anos, de ambos os sexos. Obtiveram-se resultados preocupantes quanto ao grau de insalubridade e precários hábitos de higiene. Conclui-se que as condições de vida dos idosos predispõem o surgimento de vários agravos à saúde.

  12. OtimizaÃÃo e ValidaÃÃo de MÃtodos Empregando LC-ESI-MS/MS e Quechers para DeterminaÃÃo de ResÃduos de AgrotÃxicos em CajÃ

    OpenAIRE

    Renata de Oliveira Silva

    2013-01-01

    O cajueiro (Anarcadium occidentale) Ã uma planta tÃpica da regiÃo do nordeste que responde por mais de 95% da produÃÃo nacional, sendo os estados do CearÃ, PiauÃ, Rio Grande do Norte e Bahia os principais produtores. Com o incremento de Ãreas plantadas com o cajueiro anÃo precoce, verificou-se que esta cultura era susceptÃvel ao ataque de pragas, causando prejuÃzos no desenvolvimento, produÃÃo e qualidade do fruto. Para evitar esses prejuÃzos, estudos foram realizados no sentido de controlar ...

  13. Aminoácidos livres majoritários no suco de caju: variação ao longo da safra

    OpenAIRE

    OLIVEIRA,MARIA ELISABETH BARROS DE; OLIVEIRA,GERARDO SÉRGIO FRANCELINO DE; MAIA,GERALDO ARRAES; MOREIRA,RENATO DE AZEVEDO; MONTEIRO,ANA CRISTINA DE OLIVEIRA

    2002-01-01

    Visando a contribuir para o conhecimento dos aminoácidos livres majoritários presentes no suco de caju (Anacardium occidentale L.), estudou-se o seu comportamento ao longo da safra de 1995, no período de agosto a novembro, no clone de cajueiro-anão precoce, CCP 09, com aptidão para a produção de suco. O suco foi obtido de cajus cultivados no município de Pio IX, Estado do Piauí, Brasil. Os frutos foram colhidos em intervalos de 21 dias, perfazendo cinco amostragens. Os aminoácidos foram deter...

  14. Trabalho Diurno e Noturno: Principais Impactos do Trabalho em Turnos para a Saúde de Vigilantes

    OpenAIRE

    Maria Fabiana Machado da Silva; Lauriane Maria dos Santos Teles; Keilane Ferreira de Araújo; Tátila Rayane de Sampaio Brito; Janaína dos Santos Silva; Carla Fernanda de Lima Santiago da Silva

    2013-01-01

    O objetivo do estudo foi verificar o impacto do trabalho diurno e noturno sobre a saúde de vigilantes de uma Universidade Pública do Piauí. Utilizou-se um Questionário Sociodemográfico e Profissional/Ocupacional, analisado por meio da análise de frequência, e uma Entrevista Semiestruturada, acerca da satisfação com o turno de trabalho, o cotidiano fora dele e as consequências do trabalho para a saúde, utilizando-se a Análise de Conteúdo Temático de Bardin (2002). A maioria dos vigilantes di...

  15. THE PIAUÍ IN THE INDEPENDENCE PROCESS: contribution to the construction of the empire in 1823

    Directory of Open Access Journals (Sweden)

    Johny Santana de Araújo

    2015-12-01

    Full Text Available This paper search to explore how happened the conducting of the independence process in Piauí in 1823. Three elements are essential to the reconstitution of this narrative, the first is the importance of the region for the maintenance Portuguese colonial empire in America. In second place the intense mobilization social and military political which are foundations for the understanding of a national discourse which was molded some years later, and ultimately the forwarding given to the prominent figures in this process, personified by the different ways followed by actors political in the post-independence.

  16. Diversidade genÃtica da abelha sem ferrÃo melipona quinquefasciata baseada no sequÃnciamento das regiÃes its1 e 18s do dna ribossÃmico nuclear

    OpenAIRE

    JÃlio OtÃvio Portela Pereira

    2006-01-01

    A pesquisa foi desenvolvida no perÃodo de janeiro de 2003 a marÃo de 2006, nos Departamentos de Zootecnia, e Biologia da Universidade Federal do CearÃ, localizada no municÃpio de Fortaleza, estado do CearÃ. As amostras de abelhas foram coletadas nos estados do CearÃ, Piauà e GoiÃs. O objetivo desta tese foi estudar a diversidade genÃtica de populaÃÃes da abelha sem ferrÃo Melipona quinquefasciata, ocorrendo naturalmente na Chapada do Araripe (Sul do CearÃ), na Chapada da Ibiapaba (Oeste do Ce...

  17. Influence of obesity gene in quantitative traits of swine

    Directory of Open Access Journals (Sweden)

    Graciele Segantini do Nascimento Borges

    2002-01-01

    Full Text Available Genotype data of 477 animals of several swine races (Landrace - LD, Large White - LW, Pietrain - PI, LWXLDXPI, Piau, Monteiro, and unknown race were obtained to determine the allele frequency of the obesity gene. Genotype data of 174 crossbred swine (LWXLDXPI were also obtained, in order to assess its correlation with carcass evaluation data (lean meat percentage, backfat thickness at P2, loin eye area, adjacent fat area, total fat and meat. Finally, genotype data of 96 pure swine (Landrace, Large White and Pietrain were collected, to establish its relation with meat quality (drip loss, meat color, texture analysis and intramuscular fat and carcass evaluation data (lean meat percentage; ham, loin, shoulder and belly weights; and backfat thickness at P2. This work also aimed associating EPDs (expected progeny differences for litter size, daily weight gain and backfat thickness with genotype data of 49 Large White males and 54 Landrace females. Genotyping was done on animal blood by PCR-RFLP, based on Stratil et al. (1997. Statistical analysis was done by using SAS software for variance analysis between genotypes and data for each cited class. For purebred animals, a mixed model was used, with sire within race as random effect. The allelic frequencies of alleles T and C were, respectively: 0.8142; 0.1857 (Landrace; 0.9125; 0.0875 (Large White; 0.9433; 0.0566 (Pietrain; 0.8333; 0.1666 (LWXLDXPI; 0.2500; 0.7500 (Piau; 0.8750; 0.1250 (Monteiro, and 0.8870; 0.1130 (unknown race. Since the highest allele C frequency occurred in Piau, we suggest that this allele could be associated with fat accumulation. In the Landrace race, a study was done separating the frequencies of 2 generations (great-grandfather and grandfather, and the differences confirmed by a Chi-square test, a higher frequency of allele C having been found in the grandparental generation. This suggests that this allele could be eliminated by selection from the great

  18. Eficiência do uso da água pelo meloeiro sob diferentes freqüências de irrigação Water use efficiency of the melon crop under different irrigation frequencies

    Directory of Open Access Journals (Sweden)

    Valdemício Ferreira de Sousa

    2000-01-01

    Full Text Available Objetivou-se, com este estudo, avaliar o efeito de cinco freqüências de irrigação por gotejamento, na maximização da produtividade e na eficiência do uso da água pelo meloeiro cultivado em solo arenoso de Tabuleiro Costeiro do Piauí. O experimento foi conduzido no Campo Experimental da Embrapa Meio-Norte, localizado no município de Parnaíba, PI, latitude 3º5'S longitude 41º47'W e altitude de 46,8 m. O delineamento experimental foi o de blocos ao acaso, com cinco tratamentos e seis repetições, em que os tratamentos foram: freqüências de irrigação de 0,50, 1,0, 2,0, 3,0 e 4,0 dias. Foram avaliadas as produtividades comercial e total e a eficiência do uso de água, constatando-se que a maior produtividade total (77.985 kg ha-1 e a máxima eficiência do uso da água (EUAEt pelo meloeiro (282,83 kg ha-1 mm-1 são obtidas com freqüência de irrigação de um dia. As freqüências de irrigação de 3 e 4 dias, ou superiores, não são recomendadas para o meloeiro e, se a água é escassa, utilizam-se irrigações com freqüência diária.The objective of this work was to evaluate the effect of five trickle irrigation frequencies to obtain high yields and maximum water use efficiency in a melon crop cultivated in sandy soil of the Coastal Tablelands of Piauí, Brazil. The experiment was carried out in an experimental area of Embrapa Meio-Norte in Parnaíba, Piauí State, Brazil, latitude 3º5' S, longitude 41º47' W and altitude 46.8 m. A randomized block with five treatments and six replications was used, with irrigation frequencies of 0.5, 1.0, 2.0, 3.0 and 4.0 days. The total and commercial yield and water use efficiency were evaluated. The highest total yield (77.985 kg ha-1 and the maximum water use efficiency by melon crop (282.83 kg ha-1 mm-1 were obtained with an irrigation frequency of one day. The irrigation frequencies of 3 and 4 days or higher are not recommended for the melon crop, and if the water is scarce an

  19. Transmissão vertical do HIV: situação encontrada em uma maternidade de Teresina Transmisión vertical del HIV: situación encontrada en una maternidade de Teresina Vertical transmission of HIV: situation found in a maternity of Teresina

    Directory of Open Access Journals (Sweden)

    Liliam Mendes de Araújo

    2007-08-01

    Full Text Available Oaumento dos casos de AIDS em mulheres evidencia um progressivo aumento da transmissão vertical do HIV, no Brasil e no Piauí. Considerando a relevância do tema o presente estudo teve como objetivo analisar as condições da implementação das normas e medidas recomendadas pelo Ministério da Saúde para prevenir a transmissão vertical do HIV em uma maternidade de Teresina - PI. O caminho teórico-metodológico compreendeu o estudo da dinâmica organizacional e dos seus atores, por meio de abordagem qualitativa. Para obtenção dos dados foram realizadas 17 entrevistas semi-estruturadas. Os resultados mostraram que as recomendações do Ministério da Saúde não foram atendidas na sua totalidade evidenciando a precariedade da assistência prestada para o binômio mãe/filho.El aumento de los casos de AIDS en mujeres, evidencia un progresivo aumento de la transmisión vertical de lo HIV en el Brasil, e en el Piauí. Considerando la relevancia del tema, el presente estudio tuve como objetivo analizar las condiciones de la implementación de las reglas y medidas recomendadas por el Ministerio de la Salud para prevenir la transmisión vertical del HIV en una maternidad de Teresina-PI. El camino teórico-metodológico comprendió el estudio de la dinámica organizacional y de sus actores, a través del abordaje cualitativa.. Para la obtención de los datos fueran realizados 17 entrevistas medio-estructuradas. Los resultados mostraran que las recomendaciones del Ministerio de la Salud non fueran atendidas en la suya totalidad, evidenciando la precariedad de la asistencia prestada, para el binomio madre / hijo.The increase of the number of cases of AIDS among women reveals a progressive increase of the vertical transmission of HIV in Brazil, as well as in Piauí. Considering the relevance of the subject, this study had as objective to analyze the conditions of the implementation of the rules and measures recommended by the Ministry of Health to

  20. O inquérito eletrocardiográfico

    Directory of Open Access Journals (Sweden)

    José Geraldo Ferreira Gonçalves

    2011-01-01

    Full Text Available Entre 1977 e 1981, foi realizado um inquérito eletrocardiográfico nacional tendo por objetivo avaliar a prevalência da cardiomiopatia chagásica no Brasil. Foram feitos 5.347 eletrocardiogramas. Após o pareamento dos indivíduos, segundo a idade e gênero, a distribuição dos eletrocardiogramas dos autóctones, em cada estado, ficou assim constituída: Rio Grande do Sul (1.078, Minas Gerais (760, Bahia (612, Paraná (400, Paraíba (340, Piauí (218, Sergipe (216, Goiás (176, Pernambuco (170, Ceará (136 e Alagoas (134. Os maiores percentuais de alterações eletrocardiográficas entre os indivíduos com soros reagentes foram encontrados nos Estados de Goiás (63,6%, Minas Gerais (57,6%, Ceará (57,3%, Paraná (54,5%, Piauí (53,2% e Paraíba (52,3%. Entre os controles, nestes estados, a prevalência das alterações eletrocardiográficas foi de 25%, 25,7%, 25%, 12,5%, 22,9% e 26,5% respectivamente. Observou-se diferença estatisticamente significativa em relação à prevalência das alterações eletrocardiográficas, entre os indivíduos soro reagentes e os não reagentes, em todos os estados, exceção feita para o de Alagoas. O cálculo do gradiente mostrou-se maior no Estado do Paraná (42%, seguido por Goiás (38,6%, Ceará (32,3% Minas Gerais (31,9%, Piauí (30,3%, Paraíba (25,8%, Pernambuco (22,3%, Bahia (18,9%, Sergipe (16,7%, Rio Grande do Sul (9,9% e Alagoas (7,5%. Em relação à distribuição das alterações eletrocardiográficas encontradas, nos onze estados analisados, verificou-se que as extrassístoles ventriculares, o bloqueio de grau avançado do ramo direito, o bloqueio da divisão ântero-superior do ramo esquerdo, a associação do bloqueio de grau avançado do ramo direito com o bloqueio da divisão ântero-superior do ramo esquerdo e alterações primárias do segmento ST e da onda T, mostraram diferença estatisticamente significativa, entre os indivíduos com sororreagentes e os não reagentes Além disto

  1. Ensinando e aprendendo com portadores de Esclerose Múltipla: relato de experiência Enseñando y aprendiendo com los portatodes de Esclerósis Multiple: relato de experiencia Teaching and learning with Multiple Sclerosis patients: experience report

    Directory of Open Access Journals (Sweden)

    Lúcia Helena Rios Barbosa de Almeida

    2007-08-01

    Full Text Available Relatode experiência realizado para descrever a vivência de um grupo de estudantes de Enfermagem da Universidade Federal do Piauí, diante da realidade do ser portador de Esclerose Múltipla. A experiência evidencia a necessidade de uma equipe integrada para obter conhecimentos fundamentais e oferecer uma assistência holística ao portador. Enfatiza-se o impacto das ações desenvolvidas pelos estudantes, na Associação Piauiense de Esclerose Múltipla, possibilitando-os a conviver melhor com as dificuldades advindas com a doença. Além disso, a comunidade em geral é favorecida através dos conhecimentos repassados mediante atividades desenvolvidas pelo grupo. Concluímos que um conhecimento mais amplo acerca de uma patologia ainda tão cheia de mistérios só é possível quando se alia teoria à realidade do paciente.Este es un relato de una experiência de trabajo realizado por un grupo de estudiantes de Enfermería de la Universidad Federal de Piauí, sobre la siutación de un portador de Esclerosis Multiple. La experiencia demuestra la necesidad de un equipo integrado para obtener conocimientos fundamentales y ofrecer una asistencia integral al portador. Aquí se enfatiza las acciones desarrolladas por los estudiantes, dentro de la APPEM (Asociación Piauiense de Esclerósis Multiple, posible a coexistir mejor él las dificultades que se sucedierón con la enfermedad. Favorecen la comunidad en general con el conocimiento repasado por medio de las actividades desarrolladas para el grupo. Un conocimiento más amplio acerca de una patología llena de misterios, solo es posible, cuando se junta la teoria a la realidad del paciente.This report describes the experience of a group of nursing students from Universidad Federal do Piauí, in face of the reality of multiple sclerosis patient. The experience highlight the necessity of an integrated team to achieve fundamental knowledge and to offer a holistic assistance to the patient. The

  2. Diagnóstico da hanseníase fora do município de residência: uma abordagem espacial, 2001 a 2009 Leprosy diagnosis in municipalities other than the patients' place of residence: spatial analysis, 2001-2009

    Directory of Open Access Journals (Sweden)

    Carlos Henrique Morais de Alencar

    2012-09-01

    Full Text Available Caracterizar o fluxo de pessoas afetadas pela hanseníase, do município de residência para o de diagnóstico, em área de alta endemicidade no Brasil. Estudo baseado em dados do Sistema de Informação de Agravos e Notificação de 2001-2009, nos estados do Maranhão, Pará, Tocantins e Piauí. Dos 373 municípios, 349 (93,6% tiveram pelo menos um residente afetado pela hanseníase notificado em outro município (4.325 casos, 5,2% dos notificados. Os municípios com maior número de casos notificados fora de sua residência foram Timon (248 e São José de Ribamar (201, no Maranhão. Os municípios que mais receberam casos para diagnóstico foram São Luís (719 e Teresina (516. Destacam-se Goiânia (146 e o Distrito Federal (42 como polos de notificações de casos residentes no agregado, mesmo a mais de 1.000km de distância da área. O fluxo observado indica lacunas na descentralização do processo de atenção integral à pessoa afetada pela hanseníase e chama atenção para as dificuldades e desafios associados com o acompanhamento durante e após a poliquimioterapia.The study analyzed the flow of persons with leprosy from their municipality (county of residence to that of their diagnosis in a highly endemic area in Brazil. The study was based on data from the National Information System for Notifiable Diseases from 2001 to 2009 in the States of Maranhão, Pará, Tocantins, and Piauí. Of the 373 municipalities, 349 (93.6% had at least one resident with leprosy that had been diagnosed in a different municipality (4,325 cases, or 5.2% of the total. The municipalities with the most cases reported elsewhere were Timon (248 and São José de Ribamar (201, Maranhão State. The municipalities that received the most exogenous cases for diagnosis were São Luís (719, capital of Maranhão, and Teresina (516, capital of Piauí. Goiânia (146, capital of Goiás, and the Federal District (42 also reported numerous cases, even though they are

  3. Fishes of the Taquari-Antas river basin (Patos Lagoon basin, southern Brazil

    Directory of Open Access Journals (Sweden)

    FG. Becker

    Full Text Available The aquatic habitats of the Taquari-Antas river basin (in the Patos Lagoon basin, southern Brazil are under marked environmental transformation because of river damming for hydropower production. In order to provide an information baseline on the fish fauna of the Taquari-Antas basin, we provide a comprehensive survey of fish species based on primary and secondary data. We found 5,299 valid records of fish species in the basin, representing 119 species and 519 sampling sites. There are 13 non-native species, six of which are native to other Neotropical river basins. About 24% of the total native species are still lacking a taxonomic description at the species level. Three native long-distance migratory species were recorded (Leporinus obtusidens, Prochilodus lineatus, Salminus brasiliensis, as well as two potential mid-distance migrators (Parapimelodus nigribarbis and Pimelodus pintado. Although there is only one officially endangered species in the basin (S. brasiliensis, restricted range species (21.7% of total species should be considered in conservation efforts.

  4. The violence in everyday of prostitution of women: invisibility and ambiguities La violencia en el cotidiano de la prostitución: invisibilidades y ambigüedades A violência no cotidiano da prostituição: invisibilidades e ambiguidades

    Directory of Open Access Journals (Sweden)

    Isabel Cristina Cavalcante Carvalho Moreira

    2012-10-01

    Full Text Available OBJECTIVE: To reveal the meaning of violence in everyday female prostitution. METHOD: we used a phenomenological approach of Martin Heidegger. The survey was conducted in Teresina / Piauí / Brazil, with 11 women members of the Association of Prostitutes of Piaui. The data were produced by means of open interviews conducted by a script with questions regarding their experience as a prostitute and its relationship to violence. RESULTS: The reports indicate that it is prostitution a risky activity in which gender violence is a phenomenon present. In the relational world, prostitution and violence are intertwined in the face of negotiations established between women and men with formal contracts in the dark, verbally, without witnesses, and whose object of contract is the woman herself for the purpose of providing sexual pleasure to the contractor. Through interpretative analysis was possible to understand the lived violence leads women to remain in daily life where is this fear, inauthenticity and ambiguity. CONCLUSIONS: violence unveils lived relations of domination and assertion of male power, manifested by violence physical, psychological, moral and sexual. The study advances in scientific knowledge by showing that violence against women, in prostitution, must be understood as a process factual as well as the suffering experienced by them.OBJETIVO: desvelar el sentido de la violencia en el cotidiano de la prostitución femenina. MÉTODO: Se utilizó abordaje fenomenológico de Martin Heidegger. La investigación fue realizada en Teresina/Piauí/Brasil, con 11 mujeres miembros de la Asociación de las Meretrices de Piauí. Los datos fueron producidos por medio de la entrevista abierta, acarreada por un guión con preguntas acerca de la vivencia como meretriz y su relación con la violencia. RESULTADOS: los relatos evidenciaron que la prostitución es una actividad de riesgo, en la cual la violencia de género es un fenómeno presente. En ese

  5. Evaluation of algal biofilms on indium tin oxide (ITO for use in biophotovoltaic platforms based on photosynthetic performance.

    Directory of Open Access Journals (Sweden)

    Fong-Lee Ng

    Full Text Available In photosynthesis, a very small amount of the solar energy absorbed is transformed into chemical energy, while the rest is wasted as heat and fluorescence. This excess energy can be harvested through biophotovoltaic platforms to generate electrical energy. In this study, algal biofilms formed on ITO anodes were investigated for use in the algal biophotovoltaic platforms. Sixteen algal strains, comprising local isolates and two diatoms obtained from the Culture Collection of Marine Phytoplankton (CCMP, USA, were screened and eight were selected based on the growth rate, biochemical composition and photosynthesis performance using suspension cultures. Differences in biofilm formation between the eight algal strains as well as their rapid light curve (RLC generated using a pulse amplitude modulation (PAM fluorometer, were examined. The RLC provides detailed information on the saturation characteristics of electron transport and overall photosynthetic performance of the algae. Four algal strains, belonging to the Cyanophyta (Cyanobacteria Synechococcus elongatus (UMACC 105, Spirulina platensis. (UMACC 159 and the Chlorophyta Chlorella vulgaris (UMACC 051, and Chlorella sp. (UMACC 313 were finally selected for investigation using biophotovoltaic platforms. Based on power output per Chl-a content, the algae can be ranked as follows: Synechococcus elongatus (UMACC 105 (6.38×10(-5 Wm(-2/µgChl-a>Chlorella vulgaris UMACC 051 (2.24×10(-5 Wm(-2/µgChl-a>Chlorella sp.(UMACC 313 (1.43×10(-5 Wm(-2/µgChl-a>Spirulina platensis (UMACC 159 (4.90×10(-6 Wm(-2/µgChl-a. Our study showed that local algal strains have potential for use in biophotovoltaic platforms due to their high photosynthetic performance, ability to produce biofilm and generation of electrical power.

  6. First register of fruit flies (Diptera: Tephritidae in star fruit in Teresina, Altos and Parnaiba, state of Piaui, Brazil/ Primeiro registro de moscas-das-frutas (Diptera: Tephritidae em carambola nos municípios de Teresina, Altos e Parnaíba no estado do Piauí

    Directory of Open Access Journals (Sweden)

    Almerinda Amélia Rodrigues Araújo Soares

    2007-08-01

    Full Text Available The present work aims to register the occurrence of the fruit flies associated to star fruit (Averrhoa carambola L. in three counties of the state of Piaui, as well as to determine the frequency and the index of infestation of these insects. The fruits had been collected during the months of August and September 2005, and had been placed in plastic trays with sterilized soil, stored in metal cages, and left in environmental temperature at the laboratory. Until emergency, the adults had been kept in bottles with alcohol 70% and later identified in the species level. The biggest index of infestation (flies/fruit of C. capitata has occurred in the county of Altos (3.66, followed by Teresina and Parnaiba that had presented index of infestation of 2.18 and 0.016, respectively. C. capitata was the most frequent species in all the counties, presenting frequencies of 100%, 96.5%, and 100% in Teresina, Altos and Parnaiba, respectively. Ceratitis capitata is registered for the first time in star fruit in Teresina, Altos and Parnaiba, state of the Piaui. Anastrepha fraterculus is registered for the first time in the county of Altos. A. fraterculus and C. capitata occur simultaneously in star fruits.O presente trabalho visou conhecer as espécies de moscas-das-frutas associadas à carambola (Averrhoa carambola L. em três municípios do Estado do Piauí, bem como determinar a freqüência e o índice de infestação desses insetos. Os frutos foram coletados durante os meses de agosto e setembro de 2005, colocados em bandejas plásticas com solo esterilizado, armazenados em gaiolas metálicas e deixados em temperatura ambiente no laboratório. Até a emergência dos adultos, estes foram acondicionados em frascos contendo álcool 70% e posteriormente identificados em nível de espécie. O maior índice de infestação (moscas/fruto de C. capitata ocorreu no município de Altos (3,66, seguido pelos municípios de Teresina e Parnaíba que apresentaram

  7. Aminoácidos livres majoritários no suco de caju: variação ao longo da safra Major free amino acids in cashew apple juice: behaviour during the harvest season

    Directory of Open Access Journals (Sweden)

    MARIA ELISABETH BARROS DE OLIVEIRA

    2002-04-01

    Full Text Available Visando a contribuir para o conhecimento dos aminoácidos livres majoritários presentes no suco de caju (Anacardium occidentale L., estudou-se o seu comportamento ao longo da safra de 1995, no período de agosto a novembro, no clone de cajueiro-anão precoce, CCP 09, com aptidão para a produção de suco. O suco foi obtido de cajus cultivados no município de Pio IX, Estado do Piauí, Brasil. Os frutos foram colhidos em intervalos de 21 dias, perfazendo cinco amostragens. Os aminoácidos foram determinados utilizando-se um auto-analisador de aminoácidos. Preliminarmente, foram feitos ensaios para conhecer o espectro total dos aminoácidos livres presentes no suco; destes, foram escolhidos os oito majoritários, sobre os quais está baseado o estudo. Os aminoácidos majoritários encontrados, na ordem decrescente, foram: alanina, serina, fenilalnina, leucina, ácido glutâmico, ácido aspártico, prolina e tirosinaThe major free amino acids in cashew apple juice were studied during the crop season August to November 1995. The cashew apples were obtained from the clone CCP 09 cultivated in the county of Pio IX, state of Piauí-Brazil. Analysis were carried out in five samples harvested at twenty-one days intervals by using an amino acid analyser. The amino acids present in the juice were preliminary evaluated. Only the major eight ones were selected. The major amino acids detected, in decreasing order were: alanine, serine, phenylalanine, leucine, glutamic acid, aspartic acid, proline and tyrosine.

  8. Notas, novos registros e novas espécies de Ibidionini (Coleoptera, Cerambycidae Notes, new records and new species of Ibidionini (Coleoptera, Cerambycidae

    Directory of Open Access Journals (Sweden)

    Ubirajara R. Martins

    2012-06-01

    Full Text Available Novas espécies descritas do Brasil: Tropidion terminatum sp. nov. e Tropidion una sp. nov. (Rondônia; Tropidion buriti sp. nov. (Piauí; Compsibidion manauara sp. nov. (Manaus, Compsibidion elianae sp. nov. (Goiás; Compsibidion novalimae sp. nov. e Compsibidion peti sp. nov. (Minas Gerais. Do Brasil (Mato Grosso e da Bolívia (Santa Cruz, Compsibidion ybyra sp. nov.; da Venezuela (Guarico, Tropidion jolyi sp. nov.; da Bolívia (Santa Cruz, Dodecaibidion bolivianum sp. nov. e Pygmodeon maculatum sp. nov. Minibidion captiosus nom. nov. é proposto para Minibidion bicolor Martins, Galileo & Limeira-de Oliveira, 2011. São estabelecidos novo status para Compsibidion rubricolle Melzer, 1935, e notas sobre Heterachthes tysiphonis (Thomson, 1867. São apresentados novos registros para Tropidion zonapterum (Martins, 1962, Compsibidion campestre (Gounelle, 1908 e Kolonibidion femoratum (Martins, 1971.New species are described from Brazil: Tropidion terminatum sp. nov. and Tropidion una sp. nov. (Rondônia; Tropidion buriti sp. nov. (Piauí; Compsibidion manauara, sp. nov. (Amazonas; Compsibidion elianae sp. nov. (Goiás; Compsibidion novalimae sp. nov. and Compsibidion peti sp. nov. (Minas Gerais; from Brazil (Mato Grosso and Bolivia (Santa Cruz, Compsibidion ybyra sp. nov.; from Venezuela (Guarico, Tropidion jolyi sp. nov.; from Bolivia (Santa Cruz, Dodecaibidion bolivianum sp. nov. and Pygmodeon maculatum sp. nov. Minibidion captiosus nom. nov. to Minibidion bicolor Martins, Galileo & Limeira-de Oliveira, 2011 is proposed. New status is presented for Compsibidion rubricolle Melzer, 1935 and notes on Heterachthes tysiphonis (Thomson, 1867 are presented. New records are presented for Tropidion zonapterum (Martins, 1962, Compsibidion campestre (Gounelle, 1908 and Kolonibidion femoratum (Martins, 1971.

  9. Stalk yield of sugarcane cultivars under different water regimes by subsurface drip irrigation

    Directory of Open Access Journals (Sweden)

    Aderson S. de Andrade Junior

    Full Text Available ABSTRACT This study aimed to evaluate the stalk yield of ten sugarcane cultivars (RB962962, RB931011, RB931530, RB98710, RB92579, RB867515, RB863129, SP791011, RB72545 and VAT90212 subjected to water deficit, full irrigation and water surplus by subsurface drip irrigation, during three cropping seasons (2011-2014. The experiment was conducted at the Experimental Field of Embrapa Meio-Norte, Teresina, Piauí State, Brazil, in dystrophic Red Yellow Argisol. The cultivars RB962962 (162.3 Mg ha-1 and RB867515 (158.5 Mg ha-1 have better stalk yield compared with other cultivars in all water regimes and cropping seasons.

  10. AULAS PRÁTICAS COMO ESTRATÉGIA PARA O CONHECIMENTO EM BOTÂNICA NO ENSINO FUNDAMENTAL

    OpenAIRE

    Ana Paula Miranda da Silva; Maria Francilene Souza Silva; Francinalda Maria Rodrigues da Rocha; Ivanilza Moreira de Andrade

    2016-01-01

    Na aplicação dos conteúdos da disciplina Ciências Naturais a teoria não deveria ser desvinculada da prática, pois esta metodologia é imprescindível para construção do conhecimento científico dos alunos. Assim, objetivou-se investigar a viabilidade de aulas práticas para alunos do 7º ano do Ensino Fundamental, em duas escolas estaduais no município de Parnaíba, Piauí, como estratégias para facilitar o ensino-aprendizagem em conteúdos de Botânica. Foram aplicados questionários antes e após cada...

  11. PROJETO JOVEM DE FUTURO: UMA TECNOLOGIA DO INSTITUTO UNIBANCO PARA A GESTÃO DE ESCOLAS PÚBICAS DE ENSINO MÉDIO

    OpenAIRE

    Oliveira, Regina Tereza Cestari de; Balduino, Maria Aparecida Canale

    2015-01-01

    Este artigo tem como objetivo discutir a relação entre o público e o privado na Educação Básica. Para tanto, focaliza o Projeto Jovem de Futuro, apresentado pelo Instituto Unibanco, pré-qualificado no Guia de Tecnologias Educacionais do Ministério da Educação (MEC), efetivado por meio de parceria realizada com o MEC, governos dos estados (Ceará, Goiás, Mato Grosso do Sul, Pará e Piauí) e o Instituto, no âmbito do Programa Ensino Médio Inovador/Jovem de Futuro, para a gestão de escolas de Ensi...

  12. Interações entre Platonia insignis (Clusiaceae) e a avifauna visitante floral no cerrado do Maranhão

    OpenAIRE

    Adriano Kid Azambuja

    2008-01-01

    Resumo: O bacurizeiro, Platonia insignis Mart. (Clusiaceae), é uma espécie arbórea amazônica que se dispersou nos cerrados marginais da região Nordeste do Brasil, localizados nos estados do Maranhão e do Piauí. Foram estudadas a biologia e morfologia floral, o sistema reprodutivo, a relação entre densidade de flores e exposição solar, a sobreposição da floração e a atividade dos visitantes florais. A presença das aves visitantes foi constatada através de observação direta de um ponto fixo, to...

  13. Fragilidade ambiental na bacia hidrográfica do Alto Parnaíba

    OpenAIRE

    Alves de Melo, Nivaneide

    2007-01-01

    Esta pesquisa desenvolveu estudos integrados sobre a bacia hidrográfica do Alto Parnaíba, no Piauí, considerando a atuação das atividades humanas sobre o ambiente natural, a fim de determinar o grau de alteração desse ambiente, a partir da presença antrópica neste local, além de propor ações para restabelecimento de uma situação de equilíbrio ambiental. Pois, quando os eventos sobre a paisagem são de origem antrópica e de orientação econômica, os impactos poderão causar dano...

  14. ESTUDO DA COBERTURA VEGETAL/USO DA TERRA NOS ANOS DE 1987 E 2007 NO NÚCLEO DE DEGRADAÇÃO/DESERTIFICAÇÃO DE SÃO RAIMUNDO NONATO - PIAUÍ

    OpenAIRE

    Cláudia Maria Sabóia de AQUINO; José Antonio Pacheco de ALMEIDA; José Gerardo Beserra de OLIVEIRA

    2012-01-01

    A cobertura vegetal é um componente de grande relevância para o equilíbrio ambiental, uma vez que assegura a proteção dos solos contra a erosão hídrica. Esta é recomendada pela ONU como um indicador para fins de avaliação do processo de desertificação. Considerando que aproximadamente 45,3% do estado do Piauí apresentam suscetibilidade a desertificação, este trabalho objetivou analisar de forma espaço-temporal, com o emprego de técnicas de sensoriamento remoto (detecção de mudanças), a dinâmi...

  15. Perfil nutricional de recém-nascidos de mães adolescentes suplementadas com ferro, em diferentes concentrações, zinco e ácido fólico Nutritional profile of newborns of adolescent mothers supplemented with iron, in different concentrations, zinc and pholic acid

    Directory of Open Access Journals (Sweden)

    Nadir do Nascimento NOGUEIRA

    2002-08-01

    Full Text Available O objetivo deste estudo foi avaliar o estado nutricional de recém-nascidos de mães adolescentes com até 18 anos de idade, de baixa renda, suplementadas durante a gravidez com ferro, em diferentes concentrações, zinco e ácido fólico. Estas mães fizeram pré-natal no Instituto de Perinatologia Social do Piauí, Maternidade Dona Evangelina Rosa, no município de Teresina, Piauí, Nordeste do Brasil. As adolescentes foram aleatoriamente distribuídas em cinco grupos: grupos I e II receberam quantidades constantes de ácido fólico (250 µg e diferentes concentrações de ferro, na forma de sulfato ferroso (120 e 80 mg, respectivamente; grupos III e IV receberam quantidades constantes de ácido fólico (250 µg associado ao sulfato de zinco (5 mg e ferro nas concentrações de 120 e 80 mg, respectivamente; e grupo V, considerado controle, recebeu apenas ferro (120 mg (rotina da Instituição. A avaliação do estado nutricional de 74 recém-nascidos foi feita através de dados referentes à idade, peso, comprimento e perímetro cefálico, por ocasião do nascimento. De acordo com os resultados, as médias de peso (3000 ± 418 g, comprimento (48,07 ± 2,15 cm e perímetro cefálico (33,53 ± 1,50 cm encontradas para os filhos de mães do grupo V (rotina local não diferem dos grupos de intervenção. Conclui-se que os recém-nascidos de adolescentes suplementadas com ferro em diferentes concentrações (120 e 80 mg, zinco e ácido fólico apresentaram um bom perfil nutricional. No entanto, não se observou, entre os grupos de intervenção e o controle, diferenças significativas na duração da gravidez ou no estado nutricional dos bebês.The objective of this study was to evaluate the nutritional status of newborn infants of low income adolescent mothers, aged up to 18 years old, supplemented during pregnancy with iron, in different concentrations, zinc and folic acid. These mothers received prenatal care supervision in the Institute of

  16. The meanings of death and dying: the perspective of crack users Los significados de la muerte y el morir: la perspectiva de los consumidores de crack Os significados da morte e do morrer: a perspectiva de usuários de crack

    Directory of Open Access Journals (Sweden)

    Fernando José Guedes da Silva Júnior

    2012-04-01

    Full Text Available The consumption of crack can constitute in an inauthentic form of the existence that leads a person to live improperly the being-toward-death. Given this reality, this study aimed to comprehend the significance of death and dying for the user of crack and to unveil the meanings attributed to this significance. This qualitative study was conducted, based on the phenomenological method, with 12 crack users, in the therapeutic process, in a Psychosocial Care Center - Alcohol and Drugs (CAPSad, in the period from February to April 2011, in Teresina, Piauí. The results show that death is signified, ontically, as a companion, a partner, a passage, a journey and as the crack itself. It was concluded that this significance expressed an inauthentic experience, directed toward the incessant interaction with crack, accompanied by a feeling of nullity and relational disengagement.El consumo de cocaína puede estar en un modo auténtico de la existencia que lleva la persona a vivir mal ser-para-la-muerte. Ante esta realidad se tuvo como objetivo comprender el significado de la muerte y el morir para los consumidores del crack revelar los significados atribuidos a estos significados. Se realizó un estudio cualitativo sobre el método fenomenológico con 12 usuarios de crack en el proceso terapéutico en un Centro de Atención Psicosocial de alcohol y otras drogas en el período de febrero a abril de 2011 en Teresina, Piauí. Los resultados muestran que la muerte se entiende, onticamente por socio, asociación, entradas, viajes y el propio crack. Se concluye que el sentido es expresado en una experiencia inauténtica dirigido a la convivencia de la grieta incesante acompañada por un sentimiento de la nada y la retirada relacional.O consumo de crack pode constituir-se em forma inautêntica da existência que leva a pessoa a viver de forma imprópria o ser-para-a-morte. Diante dessa realidade, objetivou-se compreender o significado da morte e do morrer para o

  17. Is Monoglucosyldiacylglycerol a Precursor to Monogalactosyldiacylglycerol in All Cyanobacteria?

    Science.gov (United States)

    Sato, Naoki

    2015-10-01

    Monogalactosyldiacylglycerol (MGDG) is ubiquitous in the photosynthetic membranes of cyanobacteria and chloroplasts. It is synthesized by galactosylation of diacylglycerol (DAG) in the chloroplasts, whereas it is produced by epimerization of monoglucosyldiacylglycerol (GlcDG) in at least several cyanobacteria that have been analyzed such as Synechocystis sp. PCC 6803. A previous study, however, showed that the mgdE gene encoding the epimerase is absent in some cyanobacteria such as Gloeobacter violaceus, Thermosynechococcus elongatus and Acaryochloris marina. In addition, the N-terminal 'fatty acid hydroxylase' domain is lacking in the MgdE protein of Prochlorococcus marinus. These problems may cast doubt upon the general (or exclusive) role of MgdE in the epimerization of GlcDG to MGDG in cyanobacteria. In addition, GlcDG is usually present at a very low level, and the structural determination of endogenous GlcDG has not been accomplished with cyanobacterial samples. In this study, I determined the structure of GlcDG from Anabaena variabilis by (1)H- and (13)C-nuclear magnetic resonance (NMR) spectroscopy. I then showed that G. violaceus, T. elongatus, A. marina and P. marinus contain GlcDG. In all cases, GlcDG consisted of fewer unsaturated molecular species than MGDG, providing further evidence that GlcDG is a precursor to MGDG. The conversion of GlcDG to MGDG was also demonstrated by radiolabeling and chase experiments in G. violaceus and P. marinus. These results demonstrate that all the analyzed cyanobacteria contain GlcDG, which is converted to MGDG, and suggest that an alternative epimerase is required for MGDG synthesis in these cyanobacteria. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  18. Sinop Yarımadası (Güney Karadeniz Kıyısal Sularındaki Bazı Syngnathid Türlerinin (Syngnathus sp., Nerophis sp., Hippocampus sp. Besin Kompozisyonları

    Directory of Open Access Journals (Sweden)

    Şule GÜRKAN

    2012-09-01

    Full Text Available Bu araştırmada, Temmuz 2001 - Mayıs 2002 tarihleri arasında Sinop yarımadası (güney Karadeniz kıyısal sularının 5 – 15 m derinliklerindeki farklı biyotoplarından el direci kullanılarak yakalanan 6 deniziğnesi (Syngnathus acus Linnaeus, 1758; Syngnathus typhle Linnaeus, 1758; Syngnathus tenurostris Rathke, 1837; Syngnathus variegatus Palas, 1811; Nerophis ophidion Linnaeus, 1758; Syngnathus abaster Risso,1926 ve bir denizatı (Hippocampus hippocampus (L.,1758 türüne ait toplam 130 bireyde 105 mide içeriği incelenmiştir. Analizler sonunda mide içeriklerinde 13 av grubu tespit edilmiştir. Deniziğnesi türlerinin besin içeriğinde bulunuş frekans değeri (% F bakımından en baskın av grupları; S. acus’da % 90.9 Euterpina acutifrons, S. typhle’de % 93.3 tanımlanamamış doku parçaları, S. tenurostris’de % 87 Pseudocalanus elongatus, S. variegatus’da % 91.7 tanımlanamamış doku parçaları, N. ophidion’da % 90 Euterpina acutifrons, S. abaster’de ise % 100 Pseudocalanus elongatus, Euterpina acutifrons, Cirriped cypris, ve Cirriped nauiplius’dur. H. hippocampus ise % 25 ile Onceae sp. en baskın av grubudur. Sonuç olarak, deniziğnesi ve denizatı türlerinin esasen bentik ve planktonik krustase gruplarıyla beslendikleri görülmekle birlikte S. tenuirostris, S. abaster ve S. variegatus için besin kompozisyonu kıyılarımızdan ilk kez belirlenmiştir

  19. The strontium inorganic mutant of the water oxidizing center (CaMn4O5) of PSII improves WOC efficiency but slows electron flux through the terminal acceptors.

    Science.gov (United States)

    Gates, Colin; Ananyev, Gennady; Dismukes, G Charles

    2016-09-01

    Herein we extend prior studies of biosynthetic strontium replacement of calcium in PSII-WOC core particles to characterize whole cells. Previous studies of Thermosynechococcus elongatus found a lower rate of light-saturated O2 from isolated PSII-WOC(Sr) cores and 5-8× slower rate of oxygen release. We find similar properties in whole cells, and show it is due to a 20% larger Arrhenius activation barrier for O2 evolution. Cellular adaptation to the sluggish PSII-WOC(Sr) cycle occurs in which flux through the QAQB acceptor gate becomes limiting for turnover rate in vivo. Benzoquinone derivatives that bind to QB site remove this kinetic chokepoint yielding 31% greater O2 quantum yield (QY) of PSII-WOC(Sr) vs. PSII-WOC(Ca). QY and efficiency of the WOC(Sr) catalytic cycle are greatly improved at low light flux, due to fewer misses and backward transitions and 3-fold longer lifetime of the unstable S3 state, attributed to greater thermodynamic stabilization of the WOC(Sr) relative to the photoactive tyrosine YZ. More linear and less cyclic electron flow through PSII occurs per PSII-WOC(Sr). The organismal response to the more active PSII centers in Sr-grown cells at 45°C is to lower the number of active PSII-WOC per Chl, producing comparable oxygen and energy per cell. We conclude that redox and protonic energy fluxes created by PSII are primary determinants for optimal growth rate of T. elongatus. We further conclude that the (Sr-favored) intermediate-spin S=5/2 form of the S2 state is the active form in the catalytic cycle relative to the low-spin S=1/2 form. Copyright © 2016 Elsevier B.V. All rights reserved.

  20. Policiais Militares em greve: oportunidades e restrições à ação coletiva (Military Police officers on strike: opportunities and restrictions to collective action

    Directory of Open Access Journals (Sweden)

    Antônia Jesuíta de Lima

    2011-01-01

    Full Text Available Resumo: Este artigo objetiva discutir, a partir do estudo exploratório e doaporte teórico de Sidney Tarrow, o movimento paredista dos cabos e soldados da Polícia Militar do Piauí, ocorrido em 1997. Proibidos constitucionalmente de atuação grevista, esses profi ssionais se mobilizaram e reivindicaram aumento salarial e direito de participação nas decisões da instituição e colocaram em discussão o confl ito entre o direito e a norma. A especifi cidade do movimento suscitou questões relativas à sua dinâmica e às variáveis que favoreceram a sua emergência. Tarrow (2009 defende a tese de que a existência de oportunidades políticas é o fator decisivo para o surgimento de ação coletiva de confronto,entendendo oportunidades como elementos variáveis, não necessariamente formais, permanentes ou racionais para a ação coletiva.Abstract: The present paper resorts to an exploratory research and to the theoretical contribution of Sidney Tarrow to discuss the strike movement – known as “movimento paredista” – of the corporals and privates of the Military Police of the state of Piauí occurred in 1997. Constitutionally prohibited to go on strike, these professionals organized themselves to demand salary increase and the right to participate in decisions of the institution, and also called attention to the conflict between law and norm. The specificity of the movement has raised questions concerning the dynamics and variables that favored its emergence. Tarrow (2009 argues in favor of the thesis that the existence of political opportunities is the decisive factor for the emergence of confrontational collective action, understanding opportunities as variable elements of this form of action, although not necessarily formal, permanent or rational.

  1. Pools and rapids as spawning and nursery areas for fish in a river stretch without floodplains

    Directory of Open Access Journals (Sweden)

    Sunshine de Ávila-Simas

    Full Text Available This study aimed to evaluate the importance of two environments situated in the main channel of the Peixe River (a tributary of the upper Uruguay River on fish reproduction and initial growth. Ichthyoplankton, macrozooplankton, and zoobenthos collections were taken on a monthly basis from October 2011 to March 2012, sampling a rapids and a pool environment. The instrument used for the capture of the ichthyoplankton in both environments was a light trap. In total, 795 eggs and 274 larvae were captured. The species that presented higher abundance and occurrence frequency out of the total captured in both environments were Leporinus obtusidens, Bryconamericus iheringii, and Bryconamericus stramineus. The evaluation of the feeding activity reveals a major repletion degree of the larvae in more advanced stages in the pool. The pool environment presented a higher abundance of larvae in more advanced development stages. We conclude that the channel of the Peixe River is important for the reproduction and initial growth of fish and that each river environment seems to fulfill a different role in the life cycle of the ichthyoplankton community.

  2. Child care consultations held by nurses within the Family Health Strategy

    Directory of Open Access Journals (Sweden)

    Francisco Fagner Sousa Oliveira

    2013-09-01

    Full Text Available The study aimed at identifying initiatives taken by nurses during child care routine visits in Family Health Units. It is an observational, descriptive and quantitative research. Data collection took place from August to October 2011, through the observation of three consultations carried out by eight nurses (24 appointments for the Family Health Strategy Scheme in Picos - Piauí. During consultations, the following issues were more frequently observed: anthropometry, reflexes according to age, encouraging of exclusive breastfeeding and advice on child hygiene. The need for further nurse training through continuous education was verified, seeking to improve care in order to contribute to the improvement of nursing care quality focused on promoting child health thru childcare consultations.

  3. Redescription of the advertisement call of Physalaemus albifrons (Spix, 1824) (Amphibia, Anura, Leptodactylidae).

    Science.gov (United States)

    Pederassi, Jonas; Lima, Mauro Sérgio Cruz Souza; Caramaschi, Ulisses; Souza, Patrícia Dos Santos; Santos, Mayra Caroliny De Oliveira; Silva, Islaíane Costa

    2015-08-03

    The genus Physalaemus Fitzinger, 1826 is composed by 46 species occurring from north to southern South America, east of the Andes (Frost 2015). Physalaemus albifrons is morphologically differentiated from the other species mainly due to the presence of a second tarsal tubercle located nearly the tibio-tarsal articulation (Bokermann 1966). Physalaemus albifrons occurs in Brazil from north of the State of Maranhão through the states of Piauí, Ceará, Bahia, Paraíba, Pernambuco, and Alagoas, being its more austral occurrence in the State of Minas Gerais (Frost 2015). The advertisement call of P. albifrons was described by Bokermann (1966); however, the description needs improvement by applying new technologies, which we provide herein.

  4. Química geral experimental: uma nova abordagem didática Experimental general chemistry: a new teaching approach

    Directory of Open Access Journals (Sweden)

    Geraldo Eduardo da Luz Júnior

    2004-02-01

    Full Text Available This essay describes a new didactic approach, in according with the national curriculum guidelines for chemistry undergraduate courses in Brazil, employed during the one-semester course "Experimental General Chemistry" for chemistry undergraduate students at the Federal University of Piauí. The new approach has positively helped student's training by improving their reading skills and their understanding of scientific reports, by developing the use of electronic tools to search and to recover the required knowledge for their learning activities, and by improving their skills of understanding published texts and dealing with digital sources. At the same time the students are strongly stimulated to enter the research program for undergraduate students available at the University.

  5. Dados anatômicos da placenta em caprinos estudado por injeção intravascular de neoprene

    OpenAIRE

    NEVES, Willams Costa; MIGLINO, Maria Angélica; ARRIVABENE, Mônica; CAVALCANTE FILHO, Miguel Ferreira; FEITOSA Jr., Francisco Solano

    1999-01-01

    Estudamos a placenta quanto aos seus aspectos morfológicos em 30 caprinos sem raça definida, adultos oriundos do Estado do Piauí, mediante a análise de esquemas de modelos obtidos pela injeção de látex Neoprene "650". Obtivemos 17 casos, ou seja, 56,66% de gestações únicas e 13 casos, ou seja, 43,33% de gestações gemelares. A área do hilo placentário varia de 1 a 6 cm de diâmetro e está situada no centro da placenta, região caracterizada pela apresentação do pedículo umbilical. O formato dos ...

  6. Comparative Chromosomal Mapping of Microsatellites in Leporinus Species (Characiformes, Anostomidae): Unequal Accumulation on the W Chromosomes

    Czech Academy of Sciences Publication Activity Database

    Poltronieri, J.; Marquioni, V.; Bertollo, L.A.C.; Kejnovský, Eduard; Molina, W.F.; Liehr, T.; Cioffi, M.B.

    2014-01-01

    Roč. 142, č. 1 (2014), s. 40-45 ISSN 1424-8581 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081707 Keywords : FISH * Heterochromatin * Molecular cytogenetic s Subject RIV: BO - Biophysics Impact factor: 1.561, year: 2014

  7. Mineração, turismo e ambiente em Pedro II, Piauí

    OpenAIRE

    Gomes, Divamélia de Oliveira Bezerra [UNESP

    2011-01-01

    Pedro II, desde a década de 50 vem sofrendo alteração da paisagem natural em decorrência da exploração de opala e nos últimos cinco anos pelo ecoturismo emergente, não planejado e estruturado. O presente trabalho analisou os impactos sócio-ambientais decorrentes da atividade de garimpo de opala e da ação do turismo em áreas naturais, bem como vem a propor ações efetivas para desenvolvimento destas atividades de forma sustentável no município. Para consecução dos objetivos propostos, a pesquis...

  8. Diet and feeding strategies of mesopelagic fishes in the western Mediterranean

    Science.gov (United States)

    Bernal, Ainhoa; Olivar, M. Pilar; Maynou, Francesc; Fernández de Puelles, M. Luz

    2015-06-01

    Myctophids, gonostomatids and sternoptychids are the most abundant teleosteans worldwide and constitute an important assemblage of the mesopelagic ecosystem, functioning as vehicles of energy and matter through trophic webs. This study concentrates on the trophic ecology of the most abundant mesopelagic fishes of the western Mediterranean (WM) based on stomach content analysis. The myctophids (in this study: Benthosema glaciale, Ceratoscopelus maderensis, Lobianchia dofleini, Myctophum punctatum, Hygophum benoiti, Hygophum hygomii, Lampanyctus crocodilus, Lampanyctus pusillus and Notoscopelus elongatus) perform extensive diel migrations across the water column, between the surface to as deep as 1000 m, interacting with plankton and micronekton at multiple depths, and generally feeding in the epipelagic layers at night. In contrast, the gonostomatids Cyclothone braueri, Cyclothone pygmaea, and the sternoptychid Argyropelecus hemigymnus remain below epipelagic layers, feeding at different times throughout the day and night. The diet composition, trophic niche breadth and prey selectivity of 11 of these fish species were determined for juvenile and adult individuals from two surveys performed in December 2009 and July 2010 in the western Mediterranean Sea. The number of prey items varied among species, e.g. Myctophum punctatum was the species with the highest feeding intensity, reaching ca. 700 prey items in a stomach, whereas the mean number of prey in Cyclothone braueri was low (usually 1 or 2 prey per stomach). A dietary shift towards larger prey was evident from juveniles to the largest and oldest adult individuals, despite trophic niche breadths did not increase with body length for any of these mesopelagic species. The diets of the small gonostomatids, sternoptychid and early juveniles of myctophids were dominated by non-calanoid copepods, ostracods, and other small zooplankton, whereas medium-sized myctophids, e.g. L. dofleini or H. benoiti, preyed mainly on

  9. Fishes of the Taquari-Antas river basin (Patos Lagoon basin, southern Brazil Peixes da bacia do rio Taquari-Antas (sistema da Laguna dos Patos, sul do Brasil

    Directory of Open Access Journals (Sweden)

    FG. Becker

    2013-02-01

    Full Text Available The aquatic habitats of the Taquari-Antas river basin (in the Patos Lagoon basin, southern Brazil are under marked environmental transformation because of river damming for hydropower production. In order to provide an information baseline on the fish fauna of the Taquari-Antas basin, we provide a comprehensive survey of fish species based on primary and secondary data. We found 5,299 valid records of fish species in the basin, representing 119 species and 519 sampling sites. There are 13 non-native species, six of which are native to other Neotropical river basins. About 24% of the total native species are still lacking a taxonomic description at the species level. Three native long-distance migratory species were recorded (Leporinus obtusidens, Prochilodus lineatus, Salminus brasiliensis, as well as two potential mid-distance migrators (Parapimelodus nigribarbis and Pimelodus pintado. Although there is only one officially endangered species in the basin (S. brasiliensis, restricted range species (21.7% of total species should be considered in conservation efforts.Os ambientes aquáticos da Bacia do rio Taquari-Antas (Bacia da Laguna dos Patos, sul do Brasil vêm sofrendo considerável transformação, principalmente em razão da implantação de barragens para geração de energia elétrica. Com o objetivo de estabelecer um diagnóstico amplo da ictiofauna da Bacia do Taquari-Antas, realizou-se um inventário das espécies dessa bacia a partir de dados primários e secundários. Foram obtidos 5.299 registros válidos de espécies de peixe na bacia, representando 119 espécies e 519 localidades amostradas. Ocorrem, na bacia, 13 espécies não nativas, seis das quais são oriundas de outras bacias neotropicais. Cerca de 24% de todas as espécies carecem de descrição taxonômica no nível específico. Foram registradas três espécies nativas migradoras de longa distância (Leporinus obtusidens, Prochilodus lineatus e Salminus brasiliensis e

  10. Cd2+ Effect on Photosynthetic Apparatus in Synechococcus elongatus and Spinach (Spinacia oleracea L.)

    Czech Academy of Sciences Publication Activity Database

    Nováková, Marie; Matějová, E.; Sofrová, D.

    2004-01-01

    Roč. 42, č. 3 (2004), s. 425-430 ISSN 0300-3604 R&D Projects: GA ČR GA525/02/0301 Institutional research plan: CEZ:AV0Z5038910 Keywords : cyanobacteria * heavy metals * photochemical activity Subject RIV: ED - Physiology Impact factor: 0.734, year: 2004

  11. Coprorhexy, coprophagy, and coprochaly in the copepods Calanus helgolandicus, Pseudocalanus elongatus, and Oithona similis

    DEFF Research Database (Denmark)

    Iversen, Morten; Poulsen, Louise K.

    2007-01-01

    Studies of fecal pellet flux show that a large percentage of pellets produced in the upper ocean is degraded within the surface waters. It is therefore important to investigate these degradation mechanisms to understand the role of fecal pellets in the oceanic carbon cycle. Degradation of pellets...

  12. Blind dating - mate finding in planktonic copepods. II. The pheromone cloud of Pseudocalanus elongatus

    DEFF Research Database (Denmark)

    Kiørboe, Thomas; Bagøien, E.; Thygesen, Uffe Høgsbro

    2005-01-01

    mm away from her. The multiple excursions define a near-spherical volume around the female within which he is capable of navigating back to her. During courtship the female hovers, but she frequently changes her body orientation and, thus, the direction of her feeding current, which also causes her...

  13. Candidatus Rickettsia andeanae, a spotted fever group agent infecting Amblyomma parvum ticks in two Brazilian biomes

    Directory of Open Access Journals (Sweden)

    Fernanda Aparecida Nieri-Bastos

    2014-04-01

    Full Text Available Adult ticks of the species Amblyomma parvum were collected from the vegetation in the Pantanal biome (state of Mato Grosso do Sul and from horses in the Cerrado biome (state of Piauí in Brazil. The ticks were individually tested for rickettsial infection via polymerase chain reaction (PCR targeting three rickettsial genes, gltA, ompA and ompB. Overall, 63.5% (40/63 and 66.7% (2/3 of A. parvum ticks from Pantanal and Cerrado, respectively, contained rickettsial DNA, which were all confirmed by DNA sequencing to be 100% identical to the corresponding fragments of the gltA, ompA and ompB genes of Candidatus Rickettsia andeanae. This report is the first to describe Ca. R. andeanae in Brazil.

  14. Playing and understanding chemistry: Reinterpreting a traditional game for educational use

    Directory of Open Access Journals (Sweden)

    Ana Carolina Rosa da Silva

    2017-12-01

    Full Text Available The importance of using educational games in the school context cannot be denied. Therefore, this article describes a study about the contributions of a game for teaching colligative properties. The game was used with a second-year class in a high school located in southeast Piauí, Brazil. It is a qualitative study; it used questionnaires for data collection and direct observation about phenomenological aspects that emerged during the application of the game. The results showed that the use of educational games is not common for the subjects observed. Their views on that use lead us to infer that the proposed playful activity has contributed to strengthen distinct aspects needed to improve the teaching and learning process in Chemistry

  15. Perfil de ácidos grasos de diversas especies de pescados consumidos en México

    Directory of Open Access Journals (Sweden)

    María Isabel Castro González

    2013-12-01

    Full Text Available Los factores bióticos y abióticos determinan la composición de ácidos grasos AG en los peces, información relevante por la asociación existente entre su consumo y los beneficios para la salud humana. El objetivo de esta investigación fue identificar la variación en la concentración de AG, según diferentes factores, en diez especies marinas de pescado comestible en México: Euthynnus alletteratus, Sciaenops ocellatus, Bairdiella chrysoura, Sphyraena guachancho, Symphurus elongatus, Istiophorus platypterus, Ophichthus rex, Eugerres plumieri, Eucinostomus entomelas y Oreochromis mossambicus. La determinación de AG se llevó a cabo mediante cromatografía de gases. El contenido de lípidos totales varió entre 0.93 y 1.95g/100g en E. entomelas y O. mossambicus, respectivamente. E. alletteratus, B. chrysoura, S elongatus, I. platypterus, O. rex y E. plumieri presentaron el siguiente orden en la concentración de AG: AG poliinsaturados AGPAG saturados AGSAG monoinsaturados AGM. S. ocellatus, S. guachancho y E. entomelas: AGSAGPAGM; mientras que tan solo O. mossambicus presentó AGSAGMAGP. Este tuvo la mayor concentración de AGS 559.40mg/100g y AGM 422.60mg/100g, mientras que B. chrysoura presentó el mayor contenido mg/100g de AGP 663.03, AGn-3 514.03, EPA+DHA 506.10 y AGn-6 145.80. Factores bióticos y abióticos influyeron significativamente en la concentración de AG. Las especies subtropicales presentaron una concentración 42.1 mayor de EPA+DHA que las tropicales. Los valores presentados pueden cambiar según modificaciones en el ecosistema y en las características de cada especie, sin embargo, el conocimiento aquí generado es útil para mejorar las recomendaciones sobre el consumo de pescado.

  16. Commercial trials using emamectin benzoate to control sea lice Lepeophtheirus salmonis infestations in Atlantic salmon Salmo salar.

    Science.gov (United States)

    Stone, J; Sutherland, I H; Sommerville, C; Richards, R H; Varma, K J

    2000-06-19

    Two trials were conducted at commercial salmon farms to evaluate the efficacy of emamectin benzoate (Slice, 0.2% aquaculture pre-mix, Schering-Plough Animal Health) as a treatment for sea lice Lepeophtheirus salmonis (Krøyer) and Caligus elongatus Nordmann infestations in Atlantic salmon Salmo salar L. Trials were carried out in 15 m2 commercial sea pens, at temperatures of 5.5 to 7.5 degrees C and 10.8 to 13.8 degrees C. Each pen was stocked with 14,000 to 17,500 fish with mean weights of 0.44 to 0.74 and 1.33 to 1.83 kg. Fish were naturally infested with sea lice at the start of each trial. At Day -1, samples of 10 or 15 fish were taken from each pen to determine pre-treatment numbers of lice. Emamectin benzoate was administered in feed, to 4 replicate pens, at a dose of 50 micrograms kg-1 biomass d-1 for 7 consecutive days (Days 0 to 6). Sea lice were counted again, between Days 7 and 77, and comparisons made with untreated control fish. Despite adverse weather conditions, wide variations in fish weights and exposure to new infestations, treatment was effective against chalimus and motile stages of L. salmonis. In the autumn trial, efficacy at Day 27 was 89%, and lice numbers remained lower on treated fish than on control fish 64 d from the start of treatment. In the winter trial, reductions in lice numbers at low temperatures were slower but good efficacy was achieved by Day 35. Although control fish had to be treated with hydrogen peroxide at Day 21, fish treated only with emamectin benzoate on Days 0 to 6 still had 89% fewer lice than control fish at Day 35. There were very few C. elongatus present, but at the end of both trials numbers were lower on treated fish. No adverse effects were associated with treatment of fish with emamectin benzoate.

  17. Aboriginal Consumption of Estuarine Food Resources and Potential Implications for Health through Trace Metal Exposure; A Study in Gumbaynggirr Country, Australia.

    Science.gov (United States)

    Russell, Shaina; Sullivan, Caroline A; Reichelt-Brushett, Amanda J

    2015-01-01

    Fishing and resource use continues to be an essential aspect of life for many Aboriginal communities throughout Australia. It is important for dietary sustenance, and also retains deep social, cultural and economic significance, playing a fundamental role in maintaining group cohesion, transferring cultural knowledge and affirming Indigenous identities. We surveyed approximately 20% of the Gumbaynggirr Aboriginal community of Nambucca Heads, New South Wales, Australia. This paper explores Gumbaynggirr Connection to Country and engagement in cultural practice. It quantifies fishing efforts and consumption of seafood within the community. We found 95% of the sample group fish, with the highest rate of fishing being 2-3 times a week (27%). Furthermore, 98% of participants eat seafood weekly or more frequently, up to more than once a day (24%). Survey results revealed that Myxus elongatus (Sand mullet) and naturally recruited Saccostrea glomerata (Sydney rock oysters) continue to be important wild resources to the Gumbaynggirr community. Trace metals were measured in M. elongatus and S. glomerata samples collected by community participants in this study. Maximum levels prescribed in the Australia New Zealand Food Standards Code were not exceeded in the edible tissue for either species, however both species exceeded the generally expected levels for zinc and copper and S. glomerata samples exceeded the generally expected level for selenium. Furthermore the average dietary exposure to trace metals from consuming seafood was calculated for the surveyed population. Trace metal intake was then compared to the provisional tolerable weekly intake prescribed by the Joint Expert Committee on Food Additives. This process revealed that copper and selenium intake were both within the provisional tolerable weekly intake, while there is no guideline for zinc. Furthermore, participants relying heavily on wild resources from the Nambucca River estuary may exceed the provisional

  18. Aboriginal Consumption of Estuarine Food Resources and Potential Implications for Health through Trace Metal Exposure; A Study in Gumbaynggirr Country, Australia.

    Directory of Open Access Journals (Sweden)

    Shaina Russell

    Full Text Available Fishing and resource use continues to be an essential aspect of life for many Aboriginal communities throughout Australia. It is important for dietary sustenance, and also retains deep social, cultural and economic significance, playing a fundamental role in maintaining group cohesion, transferring cultural knowledge and affirming Indigenous identities. We surveyed approximately 20% of the Gumbaynggirr Aboriginal community of Nambucca Heads, New South Wales, Australia. This paper explores Gumbaynggirr Connection to Country and engagement in cultural practice. It quantifies fishing efforts and consumption of seafood within the community. We found 95% of the sample group fish, with the highest rate of fishing being 2-3 times a week (27%. Furthermore, 98% of participants eat seafood weekly or more frequently, up to more than once a day (24%. Survey results revealed that Myxus elongatus (Sand mullet and naturally recruited Saccostrea glomerata (Sydney rock oysters continue to be important wild resources to the Gumbaynggirr community. Trace metals were measured in M. elongatus and S. glomerata samples collected by community participants in this study. Maximum levels prescribed in the Australia New Zealand Food Standards Code were not exceeded in the edible tissue for either species, however both species exceeded the generally expected levels for zinc and copper and S. glomerata samples exceeded the generally expected level for selenium. Furthermore the average dietary exposure to trace metals from consuming seafood was calculated for the surveyed population. Trace metal intake was then compared to the provisional tolerable weekly intake prescribed by the Joint Expert Committee on Food Additives. This process revealed that copper and selenium intake were both within the provisional tolerable weekly intake, while there is no guideline for zinc. Furthermore, participants relying heavily on wild resources from the Nambucca River estuary may exceed the

  19. Piscinoodinium pillulare (Schäperclaus, 1954 Lom, 1981 (Dinoflagellida infection in cultivated freshwater fish from the Northeast region of São Paulo State, Brazil: parasitological and pathological aspects

    Directory of Open Access Journals (Sweden)

    M. L. MARTINS

    Full Text Available The Aquaculture Center of Unesp, Jaboticabal, SP, Brazil, received fishes for diagnosis from fish farmers reporting fish crowding at pond edges and in water inlets. Fifty-three out of 194 cases showed round to oval, immobile whitish structures, measuring up to 162 mm diameter, identified as the dinoflagellate Piscinoodinium pillulare. In 34 diagnosed cases the parasites were present in the gills, in 2 on body surface, and 9 in both. Thirty-one out of 53 were tambacu hybrids hosts; 7, Piaractus mesopotamicus; 6, Colossoma macropomum; 5, Leporinus macrocephalus; 3, Oreochromis niloticus; and 1, Prochilodus lineatus. Fish showed increased mucous production on body surface and gills, while ecchymosis in the caudal peduncle and operculum was present. The gills also showed paleness, congestion, and petechiae. Histopathology presented a great number of trophonts situated between secondary lamellae, fixed to or detached from the epithelium. Primary lamellae presented interstitial hemorrhages, severe hyperplasia of the epithelium, goblet cells, and mononuclear infiltrates. The present work is the first report of P. pillulare in Brazil and emphasizes the importance of this dinoflagellate which caused significant economic losses from 1995 through 1997.

  20. Electron spin resonance dating of megafauna from Lagoa dos Porcos, Piauí, Brazil.

    Science.gov (United States)

    Kinoshita, Angela; Mayer, Elver; Ribau Mendes, Vinícius; Figueiredo, Ana Maria G; Baffa, Oswaldo

    2014-06-01

    Excavations performed at Lagoa dos Porcos site revealed a vast amount of extinct mammal fossil remains, becoming one of the richest palaeontological occurrences in the Serra da Capivara National Park region, a UNESCO World Heritage. Although anatomic and taxonomic aspects of extinct Quaternary mammals are relatively well known, chronologic information for deposits is rare. In this context, electron spin resonance (ESR) dating of megafauna samples provides important information for establishing a chronological background. This work presents the ESR dating of two teeth, one of Gomphotheriidae and other of Toxodontinae. Dose-response curves of each sample were constructed using spectra acquired with a JEOL FA-200 X-Band spectrometer resulting in equivalent dose (De) of 220 ± 40 Gy and 39 ± 2 Gy for Toxodontinae and Gomphotheriidae tooth, respectively. The conversion of De in age was made using ROSY ESR dating software resulting in 26 ± 4 and 22 ± 3 ka. These results place Lagoa dos Porcos fossil assemblage within the Late Pleistocene. These dates overlap with a period of abrupt increase in rainfall in northeast Brazil, and it is possible that this environmental change is related to the formation of this deposit. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  1. Farmacopeia natural de comunidades rurais no Estado do Piauí, Nordeste do Brasil

    Directory of Open Access Journals (Sweden)

    Maria Pessoa da Silva

    2015-04-01

    Full Text Available The purpose of this work is to know more about medicinal plants, forms of usage and therapeutic indications determined by the communities of Pau-Arrastado, Salinas and Resolvido. We used semi-structured interviews, guided tours and followed the usual botanical methodology. The study sample included 93 individuals (51.9% of the total. Species were grouped into 18 categories of disease, according to the World Health Organization (WHO. We calculated the Factor of Informant Consensus (FIC and the Index of Relative Importance (IRI. They included eighty-one (81 species, belonging to 40 botanical families and 69 genera were referred, of which 75.3% were native ones. The most prominent family was Fabaceae (18.5%, and the leaves were the most used parts (32%. The preparation method most used was dye (38.2%. The highlights were the body systems: agents of bacterial and viral infections (27.2%, digestive system diseases (22.4% and genitourinary diseases (19.5%. Croton campestris A. St. Hil. and Ximenia americana L. were the most versatile with an IRI of 2.00. There was a greater consensus for the plants indicated for the treatment of liver diseases.

  2. The genus Trematocarpus (Sarcodiaceae, Rhodophyta in southern Africa and the exclusion of Sphaerococcus (Chondrus scutellatus

    Directory of Open Access Journals (Sweden)

    R. H. Simons

    1983-11-01

    Full Text Available Trematocarpus Kützing in southern Africa is found to comprise four taxa in three species: newly described is T.  fragilis (Ag. De Toni var. divaricatus Simons, var. nov. Two of the species, T. flabellatus (J. Ag. De Toni and T.  affinis (J. Ag. De Toni are restored to independent specific rank after being regarded as synonyms of T.  scutellatus (Her. Searles. It is shown that  Sphaerococcus (Chondrus scutellatus Her., the basionym of  T.  scutellatus refers to a species of Gigartina, therefore a new combination Gigartina scutellata (Her. Simons is made for this species which was formerly known as G. fastigiata J. Ag. and G. scabiosa (Kiitz. Papenf. Trematocarpus elongatus Kiitz. is relegated to synonymy under T. fragilis var.  divaricatus.

  3. Life-stage-specific differences in exploitation of food mixtures: diet mixing enhances copepod egg production but not juvenile development

    DEFF Research Database (Denmark)

    Koski, Marja; Breteler, W.K.; Schogt, N.

    2006-01-01

    , the copepods failed to moult past the first copepodite stage, and the mortality was high. In sharp contrast, mixing two nutritionally poor food species often resulted in egg production which was not significantly different from nutritionally high quality food, although hatching success in many mixtures was low......Development, egg production and hatching success of the calanoid copepods Temora longicornis and Pseudocalanus elongatus were measured in food mixtures to test their ability to obtain a complete nutrition by combining different nutritionally poor food species. In all the food mixtures used....... Whereas egg production was significantly correlated with particulate organic nitrogen in the diet, and independent of the highly unsaturated fatty acids (HUFAs), eicosapentaenoic acid (EPA) and docosahexaenoic acid (DHA), hatching increased with increasing DHA and EPA concentration. Growth and juvenile...

  4. Specific Interaction between Redox Phospholipid Polymers and Plastoquinone in Photosynthetic Electron Transport Chain.

    Science.gov (United States)

    Tanaka, Kenya; Kaneko, Masahiro; Ishikawa, Masahito; Kato, Souichiro; Ito, Hidehiro; Kamachi, Toshiaki; Kamiya, Kazuhide; Nakanishi, Shuji

    2017-04-19

    Redox phospholipid polymers added in culture media are known to be capable of extracting electrons from living photosynthetic cells across bacterial cell membranes with high cytocompatibility. In the present study, we identify the intracellular redox species that transfers electrons to the polymers. The open-circuit electrochemical potential of an electrolyte containing the redox polymer and extracted thylakoid membranes shift to positive (or negative) under light irradiation, when an electron transport inhibitor specific to plastoquinone is added upstream (or downstream) in the photosynthetic electron transport chain. The same trend is also observed for a medium containing living photosynthetic cells of Synechococcus elongatus PCC7942. These results clearly indicate that the phospholipid redox polymers extract photosynthetic electrons mainly from plastoquinone. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. Parasitoses intestinais em região semi-árida do Nordeste do Brasil: resultados preliminares distintos das prevalências esperadas Intestinal parasite infections in a semiarid area of Northeast Brazil: preliminary findings differ from expected prevalence rates

    Directory of Open Access Journals (Sweden)

    Jair Rodrigues Alves

    2003-04-01

    Full Text Available No presente trabalho procurou-se conhecer o perfil das enteroparasitoses na cidade de São Raimundo Nonato, sudeste do Piauí, e confirmar ou não os resultados obtidos em estudos anteriores em relação à infecção por Ascaris lumbricoidese Trichuris trichiura. No período de setembro de 2000 a fevereiro de 2001, por meio de amostragem domiciliar por conveniência, foram examinadas 265 amostras fecais da população pelo método de sedimentação espontânea, das quais 57% foram positivas para enteroparasitos. Entamoeba coli (35,8%, Endolimax nana (13,6%, Hymenolepis nana (9,4% e os ancilostomídeos (9,4% foram os parasitos mais freqüentes. Foram observados dois casos de A. lumbricoides, possivelmente adquiridos fora do município. Nenhuma amostra foi positiva para T. trichiura. Esses resultados mostram um padrão diferente do restante do país. Traça-se um paralelo entre os resultados deste estudo com os achados paleoparasitológicos na população pré-histórica, habitante da região há pelo menos sete mil anos.We report on intestinal parasite infection prevalence in a population sample from São Raimundo Nonato, Southeast Piauí State, Brazil, aimed at comparison with previous studies on Trichuris trichiura and Ascaris lumbricoides infection. A total of 265 stool specimens were collected and examined by spontaneous sedimentation. Approximately 57% of specimens were infected with at least one parasite species. Entamoeba coli (35.8%, Endolimax nana (13.6%, Hymenolepis nana (9.4%, and hookworm (9.4% were the most frequently observed parasites. Two cases of roundworm infection were detected, probably acquired outside the region. T. trichiura eggs were not found. Interestingly, neither A. lumbricoides nor T. trichiura has been found in local prehistoric human coprolites. Nevertheless, hookworm infection has been present in the region for at least 7,000 years.

  6. Effects of Irregular Bimetallic Nanostructures on the Optical Properties of Photosystem I from Thermosynechococcus elongatus

    Directory of Open Access Journals (Sweden)

    Imran Ashraf

    2015-07-01

    Full Text Available The fluorescence of photosystem I (PSI trimers in proximity to bimetallic plasmonic nanostructures have been explored by single-molecule spectroscopy (SMS at cryogenic temperature (1.6 K. PSI serves as a model for biological multichromophore-coupled systems with high potential for biotechnological applications. Plasmonic nanostructures are fabricated by thermal annealing of thin metallic films. The fluorescence of PSI has been intensified due to the coupling with plasmonic nanostructures. Enhancement factors up to 22.9 and 5.1 are observed for individual PSI complexes coupled to Au/Au and Ag/Au samples, respectively. Additionally, a wavelength dependence of fluorescence enhancement is observed, which can be explained by the multichromophoric composition of PSI.

  7. LEVANTAMENTO DO PERFIL DOS SITES DE COMPRA COLETIVA DO ESTADO DO PIAUÍ

    Directory of Open Access Journals (Sweden)

    Eulálio Campelo Filho

    2016-04-01

    Full Text Available Entrepreneurs are continually innovating in their commercialization methods since ancient times. However, with the introduction of the internet in business, the rhythm of innovation has grown exponentially. And the group buying sites are one of the newest trends in this market. This article intends to characterize this segment as well as its actors, while seeking to identify the strategies applied by these companies in their daily business. The research is composed by a quantitative, descriptive and census study realized in the city of Teresina, Piauí, including all group buying sites in the region. The work has found that although it deals with a relatively new segment, the companies operating in this field apply well-defined strategies in several areas, such as pricing, strategic partnerships and communication channels.

  8. História de uma sesmaria e suas aventuras

    Directory of Open Access Journals (Sweden)

    Barbosa Lima Sobrinho

    1977-06-01

    Full Text Available A sesmaria é a 1705, concedida à viuva de Domingos Jorge Velho, D. Jerônima Cardim Froes e oficiais do terço paulista, que acabava de completar a expugnação dos Palmares, vencendo os negros refugiados nos quilombos das serras alagoanas. Quem primeiro nos deu notícia da existência dessa sesmaria foi o historiador pernambucano Pereira da Costa, na sua conhecida e respeitada Cronologia Histórica do Estado do Piauí, publicada em 1909, com o apoio de Anísio de Abreu, que era então Governador daquele Estado. Incluia-se a data de terra entre as sesmarias concedidas pelo Governo de Pernambuco e que Pereira da Costa encontrara nos códices manuscritos, existentes na Biblioteca Pública do Recife.

  9. #Contraoaumento as a socio-popular claim and questioning of the midiatic coverage in the newspapers Meio Norte and O Dia

    Directory of Open Access Journals (Sweden)

    Carlos Augusto de frança rocha Júnior

    2012-07-01

    Full Text Available This article proposes an analysis of six editions of Piaui newspapers “Meio Norte” and “O Dia”. It is about of news stories linked to the popular mobilization against the increase of the public transport fee. The corpus of the research covers the period of August 29th, 2011 until September 3rd, 2011- when the popular protest occurred in Teresina (capital of Piauí. The article’s objective is identifying the strategies of each publication and how relevant this subject is in the mentioned newspapers. Discourse Analysis was applied as one efficient methodology to this research based on concepts like “reading contract” and “interdiscourse”, and based on some authors as Charaudeau (2006, Mainguenau (2008 Marques de Melo (1985 and Verón (2004.

  10. Global metabolic rewiring for improved CO2 fixation and chemical production in cyanobacteria

    Science.gov (United States)

    Kanno, Masahiro; Carroll, Austin L.; Atsumi, Shota

    2017-03-01

    Cyanobacteria have attracted much attention as hosts to recycle CO2 into valuable chemicals. Although cyanobacteria have been engineered to produce various compounds, production efficiencies are too low for commercialization. Here we engineer the carbon metabolism of Synechococcus elongatus PCC 7942 to improve glucose utilization, enhance CO2 fixation and increase chemical production. We introduce modifications in glycolytic pathways and the Calvin Benson cycle to increase carbon flux and redirect it towards carbon fixation. The engineered strain efficiently uses both CO2 and glucose, and produces 12.6 g l-1 of 2,3-butanediol with a rate of 1.1 g l-1 d-1 under continuous light conditions. Removal of native regulation enables carbon fixation and 2,3-butanediol production in the absence of light. This represents a significant step towards industrial viability and an excellent example of carbon metabolism plasticity.

  11. Postcard and reversed journalism in narratives about cities

    Directory of Open Access Journals (Sweden)

    Ana Cláudia Peres

    2015-09-01

    Full Text Available The city is a place of encounters. Journalism often appropriates raw facts and statistic data in order to narrate it. However, there are many ways to understand the urban experience within the field, through accounts that go beyond technical rationality. This paper attempts to understand journalistic narratives as producers of meaning and the city as a text, as proposed by Michel de Certeau. Therefore, we investigate narratives about the city in the magazine piauí as a starting point to examine discursive strategies that by combining the real and the poetic expand the fact, produce dialogues and expose other possible types of journalism. Above all, we aim to provide a reflection on the place that journalism occupies today within the field of knowledge, within an epistemological perspective that considers the material and symbolic, factual and emotional, ethical and aesthetic contexts.

  12. Prevalence of Pressure Injury of Bedridden Patients, Hospitalized in a Public Hospital

    Directory of Open Access Journals (Sweden)

    Sandra Marina Gonçalves Bezerra

    2017-03-01

    Full Text Available Objective: To analyze the prevalence of pressure injury in bedridden patients, hospitalized in a public hospital. Methodology: This is a cross-sectional study conducted in the city of Teresina, state of Piauí. The sample consisted of 27 bedridden patients, with pressure injuries. Results: The injury prevalence was 31,4%. From the 27 patients studied, 59.3% were elderly, 77.8% were male, 48.1% had circulatory system diseases, 22.2% had respiratory system diseases and 59.3% of the pressure injuries were located in the sacral region. Conclusion: The prevalence of pressure injury was high among bedridden patients, which shows the need of preventive measures, such as protocol implantation, use of scale of risk assessment, appropriate supporting surface, repositioning in bed, adequacy of dressings and instructions for patient discharge. Keywords: Pressure ulcer. Prevalence. Nursing.

  13. Municipal Management, Infrastructure And Perception Of Users: A Description Of National Program For Improving Access And Quality Of Primary Care In The Brazilian Semiarid

    Directory of Open Access Journals (Sweden)

    Marília Gomes de Sousa Bezerra

    2017-09-01

    Full Text Available Introduction: The Ministry of Health with the aim of improving the service provided by the Unified Health System has been creating work tools to identify which points need to receive more attention to be optimized. Objective: Description of the role of municipal management, infrastructure assessment and perception of users of primary care. Method: Cross-sectional and descriptive study, conducted with Basic Units of Piauí municipality in 2015. The data were represented by tables. Results: 90% of the units reported receiving support for the planning and organization of the work process. Only 14, 81% of the units have equipment and supplies for proper operation. Users recommend the service in 92,62% of the cases. Conclusion: despite the precarious structure of the basic units of the county, the population still recognizes them as the best care.

  14. Health promotion in schools of Primary and Secondary Education in Teresina, Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Elenita Maria Dias de Sousa Aguiar

    2011-01-01

    Full Text Available Health is a topic under discussion. It is a theme with a particular range that must be worked out and discussed since the first steps until old age. As information and education are ways of stimulating the interest and the knowledge of the population on the aspects related to the sanitary monitoring, the Brazilian National Agency for Sanitary Vigilance (Anvisa conceived the Education and Information Project. It develops educative actions in schools of Primary and Secondary Education starting from the theme health, aiming to increase the level of citizens’ awareness. It considers the multiplying factor represented by the children and the social function of school. This paper presents an experience account developed through an action defined by the Education and Information Project, which aimed to work out the health promotion with primary and secondary students of public schools. Amongst the results the following ones are highlighted: the identification of healthy practices with regard to the preservation of health; the distinction between drugs and medicines; greater awareness of the care with medicines; and obtaining more information on “selfmedication”.

  15. Adsorção de cobre em amostras de Plintossolo do Estado do Piauí, com diferentes características Copper adsorption in Plinthosol samples from Piauí State, Brazil, with different characteristics

    Directory of Open Access Journals (Sweden)

    Lúcia H. G. Chaves

    2009-06-01

    Full Text Available A capacidade de adsorção de cobre pelo solo é um dado importante em estudos de movimentação de solutos uma vez que, se a capacidade adsortiva de um solo for ultrapassada, o metal ficará potencialmente disponível para ser lixiviado. Neste trabalho se analisam o comportamento da adsorção de cobre face às diferentes características de amostras de Plintossolo e a influência da variação de pH na adsorção do cobre, verificando-se a adequação das equações de Langmuir e Freundlich para descrever a adsorção deste elemento. Soluções de cloreto de cobre foram utilizadas nas concentrações 6, 10, 20, 40, 60 e 80 mg L-1 ajustadas a pH 4,0, 5,0 e 6,0. Os teores de matéria orgânica e a capacidade de troca catiônica das amostras de solo compõem as propriedades que mais influenciaram na adsorção do cobre. Os modelos de Langmuir e Freundlich mostraram-se igualmente capazes para descrever o comportamento do cobre nas diferentes amostras de solo estudadas. A adsorção do cobre variou em função do pH ocorrendo maior adsorção no pH 6,0.Copper adsorption by soil is very important, as after soil adsorptive capacity is exceeded, the metal become potentially available for leaching. The objectives of this study were to analyze copper adsorption considering different properties of soil samples studied, to evaluate the influence of the pH level on copper adsorption and to verify if Langmuir and Freundlich isotherms describe adequately the copper adsorption. Solutions containing different copper concentrations (6, 10, 20, 40, 60 e 80 mg L-1 were adjusted to pH 4.0, 5.0 and 6.0. The organic matter content and cation exchange capacity were the soil properties that most influenced copper adsorption. Langmuir and Freundlich models offered a good fit for the experimental data. Copper adsorption varied with soil pH, with greater adsorption at pH 6.0.

  16. Development of a sperm cryopreservation protocol for redside dace, Clinostomus elongatus: implications for genome resource banking

    DEFF Research Database (Denmark)

    Butts, Ian A.E.; Mokdad, A.; Trippel, E.A.

    2013-01-01

    of extirpation.We developed cryopreservation protocols by testing the effects of diluent (buffered sperm motility-inhibiting saline solution [BSMIS]; BSMIS + glycine; sucrose; and Hanks’ balanced salt solution [HBSS]), cryoprotectant (dimethyl sulfoxide [DMSO]; propylene glycol [PG]; N,N-dimethylacetamide [DMA...... rate was not significant for BSMIS + glycine or for HBSS, but an effect was detected for sucrose, with sperm frozen at 5◦C/min or 10◦C/min having higher motility than sperm frozen at 1◦C/min. The effect of extender was not significant at 1◦C/min or 5◦C/min, but an effect was detected at 10◦C...

  17. Distributions and phylogeographic data of rheophilic freshwater fishes provide evidences on the geographic extension of a central-brazilian amazonian palaeoplateau in the area of the present day Pantanal Wetland

    Directory of Open Access Journals (Sweden)

    Alexandre C. Ribeiro

    Full Text Available The analysis of the distribution patterns presented by examples of freshwater fishes restricted to headwater habitat: the anostomid Leporinus octomaculatus, the characins Jubiaba acanthogaster, Oligosarcus perdido, Moenkhausia cosmops, Knodus chapadae, Planaltina sp., the loricariid Hypostomus cochliodon, and the auchenipterid Centromochlus sp. provided evidences of a relatively recent shared history between the highlands of the upper rio Paraguay and adjoining upland drainage basins. Restricted to headwater of the uplands in the upper rio Paraguay and adjoining basins, these species provide biological evidence of the former extension of the central Brazilian plateau before the origin of the Pantanal Wetland. Disjunction took place due to an ecological barrier to these rheophilic taxa represented tectonic subsidence related to the origin of the Pantanal Wetland. Molecular analysis of Jubiaba acanthogaster revealed that the sample from the upper rio Xingu basin are the sister-group of a clade that includes samples from the upper rio Arinos (upper rio Tapajós plus the upper rio Paraguay basin, supporting the assumption that the origin of the upper rio Paraguay basin causing vicariance between this basin and the upper rio Tapajós is the least vicariant event in the evolutionary history of the group.

  18. TECHNOLOGY CHARACTERIZATION OF THE FISH FARM OF THE MUNICIPALITY OF CAPITÃO POÇO, PARÁ, BRAZIL

    Directory of Open Access Journals (Sweden)

    Tiago Pereira Brito

    2017-07-01

    Full Text Available The present study describes the technological aspects of fish farming developed on the Capitão Poço in northeastern state of Pará. The data were collected through 17 semi-structured interviews in aquaculture properties in the region.The farmer was legally responsible for most property. The property's operating time ranged from 3 to 20 years and the time of experience in aquaculture activity from 10 months to 20 years (mean 5.4 ± 2.9 years. Aquaculture represented a secondary activity is for subsistence or to supplement the family income. The properties had a total area ranging from 0.5 to 750 hectares (average 124.9 ± 150.0 ha, with water area between 0.00165 and 2.16 ha (average 0.4944 ± 0.5694 ha. The semi-intensive production system was predominant (88.2%, however, the intensive system keeper tanks was also recorded (11.8%, and recorded both monocultures (70.6% as policultives (29, 4%, with cultive of Oreochromis niloticus, Colossoma macropomum, Leporinus friderici and two species hybrid. The management with regard to the analysis of water quality of farming, food supply and evaluation of growth performance, although carried out were not satisfactory, requiring greater technical training to producers. Keywords Amazon; aquaculture; farmer fish; fish; cultivation system.

  19. Perfil da mortalidade materna em maternidade pública de Teresina - PI, no Período de 1996 a 2000: uma Contribuição da Enfermagem Perfil de la Mortalidad Materna en la Maternidad Pública de Teresina - PI (Brasil, en el Periodo de 1996 a 2000: una Contribución de la Enfermería Maternal profile Mortality in a Public Maternity of Teresina - PI (Brazil, in the Period between 1996 and 2000: a Nursing Contribution

    Directory of Open Access Journals (Sweden)

    Francisca Maria do Nascimento

    2007-09-01

    Full Text Available Estudo quantitativo retrospectivo com objetivo de caracterizar o perfil da mortalidade materna em uma maternidade pública de Teresina-PI, no período de 1996 a 2000. O universo constou de 107 óbitos maternos, cujos instrumentos foram: prontuários, declarações dos óbitos, livro de registros e relatórios da enfermagem, coletados em setembro a dezembro de 2004 em formulário estruturado. Os dados relativos aos aspectos socioeconômicos e pessoais revelaram como procedência os Estados: Piauí (73, 33 da capital e 40 de outras cidades; Maranhão (33; e Pará (1. A maioria das mulheres era casada, tinha idade entre 20 e 30 anos, um a três filhos, ensino fundamental incompleto e era do lar. Os dados obstétricos na maioria revelaram a não-realização de seis consultas pré-natais, era a primeira gravidez, parto cesariano e admissão em estado grave. Destacaram-se como causas dos óbitos: infecções, hipertensão e hemorragias. Conclui-se que a mortalidade materna é problema grave, necessitando melhoria assistencial nos serviços de saúde.Estudio cuantitativo y retrospectivo, que objetivó caracterizar el perfil de la mortalidad materna de una maternidad pública en Teresina PI (Brasil, en el periodo de 1996 hasta 2000. El universo fue compuesto por 107 muertes maternas, cuyos instrumentos fueron: prontuarios, declaración de muertes, libros de registros y relatos de la enfermería, colectados en septiembre y diciembre de 2004 en formulario estructurado. Los datos relativos a los aspectos socioeconómico y personales revelaran como origen los Estados: Pará (01, Maranhão (33 y Piauí (73 de estos 33 de Teresina y 40 del interior. La mayoría de las mujeres era casada, tenía edad entre 20 y 30 años, de uno a tres niños, la educación básica incompleta, trabajadoras del hogar. Los datos de la obstetricia habían demostrado que la mayoría no realizaron seis consultas prenatales, estaban en el primer embarazo, parto cesariano y admitido

  20. Engineering a cyanobacterium as the catalyst for the photosynthetic conversion of CO2 to 1,2-propanediol

    Directory of Open Access Journals (Sweden)

    Li Han

    2013-01-01

    Full Text Available Abstract Background The modern society primarily relies on petroleum and natural gas for the production of fuels and chemicals. One of the major commodity chemicals 1,2-propanediol (1,2-PDO, which has an annual production of more than 0.5 million tons in the United States, is currently produced by chemical processes from petroleum derived propylene oxide, which is energy intensive and not sustainable. In this study, we sought to achieve photosynthetic production of 1,2-PDO from CO2 using a genetically engineered cyanobacterium Synechococcus elongatus PCC 7942. Compared to the previously reported biological 1,2-PDO production processes which used sugar or glycerol as the substrates, direct chemical production from CO2 in photosynthetic organisms recycles the atmospheric CO2 and will not compete with food crops for arable land. Results In this study, we reported photosynthetic production of 1,2-PDO from CO2 using a genetically engineered cyanobacterium Synechococcus elongatus PCC 7942. Introduction of the genes encoding methylglyoxal synthase (mgsA, glycerol dehydrogenase (gldA, and aldehyde reductase (yqhD resulted in the production of ~22mg/L 1,2-PDO from CO2. However, a comparable amount of the pathway intermediate acetol was also produced, especially during the stationary phase. The production of 1,2-PDO requires a robust input of reducing equivalents from cellular metabolism. To take advantage of cyanobacteria’s NADPH pool, the synthetic pathway of 1,2-PDO was engineered to be NADPH-dependent by exploiting the NADPH-specific secondary alcohol dehydrogenases which have not been reported for 1,2-PDO production previously. This optimization strategy resulted in the production of ~150mg/L 1,2-PDO and minimized the accumulation of the incomplete reduction product, acetol. Conclusion This work demonstrated that cyanobacteria can be engineered as a catalyst for the photosynthetic conversion of CO2 to 1,2-PDO. This work also characterized two NADPH

  1. Improved Alkane Production in Nitrogen-Fixing and Halotolerant Cyanobacteria via Abiotic Stresses and Genetic Manipulation of Alkane Synthetic Genes.

    Science.gov (United States)

    Kageyama, Hakuto; Waditee-Sirisattha, Rungaroon; Sirisattha, Sophon; Tanaka, Yoshito; Mahakhant, Aparat; Takabe, Teruhiro

    2015-07-01

    Cyanobacteria possess the unique capacity to produce alkane. In this study, effects of nitrogen deficiency and salt stress on biosynthesis of alkanes were investigated in three kinds of cyanobacteria. Intracellular alkane accumulation was increased in nitrogen-fixing cyanobacterium Anabaena sp. PCC7120, but decreased in non-diazotrophic cyanobacterium Synechococcus elongatus PCC7942 and constant in a halotolerant cyanobacterium Aphanothece halophytica under nitrogen-deficient condition. We also found that salt stress increased alkane accumulation in Anabaena sp. PCC7120 and A. halophytica. The expression levels of two alkane synthetic genes were not upregulated significantly under nitrogen deficiency or salt stress in Anabaena sp. PCC7120. The transformant Anabaena sp. PCC7120 cells with additional alkane synthetic gene set from A. halophytica increased intracellular alkane accumulation level compared to control cells. These results provide a prospect to improve bioproduction of alkanes in nitrogen-fixing halotolerant cyanobacteria via abiotic stresses and genetic engineering.

  2. Role of essential lipids in copepod nutrition: no evidence for trophic upgrading of food quality by a marine ciliate

    DEFF Research Database (Denmark)

    Klein Breteler, W.; Koski, Marja; Rampen, S.

    2004-01-01

    -quality Rhodomonas sp. diet. The specific mass of fatty acids in S. sulcatum was much lower than in the Dunaliella sp. diet, However, the fatty acid composition of the protozoan more or less resembled that of the food, lacking long-chain highly unsaturated fatty acids (HUFAs). Sterols only occurred in Dunaliella sp......The ciliate Strombidium sulcatum was used to feed and grow young stages of the copepods Temora longicornis (Muller) and Pseudocalanus elongatus (Boeck). The ciliate was cultured in the laboratory using either bacteria or the green alga Dunaliella sp. as a food source. Young copepodites of both......., although in low abundance of unuseful Delta7 sterols. Obviously, S. sulcatum did not biochemically enhance bacterial or algal food for subsequent use at higher trophic levels, and only transferred fatty acids without further conversion. The results indicate a deficiency in the ciliate of HUFAs and sterols...

  3. Cyanobacterial diversity in extreme environments in Baja California, Mexico: a polyphasic study.

    Science.gov (United States)

    López-Cortés, A; García-Pichel, F; Nübel, U; Vázquez-Juárez, R

    2001-12-01

    Cyanobacterial diversity from two geographical areas of Baja California Sur, Mexico, were studied: Bahia Concepcion, and Ensenada de Aripez. The sites included hypersaline ecosystems, sea bottom, hydrothermal springs, and a shrimp farm. In this report we describe four new morphotypes, two are marine epilithic from Bahia Concepcion, Dermocarpa sp. and Hyella sp. The third, Geitlerinema sp., occurs in thermal springs and in shrimp ponds, and the fourth, Tychonema sp., is from a shrimp pond. The partial sequences of the 16S rRNA genes and the phylogenetic relationship of four cyanobacterial strains (Synechococcus cf. elongatus, Leptolyngbya cf. thermalis, Leptolyngbya sp., and Geitlerinema sp.) are also presented. Polyphasic studies that include the combination of light microscopy, cultures and the comparative analysis of 16S rRNA gene sequences provide the most powerful approach currently available to establish the diversity of these oxygenic photosynthetic microorganisms in culture and in nature.

  4. Photosystem II Water Oxidation: Mechanism, Efficiency and Flux in Diverse Oxygenic Phototrophs

    Energy Technology Data Exchange (ETDEWEB)

    Dismukes, Gerard Charles [Rutgers Univ., Piscataway, NJ (United States); Ananyev, Gennady [Rutgers Univ., Piscataway, NJ (United States); Gates, Colin [Rutgers Univ., Piscataway, NJ (United States)

    2018-01-09

    In one year, we pursued four aims: 1) extend the VZAD model to allow analysis of PSII chlorophyll fluorescence emission as modulated by interaction with the WOC (partial success); 2) compare the solar energy conversion efficiencies of PSII-WOCs from intact cells, isolated thylakoid membranes and PSII core complexes and crystals from cyanobacterium Thermosynechococcus elongatus (collaboration with Lawrence Berkeley National Laboratory; some success after changing collaborator); 3) determine whether PSIIs can store light energy by pumping protons across the thylakoid membrane (PSII-cyclic electron flow) and how it is regulated within the green alga Chlorella ohadii (collaboration with the Hebrew University of Jerusalem; some success); and 4) genetically replace the native PSII-D1 protein subunit from a higher plant with two cyanobacterial D1 isoforms to test whether their functional advantages in growth and photoprotection can be transferred (collaboration with Rutgers University; success).

  5. Detecção e análise da variabilidade de seqüências do Banana streak virus (BSV em bananeiras no Brasil Detection and analysis of Banana streak virus (BSV sequences variability of banana from Brazil

    Directory of Open Access Journals (Sweden)

    Daniel Figueiredo

    2006-06-01

    Full Text Available A técnica de PCR utilizando-se "primers" degenerados para o gênero Badnavirus foi utilizada para a detecção e análise da variabilidade de seqüências do Banana streak virus (BSV provenientes de bananeiras. A partir desta metodologia seqüências do vírus puderam ser detectadas em cultivares diplóides (AA, triplóides (AAA; AAB e tetraplóides (AAAB. Foram encontrados quatro padrões de seqüência do BSV (estirpes BSVBR-1, BSVBR-2, BSVBR-3 e BSVBR-4, diferenciadas através da análise do perfil eletroforético das amostras amplificadas. A estirpe BSVBR-1 prevalece nos estados do Acre, Amazonas, Bahia, Ceará, Goiás, Minas Gerais, Piauí, Rio de Janeiro, Rondônia, Santa Catarina, e São Paulo, enquanto que, a estirpe BSVBR-2 foi encontrada em amostras oriundas do Amazonas e do Ceará. As estirpes BSVBR-3 e BSVBR-4 foram encontradas apenas no Ceará. Este trabalho revela a presença de diferentes estirpes do BSV no Brasil, bem como a existência de cultivares de bananeiras sadias e livres de seqüências virais do BSV integradas ao seu genoma.PCR assay using degenerate primers, designed to Badnavirus genus, was used to detect and analyse the variability of BSV strains sequences from banana. The virus was detected in diploid (AA, triploids (AAA; AAB and tetraploids (AAAB banana cultivars. Four BSV sequences patterns (BSVBR-1, BSVBR-2, BSVBR-3 and BSVBR-4 strains were found, and distinguished by eletrophoresis. The strain BSVBR-1 was found in the states of Acre, Amazonas, Bahia, Ceará, Goiás, Minas Gerais, Piauí, Rio de Janeiro, Rondônia, Santa Catarina and São Paulo, while BSVBR-2 strain was detected in the states of Amazonas and Ceará. BSVBR-3 and BSVBR-4 strains were found only in the state of Ceará. This work demonstrated the presence of different BSV strains in Brazil and the existence of health banana cultivars as well as cultivars free of BSV integrated sequences.

  6. Mapeamento de locos de características quantitativas associados à composição de carcaça, no cromossomo seis de suíno Mapping of quantitative trait loci for carcass composition on swine chromosome six

    Directory of Open Access Journals (Sweden)

    A.V. Pires

    2008-06-01

    Full Text Available Uma população de suínos, composta de 550 animais F2, foi produzida a partir do intercruzamento da geração F1, obtida pelo cruzamento divergente de dois machos da raça nativa brasileira Piau com 18 fêmeas comerciais. O objetivo do trabalho foi mapear locos de características quantitativas (QTL associados a cortes de carcaça. Os animais foram genotipados para 13 marcadores microssatélites, distribuídos no cromossomo 6 de suínos. As características avaliadas foram: peso total do pernil, peso do pernil sem pele e sem capa de gordura, peso total da copa, peso da copa sem pele e sem capa de gordura, peso total da paleta, peso da paleta sem pele e sem capa de gordura, peso total do carré, peso do lombo, peso total do bacon, peso das costelas, peso total da papada, peso do filezinho e peso da banha rama. Utilizou-se o método de regressão por intervalo de mapeamento por meio do programa QTL Express. Foram encontrados indicativos de QTL para peso de pernil limpo, peso de paleta, peso de lombo e peso de filezinho. A região genômica deve ser saturada com marcadores adicionais para confirmar a presença de QTL reais.A swine population of 550 F2 animals was produced by outbred cross using two sires of the native Brazilian breed Piau and 18 commercial dams. The animals were genotyped for 13 microsatellite markers. The evaluated composition traits of carcass were: ham weight, skinless and fatless ham weight, boston shoulder weight, skinless and fatless boston shoulder weight, picnic shoulder weight, skinless and fatless picnic shoulder weight, total loin (bone-in weight, loin weight, bacon weight, rib weight, jowl weight, sirloin weight, and belly fat weight. Data were analyzed by multiple regression interval mapping, using the QTL Express software. Suggestive QTL were found for skinless and fatless ham weight, picnic shoulder weight, loin weight, and sirloin weight. However, the genomic region should be saturated with additional markers in

  7. Simulação da precipitação diária para Parnaíba e Teresina, PI, em planilha eletrônica Daily rainfall simulation in Parnaíba and Teresina - Brazil, using a spreadsheet

    Directory of Open Access Journals (Sweden)

    Aderson S. de Andrade Júnior

    2001-05-01

    Full Text Available Os estudos envolvendo precipitação pluviométrica são bastante dificultados devido ao fato das séries históricas disponíveis serem, na maioria dos casos, muito pequenas para efetuá-los. Desta forma, faz-se necessário dispor de uma técnica de simulação estocástica que possibilite a geração de valores diários de precipitação, utilizando-se uma planilha eletrônica. No Estado do Piauí, estudos com esse objetivo são inexistentes, razão por que este trabalho tem o objetivo de simular a precipitação pluviométrica diária para as regiões de Parnaíba e Teresina, PI, através de uma planilha eletrônica. O processo de simulação se baseou no método de Monte Carlo. A ocorrência da precipitação foi determinada através da cadeia de Markov, enquanto a sua magnitude foi estimada pelas funções de distribuição de probabilidades gama e empírica. O modelo utilizado proporcionou estimativas com excelente precisão e exatidão, fato comprovado pelos resultados satisfatórios quanto aos índices de desempenho estatísticos.The studies involving rainfall are quite difficult to conduct due to the fact that the available historical series, in most of the cases, are too small to make them. Thus, it is necessary to adjust a stochastic simulation technique that facilitates the generation of daily rainfall values, using a spreadsheet. In Piauí State, studies with this objective are inexistent for its several regions of agricultural importance. This work was executed with the objective of simulating the daily rainfall for the regions of Parnaíba and Teresina - PI, Brazil, using a spreadsheet. The simulation process was based on Monte Carlo's method. The occurrence of the rainfall was determined through a Markov chain, while its magnitude was estimated by gamma and empirical distribution functions. The model used provided estimates with excellent precision and accuracy, checked by satisfactory results of the statistical performance index.

  8. Situação socioeconômica e reprodutiva de mulheres presidiárias Sociodemographic and reproductive factors of female prisoners

    Directory of Open Access Journals (Sweden)

    Maria Aline Rodrigues Barros

    2016-10-01

    Full Text Available Objetivo: Investigar o perfil socioeconômico e reprodutivo de presidiárias. Metodologia: Estudo descritivo com abordagem quantitativa realizado com 47 presidiárias de duas penitenciárias femininas do Estado do Piauí. A coleta de dados foi realizada de julho a agosto de 2013 e contemplou dados acerca da situação socioeconômica e sexual. Resultados: Evidenciaram mulheres jovens, solteiras, cuja ocupação exigia pouca qualificação, baixa escolaridade e renda. Quanto à saúde reprodutiva, 42,5% eram multíparas e 40,4% não realizaram nenhuma consulta de pré-natal. A frequência de abortos provocados foi de 42,5%. Conclusão: Observou-se a necessidade de planejar estratégias educacionais de promoção da saúde reprodutiva que englobem as peculiaridades sociais vivenciadas.

  9. PROFESSIONAL CONVERGENCE: A CASE STUDY ON CHANGES IN THE JOURNALIST’S PROFILE

    Directory of Open Access Journals (Sweden)

    Jan Alyne Barbosa e Silva

    2013-12-01

    Full Text Available This paper aims at discussing some of the changes journalists have been going through, due to the use and appropriation of Communication and Information Technologies. This study is based on the case of Efrém Ribeiro, a journalist who works at Sistema Integrado de Comunicação Meio Norte, a TV broadcaster located in the city of Teresina, in the state of Piauí, Northeastern, Brazil. By exercising media and functional polyvalences, Efrém has been accumulating a number of functions previously distributed separately, as well as incorporating technological innovations in his production process. The case study consists of in-depth interviews and participant observation. The results show that the polyvalences occur only in terms of investigation and production of content for print, TV and the Web, however, deeply rooted in traditional, separate and divergent models and processes of production.

  10. [Object-oriented remote sensing image classification in epidemiological studies of visceral leishmaniasis in urban areas].

    Science.gov (United States)

    Almeida, Andréa Sobral de; Werneck, Guilherme Loureiro; Resendes, Ana Paula da Costa

    2014-08-01

    This study explored the use of object-oriented classification of remote sensing imagery in epidemiological studies of visceral leishmaniasis (VL) in urban areas. To obtain temperature and environmental information, an object-oriented classification approach was applied to Landsat 5 TM scenes from the city of Teresina, Piauí State, Brazil. For 1993-1996, VL incidence rates correlated positively with census tracts covered by dense vegetation, grass/pasture, and bare soil and negatively with areas covered by water and densely populated areas. In 2001-2006, positive correlations were found with dense vegetation, grass/pasture, bare soil, and densely populated areas and negative correlations with occupied urban areas with some vegetation. Land surface temperature correlated negatively with VL incidence in both periods. Object-oriented classification can be useful to characterize landscape features associated with VL in urban areas and to help identify risk areas in order to prioritize interventions.

  11. PROMETEUS 17, ANO 8

    Directory of Open Access Journals (Sweden)

    Os Editores da Prometeus

    2015-04-01

    Full Text Available A Prometeus chega ao seu número 17 e seu oitavo ano. Nessa edição, temos uma excelente seleção de artigos.Focalizando a filosofia antiga, temos Lethícia Ouro, Bruno Karl, Irley Franco, Leonidas Konstantakos, Helena Maronna, Miguel Ángel Rossi.Em artigo especial, Rodrigo Brito lida com a filosofia judaica de Abrahan Cohen.A filosofia contemporânea é abordada por Antonio Baptista Gonçalves, que trata de Deleuze, e Paulo Sérgio Calvet, que  trata de Hanna Arendt.Nossa edição se encerra com três traduções: uma de Boécio (William Piauí, uma de Tomás de Aquino (Húdson Canuto e uma de Eurídepdes (Evandro Luis SalvadorDesejamos que os pesquisadores se beneficiem com os trabalhos que selecionamos.Os Editores 

  12. PET-Tutorial education program: structure and actions in the cities of São Raimundo Nonato-PI, Juazeiro-BA and Petrolina-PE

    Directory of Open Access Journals (Sweden)

    Marcelo de Maio Nascimento

    2015-12-01

    Full Text Available This study presents the PET archeology groups, Biomechanics, Physical Education and Environmental Sanitation, linked to the Federal University of Vale do São Francisco/UNIVASF, which has the multicampi structure. Therefore, PET groups contribute to the process of internalization of higher education in the states of Pernambuco, Bahia and Piauí. His actions prioritize the inseparability of teaching, research and extension, qualifying 48 students fellows. The text highlights the actions of groups during the three-year period, 2011-2013, presenting objectives, methodological procedures and main results obtained to communities that have operated. We conclude that in three years of work, PET teams improved the academic background of a significant group of students of UNIVASF, functioning as a mechanism to align with the academic knowledge to solve social demands within the health and preservation of heritage in the region Northeast of Brazil.

  13. AVALIAÇÃO COMPARATIVA DA METODOLOGIA DE DETERMINAÇÃO DA ÁREA DE OLHO DE LOMBO EM SUÍNOS (Sus domesticus

    Directory of Open Access Journals (Sweden)

    MAURÍCIO DE PAULA FERREIRA TEIXEIRA

    2011-06-01

    Full Text Available In studies involving the carcass characteristics conducted at the Department of Animal Science of the Federal University of Piauí, the linear measurements of rib eye area (REA and subcutaneous fat area (SFA have been carried out by the plastic grid method, in which readings are made by counting in cm². In order to test this widelyused approach, this study aimed at conducting a comparison among three other more or less precise procedures in order to verify the traditional method accuracy. To estimate the effect of both genetic patterns and the four determination methods (Feedback, AutoCAD, Planimeter, and Weighing on REA and SFA, analysis of variance (ANOVA was used in 2 x 4 factorial arrangement. There was no difference among the four methodologies and the feedback method shows easier implementation, more practicality and reliability to be used in researches.

  14. Pobreza multidimensional nos municípios da Região Nordeste

    Directory of Open Access Journals (Sweden)

    Janaina Ottonelli

    2014-10-01

    Full Text Available Na abordagem das capacitações de Sen (1981, 1985, 2000, 2001, a pobreza significa privação em diferentes aspectos da vida. O objetivo deste estudo é mensurar a pobreza multidimensional nos municípios da Região Nordeste por meio da teoria dos conjuntos fuzzy e dados do Censo Demográfico (IBGE, 2010. São utilizados 19 indicadores (funcionamentos distribuídos em quatro dimensões: educação, saúde, condições habitacionais e renda. Os resultados indicam pobreza, com destaque nas dimensões da renda e da educação, principalmente nos estados de Maranhão, Alagoas, Piauí e Paraíba. Políticas de redução da pobreza precisam considerar quais são as privações sofridas pelas pessoas e as particularidades do local onde vivem.

  15. Integrity and activity of photosystem 2 complexes isolated from the thermophilic cyanobacterium Synechococcus elongatus using various detergents

    Czech Academy of Sciences Publication Activity Database

    Šetlíková, Eva; Sofrová, D.; Prášil, Ondřej; Budáč, Petr; Koblížek, Michal; Šetlík, Ivan

    1999-01-01

    Roč. 37, č. 2 (1999), s. 183-200 ISSN 0300-3604. [Regional Photosynthesis Workshop /2./. Lipno, 31.01.1999-03.02.1999] R&D Projects: GA ČR GA206/96/1266; GA ČR GA206/98/P110; GA MŠk VS96085; GA MŠk ME 138 Grant - others:NATO(EC) LG970388 Subject RIV: ED - Physiology Impact factor: 0.734, year: 1999

  16. Single Molecule Spectroscopy on Photosynthetic Pigment-Protein Complexes

    CERN Document Server

    Jelezko, F; Schuler, S; Thews, E; Tietz, C; Wechsler, A; Wrachtrup, J

    2001-01-01

    Single molecule spectroscopy was applied to unravel the energy transfer pathway in photosynthetic pigment-protein complexes. Detailed analysis of excitation and fluorescence emission spectra has been made for peripheral plant antenna LHC II and Photosystem I from cyanobacterium Synechococcus elongatus. Optical transitions of individual pigments were resolved under nonselective excitation of antenna chlorophylls. High-resolution fluorescence spectroscopy of individual plant antenna LHC II indicates that at low temperatures, the excitation energy is localized on the red-most Chl a pool absorbing at 680 nm. More than one pigment molecule is responsible for the fluorescence emission of the LHC II trimer. The spectral lines of single Chl a molecules absorbing at 675 nm are broadened because of the Foerster energy transfer towards the red-most pigments. Low-temperature spectroscopy on single PS I trimers indicates that two subgroups of pigments, which are present in the red antenna pool, differ by the strength of t...

  17. Preparation and HPLC isolation of L-[U-14C]tryptophan from enzyme hydrolysate labelled with 14C

    International Nuclear Information System (INIS)

    Novak, J.; Tintera, S.; Hromadkova, B.

    1990-01-01

    Tryptophan was obtained from biomass of the blue-green alga Synechococcus elongatus cultivated under 14 CO 2 . After partial purification, the protein fraction was subjected to enzymatic hydrolysis using pronase. Semipreparative isolation of L-[U- 14 C]tryptophan was accomplished on a HPLC column of Separon S Hema 1000 CM, 2% ethanol were added to the eluent, and a precolumn packed with the basic anion exchanger Spheron 1000 DEAE was used. Always after the passage of L-[U- 14 C]tryptophan, the precolumn was decoupled. The substance was collected in 96% ethanol. After removing the solvent by vacuum evaporation, the sample was analyzed on a column packed with Separon SIX C 18 in the eluent of 0.1M-NaH 2 PO 4 , 2% methanol. When the desired radiochemical purity was not attained, the sample was purified on Separon SIX C 18 using 2% methanol. The final radiochemical purity achieved by using this method is 98%. (P.A.). 5 figs., 2 tabs., 4 refs

  18. Circadian clock protein KaiC forms ATP-dependent hexameric rings and binds DNA.

    Science.gov (United States)

    Mori, Tetsuya; Saveliev, Sergei V; Xu, Yao; Stafford, Walter F; Cox, Michael M; Inman, Ross B; Johnson, Carl H

    2002-12-24

    KaiC from Synechococcus elongatus PCC 7942 (KaiC) is an essential circadian clock protein in cyanobacteria. Previous sequence analyses suggested its inclusion in the RecADnaB superfamily. A characteristic of the proteins of this superfamily is that they form homohexameric complexes that bind DNA. We show here that KaiC also forms ring complexes with a central pore that can be visualized by electron microscopy. A combination of analytical ultracentrifugation and chromatographic analyses demonstrates that these complexes are hexameric. The association of KaiC molecules into hexamers depends on the presence of ATP. The KaiC sequence does not include the obvious DNA-binding motifs found in RecA or DnaB. Nevertheless, KaiC binds forked DNA substrates. These data support the inclusion of KaiC into the RecADnaB superfamily and have important implications for enzymatic activity of KaiC in the circadian clock mechanism that regulates global changes in gene expression patterns.

  19. Enhancing the light-driven production of D-lactate by engineering cyanobacterium using a combinational strategy

    Science.gov (United States)

    Li, Chao; Tao, Fei; Ni, Jun; Wang, Yu; Yao, Feng; Xu, Ping

    2015-05-01

    It is increasingly attractive to engineer cyanobacteria for bulk production of chemicals from CO2. However, cofactor bias of cyanobacteria is different from bacteria that prefer NADH, which hampers cyanobacterial strain engineering. In this study, the key enzyme D-lactate dehydrogenase (LdhD) from Lactobacillus bulgaricus ATCC11842 was engineered to reverse its favored cofactor from NADH to NADPH. Then, the engineered enzyme was introduced into Synechococcus elongatus PCC7942 to construct an efficient light-driven system that produces D-lactic acid from CO2. Mutation of LdhD drove a fundamental shift in cofactor preference towards NADPH, and increased D-lactate productivity by over 3.6-fold. We further demonstrated that introduction of a lactic acid transporter and bubbling CO2-enriched air also enhanced D-lactate productivity. Using this combinational strategy, increased D-lactate concentration and productivity were achieved. The present strategy may also be used to engineer cyanobacteria for producing other useful chemicals.

  20. Responses of the crab Heterozius rotundifrons to heterospecific chemical alarm cues: phylogeny vs. ecological overlap.

    Science.gov (United States)

    Hazlett, Brian A; McLay, Colin

    2005-03-01

    The big-handed brachyuran crab Heterozius rotundifrons extends the time spent in its anti-predator posture, limb extended posture, if exposed to chemical cues from crushed conspecifics. In this study, we tested whether crabs also respond to chemical cues from crushed heterospecific crabs, and if so, whether phylogenetic relations or ecological overlap is more important in influencing the duration of the anti-predator posture. Chemical cues from two other brachyuran crabs (Cyclograpsus lavauxi and Hemigrapsus sexdentatus), which do not overlap directly in ecological distribution with H. rotundifrons, elicited a duration of the anti-predator posture that was indistinguishable from that produced by conspecific chemical cues. In contrast, chemical cues from two anomuran crabs (Petrolisthes elongatus and Pagurus novizealandiae) that overlap in ecological distribution with H. rotundifrons, elicited durations of the antipredator posture that were significantly shorter than those of either conspecifics or more closely related crab species. Thus, phylogenetic relationship seems to be more important than ecological overlap in influencing anti-predator behavior in H. rotundifrons.

  1. Optimization of isopropanol production by engineered cyanobacteria with a synthetic metabolic pathway.

    Science.gov (United States)

    Hirokawa, Yasutaka; Suzuki, Iwane; Hanai, Taizo

    2015-05-01

    Cyanobacterium is an attractive host for the production of various chemicals and alternative fuels using solar energy and carbon dioxide. In previous study, we succeeded to produce isopropanol using engineered Synechococcus elongatus PCC 7942 under dark and anaerobic conditions (0.43 mM, 26.5 mg/l). In the present study, we report the further optimization of this isopropanol producing condition. We then optimized growth conditions for production of isopropanol by the engineered cyanobacteria, including the use of cells in early stationary phase and buffering of the production medium to neutral pH. We observed that shifting of cultures from dark and anaerobic to light and aerobic conditions during the production phase dramatically increased isopropanol production by conversion to isopropanol from acetate, byproduct under dark and anaerobic condition. Under the optimized production conditions, the titer of isopropanol was elevated 6-fold, to 2.42 mM (146 mg/l). Copyright © 2014 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  2. Different zooplankton structures in the German Bight

    Science.gov (United States)

    Martens, P.; Brockmann, U.

    1993-06-01

    In August 1982, a net of 48 stations with altogether 208 samples was investigated in the eastern German Bight with respect to temperature, salinity, as well as the amount and species composition of the mesozooplankton (>80 μm). The data were arranged into different structures by means of a cluster analysis. Four different clusters were found: (a) a “Wadden sea water” with few holoplankton organisms but a higher amount of spionid larvae; (b) a “German Bight water” with a maximum occurrence of turbellaria ( Alaurina composita) and medium concentrations of copepods; (c) a mixing area between these two water masses with highest amounts of Oikopleura dioica, Temora longicornis, Acartia sp., mussel larvae and larvae of the spionid worms; (d) a “North Sea water” mass with highest concentrations of Pseudocalanus elongatus, Paracalanus parvus und Oithona similis. The differences in the concentrations of the species mentioned between the four clusters were significant on the 0.1%-level.

  3. Engineering an Obligate Photoautotrophic Cyanobacterium to Utilize Glycerol for Growth and Chemical Production.

    Science.gov (United States)

    Kanno, Masahiro; Atsumi, Shota

    2017-01-20

    Cyanobacteria have attracted much attention as a means to directly recycle carbon dioxide into valuable chemicals that are currently produced from petroleum. However, the titers and productivities achieved are still far below the level required in industry. To make a more industrially applicable production scheme, glycerol, a byproduct of biodiesel production, can be used as an additional carbon source for photomixotrophic chemical production. Glycerol is an ideal candidate due to its availability and low cost. In this study, we found that a heterologous glycerol respiratory pathway enabled Synechococcus elongatus PCC 7942 to utilize extracellular glycerol. The engineered strain produced 761 mg/L of 2,3-butanediol in 48 h with a 290% increase over the control strain under continuous light conditions. Glycerol supplementation also allowed for continuous cell growth and 2,3-butanediol production in diurnal light conditions. These results highlight the potential of glycerol as an additional carbon source for photomixotrophic chemical production in cyanobacteria.

  4. Prolonging hypothermic storage (4 C) of bovine embryos with fish antifreeze protein.

    Science.gov (United States)

    Ideta, Atsushi; Aoyagi, Yoshito; Tsuchiya, Kanami; Nakamura, Yuuki; Hayama, Kou; Shirasawa, Atsushi; Sakaguchi, Kenichiro; Tominaga, Naomi; Nishimiya, Yoshiyuki; Tsuda, Sakae

    2015-01-01

    Embryos obtained via superovulation are necessary for mammalian artificial reproduction, and viability is a key determinant of success. Nonfreezing storage at 4 C is possible, but currently used storage solutions can maintain embryo viability for only 24-48 h. Here we found that 10 mg/ml antifreeze protein (AFP) dissolved in culture medium 199 with 20% (v/v) fetal bovine serum and 25 mM HEPES could keep bovine embryos alive for 10 days at 4 C. We used a recombinant AFP isolated from the notched-fin eelpout (Zoarces elongatus Kner). Photomicroscopy indicated that the AFP-embryo interaction was enhanced at 37 C. Embryos pre-warmed with the AFP solution at 37 C for 60 min maintained high viability, whereas those that were not pre-warmed could live no longer than 7 days. Thus, short-term storage of bovine embryos was achieved by a combination of AFP-containing medium and controlled pre-warming.

  5. Fluorescent minerals - A potential source of UV protection and visible light for the growth of green algae and cyanobacteria in extreme cosmic environments

    Science.gov (United States)

    Omairi, Tareq; Wainwright, Milton

    2015-07-01

    We propose that green algae (Chlorella variabilis and Dunaliella tertiolecta) and cyanobacteria (Synechococcus elongatus and Nostoc commune) can grow inside fluorescent rock minerals which convert damaging UV light to visible light, thereby allowing these organisms to survive and thrive in UV-rich environments without (or with limited) visible light, which would otherwise be inimical to them. The four microorganisms were incubated inside fluorescent rocks composed of fluorite, calcite and pyrite. The resultant growth was then measured following exposure to UV radiation, with the use of optical density and measurement of chlorophyll concentration. Results show that the microorganisms were shielded from harmful UV in these semi-transparent rocks, while at the same time benefiting from the fact that the minerals converted UV to visible light; this have been shown by a statistically significant increase in their growth, which although lower than when the cells were incubated in sunlight, was significantly higher than in controls incubated in the dark.

  6. Internal radiation dose to the public from polonium-210 due to consumption of seafood from Bombay-harbour bay

    International Nuclear Information System (INIS)

    Bangera, V.S.; Rudran, Kamala

    1995-01-01

    Marine organisms such as fishes, molluscs and crustaceans are known to accumulate 210 Po. Distribution of 210 Po in coastal marine organisms mainly fishes and shell fishes is studied. Concentration of 210 Po obtained in muscle of common fishes (edible portion) varied from 2.10 ± 0.11 to 21.90 ± 5.00 Bq kg -1 dry muscle (for fishes like Pampus argenteus (Pomfret), Cynoglossus elongatus (sole), Rastrelliger kanagurta (mackerel), Harpodon nehereus (Bombay duck) etc. Concentration factors for 210 Po in edible portion of fish from sea water works out to 10 3 to 10 4 . Radiation dose to the public has been evaluated on the basis of daily intake of 40 g of fish (15 kg y -1 ). Committed effective dose (CED) to 210 Po due to consumption of sea food is calculated, CED varied from 2.05 x 10 -3 to 4 x 10 -2 mSv y -1 . (author). 7 refs., 3 figs., 3 tabs

  7. Participação e gestão local: pontuando reflexões sobre a experiência de orçamento participativo em Teresina/PI = Participation and local management: rank reflections on the experience of participating in budget Teresina/PI

    Directory of Open Access Journals (Sweden)

    Lima, Antônia Jesuíta de

    2010-01-01

    Full Text Available O debate que circunda o redimensionamento das instituições democráticas contemporâneas sinaliza para a redefinição das relações entre Estado e sociedade. Neste sentido, são preconizados novos paradigmas de gestão pública calcados em um duplo processo: de descentralização e de participação. No contexto da redemocratização da sociedade brasileira, esses parâmetros foram associados à reversão do autoritarismo que ordenou o processo de produção das políticas públicas. Assim, nas últimas décadas, assiste-se à implementação, no nível local, de formatos institucionais que visam à democratização da gestão pública. Este artigo apresenta reflexões iniciais de uma pesquisa sobre o Orçamento Participativo em Teresina/Piauí

  8. A VARIAÇÃO DO RÓTICO EM CIDADES TOCANTINENSES: EM BUSCA DE UMA NORMA FONÉTICA

    Directory of Open Access Journals (Sweden)

    Greize Alves da Silva

    2017-02-01

    Full Text Available The political emancipation of the state of Tocantins, Brazil, occurred 28 years ago, The state is characterized by linguistic varieties due to the intense migratory flow of people hailing mainly from neighboring states of Maranhão, Piauí, Bahia and Pará. Porto Nacional, Pedro Afonso and Natividade, founded on the former northern region of the state of Goiás, are the towns with the highest number of immigrants. In fact, they are relevant historical places formed by autochthonous people and immigrants. Since the above-mentioned towns present important variation aspects of the spoken Portuguese language in Tocantins, current study identifies and analyzes rhotic pronunciation, graphematically represented by /R/ as a syllabic coda, in the three mentioned towns. Survey was undertaken with 24 topodynamic and topostatic informants distributed by gender and age. A segment of the questionnaire with 25 questions collected from the project “Topodynamic and Topostatic Linguistic Atlas of the State of Tocantins (ALiTTETO”is investigated.

  9. PARTICIPATION OF TICKS IN THE INFECTIOUS CYCLE OF CANINE VISCERAL LEISHMANIASIS, IN TERESINA, PIAUÍ, BRAZIL

    Directory of Open Access Journals (Sweden)

    José Henrique Furtado Campos

    2014-07-01

    Full Text Available In this study, we detected Leishmania spp. infection in R. sanguineus collected from dogs that were naturally infected with L. (L. infantum. We examined 35 dogs of both sexes and unknown ages. The infected dogs were serologically positive by the immunofluorescence antibody test (IFAT, enzyme-linked immunosorbent assay (ELISA, and Quick Test-DPP (Dual Path Platform, as well as parasitological examination of a positive skin biopsy or sternal bone marrow aspiration. Ten negative dogs were included as controls. The ticks that infested these dogs were collected in pools of 10 adult females per animal. The PCR was performed with specific primers for Leishmania spp., which amplified a 720-bp fragment. Of the 35 analyzed samples, a product was observed in eight samples (8/35; 22.9%. We conclude that the presence of parasite DNA suggests that ticks participate in the zoonotic cycle of canine visceral leishmaniasis, in the city of Teresina, Piauí.

  10. The presumed reader in car advertisements published in Teresina's printed newspapers, from 1950 to 2002

    Directory of Open Access Journals (Sweden)

    Francisco Alves Filho

    2015-08-01

    Full Text Available This article aims to present how the image of the presumed reader has been built in the printed newspapers of the city of Teresina (Piaui State, Brazil, with them being the following: O Piauí, Folha da Manhã, O Dia, and Diário do Povo. In order to do so, we have researched the bibliography referent to the studies of authors such as Charles Bazerman (2011, Carolyn Miller (2009 [1984], and Amy Devitt (2004, representatives of Gender Rhetorical Studies. Besides these, we have consulted Bakhtin's assumptions for studying genre, mainly extracted from Marxism and the Philosophy of Language, and Aesthetics of Verbal Creation, as well as Brazilian authors related to the study of discursive genres, such as Fiorin (2008, Marcuschi (2008, and Faraco (2009. With the research, we could confirm that the advertisements actually build social-historic blocks capable of mirroring the values of a society, but also capable of contributing directly for determined values to be restored or forgotten.

  11. PROJETO JOVEM DE FUTURO: UMA TECNOLOGIA DO INSTITUTO UNIBANCO PARA A GESTÃO DE ESCOLAS PÚBICAS DE ENSINO MÉDIO

    Directory of Open Access Journals (Sweden)

    Regina Tereza Cestari de Oliveira

    2015-12-01

    Full Text Available Este artigo tem como objetivo discutir a relação entre o público e o privado na Educação Básica. Para tanto, focaliza o Projeto Jovem de Futuro, apresentado pelo Instituto Unibanco, pré-qualificado no Guia de Tecnologias Educacionais do Ministério da Educação (MEC, efetivado por meio de parceria realizada com o MEC, governos dos estados (Ceará, Goiás, Mato Grosso do Sul, Pará e Piauí e o Instituto, no âmbito do Programa Ensino Médio Inovador/Jovem de Futuro, para a gestão de escolas de Ensino Médio. Mostra que se trata de proposta de gestão escolar para resultados, com base na lógica de mercado e busca problematizar, mediante análise documental, as orientações do Programa, que influenciam as políticas educacionais brasileiras para o Ensino Médio.

  12. POBREZA E CONDIÇÕES SOCIOECONÔMICAS DOS CATADORES DE CARANGUEJO DO POVOADO CARNAUBEIRAS, ARAIOSES-MA

    Directory of Open Access Journals (Sweden)

    Jean Carlos Costa Soares

    2016-01-01

    Full Text Available In the Lower Maranhão region Parnaíba, in the municipality of Araioses, is one of the largest communities in mangrove crab pickers of Brazil: Carnaubeiras. The town owes its importance to the large export trade crustacean to neighboring states of Piauí and Ceará as well as being situated between the major tourist routes in the country. This paper sought to understand the socioeconomic conditions of crab collectors through semi-structured interviews to understand its poverty. The results show that first, the crab collectors have low education; Second, the income of these workers do not reach the minimum wage; Third and consequently, low pay is the result of plunder by the entrepreneurs of the tourism cuisine of neighboring states; Fourth ,lack of collective organization category in coping against their exploitation; Concludes that the results obtained in this study denote the frame of poverty in the current situation of the crab hunter Carnaubeiras community.

  13. Syphilis prevalence among women in the prison system of a northeastern Brazilian capital

    Directory of Open Access Journals (Sweden)

    Telma Maria Evangelista de Araújo

    2015-12-01

    Full Text Available The aim of this study was to investigate the prevalence of syphilis and associated factors in inmates of the women's prison of Teresina, Piauí, Brazil. This cross-sectional study was conducted in November 2013. The population consisted of inmates from the referred penitentiary (n=131. Data were collected through a form composed of closed-ended and mixed questions. The mean age was 33.1 years, 60.3% affirmed not having a stable relationship, and 93.1% had children. Alcohol use was reported by 70.8%, and the use of illicit drugs, by 56.2%. It was evidenced that 38.5% of women never use a condom during sexual intercourse, and that 62.2% do not know how the transmission of syphilis happens. The high prevalence of syphilis, 25.2%, is statistically associated with marital status, illicit drug use and their consumption before sex, demonstrating that unfavorable socioeconomic conditions are important risk and vulnerability factors to sexually transmitted diseases.

  14. PRACTICE OF OPERATIONS IN COMPANIES OF TERESINA, PIAUÍ, BRAZIL

    Directory of Open Access Journals (Sweden)

    Tonny Kerley de Alencar Rodrigues

    2014-12-01

    Full Text Available This research was structured in order to respond those research problems: The companies of the city of Teresina, Piauí, Brazil practice operations management? What tools of operations management they use? What are the tools of operations management that they need more? Trying to understand these issues, we developed a quantitative survey. The research can be rated as descriptive and explanatory, applied and/or intervention. As for media, research can be classified as documentary, bibliographic and/or participant. For the better development of the study it was used a documentary approach. Regarding the sample was stratified random amount of small businesses that responded to the proposed questionnaire was used was 415. The results showed that the MPEs have a number of structural features for example: complementarity and subordination relationship with large companies, low investment in technological innovation, high rate birth and death, low capital intensity, strong family presence in the composition of labor among other.

  15. Ciência na internet: Mapeamento da divulgação científica nos sites de nove Universidades Federais da região Nordeste do Brasil

    Directory of Open Access Journals (Sweden)

    MORAES, Danilo de Almeida

    2009-12-01

    Full Text Available The present work investigate the characterics of the scientific publication on-line of nine Federal Universities from brazilian Northeast, that represents each state of this region: Maranhão (UFMA, Piauí (UFPI, Ceará (UFC, Rio Grande do Norte (UFRN, Paraíba (UFPB, Pernambuco (UFPE, Alagoas (UFAL, Sergipe (UFS and Bahia (UFBA. The objective of this work is analise, in each one of these sites, that works as suport for the dissemination of science, aspects like interactivity, updating and memory. Besides that, try to identify If these universities are considering the potential offered by the internet, when it tryes to close the society to the scientific knowledge, produced by proffessors and students. The research is based on systematic observation of each of the selected sites and in the opinion of researchers who study the science communication and the implications of the use of so-called new technologies in the field of communication.

  16. Reproductive strategies and genetic variability in tropical freshwater fish

    Directory of Open Access Journals (Sweden)

    Maria Dolores Peres Lassala

    2007-01-01

    Full Text Available We estimated the genetic variability of nine fish species from the Brazilian upper Paraná River floodplain (Astyanax altiparanae, Hoplias malabaricus, Leporinus lacustris, Loricariichthys platymetopon, Parauchenipterus galeatus, Pimelodus maculatus, Rhaphiodon vulpinus, Roeboides paranensis and Serrasalmus marginatus based on data for 36 putative allozyme loci obtained using corn starch gel electrophoresis of 13 enzymatic systems: aspartate aminotransferase (EC 2.6.1.1, acid phosphatase (EC 3.1.3.2, esterase (EC 3.1.1.1, glycerol-3-phosphate dehydrogenase (EC 1.1.1.8, glucose-6-phosphate dehydrogenase (EC 1.1.1.49, glucose-6-phosphate isomerase (EC 5.3.1.9, Iditol dehydrogenase (EC 1.1.1.14, isocitrate dehydrogenase - NADP+ (EC 1.1.1.42, L-lactate dehydrogenase (EC 1.1.1.27, malate dehydrogenase (EC 1.1.1.37, malate dehydrogenase-NADP+ (EC 1.1.1.40, phosphoglucomutase (EC 5.4.2.2 and superoxide dismutase, (EC 1.15.1.1. The mean expected heterozygosity varied from zero to 0.147. When data from the literature for 75 species of tropical fish were added to the nine species of this study, the heterozygosity values differed significantly among the groups of different reproductive strategies. The highest mean heterozygosity was for the non-migratory without parental care, followed by the long-distance migratory, and the lowest mean was for the non-migratory with parental care or internal fecundation.

  17. La importancia de Palenque, Chiapas, para la conservación de los murciélagos de México The importance of Palenque, Chiapas, for the conservation of Mexican bats

    Directory of Open Access Journals (Sweden)

    Luis Gerardo Avila-Torresagatón

    2012-03-01

    Full Text Available La fauna de murciélagos de Chiapas, una de las más estudiadas del país, representa cerca del 77% de las especies registradas para México. Sin embargo, se ha prestado poca atención a los murciélagos de la región selva-norte, área convergente entre la Planicie del Golfo, la Sierra Chiapaneca y la porción más norteña de la Selva Lacandona. Con el objetivo de complementar el listado de las especies de la Región Selva Norte, entre febrero de 2008 y mayo de 2010 se capturaron murciélagos en 130 sitios mediante redes de niebla en Palenque, Chiapas. Los muestreos se realizaron en el continuo de vegetación del Parque Nacional Palenque (PNP y en fragmentos aislados de vegetación en diferente grado de sucesión, así como en cercas vivas, corredores riparios y pastizales inducidos, localizados desde 1 hasta 14 kilómetros al norte del Parque. Con un esfuerzo de muestreo de 432 m-red/noche, en 130 noches se registraron 52 especies de murciélagos; 10 catalogadas como especies hábitat-dependientes, 26 vulnerables a la fragmentación y 16 tolerables a la fragmentación. Entre las especies registradas se encuentran Noctilio leporinus, Mimon crenulatum, Chiroderma salvini, Myotis californicus, M. elegans, Rhogeessa tumida, Molosus rufus y M. sinaloae que no se habían registrado previamente en la zona. Los resultados de este trabajo muestran que la diversidad de murciélagos encontrada en Palenque representa el 42% de la fauna de quirópteros mexicanos, por lo que el PNP y su periferia deben considerarse como área focal para la conservación de este grupo de mamíferos.The bat fauna of Chiapas, is one of the most studied of Mexico, and representing about 77% of the bat species reported to the country. Although, low attention have received the bats from the Selva-Norte region (located in the Plains of the Gulf of Mexico, the Chiapas Mountains and the northern portion of Lacandona. With the objective of obtain a comprehensive list of the bat

  18. Composição bromatológica e produtividade do capim-andropógon em diferentes idades de rebrota em sistema silvipastoril - DOI: 10.4025/actascianimsci.v31i2. Bromatological composition and productivity of Andropogon grass at different ages of resprout in silvopastoral system - DOI: 10.4025/actascianimsci.v31i2.4549

    Directory of Open Access Journals (Sweden)

    Teodoreto Barbosa Carvalho

    2009-08-01

    Full Text Available Avaliou-se a composição e produtividade do capim-andropógon (Andropogon gayanus Kunth. em diferentes idades de rebrota, associado às espécies arbóreas pau-d’arco (Tabebuia serratifolia e jatobá (Hymenaea courbaril no período chuvoso, em Teresina, Piauí. Adotou-se o delineamento de blocos ao acaso, em esquema fatorial 3 x 2, com parcelas subdivididas, sendo as parcelas os ambientes (sombreamento com jatobá e pau-d’arco e área aberta e posições (nascente e poente, e as subparcelas as idades (35, 49 e 63 dias, com cinco repetições. Houve interação ambiente x idade para MS na planta, FDN e FDA na planta e nas folhas e NIDN nas folhas. A PB nas folhas à sombra foi superior (9,65 ± 0,94% em relação à área aberta (9,16 ± 1,41%. Houve efeito linear decrescente (p The study evaluated composition and productivity of Andropogon grass at different ages of resprout, associated with the species Tabebuia serratifolia and Hymenaea courbaril, during the rainy period, in Teresina, Piauí. A random blocks design was adopted, in a 3 x 2 factorial scheme, with subdivided parcels, being the parcels the environments (shading with Tabebuia serratifolia, Hymenaea courbaril and open area and position (rising and setting, and subparcels the ages (35, 49 and 63 days, with five repetitions. There was interaction between the environment and age for DM in the plant, NDF and ADF in the plant and leaves, and NDIN in leaves. The CP in leaves in the shade was higher (9.65 ± 0.94% compared to the open area (9.16 ± 1.41%. There was a linear effect (p Andropogon grass under T. serratifolia and H. courbaril, respectively. The culture of the grass in silvopastoral systems is viable, due to the stability in the composition of DM and ADF in the ratios of NDIN and ADIN in the plant and leaves, as well as for CP in plant and NDF in leaves, with higher CP levels in leaves of the grass. There was no difference in the levels of NDF in the grass in function of

  19. Composição bromatológica e produtividade do capim-andropógon em diferentes idades de rebrota em sistema silvipastoril = Bromatological composition and productivity of Andropogon grass at different ages of resprout in silvopastoral system

    Directory of Open Access Journals (Sweden)

    Marlúcia da Silva Bezerra Lacerda

    2009-04-01

    Full Text Available Avaliou-se a composição e produtividade do capim-andropógon (Andropogon gayanus Kunth. em diferentes idades de rebrota, associado às espécies arbóreas pau-d’arco (Tabebuia serratifolia e jatobá (Hymenaea courbaril no período chuvoso, em Teresina, Piauí.Adotou-se o delineamento de blocos ao acaso, em esquema fatorial 3 x 2, com parcelas subdivididas, sendo as parcelas os ambientes (sombreamento com jatobá e pau-d’arco e área aberta e posições (nascente e poente, e as subparcelas as idades (35, 49 e 63 dias, com cinco repetições. Houve interação ambiente x idade para MS na planta, FDN e FDA na planta e nas folhas e NIDN nas folhas. A PB nas folhas à sombra foi superior (9,65 ± 0,94% em relação à área aberta (9,16 ± 1,41%. Houve efeito linear decrescente (p The study evaluated composition and productivity of Andropogon grass at different ages of resprout, associated with the species Tabebuiaserratifolia and Hymenaea courbaril, during the rainy period, in Teresina, Piauí. A random blocks design was adopted, in a 3 x 2 factorial scheme, with subdivided parcels, being the parcels theenvironments (shading with Tabebuia serratifolia, Hymenaea courbaril and open area and position (rising and setting, and subparcels the ages (35, 49 and 63 days, with five repetitions. There wasinteraction between the environment and age for DM in the plant, NDF and ADF in the plant and leaves, and NDIN in leaves. The CP in leaves in the shade was higher (9.65 ± 0.94% compared to the open area (9.16 ± 1.41%. There was a linear effect (p < 0.01 of the age on CPin the plant and leaves. From days 47.7 and 48.8 there was a reduction in the leaf/steam ratio of Andropogon grass under T. serratifolia and H. courbaril, respectively. The culture of the grass in silvopastoral systems is viable, due to the stability in the composition of DM and ADF in the ratios of NDIN and ADIN in the plant and leaves, as well as for CP in plant and NDF in leaves, with

  20. Evolução temporal da mortalidade por suicídio em pessoas com 60 anos ou mais nos estados brasileiros, 1980 a 2009 Suicide mortality temporal trends in people aged 60 years or more in the Brazilian states: 1980 to 2009

    Directory of Open Access Journals (Sweden)

    Liana Wernersbach Pinto

    2012-08-01

    Full Text Available Este artigo objetiva verificar a evolução temporal da mortalidade por suicídio em pessoas com 60 anos ou mais segundo a unidade da federação no período de 1980 a 2009. Na construção das séries históricas empregaram-se dados da mortalidade por suicídio (CID-9 códigos E950 a E959 e CID-10 códigos X60 a X84 e Y87.0 obtidos do Sistema de Informação sobre Mortalidade (SIM/MS. Dados referentes à contagem populacional foram obtidos do Instituto Brasileiro de Geografia e Estatística. Na avaliação da tendência temporal empregou-se o modelo de regressão de Poisson, no qual a variável resposta foi o número de óbitos e a variável explanatória o ano calendário centralizado. Foram consideradas tendências estatisticamente significativas aquelas cujo p-valor The scope of this paper is to determine the temporal evolution of mortality by suicide in people aged 60 or more per State in Brazil between 1980 and 2009. Historical mortality by suicide data (ICD-9 codes E950 to E959 and ICD-10 codes X60 to X84 and Y87.0 were obtained from the Mortality Information System (SIM / MS. Data regarding population counts were obtained from the Brazilian Institute of Geography and Statistics. In the assessment of temporal trends the Poisson regression model was used, in which the dependent variable was the number of deaths and the centralized calendar year was the explanatory variable. Statistically significant trends were considered those whose p-value was d" 0.05. The results revealed the presence of a statistically significant increasing trend in four states and a decrease in two (general population; 60 years or more. In the male population there was an increase in five states and a reduction in two. The female rate showed an increase in one state and a decrease in three. There was an increasing trend in Piauí, Ceará and Rio Grande do Norte and a reduction in Amazonas, Roraima, and São Paulo for people aged between 60 and 69. Increasing rates

  1. Leishmaniasis and textbook: how are endemic diseases addressed in public education?

    Directory of Open Access Journals (Sweden)

    Débora Batista Reis

    2014-03-01

    Full Text Available Visceral Leishmaniasis is a vector-borne zoonosis, considered a public health problem in Brazil, because of their magnitude, geographic expansion and lethality. The disease is the etiologic agent trypanosamatid Leishmania infantum, is transmitted by the bite of Lutzomyia longipalpis, an insect of the order Diptera that has hematophagous habits. Typically considered rural, the disease emerged in the urban scene in Teresina, Piauí state, in the 80´s, reaching the other urban producing several epidemiological outbreaks. Control of the disease, based on the slaughter of seropositive dogs, chemical vector control and treatment of human patients as strategies recommended by the Ministry of Health, do not have satisfactory results, it is imperative to integrate these strategies to the actions of health education. Considering the role of the school in the dissemination of knowledge and the promotion of health education actions and, above all, the importance of the textbook as an important educational tool for the teaching-learning process, this study aimed to analyze the books as they are atopted by public schools of the city of Floriano, Piauí state, address endemic diseases, particularly leishmaniasis. Physical criteria, as aspects of the brochure and binding aspects and the contents were used in the analyzes. The selection of books was made by teachers and managers of schools based on the National Textbook Program (PNLD tab and then were approved in the pedagogical evaluation of the Ministry of Education. Copies of each level of education (primary and secondary were analyzed according to conceptual and physical aspects. The analysis of conceptual and methodological aspects was based on the literature and a thorough observation of the images that complement the content. The physical aspects were evaluated according to the type of binding, size, font size and spacing employ, didactic presentation order of the content and illustrations. It was found

  2. FAZENDINHA I: DESCOBERTA DE UM NOVO SÍTIO PRÉ-HISTÓRICO E DESCRIÇÃO PRELIMINAR DE SUAS INSCRIÇÕES RUPESTRES E PROBLEMAS DE CONSERVAÇÃO (Fazendinha I: Discovery of a New Prehistoric Site, Preliminary Description from its Rock Inscriptions, and Conservation Problems

    Directory of Open Access Journals (Sweden)

    Luis Carlos Duarte Cavalcante

    2016-06-01

    Full Text Available O sítio arqueológico conhecido como Fazendinha I, descoberto em 2010, é um abrigo de arenito com inscrições pré-históricas, localizado na área rural de Piripiri, estado do Piauí, Brasil. O abrigo sob-rocha contém uma coleção excepcional de 141 pinturas rupestres e 65 gravuras rupestres. As pinturas rupestres consistem de grafismos geométricos abstratos, carimbos de mãos humanas, zoomorfos (lagartos e ornitomorfos, antropomorfos e fitomorfos, pintados predominantemente em diferentes tonalidades de vermelho, mas também em preto, alaranjado, vinho, púrpura-escuro e marrom-alaranjado. As gravuras rupestres (feitas por picotagem; algumas com acabamento por abrasão representam principalmente cúpules, mas também figuras abstratas e um lagarto (único animal gravado conhecido em todos os sítios pré-históricos da região arqueológica de Piripiri. A vasta maioria das gravuras foi também pintada. Além da elevada densidade de inscrições rupestres, há sobreposições e recorrências dos motivos pintados e gravados. Vegetação, fauna e estado de conservação das inscrições pré-históricas e do abrigo sob-rocha, são mencionados. ENGLISH: The archaeological site known as Fazendinha I, discovered in 2010, is a sandstone shelter with prehistoric inscriptions located in the rural area of Piripiri, in the state of Piauí, Brazil. The rockshelter contains an exceptional collection of 141 rock paintings and 65 rock engravings. The rock paintings consist of abstract geometric graphisms, human handprints, zoomorphs (lizards and ornithomorphs, anthropomorphs and phytomorphs, painted predominantly in different tonalities of red, but also in black, orangish, wine, dark-purple, and orangish brown. The rock engravings (made by pecking; some finished by abrading represent mainly cupules, but also abstract figures and a lizard (the only engraved animal known in all prehistoric sites of the archaeological region from Piripiri. The vast

  3. Conhecimento objetivo e percebido sobre contraceptivos hormonais orais entre adolescentes com antecedentes gestacionais Objective and perceived knowledge of oral contraceptive methods among adolescent mothers

    Directory of Open Access Journals (Sweden)

    Michelle Chintia Rodrigues de Sousa

    2009-03-01

    Full Text Available A elevada freqüência de gestação precoce no Brasil e, particularmente, em Teresina (21,5%, Piauí, motivou o presente estudo, cuja meta foi identificar os níveis de conhecimento objetivo e percebido sobre contraceptivos hormonais orais, bem como variáveis reprodutivas e sócio-demográficas preditoras de elevado conhecimento. Realizou-se estudo transversal com 278 adolescentes com idade de 15 a 19 anos de idade, com antecedentes reprodutivos, internadas em quatro maternidades de Teresina, em 2006. Regressão logística foi a base da análise estatística. Quase 98% das adolescentes apresentaram baixo conhecimento tanto objetivo quanto percebido. Apenas o maior número de gestações foi preditor de elevado conhecimento objetivo para anticoncepcionais orais. Os baixos níveis de conhecimento objetivo e percebido das adolescentes sobre o uso de anticoncepcionais orais revelam a suscetibilidade das jovens ao comportamento sexual de risco. Sugere-se a utilização de abordagem mais interativa com os adolescentes para elevar o nível de conhecimento tanto objetivo quanto percebido deles, e assim reduzir a incidência e reincidência da gravidez indesejada na adolescência e suas conseqüências negativas na vida destas jovens e de sua prole.The high rate of early pregnancy in Brazil and particularly in Teresina (21.5%, Piauí State, motivated the current study, the aim of which was to identify levels of objective and perceived knowledge on oral contraceptives, as well as predictive reproductive and socio-demographic variables for high knowledge. A cross-sectional study was performed including 278 teenage mothers (15-19 years, with their childbearing history, admitted to four maternity hospitals in Teresina in 2006. Logistic regression provided the basis for the statistical analysis. Nearly 98% of the adolescent mothers showed low objective and perceived knowledge of oral contraceptives. High parity was the only predictor of increased objective

  4. Consumo alimentar de adolescentes matriculados em um colégio particular de Teresina, Piauí, Brasil

    Directory of Open Access Journals (Sweden)

    CARVALHO Cecilia Maria Resende Gonçalves de

    2001-01-01

    Full Text Available Com o objetivo de estudar o consumo alimentar de adolescentes matriculados em um colégio particular de Teresina, realizou-se estudo transversal através de amostragem sistemática. A freqüência de consumo de alimentos expressa em dias por semana foi obtida mediante questionário administrado individualmente ao aluno. O estado nutricional foi avaliado pelo Índice de Massa Corporal, considerando com sobrepeso valores > ou = P85. Os resultados indicam prevalência elevada de risco para o sobrepeso (19,8% nos 334 adolescentes. Os meninos consumiram com maior freqüência alimentos energéticos (milho, manteiga, pizza, lasanha, sucos industrializados, refrigerantes e construtores (frango, ovos, leguminosas em relação às meninas (p < 0,05. Os adolescentes de 10 a 13 anos consumiram com maior freqüência milho, mel, açúcar, rapadura enquanto aqueles com idade entre 17 e 19 anos consumiram mais arroz, bolos, biscoitos, rosca, balas, goma de mascar, refrigerantes, frutas verde-amarelo.

  5. Factors associated with Leishmania chagasi infection in domestic dogs from Teresina, State of Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    João Pereira da Silva

    2012-08-01

    Full Text Available INTRODUCTION: Many studies have evaluated risk factors for human visceral leishmaniasis, but few have focused on the infection among dogs. The objective of this study was to assess the association between peridomestic socioeconomic and environmental factors and the presence of dogs seropositive for Leishmania chagasi in the City of Teresina, Brazil. METHODS: This case-control study was based on the results of a routine seroepidemiological survey among domestic dogs carried out in 2007. Serological tests were performed by means of indirect immunofluorescence antibody test. All dwellings in which at least one seropositive dog was detected were considered cases, and controls were a random sample of dwellings in which only seronegative dogs were identified. Associations between variables were expressed as odds ratios (OR and their respective 95% confidence intervals (95%CI estimated using multivariate logistic regression. RESULTS: Dwellings with a history of dogs removed by the visceral leishmaniasis control program in the last 12 months had five-fold higher odds of having at least one seropositive dog as compared with dwellings having no history of dog removal (OR = 5.19; 95%CI = 3.20-8.42. Dwellings with cats had 58% increased odds of dog infection as compared with those having no cats (OR = 1.58; 95%CI = 1.01-2.47. CONCLUSIONS: Identification of factors associated with canine visceral leishmaniasis might be used for the delimitation of areas of higher risk for human visceral leishmaniasis, since infection in dogs generally precedes the appearance of human cases.

  6. Photophysiological and photosynthetic complex changes during iron starvation in Synechocystis sp. PCC 6803 and Synechococcus elongatus PCC 7942.

    Directory of Open Access Journals (Sweden)

    Jared M Fraser

    Full Text Available Iron is an essential component in many protein complexes involved in photosynthesis, but environmental iron availability is often low as oxidized forms of iron are insoluble in water. To adjust to low environmental iron levels, cyanobacteria undergo numerous changes to balance their iron budget and mitigate the physiological effects of iron depletion. We investigated changes in key protein abundances and photophysiological parameters in the model cyanobacteria Synechococcus PCC 7942 and Synechocystis PCC 6803 over a 120 hour time course of iron deprivation. The iron stress induced protein (IsiA accumulated to high levels within 48 h of the onset of iron deprivation, reaching a molar ratio of ~42 IsiA : Photosystem I in Synechococcus PCC 7942 and ~12 IsiA : Photosystem I in Synechocystis PCC 6803. Concomitantly the iron-rich complexes Cytochrome b6f and Photosystem I declined in abundance, leading to a decrease in the Photosystem I : Photosystem II ratio. Chlorophyll fluorescence analyses showed a drop in electron transport per Photosystem II in Synechococcus, but not in Synechocystis after iron depletion. We found no evidence that the accumulated IsiA contributes to light capture by Photosystem II complexes.

  7. Nitrogen Starvation Acclimation in Synechococcus elongatus: Redox-Control and the Role of Nitrate Reduction as an Electron Sink

    Directory of Open Access Journals (Sweden)

    Alexander Klotz

    2015-03-01

    Full Text Available Nitrogen starvation acclimation in non-diazotrophic cyanobacteria is characterized by a process termed chlorosis, where the light harvesting pigments are degraded and the cells gradually tune down photosynthetic and metabolic activities. The chlorosis response is governed by a complex and poorly understood regulatory network, which converges at the expression of the nblA gene, the triggering factor for phycobiliprotein degradation. This study established a method that allows uncoupling metabolic and redox-signals involved in nitrogen-starvation acclimation. Inhibition of glutamine synthetase (GS by a precise dosage of l-methionine-sulfoximine (MSX mimics the metabolic situation of nitrogen starvation. Addition of nitrate to such MSX-inhibited cells eliminates the associated redox-stress by enabling electron flow towards nitrate/nitrite reduction and thereby, prevents the induction of nblA expression and the associated chlorosis response. This study demonstrates that nitrogen starvation is perceived not only through metabolic signals, but requires a redox signal indicating over-reduction of PSI-reduced electron acceptors. It further establishes a cryptic role of nitrate/nitrite reductases as electron sinks to balance conditions of over-reduction.

  8. Nitrogen Starvation Acclimation in Synechococcus elongatus: Redox-Control and the Role of Nitrate Reduction as an Electron Sink

    Science.gov (United States)

    Klotz, Alexander; Reinhold, Edgar; Doello, Sofía; Forchhammer, Karl

    2015-01-01

    Nitrogen starvation acclimation in non-diazotrophic cyanobacteria is characterized by a process termed chlorosis, where the light harvesting pigments are degraded and the cells gradually tune down photosynthetic and metabolic activities. The chlorosis response is governed by a complex and poorly understood regulatory network, which converges at the expression of the nblA gene, the triggering factor for phycobiliprotein degradation. This study established a method that allows uncoupling metabolic and redox-signals involved in nitrogen-starvation acclimation. Inhibition of glutamine synthetase (GS) by a precise dosage of l-methionine-sulfoximine (MSX) mimics the metabolic situation of nitrogen starvation. Addition of nitrate to such MSX-inhibited cells eliminates the associated redox-stress by enabling electron flow towards nitrate/nitrite reduction and thereby, prevents the induction of nblA expression and the associated chlorosis response. This study demonstrates that nitrogen starvation is perceived not only through metabolic signals, but requires a redox signal indicating over-reduction of PSI-reduced electron acceptors. It further establishes a cryptic role of nitrate/nitrite reductases as electron sinks to balance conditions of over-reduction. PMID:25780959

  9. Competitiveness of the agro-industrial system for broiler chicken processing in Tocantins: the case of the Frango Norte company Competitividad del sistema agroindustrial del pollo de corte en Tocantins, el caso de la empresa"Frango Norte" Competitividade do sistema agroindustrial do frango de corte no Tocantins: o caso da empresa Frango Norte

    Directory of Open Access Journals (Sweden)

    Waldecy Rodrigues

    2011-06-01

    Full Text Available This article analyzes contractual and organizational arrangements of the company Frango Norte as well as their impact on levels of competitiveness. Of further interest was an understanding of possibilities and perspectives of the poultry processing industry in the state of Tocantins. This company is one of two poultry processing plants in the state of Tocantins and it supplies most of the local market while also attending other states such as Pará, Piauí and Maranhão. The method used for this study was discrete Comparative Structural Analysis of New Institutional Economics that compares different governance structures as a way to minimize transaction costs. Results reveal that the incomplete stage of the agro-industrial system for broilers in Tocantins, especially characteristics of the local market and suppliers still contribute to informality in various links of the supply chain. Remoteness and lack of bargaining power in negotiations to acquire assets with high specificity, especially chickens for processing and young chickens for fattening, are some of the bottlenecks for competitive performance of the Frango Norte companyEl objetivo del artículo es analizar las relaciones contractuales y los arreglos organizacionales de la empresa"Frango Norte", bien como sus reflejos en sus niveles de competitividad. Además se pretende comprender las posibilidades y perspectivas futuras de la avicultura industrial en el Estado do Tocantins. La empresa en estudio es una de las dos firmas del ramo instaladas en mencionado Estado y sus productos abastecen a la mayor parte del mercado local, además de atender a otros Estados como Pará, Piauí y Maranhão. El método utilizado para la ejecución de este estudio fue el Análisis Estructural Discreto Comparado de la Nueva Economía Institucional, que consiste en la comparación entre diversas estructuras de governanzas como mecanismos para minimizar los costos de transacción. Los resultados revelan que la

  10. Validade, confiabilidade e evitabilidade da causa básica dos óbitos neonatais ocorridos em unidade de cuidados intensivos da Rede Norte-Nordeste de Saúde Perinatal Validez, confiabilidad y evitabilidad de la causa básica de óbitos neonatales ocurridos en una unidad de cuidados intensivos de la Red Norte-Nordeste de Salud Perinatal Validity and reliability of data and avoidability of the underlying cause of neonatal deaths in the intensive care unit of the North-Northeast Perinatal Care Network

    Directory of Open Access Journals (Sweden)

    Isabel Marlúcia Lopes Moreira de Almeida

    2013-03-01

    Full Text Available Analisar a validade e confiabilidade da causa básica e a evitabilidade dos óbitos neonatais ocorridos em unidade de cuidados intensivos da Rede Norte-Nordeste de Saúde Perinatal (RENOSPE. A amostra foi de 53 óbitos neonatais contidos no banco de dados da RENOSPE e ocorridos em maternidade de Teresina, Piauí, Brasil. A validade foi feita comparando-se as causas da Rede com as obtidas dos prontuários, sendo calculado kappa, sensibilidade e valor preditivo positivo (VPP. Na análise da evitabilidade, foi utilizada a Lista Brasileira de Causas de Mortes Evitáveis. Quando comparadas as causas de óbitos entre RENOSPE e prontuários, o kappa foi de 47,6% para causas maternas e 73,9% para malformações congênitas, sensibilidade de 95% e 83,3%, e VPP de 88,9% e 85,7%, respectivamente. O percentual de óbitos evitáveis na RENOSPE foi elevado, sendo por adequada atenção à mulher na gestação em 72% dos casos. As causas classificadas como malformações congênitas foram válidas, e os óbitos evitáveis apontam para necessidade do controle da gravidez.Analizar la validez y confiabilidad de la causa básica de los óbitos neonatales y su evitabilidad, ocurridos en una unidad de cuidados intensivos de la Red Norte-Nordeste de Salud Perinatal (RENOSPE. La muestra fue de 53 óbitos neonatales, incluidos en el banco de datos de la RENOSPE y ocurridos en la maternidad de Teresina, Piauí, Brasil. La validez fue realizada comparándose las causas de la red, con las obtenidas de los historiales médicos, calculándose kappa, sensibilidad y valor predictivo positivo (VPP. En el análisis de la evitabilidad, se utilizó la lista brasileña de causas de muertes evitables. Resultados: cuando se comparan las causas de óbitos entre RENOSPE y los historiales, el kappa fue de un 47,6% con respecto a causas maternas y un 73,9% para malformaciones congénitas, sensibilidad de un 95% y un 83,3%, y VPP de un 88,9% y un 85,7%, respectivamente. El porcentaje de

  11. Dynamics and cytochemistry of oogenesis in Leporinus striatus Kner (Teleostei, Characiformes, Anostomidae from the Rio Sapucaí, Minas Gerais State, Brazil

    Directory of Open Access Journals (Sweden)

    Helena A.S. Chini

    2001-12-01

    Full Text Available Oogenesis involves a sequense of transformations which are undergone by female germ cells. These cells change into oogonias and then into mature oocytes. Sexually mature females were collected monthly, during one year, from the Rio Sapucaí, tributary of the Rio Grande, which is part of the Furnas Reservoir system in the state of Minas Gerais. The observed material showed that oogonias were small spherical cells, had a big spherical nucleus, with a single nucleolus, and weakly stained cytoplasm with eosinophilic granules (FG stained, which indicate their protein content. The primary oocytes showed a big basophilic nucleus, with a large peripheral nucleolus, and several smaller nucleoli. They show a reduced cytoplasmic content. The previtellogenic oocytes presented voluminous cytoplasm and nucleus with several small peripheral nucleoli. The oocytes underwent vitellogenesis with the development of the zona radiata and the follicle cells. The zona radiata had two layers, the outer and the inner, which showed its protein content when stained with CM and FG techniques. TB pH 2.5 and pH 4.0 staining showed that oocytes undergoing vitellogenesis presented weakly stained cytoplasm and peripheral cytoplasmic vesicles. The follicle cells that were squamous became cuboidal. In mature oocytes, the yolk granules that filled the cytoplasm became green and blue when stained with FG and CM techniques, indicating their protein content. The perivitclline region showed rosy stained vesicles (TB pH 2.5 and pH 4.0 spread among the weakly stained peripheral vesicles, which seemed to be the cortical alveoli. The zona radiata cells, CM and FG stained, still showed two layers like the oocytes from the previous stage, but thicker.

  12. Análise de restrição enzimática do gene hsp65 de isolados clínicos de pacientes com suspeita de tuberculose pulmonar em Teresina, Piauí Restriction enzyme analysis of the hsp65 gene in clinical isolates from patients suspected of having pulmonary tuberculosis in Teresina, Brazil

    Directory of Open Access Journals (Sweden)

    Maria das Graças Motta e Bona

    2011-10-01

    Full Text Available OBJETIVO: Identificar as espécies de micobactérias encontradas no escarro de pacientes com suspeita de tuberculose pulmonar e analisar o impacto dessas identificações na abordagem terapêutica. MÉTODOS: Foram avaliados 106 pacientes com suspeita de tuberculose pulmonar encaminhados para o serviço de pneumologia de um hospital público em Teresina, Piauí. Espécimes de escarro matinal foram avaliados quanto à presença de micobactérias por baciloscopia e cultura. Foram utilizadas PCR e análise de restrição enzimática do gene hsp65 (PRA-hsp65 para a identificação das cepas de micobactérias isoladas em cultura. RESULTADOS: Foram analisadas 206 amostras de escarro. A idade dos pacientes variou de 15 a 87 anos, sendo 67% do gênero masculino. Tosse ocorreu em 100% dos casos. O padrão radiográfico predominante foi de lesão moderada, observada em 70%. A positividade no esfregaço foi de 76%, e isolamento em cultura ocorreu em 91% das culturas executadas. Testes tradicionais identificaram micobactérias não tuberculosas (MNT em 9% dos isolados. O método PRA-hsp65 confirmou esses dados, mostrando sete padrões de bandas capazes de identificar as espécies de MNT isoladas: Mycobacterium kansasii; M. abscessus 1; M. abscessus 2; M. smegmatis; M. flavescens 1; M. gordonae 5 e M. gordonae 7. Todos os pacientes com MNT tinham mais de 60 anos, e observaram-se bronquiectasias em 88% das radiografias. Houve dois casos de reinfecção, identificados inicialmente como infecção por M. abscessus e M. kansasii. CONCLUSÕES: As MNT causam infecção pulmonar em pacientes imunocompetentes, e a identificação das MNT é importante para estabelecer o diagnóstico correto e a decisão terapêutica mais adequada. O método PRA-hsp65 é útil para identificar espécies de MNT e pode ser implantado em laboratórios de biologia molecular não especializados em micobactérias.OBJECTIVE: To identify mycobacterial species in the sputum of patients

  13. Fluorescent minerals--A potential source of UV protection and visible light for the growth of green algae and cyanobacteria in extreme cosmic environments.

    Science.gov (United States)

    Omairi, Tareq; Wainwright, Milton

    2015-07-01

    We propose that green algae (Chlorella variabilis and Dunaliella tertiolecta) and cyanobacteria (Synechococcus elongatus and Nostoc commune) can grow inside fluorescent rock minerals which convert damaging UV light to visible light, thereby allowing these organisms to survive and thrive in UV-rich environments without (or with limited) visible light, which would otherwise be inimical to them. The four microorganisms were incubated inside fluorescent rocks composed of fluorite, calcite and pyrite. The resultant growth was then measured following exposure to UV radiation, with the use of optical density and measurement of chlorophyll concentration. Results show that the microorganisms were shielded from harmful UV in these semi-transparent rocks, while at the same time benefiting from the fact that the minerals converted UV to visible light; this have been shown by a statistically significant increase in their growth, which although lower than when the cells were incubated in sunlight, was significantly higher than in controls incubated in the dark. Copyright © 2015 The Committee on Space Research (COSPAR). Published by Elsevier Ltd. All rights reserved.

  14. Analysis of Selected Environmental Indicators in the Cultivation System of Energy Crops

    Directory of Open Access Journals (Sweden)

    Šoltysová Božena Š

    2017-11-01

    Full Text Available The changes of selected chemical parameters were observed in Gleyic Fluvisols. The field experiment was established as a twofactor experiment with four energy crops (Arundo donax L., Miscanthus × giganteus, Elymus elongatus Gaertner, Sida hermafrodita and two variants of fertilization (nitrogen fertilization in rate 60 kg ha-1, without nitrogen fertilization. Soil samples were taken from the depth of 0 to 0.3 m at the beginning of the experiment in the autumn 2012 and at the end of reference period in the autumn 2015. Land management conversion from market crops to perennial energy crops cultivation has influenced changes of selected soil chemical parameters. The contents of soil organic carbon were affected by cultivated energy crops differently. It was found out that Arundo increased the organic carbon content and Miscanthus, Elymus and Sida decreased its content. At the same time, the same impact of the crops on content of available phosphorus and potassium and soil reaction was found. It was recorded that each cultivated crop decreased the soil reaction and available phosphorus content and increased the content of available potassium.

  15. Structural insights into the light-driven auto-assembly process of the water-oxidizing Mn4CaO5-cluster in photosystem II.

    Science.gov (United States)

    Zhang, Miao; Bommer, Martin; Chatterjee, Ruchira; Hussein, Rana; Yano, Junko; Dau, Holger; Kern, Jan; Dobbek, Holger; Zouni, Athina

    2017-07-18

    In plants, algae and cyanobacteria, Photosystem II (PSII) catalyzes the light-driven splitting of water at a protein-bound Mn 4 CaO 5 -cluster, the water-oxidizing complex (WOC). In the photosynthetic organisms, the light-driven formation of the WOC from dissolved metal ions is a key process because it is essential in both initial activation and continuous repair of PSII. Structural information is required for understanding of this chaperone-free metal-cluster assembly. For the first time, we obtained a structure of PSII from Thermosynechococcus elongatus without the Mn 4 CaO 5 -cluster. Surprisingly, cluster-removal leaves the positions of all coordinating amino acid residues and most nearby water molecules largely unaffected, resulting in a pre-organized ligand shell for kinetically competent and error-free photo-assembly of the Mn 4 CaO 5 -cluster. First experiments initiating (i) partial disassembly and (ii) partial re-assembly after complete depletion of the Mn 4 CaO 5 -cluster agree with a specific bi-manganese cluster, likely a di-µ-oxo bridged pair of Mn(III) ions, as an assembly intermediate.

  16. Nematodes (Mermithidae parasitizing grasshoppers (Orthoptera: Acrididae in the Pampean region, Argentina

    Directory of Open Access Journals (Sweden)

    J. M. Rusconi

    Full Text Available Abstract This work provides the results of a survey of entomonematodes parasites of grasshoppers in grasslands of the Pampean Region, Argentina. Nymphs of Staurorhectus longicornis Giglio-Tos, Laplatacris dispar Rhen, 1939, Dichroplus elongatus Giglio-Tos, 1894 and Metaleptea brevicornis (L. (Orthoptera: Acrididae were collected. Mermithidae was the only family registered with seven species: Agamermis decaudata Cobb, Steiner and Christie, 1923, Amphimermis bonaerensis Miralles and Camino, 1983, Amphimermis dichroplusi Camino and Lange, 1997, Amphimermis ronderosi Camino and Lange, 1997, Hexamermis coclhearius Stock and Camino, 1992, Hexamermis ovistriata Stock and Camino, 1992, and Longimermis acridophila Camino and Stock, 1989. The values of parasitism ranged between 1-12%, and intensity not overcome the number of 5.0 nematodes per larva. The nematodes observed showed specificity, not registering the same species of parasite in more than one host species. The Pampean region constituted an area with high diversity of mermithids where new species could be consider as bioregulator agents of this troublesome insect pests in agricultural areas of Argentina.

  17. Defining an additivity framework for mixture research in inducible whole-cell biosensors

    DEFF Research Database (Denmark)

    Martin-Betancor, K; Ritz, Christian; Fernández-Piñas, F

    2015-01-01

    A novel additivity framework for mixture effect modelling in the context of whole cell inducible biosensors has been mathematically developed and implemented in R. The proposed method is a multivariate extension of the effective dose (EDp) concept. Specifically, the extension accounts for differe......A novel additivity framework for mixture effect modelling in the context of whole cell inducible biosensors has been mathematically developed and implemented in R. The proposed method is a multivariate extension of the effective dose (EDp) concept. Specifically, the extension accounts...... for differential maximal effects among analytes and response inhibition beyond the maximum permissive concentrations. This allows a multivariate extension of Loewe additivity, enabling direct application in a biphasic dose-response framework. The proposed additivity definition was validated, and its applicability...... illustrated by studying the response of the cyanobacterial biosensor Synechococcus elongatus PCC 7942 pBG2120 to binary mixtures of Zn, Cu, Cd, Ag, Co and Hg. The novel method allowed by the first time to model complete dose-response profiles of an inducible whole cell biosensor to mixtures. In addition...

  18. Factors associated with Leishmania chagasi infection in domestic dogs from Teresina, State of Piauí, Brazil Fatores associados à infecção por Leishmania chagasi em cães domiciliados de Teresina, Estado do Piauí, Brasil

    Directory of Open Access Journals (Sweden)

    João Pereira da Silva

    2012-08-01

    Full Text Available INTRODUCTION: Many studies have evaluated risk factors for human visceral leishmaniasis, but few have focused on the infection among dogs. The objective of this study was to assess the association between peridomestic socioeconomic and environmental factors and the presence of dogs seropositive for Leishmania chagasi in the City of Teresina, Brazil. METHODS: This case-control study was based on the results of a routine seroepidemiological survey among domestic dogs carried out in 2007. Serological tests were performed by means of indirect immunofluorescence antibody test. All dwellings in which at least one seropositive dog was detected were considered cases, and controls were a random sample of dwellings in which only seronegative dogs were identified. Associations between variables were expressed as odds ratios (OR and their respective 95% confidence intervals (95%CI estimated using multivariate logistic regression. RESULTS: Dwellings with a history of dogs removed by the visceral leishmaniasis control program in the last 12 months had five-fold higher odds of having at least one seropositive dog as compared with dwellings having no history of dog removal (OR = 5.19; 95%CI = 3.20-8.42. Dwellings with cats had 58% increased odds of dog infection as compared with those having no cats (OR = 1.58; 95%CI = 1.01-2.47. CONCLUSIONS: Identification of factors associated with canine visceral leishmaniasis might be used for the delimitation of areas of higher risk for human visceral leishmaniasis, since infection in dogs generally precedes the appearance of human cases.INTRODUÇÃO: Diversos estudos avaliaram fatores de risco para leishmaniose visceral humana, mas poucos focalizaram a infecção canina. O objetivo deste estudo é avaliar a associação entre condições sócio-ambientais peridomiciliares e a presença de cães sorologicamente positivos para Leishmania chagasi em Teresina, Brasil. MÉTODOS: Estudo caso-controle baseado nos resultados de inquérito soroepidemiológico de rotina entre cães domésticos no ano de 2007. O exame sorológico foi realizado por meio de reação de imunofluorescência indireta. Foram consideradas como casos todas as residências que albergassem pelo menos um cão soropositivo, enquanto o grupo controle correspondeu a uma amostra aleatória das residências onde somente cães soronegativos foram registrados. Associações entre as variáveis foram expressas por meio da razão de chance ou odds ratio (OR e respectivos intervalos de 95% de confiança (IC95% estimados mediante regressão logística multivariada. RESULTADOS: Residências com história de pelo menos um cão recolhido pelo programa de controle da leishmaniose visceral nos últimos 12 meses apresentaram chance cerca de 5 vezes mais alta de terem cães infectados em comparação com residências sem história de cães removidos no período (OR = 5,19; IC95% = 3,20-8,42. Residências com presença de gatos apresentaram chance 58% mais alta de terem cães infectados em comparação com aquelas sem gatos (OR = 1,58; IC95% = 1,01-2,47. CONCLUSÕES: A identificação de fatores associados à leishmaniose visceral canina pode ser útil para a delimitação de áreas sob maior risco para leishmaniose visceral humana, na medida em que a infecção canina geralmente precede a ocorrência de casos humanos.

  19. Ticks infesting bats (Mammalia: Chiroptera) in the Brazilian Pantanal.

    Science.gov (United States)

    Muñoz-Leal, Sebastián; Eriksson, Alan; Santos, Carolina Ferreira; Fischer, Erich; de Almeida, Juliana Cardoso; Luz, Hermes R; Labruna, Marcelo B

    2016-05-01

    Ticks associated with bats have been poorly documented in the Neotropical Zoogeographical Region. In this study, a total of 1028 bats were sampled for tick infestations in the southern portion of the Brazilian Pantanal. A total of 368 ticks, morphologically identified as Ornithodoros hasei (n = 364) and O. mimon (n = 4), were collected from the following bat species: Artibeus planirostris, Platyrrhinus lineatus, Phyllostomus hastatus, Mimon crenulatum and Noctilio albiventris. Morphological identification of O. hasei was confirmed by molecular analysis. Regarding the most abundant bat species, only 40 (6.2%) out of 650 A. planirostris were infested by O. hasei, with a mean intensity of 7.2 ticks per infested bat, or a mean abundance of 0.44 ticks per sampled bat. Noteworthy, one single P. hastatus was infested by 55 O. hasei larvae, in contrast to the 2.5-7.2 range of mean intensity values for the whole study. As a complement to the present study, a total of 8 museum bat specimens (6 Noctilio albiventris and 2 N. leporinus), collected in the northern region of Pantanal, were examined for tick infestations. These bats contained 176 ticks, which were all morphologically identified as O. hasei larvae. Mean intensity of infestation was 22, with a range of 1-46 ticks per infested bat. Our results suggest that A. planirostris might play an important role in the natural life cycle of O. hasei in the Pantanal.

  20. Estudo dos vestígios de peixes dos sítios arqueológicos da área de influência da Usina Hidrelétrica Machadinho, Rio Grande do Sul, Brasil A study of fish traces taken from the archaeological sites of the areas surrounding the Machadinho Hydroelectric power station, Rio Grande do Sul, Brazil

    Directory of Open Access Journals (Sweden)

    Cláudio Ricken

    2009-09-01

    Full Text Available The analysis of the material obtained in the rescue of archaeological sites in the area surrounding the Hydroelectric Plant of Machadinho, Rio Grande do Sul, revealed that a considerable amount of bones and fish scales incorporated in the alimentary remains. Using an osteological collection as reference, we identified remains of Salminus brasiliensis (Cuvier, 1816 (Characidae, Brycon orbignyanus (Valenciennes, 1849 (Characidae, Pogonopoma obscurum Quevedo & Reis, 2002 (Loricariidae, Hemiancistrus fuliginosus Cardoso & Malabarba, 1999, Prochilodus lineatus (Valenciennes, 1836 (Prochilodontidae, Schizodon sp. (Anostomidae, Leporinus sp. (Anostomidae, Hoplias sp. (Erythrinidae, Hypostomus sp. (Loricariidae and Crenicichla sp. (Cichlidae. Based on specimens from fish collections, regressions were obtained comparing the size of the pre-maxillary bone in Crenicichla spp. and the length of the pectoral fin spine of Hemiancistrus fuliginosus, Pogonopoma obscurum and Hypostomus spp, with the standard length and weight of corresponding specimens. The estimated size and weight of the specimens obtained from fish remains in the archaeological sites varied between 79.7-153.9 mm and 13.5-33.9 g for Hemiancistrus fuliginosus, 158.2-151.0 mm and 179.5-194.3 g for Pogonopoma obscurum, 117.1-166.2 mm and 86.6-93.1 g for Crenicichla spp., and 62.2-397.2 mm and 34-20.3 g for Hypostomus spp. Therefore using these estimates of standard lengths and weights it was possible to formulate a hypotheses on the fishing technology used by the inhabitants of these sites.

  1. Feeding and social behavior of the piabanha, Brycon devillei (Castelnau, 1855 (Characidae: Bryconinae in the wild, with a note on following behavior

    Directory of Open Access Journals (Sweden)

    Pedro G Azevedo

    Full Text Available Knowledge concerning the behavior of wild freshwater fishes in Brazil is restricted to a few studies, despite such studies being able to answer fundamental questions about conservation. Species of Brycon are amongst the most threatened in the Neotropics, particularly in southeast Brazil, due to anthropogenic activities in this region. This study investigated the feeding and social behaviors of the endangered fish, Brycon devillei in the Preto River, Jequitinhonha basin, Minas Gerais State, Brazil. Behavioral data were collected by snorkeling with four spatially separated groups (habituated, and direct observations of shoals were made using an underwater video camera (a total of 448 hours of observations. This species showed diverse tactics to obtain food. However, the species proved to be predominately a specialist surface-picker, which adopted alternative tactics to find food at certain times of the year, most notably when food items on the water surface became low. Feeding frequency was shown to be negatively correlated to agonistic behavior between conspecifics. Feeding associations were also recorded between the anostomid Leporinus garmani, acting as a nuclear species, and B. devillei, as follower species. The data presented here showed the importance of conserving the riparian environment to protect B. devillei populations. Furthermore, the present study included rare observations of nuclear-follower feeding association among freshwater fishes, especially between medium-sized characiforms, being the first observations of such kind in a Cerrado stream.

  2. Bat community species richness and composition in a restinga protected area in Southeastern Brazil.

    Science.gov (United States)

    Oprea, M; Esbérard, C E L; Vieira, T B; Mendes, P; Pimenta, V T; Brito, D; Ditchfield, A D

    2009-11-01

    In Brazil, restingas are under severe human-induced impacts resulting in habitat degradation and loss and remain one of the less frequently studied ecosystems. The main objectives of the present study are to describe the bat community in a restinga in Paulo Cesar Vinha State Park, Guarapari municipality, state of Espírito Santo, southeastern Brazil. Fieldwork was conducted twice a month from August 2004 to September 2005. A total sampling effort of 40,300 m(2)/h, represents the largest sampling effort for sampling bats in restingas to date. Bats were sampled in five different vegetational types in the area. Captured bats were processed recording information on species, sex, age, forearm length and weight. Shannon Diversity and Jaccard indexes were used to analyse diversity and similarity among habitats in the Park. A total of 554 captures belonging to 14 species and two families were obtained. Noctilio leporinus was recorded through direct observation and an ultra-sound detector also registered the presence of individuals from the family Molossidae, without being possible to distinguish it at specific level. Frugivores were the most representative guild. Richness was higher in Clusia shrubs (11 species) and Caraís lagoon (10 species). Shannon diversity index was estimated at H' = 1.43 for the overall sample, with Caraís lagoon representing the most diverse habitat (H' = 1.60). The greater similarity (J = 0.714) was observed for the two areas under high human influence.

  3. Bat community species richness and composition in a restinga protected area in Southeastern Brazil

    Directory of Open Access Journals (Sweden)

    M. Oprea

    Full Text Available In Brazil, restingas are under severe human-induced impacts resulting in habitat degradation and loss and remain one of the less frequently studied ecosystems. The main objectives of the present study are to describe the bat community in a restinga in Paulo Cesar Vinha State Park, Guarapari municipality, state of Espírito Santo, southeastern Brazil. Fieldwork was conducted twice a month from August 2004 to September 2005. A total sampling effort of 40,300 m²/h, represents the largest sampling effort for sampling bats in restingas to date. Bats were sampled in five different vegetational types in the area. Captured bats were processed recording information on species, sex, age, forearm length and weight. Shannon Diversity and Jaccard indexes were used to analyse diversity and similarity among habitats in the Park. A total of 554 captures belonging to 14 species and two families were obtained. Noctilio leporinus was recorded through direct observation and an ultra-sound detector also registered the presence of individuals from the family Molossidae, without being possible to distinguish it at specific level. Frugivores were the most representative guild. Richness was higher in Clusia shrubs (11 species and Caraís lagoon (10 species. Shannon diversity index was estimated at H' = 1.43 for the overall sample, with Caraís lagoon representing the most diverse habitat (H' = 1.60. The greater similarity (J = 0.714 was observed for the two areas under high human influence.

  4. History of mesquite introduction in Rio Grande do Norte State, Brazil

    Directory of Open Access Journals (Sweden)

    João Paulo Silva dos Santos

    2017-06-01

    Full Text Available The mesquite (Prosopis juliflora (Sw DC was established as a successful action of xerophilous introduction in Brazilian Northeast dry region. Its fruits are used in animal feed and the wood may be used as piles, firewood and charcoal. The species was introduced in 1942, spreading in "low areas" in Rio Grande do Norte, Paraiba, Pernambuco, Bahia and Piauí States. This article aims to elucidate how mesquite was introduced in Rio Grande do Norte State and to understand how it was spread. It was first introduced in Rio Grande do Norte State by the introduction experiments installed at São Miguel farm in the municipality of Angicos. The enthusiasm of technicians and researchers promoted the distribution of pods and seedlings on farms and cities in the state. In addition, there were government incentives to production, distribution and planting the species. This work aims to establish considerations to be used as historical basis on studies about this species and to consider aspects regarding current situation of this culture in Brazilian Northeast.

  5. Redescription of Hypostomus johnii, a senior synonym of Hypostomus eptingi (Siluriformes: Loricariidae, Northeastern Brazil

    Directory of Open Access Journals (Sweden)

    Telton Pedro Anselmo Ramos

    2017-06-01

    Full Text Available ABSTRACT Hypostomus johnii (Steindachner was described from the rio Parnaíba basin in the state of Piauí and the rio São Francisco basin in the state of Bahia. Despite the good quality of the original description of H. johnii, it does not currently allow its distinction from congeners. Thus, H. johnii is redescribed based on the analysis of the types and several recently collected specimens. Recent collecting efforts of the rios Parnaíba and São Francisco basins resulted in specimens only being found in the rio Parnaíba basin. This raises doubts about whether H. johnii occurs in the rio São Francisco basin. The species is distinguished from its congeners by having a high number of teeth on the premaxilla and dentary (between 60-115; small to moderate-sized dark spots with a light background; absence of keels on flanks; and abdominal plates more evident on laterals. A lectotype of H. johnii is designated herein and H. eptingi is considered a junior synonym of H. johnii.

  6. Histology of parotoid gland of Anuran species Rhinella schneideri (Amphibia: Bufonidae

    Directory of Open Access Journals (Sweden)

    Juliana Costa Sousa

    2015-02-01

    Full Text Available We performed histologic evaluation of the parotid glands of 10 (male and female Rhinella schneideri. Animals were manually captured during nocturnal collections in Bom Jesus, Piauí, and euthanized by administering a lethal dose of anesthetic thiopental. The parotid glands were then collected and embedded in paraffin, and sectioned to 4 µm blocks using a manual rotary microtome. Considering the lack of general information concerning anatomical and histological conditions of Rhinella scheneideri, we sought to address key characteristics of macro glands found in the species with the goal of a better understanding of the operation of this type of defense mechanism. Histological analysis revealed the presence of macrogland alveoli with ducts encircled with differentiated mucous cells, known as "accessory glands", as well as granular glands. We also discovered glandular ducts on the glands which communicate with the outside of the body. These ducts are internally lined by duct glandular epithelial cells, forming a plug which promotes total obstruction of the duct. There were no histological differences in macro gland anatomy in this species compared to other species in Bufonidae.

  7. Prevalence and factors associated with stunting and excess weight in children aged 0-5 years from the Brazilian semi-arid region.

    Science.gov (United States)

    Ramos, Clariana V; Dumith, Samuel C; César, Juraci A

    2015-01-01

    To analyze the prevalence of excess weight and low height, and identify associated factors among children younger than five years. Cross-census study. A total of 1,640 children from two municipalities in Piauí, Brazil were included. The prevalence of low height was 10.9% (95% CI: 9.3 to 12.4), inversely associated with mother's younger age and low level of education, lower socioeconomic status, mothers who had fewer than six prenatal consultations, and households that had more than one child younger than 5 years. Excess weight prevalence was 19.1% (95% CI: 17.2 to 21.0), and remained inversely associated with lower maternal age, low maternal education, and cesarean delivery. Stunting was greater in children aged between 12 and 23 months, while excess weight decreased with age. It is noteworthy that the stunting rate, although decreasing, is still high, while the prevalence of excess weight, even in this very poor area, already exceeds the expected percentage for a population with better socioeconomic level. Copyright © 2014 Sociedade Brasileira de Pediatria. Published by Elsevier Editora Ltda. All rights reserved.

  8. Teaching arithmetic at the primary school in the nineteenth century: the memories of Humberto de Campos

    Directory of Open Access Journals (Sweden)

    Maria Laura Magalhães Gomes

    2017-09-01

    Full Text Available This article focuses on the narrative of Humberto de Campos in his first volume of memoirs (1886-1900 with regard to the education of the author. The first section emphasizes the importance of autobiographical writing for research in History of Education, and especially in History of Mathematics Education. The second section is a brief presentation of Humberto de Campos as a Brazilian writer. The next part discusses the theoretical and methodological foundations adopted for the use of autobiographical sources in research. The core of the text consists of the approach of the main school experiences narrated by Humberto de Campos in Parnaíba, in the interior of the state of Piauí, in the 1890s, highlighting practices that involve mathematical knowledge. The writer’s school memories emphasize the material precariousness of elementary education, the simultaneous teaching of many students of different levels in schools managed by a single teacher and the teaching methods based on repetition and memorization and supported in practices of punishment and humiliation of students.

  9. RAPD analysis of the genetic diversity of mango (Mangifera indica) germplasm in Brazil.

    Science.gov (United States)

    Souza, I G B; Valente, S E S; Britto, F B; de Souza, V A B; Lima, P S C

    2011-12-14

    We evaluated genetic variability of mango (Mangifera indica) accessions maintained in the Active Germplasm Bank of Embrapa Meio-Norte in Teresina, Piauí, Brazil, using RAPDs. Among these accessions, 35 originated from plantings in Brazil, six from the USA and one from India. Genomic DNA, extracted from leaf material using a commercial purification kit, was subjected to PCR with the primers A01, A09, G03, G10, N05, and M16. Fifty-five polymorphic loci were identified, with mean of 9.16 ± 3.31 bands per primer and 100% polymorphism. Application of unweighted pair group method using arithmetic average cluster analysis demonstrated five genotypic groups among the accessions examined. The genotypes Rosa 41, Rosa 48 and Rosa 49 were highly similar (94% similarity), whereas genotypes Sensation and Rosa 18 were the most divergent (only 7% similarity). The mango accessions were found to have considerable genetic variability, demonstrating the importance of analyzing each genotype in a collection in order to efficiently maintain the germplasm collection.

  10. REPRESENTAÇÕES SOCIAIS SOBRE AS CAUSAS DOS ACIDENTES COM MATERIAIS PERFUROCORTANTES POR TÉCNICOS DE ENFERMAGEM

    Directory of Open Access Journals (Sweden)

    Juliana Almeida Marques Lubenow

    2012-01-01

    Full Text Available Los accidentes con material corto-punzante son serios debido a las enfermedades que puedan ser causadas. El estudio es descriptivo, con abordaje cualitativa e fue desarrollado en hospital privado en Piauí, entre marzo y junio de 2011. El objetivo es analizar las causas atribuidas por técnicos de enfermería al su proprio accidente, utilizando la Teoría de las Representaciones Sociales. Fueran hechas entrevistas en profundidad con 16 profesionales que sufrirán ese tipo de accidente. Los dados fueran procesados a través del programa ALCESTE 4.8 que evidenció falta de cuidado como la principal causa identificada por elles. También fueran apuntadas negligencia del colega de trabajo e agitación del paciente. La representación social predominante es que el accidente solamente ocurre pelo comportamiento irresponsable del profesional. Por lo tanto, cada exposición percutánea debe ser analizada individualmente en la búsqueda de causas reales que non culpen solamente el trabajador.

  11. Descriptive macroscopic anatomy of the central nervous system six-banded armadillo (Euphractus sexcintus, Linnaeus, 1758 and nine-banded armadillo (Dasypus novemcinctus, Linnaeus, 1758

    Directory of Open Access Journals (Sweden)

    João Victor Silva Araújo

    2016-02-01

    Full Text Available Armadillos of the species Dasypus novemcinctus and Euphractus sexcintus are xenarthrico is a mammal that inhabits fields and has several eating habits. This study proposes to analise the macroscopic anatomy of the nervous system of the armadillo peba, enabling comparisons with other mammals. Three animals of each species were to donated ICMBio - Chico Mendes Institute for Biodiversity, the Serra da Capivara National Park, authorized by SISBIO 22826-01, victims of poaching and they had died. The animals were stored in Histology and Embryology Laboratory of the Morphology Department of Health Sciences Center of the Federal University of Piauí. Initially, they were fixed with 10% buffered formalin for 24 hours and then dissected for observation of the organs forming the central nervous system. The central nervous system Armadillo consists of the brain and spinal cord. The macroscopic morphology, the central nervous system Armadillo resembles those of other mammals, however, anatomical features found in the brain and spinal cord suggest a higher olfactory expression and motor skills.

  12. GRADUAÇÃO EM ENFERMAGEM DO NORDESTE EM DISCUSSÃO NA UFPI

    Directory of Open Access Journals (Sweden)

    Maria do Livramento Fortes Figueiredo

    2017-11-01

    Full Text Available O Programa de Pós-Graduação em Enfermagem da Universidade Federal do Piauí realizou no período de 28 a 30 de junho de 2017 o V Encontro de Pós-Graduação em Enfermagem do Nordeste (V ENPGENE, com o tema central: “A Pós-Graduação em Enfermagem do Nordeste”. O evento contou com o apoio do “Programa de Apoio a Eventos no País – PAEP/CAPES” e da Universidade Federal do Piauí, atém de parceiros locais: Centro Universitário UNINOVAFAPI e o Conselho Regional de Enfermagem do Piauí (COREn-PI. Esta iniciativa visou resgatar a sequência cronológica deste importante encontro para nossa região, considerando que a última edição ocorreu no ano de 2009, na cidade de Natal/RN. Além do mais os eventos regionais mostram-se como uma oportunidade de fortalecimento e intercâmbios entre os programas de pós-graduação e na melhoria dos indicadores de qualidade dos cursos já existentes. O V ENPGENE reuniu alunos de graduação, de pós-graduação e pesquisadores em nível de excelência, o que propiciou a socialização do conhecimento produzido nos programas de pós-graduação brasileiros, permitindo a adoção de novas metodologias, tecnologias e inovações nas pesquisas em enfermagem, tornando desta forma, os resultados das mesmas aplicáveis no ensino e na assistência à saúde da população. Tivemos a participação de palestrantes de várias instituições de ensino da enfermagem: da Escola de Enfermagem de Ribeirão Preto da Universidade de São Paulo (EERP/USP, da Escola Paulista de Enfermagem da Universidade Federal de São Paulo (EPE/UNIFESP, da Universidade Federal de Tocantins (PPGEnf/TO, da Universidade Federal do Estado do Rio de Janeiro (PPGEnf/UNIRIO, da Universidade Federal de Pernambuco (PPGEnf/PE, da Universidade Federal do Ceará (PPGEnf/UFC, da Universidade Federal da Paraíba (PPGEnf/UFPB, da Universidade Federal do Maranhão (PPGEnf/UFMA, do Centro Universitário UNINOVAFAPI, da Universidade Federal do

  13. Prevalence of photoprotection and its associated factors in risk group for skin cancer in Teresina, Piauí.

    Science.gov (United States)

    Cardoso, Fernanda Ayres de Morais E Silva; Mesquita, Gerardo Vasconcelos; Campelo, Viriato; Martins, Maria do Carmo de Carvalho E; Almeida, Camila Aparecida Pinheiro Landim; Rabelo, Regina Silva; Rocha, Amanda Eugênia Almeida; Santos, Jadson Lener Oliveira Dos

    2017-01-01

    The incidence of skin cancer has increased worldwide, particularly melanoma rates, which had a mean development of 2.6 % a year in the last 10 years. The agreement on the relation between long-term or chronic exposure to the sun and the emergence of these neoplasias has made several workers who perform activities exposed to solar radiation to form a risk group for the development of skin cancer, community health agents included. To analyze the prevalence of sunscreen-use-related factors to skin cancer in a labor risk group. Cross-sectional study with community health agents selected through simple random sampling. After collecting data using semi-structured interviews, a descriptive analysis was performed for the qualitative variables, bivariate analysis was employed for checking the association between sunscreen use and sociodemographic, occupational and knowledge about skin variables, and multivariate analysis was conducted to check independent variables associated to sunscreen use. A 5% significance level was used. Of 261 health gents selected, 243 were able to participate in the study. The prevalence rate of sunscreen use was 34.2% (95% CI: 28.2-40.2). Factors associated with sunscreen use were female sex, advanced age, use of sunscreen in situations when the skin got burnt, knowledge of the negative effects of the sun on the skin and skin cancer history. The prevalence found reveals that there is a need for implementing educational strategies in health services regarding photoprotection.

  14. Prevalence of photoprotection and its associated factors in risk group for skin cancer in Teresina, Piauí*

    Science.gov (United States)

    Cardoso, Fernanda Ayres de Morais e Silva; Mesquita, Gerardo Vasconcelos; Campelo, Viriato; Martins, Maria do Carmo de Carvalho e; Almeida, Camila Aparecida Pinheiro Landim; Rabelo, Regina Silva; Rocha, Amanda Eugênia Almeida; dos Santos, Jadson Lener Oliveira

    2017-01-01

    Background The incidence of skin cancer has increased worldwide, particularly melanoma rates, which had a mean development of 2.6 % a year in the last 10 years. The agreement on the relation between long-term or chronic exposure to the sun and the emergence of these neoplasias has made several workers who perform activities exposed to solar radiation to form a risk group for the development of skin cancer, community health agents included. OBJECTIVES To analyze the prevalence of sunscreen-use-related factors to skin cancer in a labor risk group. METHODOLOGY Cross-sectional study with community health agents selected through simple random sampling. After collecting data using semi-structured interviews, a descriptive analysis was performed for the qualitative variables, bivariate analysis was employed for checking the association between sunscreen use and sociodemographic, occupational and knowledge about skin variables, and multivariate analysis was conducted to check independent variables associated to sunscreen use. A 5% significance level was used. Results Of 261 health gents selected, 243 were able to participate in the study. The prevalence rate of sunscreen use was 34.2% (95% CI: 28.2-40.2). Factors associated with sunscreen use were female sex, advanced age, use of sunscreen in situations when the skin got burnt, knowledge of the negative effects of the sun on the skin and skin cancer history. Conclusions The prevalence found reveals that there is a need for implementing educational strategies in health services regarding photoprotection. PMID:28538880

  15. [Maltreatment and discrimination in induced abortion care: perception of women in Teresina, State of Piauí, Brazil].

    Science.gov (United States)

    Madeiro, Alberto Pereira; Rufino, Andréa Cronemberger

    2017-08-01

    Treatment of complications resulting from induced abortion may be hampered by discriminatory attitudes manifested by healthcare professionals in hospitals and abortion services. This article retrieved stories of institutional abuse directed at women who had an induced abortion in illegal and unsafe conditions. Seventy-eight women admitted to a public hospital in Teresina for complications after an induced abortion were interviewed. A semi-structured script was used with questions about practices and itineraries of abortion and institutional violence during hospitalization. Discriminatory practices and maltreatment during care were reported by 26 women, especially among those who confessed to induction of the abortion. Moral judgement, threat of filing a complaint to the police, negligence in the control of pain, long wait for uterine curettage, and hospitalization with mothers who have recently given birth were the main types of institutional violence reported by women. Cases of institutional violence in the care of induced abortion violates the duty of the healthcare service and prevents women from receiving the necessary health care.

  16. Urban Afforestation: Environmental Perception from the Surrounding Residentes of the Seedling Nersey of Teresina North, Piauí

    Directory of Open Access Journals (Sweden)

    Sunamita Lima da Silva

    2016-12-01

    Full Text Available The need of urban afforestation is an evident reality in a tropical country with continental dimensions like Brazil. Due its geographic position. Based on that, this article analysed the afforestation project located in two place of seedling-nurseries distribution in north area through the “Teresina Mais Verde” program. In front of that scene, it aimed to analyze how is the owner view on environmental education. The search was accomplished from qualitative analysis records in two steps: bibliographic review and individual interview with the interested in acquiring the seedlings. The main reached results showed that the initiative is good.  Though the question is not only produce seedlings and delivery them to the population. There was a lack of specific strategy to reach the main aim.

  17. Larval fish distribution and their relationship with environmental factors in the southern Tyrrhenian Sea (central Mediterranean during two years of sampling

    Directory of Open Access Journals (Sweden)

    Adriana Profeta

    2014-06-01

    The results of this study could have implications for the management of marine resources, because the investigated area has already been identified as a nursery area for many pelagic and coastal fishes and a natural habitat for many species of high commercial interest. Fig. 1. Results of CCA analysis for larval fish species and sampled stations during June 2006. Two first axes (CCA1 and CCA2 are represented. Species abbreviations in alphabetical order: An_a (Anthias anthias, Ap_i (Apogon imberbis, Ar_k (Arnoglossus kessleri, Ar_h (Argyropelecus hemigymnus, Ar_l (Arnoglossus laterna, Ar_r (Arnoglossus rueppelii, Ar_t (Arnoglossus thori, Be_g (Benthosema glaciale, Bl_o (Blennius ocellaris, Bo_b (Boops boops, Bo_p (Bothus podas, Ca_a (Capros aper, Ca_p (Callyonimus maculatus, Ce_m (Ceratoscopelus maderensis, Ce_m1(Cepola macrophtalma, Ci_l (Citharus linguatula, Co_j (Coris julis, Co_n (Ophidion barbatum, Cy_b (Cyclothone braueri, Cy_p (Cyclothone pygmaea, En_e (Engraulis encrasicolus, Di_a (Diplodus annularis, Di_h (Diaphus holti, Di_r (Diaphus rafinesquei, El_r (Electrona rissoi, Go_n (Gobius niger, He_d (Helicolenus dactylopterus, Hy_b (Hygophum benoiti, Hy_h (Hygophum hygomii, La_c (Lampanyctus crocodilus, La_p (Lampanyctus pusillus, Le_c (Lepidotrigla cavillone, Le_j (Lestidiops jayakari, Lo_d (Lobianchia dofleini, Ma_m (Maurolicus muelleri, Ma_s (Macrorhamphosus scolopax, Me_m (Merluccius merluccius, Mi_p (Micromesistius poutassou, My_p (Myctophum punctatum, Mu_s (Mullus surmuletus, Ne_s (Nemichthys scolopaceus, No_b (Notoscopelus bolini, No_e (Notoscopelus elongatus, No_r (Arctozenus risso, Ob_m (Oblada melanura, Pa_s (Paralepis speciosa. Sc_p (Scorpaena porcus, Sc_s (Scorpaena scrofa, Se_c (Serranus cabrilla, Se_h (Serranushepatus, Sp_f (Spicara maena, Sp_s (Spicara smaris, Sy sp. (Symphurus nigrescens, Sy_v, (Symphurus ligulatus, St_b (Stomias boa boa, Tr_d (Trachinus draco, Tr_me (Trachurus mediterraneus, Tr_t (Trachurus trachurus, Ur_s (Uranoscopus scaber

  18. Seasonal dynamic of the occurrence of the gregarines infection of Harpalus rufipes (Coleoptera, Carabidae in agroecosystem

    Directory of Open Access Journals (Sweden)

    D. Y. Reshetnyak

    2015-08-01

    Full Text Available Relationships in the “parasite-host” system are closely interrelated and occur at all levels from the molecular to behavioral and population ones. There are two models of realization of these relations. The first case is when the parasites are uniformly distributed in the host population. High extensiveness of invasion is accompanied by its low intensity. The second case is when a part of host population is infected with parasites, but the negative impact is manifested to the maximum extent. Invasion of the ground beetle Harpalus rufipes (De Geer, 1774, dwelling in sweet corn agroecosystems located in the vicinity of Dnipropetrovsk near Doslidnoe village, by several gregarines species is investigated in this study. H. rufipes is an abundant, ubiquitous species, living in extremely wide range of terrestrial ecosystems, with especially high populations inhabiting anthropogenically transformed environments. H. rufipes has a wide range of feeding. This species is distributed in the Central and Eastern Europe, and introduced to North America. Gregarines were found in the intestines of 20 individuals of H. rufipes from 190 (10.5%: Gregarina ovata Dufour, 1828, G. steini Berndt, 1902, G. amarae (Hammerschmidt, 1839 Frantzius, 1848, Clitellocephalus ophoni (Tuzet and Ormieres, 1956 Clopton, 2002, Torogregarina sphinx Clopton, 1998, Gigaductus macrospora Filipponi, 1948 and G. elongatus (Moriggi, 1943 Filipponi, 1948. There is high level of infestation of C. ophoni and G. steini. At the same time, not more than three species of the gregarines were localized in the beetle body. Seasonal dynamic of occurrence of the gregarines is as follows. Maximal indices of occurrence are found at the end of August (22.2% and minimal ones at the end of June (4.8%. The highest total number of gregarines (383 ind. is recorded at the end of August, the lowest one is fixed at the beginning of September (33 ind.. Indices of gregarine species dominance are as follows

  19. Estudio Palinológico de los 35 mts. Superiores de la Sección Tarragona, Sabana de Bogotá Estudio Palinológico de los 35 mts. Superiores de la Sección Tarragona, Sabana de Bogotá

    Directory of Open Access Journals (Sweden)

    Dueñas J. Hernando

    1979-12-01

    Full Text Available En el presente trabajo se da a conocer el resulrado del estudio palinológico de los 35 metros superiores de la sección Tarragona, localizada en la Sabana de Bogotá, a 2.560 metros sobre el nivel del mar. Se describen 2 géneros (Spirotremesporites, Striadyadosporites y 5 especies(Spirotremesporites simplex, Spirotremesporites multiplex, Spirotremesporites ecuatorialis, Striadyadosporites elongatus y Striadyadosporites constrictus de fungi fósil, 14 tipos de polen, 8 tipos de esporas triletes, 4 tipos de Pediastrum y un tipo especial de Chlorococcales. Con base en la relación de polen de elementos de páramo a polen de elementos de bosque (Pp/Pb y a la estrarigrafía, se dividió el diagrama depolen en 8 zonas climáticas (vegetación, con las cuales fue posible correlacionar la sección Tarragona con otras secciones levantadas en la Sabana de Bogotá y regiones aledañas. Utilizando esta correlación y las fechas de edad absoluta que se han obtenido en las diferentes secciones del área, fue posible efectuar una correlacion tentativa con las unidades cronoestratigráficas europeas.  Los 35 metros superiores de la sección Tarragona representan la historia geológica de por lo menos los últimos 500.000 años de la Sabana de Bogotá.In this study it is given the result of the palynological study of the uppermost 35 meters of the Tarragona section, located in the Sabana de Bogotá at an altitude of 2.560 meters above sea level.  It is described: 2 genus (Spirotremesporites, Striadyadosporites and 5 species (Spirotremesporites simplex, Spirotremesporites multiplex, Spirotremesporites ecuatorialis, Striadyadosporites elongatus and Striadyadosporites constrictus of fossil fungi, 14 types of pollen, 8 types of trilete spores, 4 types of Pediastrum and one special type of Chlorococcales.  On the basis of the relation, Pollen of paramo elements to Pollen of forest elements (Pp/Pb and the stratigraphy it was possible to divide the pollen diagram

  20. Análise da pele de três espécies de peixes: histologia, morfometria e testes de resistência Analysis of the skin of three fish species: histology, morphometry and resistance tests

    Directory of Open Access Journals (Sweden)

    Maria Luiza R. Souza

    2003-12-01

    Full Text Available O objetivo deste trabalho foi analisar a pele de três espécies de peixes (piavuçu Leporinus macrocephalus, pacu prata Mylossoma sp e piraputanga Brycon hilarii através de análise histologica e morfometrica e testes de resistência após o curtimento. Amostras de peles da região dorsal foram coletadas, fixadas em Bouin por 24 horas, incluídas em parafina, cortadas em 5 µm de espessura e coradas por Hematoxilina-eosina. Os cortes foram analisados pela microscopia de luz. Foi utilizado o dinamômetro EMIC para a análise físico-mecânica do couro em 10 amostras no sentido longitudinal a partir da região dorsal do peixe de cada espécie. A derme desses peixes possui um padrão estrutural comum aos teleósteos, porém a disposição e distribuição das fibras colágenas apresentaram-se diferentes entre as espécies analisadas. Através da análise morfométrica constatou-se que a espessura da derme da pele diferiu entre as três espécies. Não houve diferença no teste de resistência à tração no couro da piraputanga (16,88 N/mm² e piavuçu (18,50 N/mm². Os resultados para os couros destas duas espécies de peixes foram superiores ao pacu (11,83 N/mm². O valor de alongamento até a ruptura foi superior para piavuçu (52,83% e piraputanga (60,45%, não diferindo entre eles, porém foi inferior para o pacu (33,83%. O rasgamento progressivo foi maior no couro de pacu (36,51 N/mm. As peles das três espécies analisadas podem ser transformadas em couro para sua aplicação em diversos artefatos.This study was carried out to analyse the skin of three species of fish (piavuçu Leporinus macrocephalus, pacu prata Mylossoma sp e piraputanga Brycon hilarii through histological and morphometrical analysis and resistance tests after hardening. Skin samples from the dorsal region were taken and fixed in Bouin solution for 24 hours. They were embedded in paraffin, cut 5 µm thick and stained by Hematoxylin-eosin technique. The cuts were analyzed

  1. Alegações maternas para o desmame: estudo qualitativo Maternal allegations for weaning: qualitative study

    Directory of Open Access Journals (Sweden)

    Carmen V. Ramos

    2003-10-01

    Full Text Available OBJETIVO: Estudar as alegações para o desmame entre mulheres assistidas em uma maternidade Amiga da Criança, em Teresina, Piauí. METODOLOGIA: Adotou-se os preceitos metodológicos da pesquisa qualitativa em saúde, utilizando como referencial teórico a teoria das representações sociais. Ao todo, entrevistou-se 24 mulheres que se encontravam em processo de desmame antes do 4º mês de vida do bebê. RESULTADOS: A análise compreensiva permitiu revelar que a tomada de decisões que leva as mulheres ao desmame se dá de maneira complexa e carregada de culpa. Dentre os motivos alegados, figuraram leite fraco ou pouco, intercorrências de mama puerperal, falta de experiência, inadequação entre as suas necessidades e as do bebê, interferências externas, trabalho, ambigüidade entre o querer/poder amamentar e entre o fardo/desejo. CONCLUSÕES: A solidão/isolamento da mulher-mãe e a necessidade de obter apoio para a consecução dessa prática, não só por parte do serviço de saúde como também dos outros segmentos da sociedade, se fizeram presentes de forma uniforme nas entrevistas. Nesta perspectiva, vale atentar para a necessidade de reformulações do modelo assistencial ora vigente, no sentido de considerar a amamentação como um ato que precisa ser aprendido pela mulher e protegido pela sociedade.OBJECTIVE: To study the reasons for weaning given by women receiving care at a Baby-Friendly Maternity in Teresina, state of Piauí, Brazil. METHODS: The methodological principles of qualitative research were applied, supported by the social representation theory. Data were collected from 24 women who were in the process of weaning their babies before the 4th month of life. RESULTS: The decision-making process that leads women to wean their babies is complex and guilt-ridden. The following reasons for weaning were mentioned: having weak or little milk; puerperal problems affecting the breasts; lack of experience; disparity between the

  2. Barreiras às novas formas de coordenação no agrossistema do caju na região nordeste, Brasil Barriers to new coordination forms in the cashew nut agricultural system in northeast of Brazil

    Directory of Open Access Journals (Sweden)

    Hildo Meirelles de Souza Filho

    2010-01-01

    Full Text Available Embora a produção brasileira de amêndoa de castanha-de-caju tenha crescido nos anos 2000, sua participação no mercado internacional reduziu-se, revelando perda de competitividade desse agrossistema. A produtividade na produção rural é baixa e subsiste uma antiquada estrutura de governança das relações entre produtores, intermediários e processadores de castanha em casca. Novas formas de coordenação estão sendo testadas, mas ainda não foram capazes de substituir a antiga. O objetivo desse artigo é identificar o conjunto de barreiras à transformação dessa estrutura. O referencial teórico adotado encontra-se fundamentalmente na Economia de Custos de Transação. Para investigação empírica, adotou-se o método de pesquisa rápida (rapid appraisal, compreendendo entrevistas junto a uma amostra não probabilística de agentes da cadeia nos estados do Ceará, Piauí e Rio Grande do Norte. Os resultados mostram que há resiliência da estrutura de governança antiga, a qual está assentada na funcionalidade e capacidade de reação dos intermediários. Assim, a estratégia de mudança cautelosa das empresas processadoras é, por um lado, racional diante de grandes incertezas, e, por outro, lenta diante das transformações do mercado internacional.Although the Brazilian production of cashew nuts has increased in the years 2000, its international market-share has decreased revealing competitiveness loss of this agri-system. Agricultural yields are low and a traditional governance structure among farmers, intermediaries, and cashew nut processing industries still subsists. New coordination forms have been tested, but they have not been able to substitute the old one. The objective of this article is the identification of barriers to the changes of this structure. The Economy of Transaction Cost is the theoretical approach adopted. For empirical investigation, a rapid appraisal method was adopted comprising interviews with

  3. Composição química e antinutrientes presentes nas amêndoas cruas e torradas de chicha (Sterculia striata A. St. Hill & Naudin Chemical composition and antinutrients of raw and roasted chicha almonds (Sterculia striata A. St. Hill & Naudin

    Directory of Open Access Journals (Sweden)

    Aline Gomes de Moura e Silva

    2011-04-01

    Full Text Available OBJETIVO: Analisar os componentes químicos e antinutrientes antes e após torrefação da amêndoa de chichá da espécie Sterculia striata A. St. Hill & Naudin, oriunda de Corrente, Piauí. MÉTODOS: Foram realizadas análises: centesimal, perfil de ácidos graxos, antinutrientes (taninos, inibidor de tripsina, inibidor de amilase, lectina, fitatos, compostos fenólicos e atividade de peroxidase e polifenoloxidase. RESULTADOS: Os resultados da análise centesimal da amêndoa crua e torrada foram: lipídeos de 25,1% e 26,2%, carboidratos de 44,4% e 45,6%, proteína de 20,8% e 22,1%, cinzas de 3,7% e 4,0%, fibra alimentar total de 12,3% e 10,4%, respectivamente. Nas amêndoas cruas e torradas não foram encontradas lectinas, taninos, inibidores de tripsina e alfa-amilase. Verificou-se a ausência de peroxidase e polifenoloxidase e conteúdo de compostos fenólicos de 107,7mg/100g e 108,9mg/100g para amêndoas cruas e torradas, respectivamente. CONCLUSÃO: A torrefação realizada a 205°C por 11 minutos diminuiu o teor de fitatos de 10,6mg/g para 5,5mg/g. Por fim, as amêndoas de chichá, cruas e torradas, apresentam alto teor de proteínas, fibras, ácidos graxos monoinsaturados e saturados.OBJECTIVE: This study analyzed the chemical components and antinutrients present in raw and roasted chichá almonds from the species Sterculia striata A. St. Hill & Naudin harvested in Corrente, Piauí. METHODS: The following were determined: percent composition, fatty acid profile, antinutrients (tannins, trypsin inhibitor, amylase inhibitor, lectin, phytates, phenolic compounds and peroxidase and polyphenol oxidase activities. RESULTS: The percentage composition of the raw and lipid almonds were respectively: 25.1% and 26.2% fats, 44.4% and 45.6% carbohydrates, 20.8% and 22.1% protein, 3.7% and 4.0% ashes, and 12.3% and 10.4% total fiber. Neither raw nor roasted almonds contained lectins, tannins, trypsin inhibitors, alpha-amylase, peroxidase and

  4. Preferência do pulgão-preto, Aphis craccivora Koch, a diferentes genótipos de feijão-de-corda, Vigna unguiculata (L. Walp Black aphid, Aphis craccivora Koch, preference to different cowpea, Vigna unguiculata (L. Walp. cultivars

    Directory of Open Access Journals (Sweden)

    João Gutemberg Leite Moraes

    2007-12-01

    Full Text Available Este trabalho foi desenvolvido visando a avaliar a resposta de cultivares de feijão-de-corda, Vigna unguiculata (L. Walp., à presença do pulgão-preto (Aphis craccivora Koch. Os experimentos foram conduzidos de agosto a outubro de 2004, em casa-de-vegetação da Universidade Federal do Ceará (UFC. As cultivares foram: "Epace-10", "Epace-11", "Patativa", "Pingo de Ouro", "Pitiúba", "BR-10 Piauí", "BR-12 Canindé", "BR-14 Mulato" e "BR-17 Gurguéia". O experimento constou de três ensaios, cada um com cinco tratamentos e seis repetições, sendo o delineamento estatístico inteiramente casualizado. Os genótipos foram cultivados em copos plásticos de 300ml e mantidos em gaiolas protegidas por tela antiafídeos. As plantas foram infestadas após doze dias do plantio através da liberação de cinco fêmeas adultas do pulgão-preto por planta. As avaliações foram realizadas após o terceiro e o quinto dia da infestação, constando da contagem direta das formas adulta e jovem do inseto presentes nas plantas. Os dados obtidos foram analisados através de análise de variância e pelo teste de Tukey em 5% de probabilidade de erro. As cultivares "Epace-10" e "Patativa" foram as menos preferidas por A. craccivora.This research was conducted with the intention of evaluating the response of different cowpea, Vigna unguiculata (L. Walp, cultivars to the black aphid (Aphis craccivora Koch. The bioassays were conducted from August through October of 2004 in a greenhouse at the Ceará Federal University (UFC campus. The cowpea cultivars used were: Epace-10, Epace-11, Patativa, Pingo de Ouro, Pitiúba, BR-10 Piauí, BR-12 Canindé, BR-14 Mulato and BR-17 Gurguéia. Each assay had five treatments and six replications in a completely randomized block design. The genotypes were raised in a 300ml plastic cup and maintained in cages protected by an insect proof net. Plants were infested twelve days after planting with five adult females per plant

  5. Clinical and epidemiological analysis of patients with HIV/AIDS admitted to a reference hospital in the northeast region of Brazil Análise clínica e epidemiológica dos pacientes com HIV/AIDS internados em um Hospital de Referência na Região Nordeste do Brasil

    Directory of Open Access Journals (Sweden)

    Vítor Yamashiro Rocha Soares

    2008-12-01

    Full Text Available The AIDS epidemic has become a worldwide phenomenon of enormous magnitude and extension, deeply transforming medical practices and public health initiatives. This retrospective survey aimed to analyze clinical and epidemiological characteristics of patients with HIV/AIDS admitted to the Institute of Tropical Diseases Natan Portella, Teresina, Piauí, Brazil, from January, 2001 through December, 2004. Of the 828 patients, 43% were from other states and 71.3% were men. Average patient age was 35.4 ± 11.5 years-old and 85.5% were illiterate or had primary education. The main form of exposure to HIV was heterosexual behavior (54.1%, while injectable drug use was confirmed by only 2.7% of registered cases. The most frequent infectious complications were candidiasis (42.4% and pneumocystosis (22.2%. Sixty-eight cases (8.2% of visceral leishmaniasis were registered. Using multivariate analysis, individuals aged over 40 years-old, patients with active tuberculosis, Pneumocystis carinii pneumonia and central nervous system cryptococcosis showed increased risk of death. In this study, young male adults with low educational levels predominated and the most frequent opportunistic infections were candidiasis and pneumocystosis.A epidemia de AIDS tornou-se um fenômeno mundial de grande magnitude e extensão, transformando profundamente a prática médica e as iniciativas em saúde pública. O estudo retrospectivo analisou as características clínicas e epidemiológicas dos pacientes com HIV/AIDS internados no Instituto de Doenças Tropicais Natan Portella, Teresina, Piauí, Brasil, de janeiro de 2001 a dezembro de 2004 . Dos 828 pacientes, 43% eram provenientes de outros estados e 71,3% eram do sexo masculino. A idade média foi 35,4 ± 11,5 anos. Eram analfabetos ou cursaram até o ensino fundamental 85,5%. A principal via de exposição ao HIV foi o comportamento heterossexual (54,1%, enquanto o uso de drogas injetáveis foi observado em apenas 2,7% dos

  6. O emprego de vírgula em construções causais e explicativas do português

    Directory of Open Access Journals (Sweden)

    Eliane Mourão

    2014-11-01

    Full Text Available No quadro tradicional dos estudos da linguagem, a distinção entre orações coordenadas explicativas e subordinadas adverbiais causais determina o emprego de vírgula. Todavia, o quadro tradicional não fornece critérios que permitam diferenciar com o rigor necessário os dois tipos de oração. Trabalhamos com a hipótese de que isso se deve ao fato de esses critérios privilegiarem a estrutura sintática das orações, ignorando sua participação na organização textual. Desse modo, buscando compreender as condições de emprego dos sinais de pontuação com as construções do português brasileiro tradicionalmente denominadas coordenadas explicativas e subordinadas adverbiais causais, examinamos essas construções do ponto de vista do quadro da gramática funcional, em que fatores formais e textuais se associam na explicação dos fatos linguísticos. Valemo-nos principalmente de estudo realizado por Neves (1999 para estabelecermos as variáveis que deveriam compor nossa investigação. Examinamos qualitativa e quantitativamente dados das orações focalizadas extraídos das revistas Veja e Piauí. Distinguimos quatro padrões oracionais, aos quais se associa, como elemento caracterizador, o emprego de vírgula. In the traditional framework of language studies, the distinction between independent explanatory clauses and result clauses determines the use of comma. However, the traditional framework does not provide criteria which enable distinguishing these two types of clauses with adequate precision. We raise the hypothesis that this happens due to the fact that these criteria privilege the syntactic structure of the clauses, disregarding its participation in textual organization. Therefore, trying to comprehend the issues related to the use of punctuation marks in the Brazilian Portuguese structures traditionally called result clauses and independent explanatory clauses, we analyzed these clauses from the perspective provided by

  7. Comportamento reológico de méis de florada de silvestre Rheological behavior of honey from Serjania glabrata flowers

    Directory of Open Access Journals (Sweden)

    Alexandre J. de M. Queiroz

    2007-04-01

    Full Text Available Estudou-se o comportamento reológico de méis de Apis mellifera produzidos no estado do Piauí, no semi-árido brasileiro, elaborados com florada predominante de silvestre (Serjania glabrata. As amostras foram coletadas ao longo do ano 2000, a partir de coletas realizadas por apicultores, associações e cooperativas de apicultura da região abrangida pelos municípios de Picos, Itainópolis, Vera Mendes e Isaías Coelho. Após as coletas as amostras passaram pelos processos de centrifugação, filtragem e decantação. As medidas reológicas foram feitas nas temperaturas de 20 a 40 ºC utilizando-se um viscosímetro Brookfield, modelo RVT. As leituras de velocidade de rotação e torque foram transformadas em valores de taxa de deformação e tensão de cisalhamento. Os dados de taxa de deformação e tensão de cisalhamento foram ajustados pelas equações da Lei-da-Potência e de Herschel-Bulkley. As amostras apresentaram comportamento pseudoplástico. As equações se ajustaram adequadamente aos resultados experimentais de tensão de cisalhamento em função da taxa de deformação. O aumento de temperatura reduziu a viscosidade aparente em níveis próximos de 80%. Os valores de viscosidade aparente foram bem ajustados por uma equação do tipo Arrhenius.The rheological behavior of Apis mellifera honey produced in the State of Piauí, in the Brazilian semi-arid, obtained with predominance of Serjania glabrata flowers was studied. The samples were collected in the year 2000 by beekeepers and associations and cooperatives of beekeepers in the area covered by the municipal districts of Picos, Itainópolis, Vera Mendes and Isaías Coelho. The samples were centrifuged, filtered, decanted and the rheological measures at temperatures of 20 to 40 ºC using a Brookfield Viscometer RVT model were made. The readings of rotation speed and torque were transformed in shear rate and shear stress values. The data of shear rate and shear stress were fitted

  8. Novos polimorfismos no gene da obesidade em raças divergentes de suínos Polymorphisms in the leptin gene in divergent swine breeds

    Directory of Open Access Journals (Sweden)

    M.A.M. Soares

    2006-06-01

    Full Text Available Investigou-se a existência de polimorfismo no gene da leptina (gene da obesidade entre varrões da raça nativa Piau (porco tipo banha e matrizes mestiças de raças comerciais (Landrace/Large White e Landrace/Large White com Pietrain, selecionadas para peso e precocidade. Oito pares de primers foram desenhados a partir da seqüência disponível no GenBank (U66254, usada, neste trabalho, como seqüência de referência. Amostras de DNA foram extraídas de células sangüíneas brancas utilizando-se solução de fenol:clorofórmio, após tratamento com proteinase K. Os fragmentos gerados por amplificação da reação em cadeia da polimerase foram purificados e seqüenciados em seqüenciador automático. As seqüências de nucleotídeos, obtidas a partir do DNA das raças comerciais de suíno, apresentaram maior similaridade com a seqüência de referência, e as seqüências geradas a partir do DNA dos animais nativos divergiram de ambas em algumas posições. Dos 28 polimorfismos encontrados, oito foram observados em apenas uma das três seqüências geradas a partir do DNA das raças nativas. Doze estavam presentes em duas seqüências, e os oito polimorfismos restantes foram encontrados nos três animais nativos.Leptin gene (obese gene polymorphism was investigated in Piau boars (a fat, native breed and sows from commercial strains (Landrace/Large White and Landrace/Large White by Pietrain chosen for rapid growth and early sexual maturity. Eight pairs of primers designed using the sequence available from GenBank (access nº U66254 were identified as the reference sequence in this project. DNA samples were extracted from white blood cells using phenol:chloroform solution, after treatment with proteinase K. Fragments generated by amplification of the Polymerase Chain Reaction were purified and sequenced in an automatic sequencer. Nucleotide sequences obtained from DNA of commercial swine breeds were similar to the reference sequence; whereas

  9. Caracterização da fauna edáfica em sistemas de manejo para produção de forragens no Estado do Piauí Characterization of edaphic fauna in management systems for forage production in the State of Piauí

    Directory of Open Access Journals (Sweden)

    Luís Alfredo Pinheiro Leal Nunes

    2012-03-01

    Full Text Available O objetivo desse trabalho foi avaliar a distribuição da fauna em função da umidade do solo em diferentes sistemas de manejo para a produção de forragens com capim-Tifton 85 (Cynodon dactylon Pers. x C. niemfuensis Vanderys, capim-Tanzânia (Panicum maximum Jacq. cv. Tanzânia, capim-Andropogon (Andropogon gayanus Kunth, Leucena (Leucaena leucocephala (Lam. R. de Wit. tendo como controle uma Mata dos Cocais. A coleta da fauna foi feita utilizando-se armadilhas do tipo Pitfall em duas épocas do ano: setembro de 2007 e março de 2008, período seco e chuvoso, respectivamente. Os sistemas com capim-Tifton, capim-Tanzânia e Leucena mostraram maior número de indivíduos nos dois períodos avaliados. A queimada ocorrida no capim-Andropogon antes da primeira coleta resultou em uma redução na abundância e diversidade da fauna edáfica. Os maiores valores em riqueza, diversidade e uniformidade de fauna foram obtidos na amostragem realizada no período úmido. A mata mostrou maior diversidade e equitabilidade nos dois períodos avaliados. Em situação de estresse hídrico alguns grupos como Formicidae e Collembola predominaram nos sistemas de manejo diminuindo a uniformidade, enquanto no período úmido vários grupos mostraram boa representatividade o que favoreceu a uniformidade. A análise multivariada de componentes principais evidenciou que os sistemas com mata, capim-Tifton e capim-Tanzania e Leucena mostraram associação com vários grupos da fauna edáfica nos dois períodos avaliados enquanto que o sistema com capim-Andropogon, que sofreu queimada, apresentou afinidade apenas com o grupo Heteroptera, no período seco.The objective of this study was to evaluate the distribution of fauna as a function of soil moisture in different fodder-production management systems of Tifton 85 grass (Cynodon dactylon Pers. x C. niemfuensis Vanderys, Tanzania grass (Panicum maximum Jacq. cv. Tanzânia, Andropogon Grass (Andropogon gayanus Kunth and Leucena plants (Leucaena leucocephala (Lam. R. de Wit., with a coca-crop forest used as control. Sampling of the fauna was accomplished using "pitfall" traps in two periods of the year: September 2007 and March 2008, the dry and wet seasons respectively. Those systems with Tifton grass, Tanzania grass and Leucaena plants showed a higher number of individuals in both periods. The fire which occurred in the Andropogon grass before the first harvest resulted in a reduction in the amount and diversity of the soil fauna. The highest values for wealth, diversity and uniformity of fauna, were obtained from samples collected during the wet season. The forest presented a greater diversity and balance for both periods assessed. In a situation of water-stress, some groups, such as Collembola and Formicidae, predominated in the management systems, decreasing uniformity, while in the wet season, several groups were well represented, favouring uniformity. Principal-component multivariate analysis showed that systems of forest, Tifton grass, Tanzania grass and Leucaena plants were associated with several groups of soil fauna in the two periods evaluated, while the system of Andropogon grass, which suffered a fire, showed an affinity only with the Hepteroptera group during the dry season.

  10. A iniciativa hospital amigo da criança sob a ótica dos atores sociais que a vivenciam em Teresina, Piauí The baby-friendly hospital initiative as perceived by the social actors who experience it in Teresina, Piauí, Brazil

    Directory of Open Access Journals (Sweden)

    Carmen Viana Ramos

    2010-12-01

    Full Text Available OBJETIVO: Analisar os reflexos da Iniciativa Hospital Amigo da Criança nos atores sociais que a vivenciam. MÉTODOS: Estudo qualitativo. Utilizaram-se entrevistas semiestruturadas, com auxílio de um roteiro temático, junto a vinte mulheres e dez profissionais de saúde em cinco hospitais amigos da criança em Teresina (PI. Para a análise dos dados foi utilizada a técnica de an��lise de conteúdo do tipo temática. RESULTADOS: A análise das falas levou à construção de dois eixos de discussão: um relacionado à tríade de sustentação da Iniciativa - promoção, proteção e apoio; e o outro a seu próprio modus operandi, os quais permitiram evidenciar dificuldades na implementação das normas e rotinas da Iniciativa Hospital Amigo da Criança desenvolvidas nas instituições. CONCLUSÃO: Os resultados revelaram a necessidade de ajustes para melhorar a resolutividade do programa, com ênfase para: adoção de uma nova matriz ensino-aprendizagem pautada na educação reflexiva e na adoção dos referenciais da pedagogia da problematização; fortalecimento das redes de apoio à mulher; investimentos na melhoria do acolhimento, tornando a relação cliente-profissional mais respeitosa e definição de um processo de monitoramento contínuo que permita a adoção de medidas corretivas sempre que se fizer necessário.OBJECTIVE: This study analyzed the way the Baby-Friendly Hospital Initiative is perceived by the social actors involved in it. METHODS: This qualitative study administered semi-structured interviews aided by a thematic guide to twenty female patients and ten health professionals from five Baby-Friendly Hospitals in Teresina (PI, in Northeast Brazil. Thematic content analysis was used to analyze the data. RESULTS: Analysis of the testimonials led to two axes of discussion: one related to the foundation triad of the initiative - promotion, protection and support; and the other related to its own modus operandi, highlighting the difficulties for implementing the BFHI norms and practices carried out in these institutions. CONCLUSION: The results showed that adjustments are necessary to improve the effectiveness of the program, with special emphasis to: adoption of a new teaching-learning matrix based on reflexive education; adoption of references from the pedagogy of questioning; strengthening of women's support networks; investments for improving the receptiveness, thus creating a more respectful relationship between customers and professionals; and the establishment of a continuous monitoring system that allows the implementation of corrective measures whenever necessary.

  11. Mercury bioaccumulation in bats reflects dietary connectivity to aquatic food webs.

    Science.gov (United States)

    Becker, Daniel J; Chumchal, Matthew M; Broders, Hugh G; Korstian, Jennifer M; Clare, Elizabeth L; Rainwater, Thomas R; Platt, Steven G; Simmons, Nancy B; Fenton, M Brock

    2018-02-01

    Mercury (Hg) is a persistent and widespread heavy metal with neurotoxic effects in wildlife. While bioaccumulation of Hg has historically been studied in aquatic food webs, terrestrial consumers can become contaminated with Hg when they feed on aquatic organisms (e.g., emergent aquatic insects, fish, and amphibians). However, the extent to which dietary connectivity to aquatic ecosystems can explain patterns of Hg bioaccumulation in terrestrial consumers has not been well studied. Bats (Order: Chiroptera) can serve as a model system for illuminating the trophic transfer of Hg given their high dietary diversity and foraging links to both aquatic and terrestrial food webs. Here we quantitatively characterize the dietary correlates of long-term exposure to Hg across a diverse local assemblage of bats in Belize and more globally across bat species from around the world with a comparative analysis of hair samples. Our data demonstrate considerable interspecific variation in hair total Hg concentrations in bats that span three orders of magnitude across species, ranging from 0.04 mg/kg in frugivorous bats (Artibeus spp.) to 145.27 mg/kg in the piscivorous Noctilio leporinus. Hg concentrations showed strong phylogenetic signal and were best explained by dietary connectivity of bat species to aquatic food webs. Our results highlight that phylogeny can be predictive of Hg concentrations through similarity in diet and how interspecific variation in feeding strategies influences chronic exposure to Hg and enables movement of contaminants from aquatic to terrestrial ecosystems. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. Revisão da subfamília Atactorhynchinae Petrotschenko, 1956 (Acanthocephala - Neoechinorhynchidae A review of Atactorhynchinae Petrotschenko, 1956 (Acanthocephala, Neoechinorhynchidae

    Directory of Open Access Journals (Sweden)

    Dely Noronha

    1973-01-01

    Full Text Available No presente trabalho é feita a revisão da subfamília Atactorhynchinae Petrostschenko, 1956. Para o gênero Floridosentis Ward, 1953, o estudo é baseado em exemplares do material tipo, além de outros encontrados parasitnando três peixes do gênero Mugil (Parati, provenientes de Cabo Frio, Rio de Janeiro. Quanto ao gênero Atactorhynchus Chandler, 1935, o nosso estudo foi baseado na descrição original de Chandler e do trabalho de Golvan sobre a classe dos Eoacanthocephala (Van Cleave, 1936.In this paper, the authors revise the sub-family Atactorhynchinae Petrotschenko, 1956, after studying types of Floridosentis mugilis (Machado Filho, 1951 and material recovered from intestine of Mugil sp. from Cabo Frio, Estado do Rio de Janeiro, Brasil. They confirm what was suggested by Bullock, 1962, about a new combination for the type species of Floridosentis Ward, 1953. For this reason, they make F. elongatus, synonym of F. mugilis Machado Filho, 1951. Besides they also enlarge the subfamily diagnosis and add a table showing the maind differences between the two genera under Atactorhynchinae Petrotschenko, 1956.

  13. Silica ecosystem for synergistic biotransformation

    Science.gov (United States)

    Mutlu, Baris R.; Sakkos, Jonathan K.; Yeom, Sujin; Wackett, Lawrence P.; Aksan, Alptekin

    2016-06-01

    Synergistical bacterial species can perform more varied and complex transformations of chemical substances than either species alone, but this is rarely used commercially because of technical difficulties in maintaining mixed cultures. Typical problems with mixed cultures on scale are unrestrained growth of one bacterium, which leads to suboptimal population ratios, and lack of control over bacterial spatial distribution, which leads to inefficient substrate transport. To address these issues, we designed and produced a synthetic ecosystem by co-encapsulation in a silica gel matrix, which enabled precise control of the microbial populations and their microenvironment. As a case study, two greatly different microorganisms: Pseudomonas sp. NCIB 9816 and Synechococcus elongatus PCC 7942 were encapsulated. NCIB 9816 can aerobically biotransform over 100 aromatic hydrocarbons, a feat useful for synthesis of higher value commodity chemicals or environmental remediation. In our system, NCIB 9816 was used for biotransformation of naphthalene (a model substrate) into CO2 and the cyanobacterium PCC 7942 was used to provide the necessary oxygen for the biotransformation reactions via photosynthesis. A mathematical model was constructed to determine the critical cell density parameter to maximize oxygen production, and was then used to maximize the biotransformation rate of the system.

  14. Enhanced limonene production in cyanobacteria reveals photosynthesis limitations.

    Science.gov (United States)

    Wang, Xin; Liu, Wei; Xin, Changpeng; Zheng, Yi; Cheng, Yanbing; Sun, Su; Li, Runze; Zhu, Xin-Guang; Dai, Susie Y; Rentzepis, Peter M; Yuan, Joshua S

    2016-12-13

    Terpenes are the major secondary metabolites produced by plants, and have diverse industrial applications as pharmaceuticals, fragrance, solvents, and biofuels. Cyanobacteria are equipped with efficient carbon fixation mechanism, and are ideal cell factories to produce various fuel and chemical products. Past efforts to produce terpenes in photosynthetic organisms have gained only limited success. Here we engineered the cyanobacterium Synechococcus elongatus PCC 7942 to efficiently produce limonene through modeling guided study. Computational modeling of limonene flux in response to photosynthetic output has revealed the downstream terpene synthase as a key metabolic flux-controlling node in the MEP (2-C-methyl-d-erythritol 4-phosphate) pathway-derived terpene biosynthesis. By enhancing the downstream limonene carbon sink, we achieved over 100-fold increase in limonene productivity, in contrast to the marginal increase achieved through stepwise metabolic engineering. The establishment of a strong limonene flux revealed potential synergy between photosynthate output and terpene biosynthesis, leading to enhanced carbon flux into the MEP pathway. Moreover, we show that enhanced limonene flux would lead to NADPH accumulation, and slow down photosynthesis electron flow. Fine-tuning ATP/NADPH toward terpene biosynthesis could be a key parameter to adapt photosynthesis to support biofuel/bioproduct production in cyanobacteria.

  15. Delineating Substrate Diversity of Disparate Short-Chain Dehydrogenase Reductase from Debaryomyces hansenii.

    Directory of Open Access Journals (Sweden)

    Arindam Ghatak

    Full Text Available Short-chain dehydrogenase reductases (SDRs have been utilized for catalyzing the reduction of many aromatic/aliphatic prochiral ketones to their respective alcohols. However, there is a paucity of data that elucidates their innate biological role and diverse substrate space. In this study, we executed an in-depth biochemical characterization and substrate space mapping (with 278 prochiral ketones of an unannotated SDR (DHK from Debaryomyces hansenii and compared it with structurally and functionally characterized SDR Synechococcus elongatus. PCC 7942 FabG to delineate its industrial significance. It was observed that DHK was significantly more efficient than FabG, reducing a diverse set of ketones albeit at higher conversion rates. Comparison of the FabG structure with a homology model of DHK and a docking of substrate to both structures revealed the presence of additional flexible loops near the substrate binding site of DHK. The comparative elasticity of the cofactor and substrate binding site of FabG and DHK was experimentally substantiated using differential scanning fluorimetry. It is postulated that the loop flexibility may account for the superior catalytic efficiency of DHK although the positioning of the catalytic triad is conserved.

  16. Comunicação turística no munícipio de Cajueiro da Praia-Piauí/Brasil

    OpenAIRE

    André Riani Costa Perinotto; Brendo Rodrigues dos Santos; Maurício da Silva Santos

    2017-01-01

    The present study aimed to diagnose the touristic communication in Cajueiro da Praia/PI and, thus, identified the main medias that influence the tourist visit to this city. To do so make the bibliographic investigation about communication, marketing, tourism, internet, photography, expectation formation and client satisfaction. Questionnaires with 21 objective and subjective questions and with some sub items were applied to tourists. Concluding the quantitative step, the collected data were p...

  17. Final Pleistocene and Early Holocene at Sitio do Meio, Piauí, Brazil: Stratigraphy and comparison with Pedra Furada

    Directory of Open Access Journals (Sweden)

    Giulia Aimola

    2014-09-01

    Full Text Available English: Sitio do Meio, in southern Piaui, Brazil, is the second rock shelter presenting fully Pleistocene dates and artefacts after Pedra Furada.  Despite the anthropogenic origin of Pedra Furada artefacts has been questioned, SDM has better chances to be accepted by the scientific community because of the absence of the most relevant stone breaking agents in this kind of site, i.e. waterfalls. This paper presents a critical revision of the history of excavations (1980-2000, stratigraphy, chronology, and the archaeological content of the site (sector 2. At least 98 stone tools have been identified and described, all of them being older than 12,500 BP, i.e. belonging to the Upper Pleistocenic phase of Pedra Furada 3, as defined in the close reference site. The lithic industry of Serra Talhada phase (lower Holocene is also presented and compared with paleoindian sites of North-Eastern and Central Brazil.French:Le Sitio do meio, dans le  Piaui méridional (Brésil est le deuxième abri sous roche de la région ayant livré des dates pléistocènes en dehors du site de la Pedra Furada. L'article présente une révision critique des fouilles (1980-2000, la chronostratigraphie et le contenu archéologique du secteur 2. Une centaine d'outils lithiques sont décrits, ils sont plus anciens de 12,5 ka BP  et correspondent à la phase Pléistocène Pedra Furada 3 définie dans le site éponyme de référence. On présente aussi l' industrie lithique de la phase Serra Talhada (Holocène  ancien en la comparant aux industries paléoindiennes du Nord-Est et du centre du Brésil.

  18. Sociodemographic and environmental analysis for the occurrence of anti-Leptospira antibodies in dogs of Teresina, Piauí, Brazil.

    Science.gov (United States)

    Silva, Elís Rosélia Dutra de Freitas Siqueira; Castro, Vanessa; Mineiro, Ana Lys Bezerra Barradas; Prianti, Maria das Graças; Martins, Gustavo Henrique Chaves; Santana, Misael das Virgens; Brito, Lucas Moreira; Silva, Silvana Maria Medeiros de Sousa

    2018-05-01

    Leptospirosis is a worldwide zoonosis whose transmission is interlinked by multiple factors in the man-animal-ecosystem interface. This study aimed to evaluate the risk factors for the occurrence of anti-Leptospira antibodies in dogs in the capital Teresina (PI), and to determine their spatial distribution. Five hundred fifty-eight dog blood samples were submitted to the Microscopic Serum Agglutination (MSA) test. We applied semi-structured questionnaires to dog owners and obtained the area of residence for projection in geographical maps. Serum prevalence was 13.8%, in which the most common serovar was icterohaemorrhagiae, with 49.2%. Dogs with street access, failure to collect food bowl and low income of owners were risk factors. There was a higher number of seropositive dogs in the rainy season, with 87.1%, which is a probable risk factor for the occurrence of cases. The distribution of seropositive dogs was widely spread in the city, with predominance of cases in anthropized areas. These risk factors favor the occurrence of anti-Leptospira antibodies in dogs that are agent maintenance sources in the city and reinforce the need for epidemiological and environmental surveillance to prevent leptospirosis.

  19. Biossegurança no manejo de animais silvestres em áreas de confinamento no Estado do Piauí

    Directory of Open Access Journals (Sweden)

    Felipe José Costa Viana

    2016-02-01

    Full Text Available A biossegurança em áreas de confinamento de animais silvestres é questão fundamental para a saúde pública, sobretudo em locais onde os animais são considerados protagonistas da atração, como em parques zoológicos. Estes locais, apesar de toda segurança envolvida na contenção e manejo dos animais, ainda podem ser considerados como ponto de transmissão de zoonoses. Objetivou-se avaliar o grau de insalubridade dos funcionários e o uso de equipamentos de proteção contra patógenos de caráter zoonótico em áreas de confinamento de animais silvestres. O estudo foi realizado através da análise dos dados obtidos por meio de questionário aplicado aos trabalhadores de áreas de confinamento de animais silvestres, cujo enfoque era sobre a rotina de trabalho, manejo dos animais, histórico de saúde e o conhecimento acerca de doenças zoonóticas. As informações coletadas revelaram que, em parte, a administração do local proporciona aos funcionários uma segurança básica, fornecendo EPIs e cursos de atualização no manejo dos animais. Entretanto, a vestimenta utilizada pelos funcionários é lavada em suas próprias residências. Ainda há pontos a serem corrigidos na biossegurança nestes parques, como a construção de vestiários e uniformes próprios, com a lavagem do mesmo em um setor de lavanderia no próprio local.

  20. Comunicação turística no munícipio de Cajueiro da Praia-Piauí/Brasil

    Directory of Open Access Journals (Sweden)

    André Riani Costa Perinotto

    2017-07-01

    Full Text Available The present study aimed to diagnose the touristic communication in Cajueiro da Praia/PI and, thus, identified the main medias that influence the tourist visit to this city. To do so make the bibliographic investigation about communication, marketing, tourism, internet, photography, expectation formation and client satisfaction. Questionnaires with 21 objective and subjective questions and with some sub items were applied to tourists. Concluding the quantitative step, the collected data were placed on analysis in a tabulation made in Microsoft Excel through a dynamic table, and tables and charts were developed to find better results to the research. Thereby, it was possible to diagnose the touristic communication in Cajueiro da Praia/PI and to highlight that it is in a growing stage regarding local tourism, and it was proved that tourists search and recommend the destination personally and through medias. Similarly, was evaluated as the media and the pictures are important when they are shown for the decision to choose the tourist destination, and analyzing the effect of its use in the formation of expectations and tourist satisfaction through different medias and photographs shown when the destinations are advertised. It also analyzed the use of social media by tourists as a factor of product search, to purchase and to choose the destination in study.