Detection of phytoplasmas of temperate fruit trees.

Science.gov (United States)

Laimer, Margit

2009-01-01

Phytoplasmas are associated with hundreds of plant diseases globally. Many fruit tree phytoplasmas are transmitted by insect vectors or grafting, are considered quarantine organisms and a major economic threat to orchards. Diagnosis can be difficult, but immunochemical and molecular methods have been developed.

Mapping X-Disease Phytoplasma Resistance in Prunus virginiana

OpenAIRE

Ryan R. Lenz; Wenhao Dai

2017-01-01

Phytoplasmas such as “Candidatus Phytoplasma pruni,” the causal agent of X-disease of stone fruits, lack detailed biological analysis. This has limited the understanding of plant resistance mechanisms. Chokecherry (Prunus virginiana L.) is a promising model to be used for the plant-phytoplasma interaction due to its documented ability to resist X-disease infection. A consensus chokecherry genetic map “Cho” was developed with JoinMap 4.0 by joining two parental maps. The new map contains a com...

Palm yellows phytoplasmas and their genetic classification ...

African Journals Online (AJOL)

Palm yellows phytoplasmas have been a subject of debate because of two recent outbreaks. Firstly, a lethal yellowing-type phytoplasma disease was recorded on a number of palm species of mainly the genus Phoenix in Florida in 2008. Shortly afterwards, Sabal palmetto which has never been threatened by a ...

Use of quantitative real time PCR for a genome-wide study of AYWB phytoplasma gene expression in plant and insect hosts

DEFF Research Database (Denmark)

Makarova, Olga; MacLean, Allyson M.; Hogenhout, Saskia A.

2011-01-01

this technique for reliable gene expression quantification of phytoplasmas on a large scale. In our experimental setup, 242 genes of aster yellows phytoplasma strain witches' broom (AY-WB) were tested for differences in expression in plant and insect host environments, and were shown to be predominantly...

Chromosome sizes of phytoplasmas composing major phylogenetic groups and subgroups.

Science.gov (United States)

Marcone, C; Neimark, H; Ragozzino, A; Lauer, U; Seemüller, E

1999-09-01

ABSTRACT Chromosome sizes of 71 phytoplasmas belonging to 12 major phylogenetic groups including several of the aster yellows subgroups were estimated from electrophoretic mobilities of full-length chromosomes in pulsed-field gels. Considerable variation in genome size, from 660 to 1,130 kilobases (kb), was observed among aster yellows phytoplasmas. Chromosome size heterogeneity was also observed in the stolbur phytoplasma group (range 860 to 1,350 kb); in this group, isolate STOLF contains the largest chromosome found in a phytoplasma to date. A wide range of chromosome sizes, from 670 to 1,075 kb, was also identified in the X-disease group. The other phytoplasmas examined, which included members of the apple proliferation, Italian alfalfa witches' broom, faba bean phyllody, pigeon pea witches' broom, sugarcane white leaf, Bermuda grass white leaf, ash yellows, clover proliferation, and elm yellows groups, all have chromosomes smaller than 1 megabase, and the size ranges within each of these groups is narrower than in the aster yellows, stolbur, and X-disease groups. The smallest chromosome, approximately 530 kb, was found in two Bermuda grass white leaf phytoplasma isolates. This not only is the smallest mollicute chromosome found to date, but also is the smallest chromosome known for any cell. More than one large DNA band was observed in several phytoplasma preparations. Possible explanations for the occurrence of more than one band may be infection of the host plant by different phytoplasmas, the presence of more than one chromosome in the same organism, or the presence of large extrachromosomal DNA elements.

Deep amplicon sequencing reveals mixed phytoplasma infection within single grapevine plants

DEFF Research Database (Denmark)

Nicolaisen, Mogens; Contaldo, Nicoletta; Makarova, Olga

2011-01-01

The diversity of phytoplasmas within single plants has not yet been fully investigated. In this project, deep amplicon sequencing was used to generate 50,926 phytoplasma sequences from 11 phytoplasma-infected grapevine samples from a PCR amplicon in the 5' end of the 16S region. After clustering ...

Molecular survey of the Texas Phoenix decline phytoplasma ...

African Journals Online (AJOL)

user

Restriction fragment length polymorphisms (RFLP) analysis of the PCR-amplified 16S-23S IGS region and the gcp gene using a three restriction enzymes showed that the population of the phytoplasmas infecting S. palmetto in West Central Florida is probably homogenous. The S. palmetto phytoplasma also appeared ...

Micropropagation and maintenance of phytoplasmas in tissue culture.

Science.gov (United States)

Bertaccini, Assunta; Paltrinieri, Samanta; Martini, Marta; Tedeschi, Mara; Contaldo, Nicoletta

2013-01-01

Maintenance of phytoplasma strains in tissue culture is achievable for all strains transmitted to periwinkle (Catharanthus roseus), and also for other naturally infected plant host species. Shoots of 1-3 cm length are grown in a solid medium containing Murashige and Skoog (MS) micro- and macroelements and 0.12 mg/L benzylaminopurine. The continued presence of phytoplasmas in infected shoots of periwinkle that have been maintained in micropropagation for up to 20 years can be shown by diagnostic methods such as nested PCR tests using the 16S rDNA gene (see Chapters 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25,and 26 for phytoplasma diagnostic methods).

Phytoplasma phylogenetics based on analysis of secA and 23S rRNA gene sequences for improved resolution of candidate species of 'Candidatus Phytoplasma'.

Science.gov (United States)

Hodgetts, Jennifer; Boonham, Neil; Mumford, Rick; Harrison, Nigel; Dickinson, Matthew

2008-08-01

Phytoplasma phylogenetics has focused primarily on sequences of the non-coding 16S rRNA gene and the 16S-23S rRNA intergenic spacer region (16-23S ISR), and primers that enable amplification of these regions from all phytoplasmas by PCR are well established. In this study, primers based on the secA gene have been developed into a semi-nested PCR assay that results in a sequence of the expected size (about 480 bp) from all 34 phytoplasmas examined, including strains representative of 12 16Sr groups. Phylogenetic analysis of secA gene sequences showed similar clustering of phytoplasmas when compared with clusters resolved by similar sequence analyses of a 16-23S ISR-23S rRNA gene contig or of the 16S rRNA gene alone. The main differences between trees were in the branch lengths, which were elongated in the 16-23S ISR-23S rRNA gene tree when compared with the 16S rRNA gene tree and elongated still further in the secA gene tree, despite this being a shorter sequence. The improved resolution in the secA gene-derived phylogenetic tree resulted in the 16SrII group splitting into two distinct clusters, while phytoplasmas associated with coconut lethal yellowing-type diseases split into three distinct groups, thereby supporting past proposals that they represent different candidate species within 'Candidatus Phytoplasma'. The ability to differentiate 16Sr groups and subgroups by virtual RFLP analysis of secA gene sequences suggests that this gene may provide an informative alternative molecular marker for pathogen identification and diagnosis of phytoplasma diseases.

Molecular detection and characterization of a phytoplasma from xianlajiao chili pepper in shaanxi province, china

International Nuclear Information System (INIS)

Guo, C.M.; Lu, M.H.; Zhao, Z.L.; Hu, J.C.; Nie, W.Y.; Guo, J.W.

2017-01-01

Surveys were performed in the main Xianlajiao chili pepper-producing areas of Shaanxi Province to determine whether a phytoplasma was associated with the incidence of Arbuscular Lobular Disease (ALD). During July 2012 and 2013, 92 and 86 chili pepper plants, respectively, showing ALD-like symptoms were collected from 12 counties and the cities of Baoji, Weinan, Xianyang, and Xian. Samples from paulownia trees and plantain with symptoms of paulownia witches' broom and little leaf, respectively, located in pepper fields in Baoji city, Fengxiang county were also collected. Universal DNA primers for amplification of the phytoplasma 16S rRNA gene were used for nested PCR assays and DNA sequencing. Phytoplasma DNA was amplified from two chili pepper plants, the paulownia trees, and the plantain collected from Baoji city. The phylogenetic analysis of 16S rDNA sequences of the phytoplasmas detected in the chili pepper confirmed that these phytoplasmas are members of the 16SrI group "Candidatus Phytoplasma asteris". The results of virtual RFLP analysis and sequence homology comparison showed that the two Xianlajiao phytoplasmas have high homology with phytoplasmas 16SrI-B and 16SrI-M. Transmission electron microscopy assays revealed the presence of typical phytoplasma pleomorphic bodies in the phloem of phytoplasma-infected Xianlajiao chili pepper plants. Although our results did not establish a strong association between the presence of the phytoplasma and ALD, the simultaneous detection of a 16SrI phytoplasma in two symptomatic Xianlajiao chili peppers, the paulownia trees, and the plantain suggests a complex epidemiology related to the 16SrI phytoplasma pathogen in these new plant hosts. (author)

A phytoplasma closely related to the pigeon pea witches'-broom phytoplasma (16Sr IX) is associated with citrus huanglongbing symptoms in the state of São Paulo, Brazil.

Science.gov (United States)

Teixeira, D C; Wulff, N A; Martins, E C; Kitajima, E W; Bassanezi, R; Ayres, A J; Eveillard, S; Saillard, C; Bové, J M

2008-09-01

In February 2007, sweet orange trees with characteristic symptoms of huanglongbing (HLB) were encountered in a region of São Paulo state (SPs) hitherto free of HLB. These trees tested negative for the three liberibacter species associated with HLB. A polymerase chain reaction (PCR) product from symptomatic fruit columella DNA amplifications with universal primers fD1/rP1 was cloned and sequenced. The corresponding agent was found to have highest 16S rDNA sequence identity (99%) with the pigeon pea witches'-broom phytoplasma of group 16Sr IX. Sequences of PCR products obtained with phytoplasma 16S rDNA primer pairs fU5/rU3, fU5/P7 confirm these results. With two primers D7f2/D7r2 designed based on the 16S rDNA sequence of the cloned DNA fragment, positive amplifications were obtained from more than one hundred samples including symptomatic fruits and blotchy mottle leaves. Samples positive for phytoplasmas were negative for liberibacters, except for four samples, which were positive for both the phytoplasma and 'Candidatus Liberibacter asiaticus'. The phytoplasma was detected by electron microscopy in the sieve tubes of midribs from symptomatic leaves. These results show that a phytoplasma of group IX is associated with citrus HLB symptoms in northern, central, and southern SPs. This phytoplasma has very probably been transmitted to citrus from an external source of inoculum, but the putative insect vector is not yet known.

'Candidatus Phytoplasma solani', a novel taxon associated with stolbur- and bois noir-related diseases of plants.

Science.gov (United States)

Quaglino, Fabio; Zhao, Yan; Casati, Paola; Bulgari, Daniela; Bianco, Piero Attilio; Wei, Wei; Davis, Robert Edward

2013-08-01

Phytoplasmas classified in group 16SrXII infect a wide range of plants and are transmitted by polyphagous planthoppers of the family Cixiidae. Based on 16S rRNA gene sequence identity and biological properties, group 16SrXII encompasses several species, including 'Candidatus Phytoplasma australiense', 'Candidatus Phytoplasma japonicum' and 'Candidatus Phytoplasma fragariae'. Other group 16SrXII phytoplasma strains are associated with stolbur disease in wild and cultivated herbaceous and woody plants and with bois noir disease in grapevines (Vitis vinifera L.). Such latter strains have been informally proposed to represent a separate species, 'Candidatus Phytoplasma solani', but a formal description of this taxon has not previously been published. In the present work, stolbur disease strain STOL11 (STOL) was distinguished from reference strains of previously described species of the 'Candidatus Phytoplasma' genus based on 16S rRNA gene sequence similarity and a unique signature sequence in the 16S rRNA gene. Other stolbur- and bois noir-associated ('Ca. Phytoplasma solani') strains shared >99 % 16S rRNA gene sequence similarity with strain STOL11 and contained the signature sequence. 'Ca. Phytoplasma solani' is the only phytoplasma known to be transmitted by Hyalesthes obsoletus. Insect vectorship and molecular characteristics are consistent with the concept that diverse 'Ca. Phytoplasma solani' strains share common properties and represent an ecologically distinct gene pool. Phylogenetic analyses of 16S rRNA, tuf, secY and rplV-rpsC gene sequences supported this view and yielded congruent trees in which 'Ca. Phytoplasma solani' strains formed, within the group 16SrXII clade, a monophyletic subclade that was most closely related to, but distinct from, that of 'Ca. Phytoplasma australiense'-related strains. Based on distinct molecular and biological properties, stolbur- and bois noir-associated strains are proposed to represent a novel species level taxon, 'Ca

Molecular identification of phytoplasmas associated with some weeds in West Azarbaijan province, Iran

Directory of Open Access Journals (Sweden)

Samaneh ZIBADOOST

2016-04-01

Full Text Available During field surveys in 2013 and 2014, about 14 weed plants showing phytoplasma diseases symptoms including yellowing and witches’broom were collected and tested by polymerase chain reaction (PCR using universal primers for 16SrRNA starting by primer pairs P1/P7 in first round PCR followed by primer pair R16F2n/R16R2 in nested PCR. The detected phytoplasmas were characterized and differentiated through sequence analysis of PCR-amplified rDNA and virtual restriction fragment length polymorphism (RFLP. The phytoplasmas detected in symptomatic horseweed (Erigeron canadensis L., common madder (Rubia tinctorum L., Johnson grass (Sorghum halepense [L.] Pers. and Sophora root (Sophora alopecuroides L. were identified as members of the clover proliferation group (16SrVI group by construction of phylogenetic trees. Further analysis by virtual RFLP classified the phytoplasmas of Erigeron canadensis L. and Sorghum halepense L. in subgroup 16SrVI-A and phytoplasmas of Rubia tinctorum L. and Sophora alpecuriodes L. in subgroup 16SrVI-D. This is the first report on the occurrence of phytoplasma diseases of weeds in west Azarbaijan, Iran.

Identification of 16SrIX-C phytoplasmas in Argyranthemum frutescens in Italy

Directory of Open Access Journals (Sweden)

Luca FERRETTI

2015-04-01

Full Text Available Phytoplasmas are cell wall-less microorganisms associated with plant diseases worldwide. Many important food, vegetable and fruits crops as well as ornamental plants can be severely affected by these pathogens, with significant economic impacts. Phytoplasma diseases of ornamentals have been described worldwide in a wide range of plant genera, and 11 different 16Sr groups have been identified. In Italy, many ornamental plant species belonging to several botanical families have been found to be infected by phytoplasmas, classified into the ribosomal groups 16SrI, 16SrII, 16SrV and 16SrXII. During a survey carried out in commercial gardens in Rome, some marguerite daisy (Argyranthemum frutescens plants showing symptoms of phytoplasma-like disease, were collected and submitted to molecular analyses. Cloning and sequencing of the portion of the 16S rRNA gene followed by BLAST analysis, real and virtual restriction fragment length polymorphism anlaysis with AluI and RsaI, allowed assignment of the detected phytoplasma to the 16SrIX-C group (Picris echioides yellows, PEY.

“Candidatus Phytoplasma pyri” affects behavior of Cacopsylla pyricola (Hemiptera: Psyllidae)

Science.gov (United States)

Pear psylla, Cacopsylla pyricola (Hemiptera: Psyllidae), is a key pest of pear and is a vector of "Candidatus Phytoplasma pyri", the pathogen associated with pear decline disease. Although commercial pear trees are grafted to Phytoplasma-resistant rootstock, a recent report indicated that many C. p...

Use of a fragment of the tuf gene for phytoplasma 16Sr group/subgroup differentiation

DEFF Research Database (Denmark)

Contaldo, Nicoletta; Canel, Alessandro; Makarova, Olga

2011-01-01

The usefulness of RFLP analyses on a 435 bp fragment of the tuf gene for preliminary identification of phytoplasmas from a number of phytoplasma ribosomal groups and/or 'Candidatus. Phytoplasma' was verified. The strains employed belong to thirteen 16Sr DNA groups and 22 different subgroups...

Mapping X-Disease Phytoplasma Resistance in Prunus virginiana.

Science.gov (United States)

Lenz, Ryan R; Dai, Wenhao

2017-01-01

Phytoplasmas such as " Candidatus Phytoplasma pruni," the causal agent of X-disease of stone fruits, lack detailed biological analysis. This has limited the understanding of plant resistance mechanisms. Chokecherry ( Prunus virginiana L.) is a promising model to be used for the plant-phytoplasma interaction due to its documented ability to resist X-disease infection. A consensus chokecherry genetic map "Cho" was developed with JoinMap 4.0 by joining two parental maps. The new map contains a complete set of 16 linkage groups, spanning a genetic distance of 2,172 cM with an average marker density of 3.97 cM. Three significant quantitative trait loci (QTL) associated with X-disease resistance were identified contributing to a total of 45.9% of the phenotypic variation. This updated genetic linkage map and the identified QTL will provide the framework needed to facilitate molecular genetics, genomics, breeding, and biotechnology research concerning X-disease in chokecherry and other Prunus species.

Mapping X-Disease Phytoplasma Resistance in Prunus virginiana

Directory of Open Access Journals (Sweden)

Ryan R. Lenz

2017-11-01

Full Text Available Phytoplasmas such as “Candidatus Phytoplasma pruni,” the causal agent of X-disease of stone fruits, lack detailed biological analysis. This has limited the understanding of plant resistance mechanisms. Chokecherry (Prunus virginiana L. is a promising model to be used for the plant-phytoplasma interaction due to its documented ability to resist X-disease infection. A consensus chokecherry genetic map “Cho” was developed with JoinMap 4.0 by joining two parental maps. The new map contains a complete set of 16 linkage groups, spanning a genetic distance of 2,172 cM with an average marker density of 3.97 cM. Three significant quantitative trait loci (QTL associated with X-disease resistance were identified contributing to a total of 45.9% of the phenotypic variation. This updated genetic linkage map and the identified QTL will provide the framework needed to facilitate molecular genetics, genomics, breeding, and biotechnology research concerning X-disease in chokecherry and other Prunus species.

Detection of phytoplasma by loop-mediated isothermal amplification of DNA (LAMP).

Science.gov (United States)

Obura, E; Masiga, D; Wachira, F; Gurja, B; Khan, Z R

2011-02-01

Napier stunt phytoplasma (16SrXI and 16SrIII) in eastern Africa is a serious threat to the expansion of Napier grass (Pennisetum purpureum) farming in the region, where it is widely cultivated as fodder in zero grazing livestock systems. The grass has high potential for bio-fuel production, and has been adopted by farmers as a countermeasure to cereal stem borer Lepidoptera, since it attracts and traps the insect. Diagnosis of stunt phytoplasma have been largely by nested polymerase chain reaction (nPCR) targeting the 16S rRNA gene. However, the method is laborious, costly and technically demanding. This investigation has developed a simpler but effective phytoplasma diagnostic tool, called; loop-mediated isothermal amplification of DNA (LAMP). The assay was tested on 8 symptomatic and 8 asymptomatic plants, while its detection limit was compared to nested PCR using samples serially diluted from 3 ng/μl to 0.38 pg/μl. Molecular typing of LAMP products was determined by BsrI restriction digestion and Southern blot analysis. The assay sensitivity, positive and negative predictive values were estimated, while the specificity was tested on 11 phytoplasma groups. LAMP was specific to 5 phytoplasma groups: 16SrVI, X, XI and XVI. BsrI restriction digestion produced two predicted fragments, and there was specific binding of probe DNA to the LAMP amplicons in Southern blot analysis. The assay sensitivity was 100%, while the positive and negative predictive values were 63 and 100% respectively. LAMP was 20-fold more sensitive than nested PCR. This study validates LAMP for routine diagnosis of Napier stunt and other closely related phytoplasmas. Copyright © 2010 Elsevier B.V. All rights reserved.

Recilia banda Kramer (Hemiptera: Cicadellidae), a vector of Napier stunt phytoplasma in Kenya

Science.gov (United States)

Obura, Evans; Midega, Charles A. O.; Masiga, Daniel; Pickett, John A.; Hassan, Mohamed; Koji, Shinsaku; Khan, Zeyaur R.

2009-10-01

Napier grass ( Pennisetum purpureum) is the most important fodder crop in smallholder dairy production systems in East Africa, characterized by small zero-grazing units. It is also an important trap crop used in the management of cereal stemborers in maize in the region. However, production of Napier grass in the region is severely constrained by Napier stunt disease. The etiology of the disease is known to be a phytoplasma, 16SrXI strain. However, the putative insect vector was yet unknown. We sampled and identified five leafhopper and three planthopper species associated with Napier grass and used them as candidates in pathogen transmission experiments. Polymerase chain reaction (PCR), based on the highly conserved 16S gene, primed by P1/P6-R16F2n/R16R2 nested primer sets was used to diagnose phytoplasma on test plants and insects, before and after transmission experiments. Healthy plants were exposed for 60 days to insects that had fed on diseased plants and acquired phytoplasma. The plants were then incubated for another 30 days. Nested PCR analyses showed that 58.3% of plants exposed to Recilia banda Kramer (Hemiptera: Cicadellidae) were positive for phytoplasma and developed characteristic stunt disease symptoms while 60% of R. banda insect samples were similarly phytoplasma positive. We compared the nucleotide sequences of the phytoplasma isolated from R. banda, Napier grass on which these insects were fed, and Napier grass infected by R. banda, and found them to be virtually identical. The results confirm that R. banda transmits Napier stunt phytoplasma in western Kenya, and may be the key vector of Napier stunt disease in this region.

Identification and Molecular Characterization of a Phytoplasma Associated with Pomegranate Fasciation Disease

Directory of Open Access Journals (Sweden)

Rui GAO

2018-01-01

Full Text Available To confirm phytoplasma infection, samples of pomegranate (Punica granatum L. plants showing symptoms of fasciation were collected from an orchard located in Tai'an, Shandong Province, China. A fragment of approximately 1.2 kb was amplified with universal primers targeting the phytoplasma 16S rRNA gene from symptomatic pomegranate plants, while no fragment was obtained from healthy plants. The phytoplasma associated with the disease was designated as pomegranate fasciation (PoF. Two representative phytoplasma 16S rDNA gene sequences (PoF-Ch01 and PoF-Ch02 had 100% nucleotide sequence identity. The 16S rDNA sequence of PoF-Ch01 and PoF-Ch02 showed the highest similarity (99.6% to that of ‘P. granatum’ phytoplasma isolate AY-PG, which belong to 16SrI-B. Further phylogenetic analysis showed that PoF-Ch01 and PoF-Ch02 belonged to a cluster of 16SrI subgroup members. In silico RFLP analysis indicated that PoF-Ch01 shared the highest similarity coefficient of 0.97 with reference strains of 16SrI-B, M and N. Actual RFLP analysis of both enzymes BstUI and BfaI confirmed that of the virtual RFLP analysis. Combining these results, we concluded that PoF was a member of the ‘Candidatus Phytoplasma asteris’ group (16SrI, and has very close relationship with 16SrI-B subgroup. Keywords: Punica granatum, fasciation disease, RFLP analysis, 16SrI group

DNA barcoding for identification of 'Candidatus Phytoplasmas' using a fragment of the elongation factor Tu gene.

Directory of Open Access Journals (Sweden)

Olga Makarova

Full Text Available Phytoplasmas are bacterial phytopathogens responsible for significant losses in agricultural production worldwide. Several molecular markers are available for identification of groups or strains of phytoplasmas. However, they often cannot be used for identification of phytoplasmas from different groups simultaneously or are too long for routine diagnostics. DNA barcoding recently emerged as a convenient tool for species identification. Here, the development of a universal DNA barcode based on the elongation factor Tu (tuf gene for phytoplasma identification is reported.We designed a new set of primers and amplified a 420-444 bp fragment of tuf from all 91 phytoplasmas strains tested (16S rRNA groups -I through -VII, -IX through -XII, -XV, and -XX. Comparison of NJ trees constructed from the tuf barcode and a 1.2 kbp fragment of the 16S ribosomal gene revealed that the tuf tree is highly congruent with the 16S rRNA tree and had higher inter- and intra- group sequence divergence. Mean K2P inter-/intra- group divergences of the tuf barcode did not overlap and had approximately one order of magnitude difference for most groups, suggesting the presence of a DNA barcoding gap. The use of the tuf barcode allowed separation of main ribosomal groups and most of their subgroups. Phytoplasma tuf barcodes were deposited in the NCBI GenBank and Q-bank databases.This study demonstrates that DNA barcoding principles can be applied for identification of phytoplasmas. Our findings suggest that the tuf barcode performs as well or better than a 1.2 kbp fragment of the 16S rRNA gene and thus provides an easy procedure for phytoplasma identification. The obtained sequences were used to create a publicly available reference database that can be used by plant health services and researchers for online phytoplasma identification.

'Candidatus Phytoplasma palmicola', associated with a lethal yellowing-type disease of coconut (Cocos nucifera L.) in Mozambique.

Science.gov (United States)

Harrison, Nigel A; Davis, Robert E; Oropeza, Carlos; Helmick, Ericka E; Narváez, María; Eden-Green, Simon; Dollet, Michel; Dickinson, Matthew

2014-06-01

In this study, the taxonomic position and group classification of the phytoplasma associated with a lethal yellowing-type disease (LYD) of coconut (Cocos nucifera L.) in Mozambique were addressed. Pairwise similarity values based on alignment of nearly full-length 16S rRNA gene sequences (1530 bp) revealed that the Mozambique coconut phytoplasma (LYDM) shared 100% identity with a comparable sequence derived from a phytoplasma strain (LDN) responsible for Awka wilt disease of coconut in Nigeria, and shared 99.0-99.6% identity with 16S rRNA gene sequences from strains associated with Cape St Paul wilt (CSPW) disease of coconut in Ghana and Côte d'Ivoire. Similarity scores further determined that the 16S rRNA gene of the LYDM phytoplasma shared coconut LYDM phytoplasma strains from Mozambique as novel members of established group 16SrXXII, subgroup A (16SrXXII-A). Similarity coefficients of 0.97 were obtained for comparisons between subgroup 16SrXXII-A strains and CSPW phytoplasmas from Ghana and Côte d'Ivoire. On this basis, the CSPW phytoplasma strains were designated members of a novel subgroup, 16SrXXII-B.

Ultrastructural changes in aster yellows phytoplasma affected Limonium sinuatum Mill. plants II. Pathology of cortex parenchyma cells

Directory of Open Access Journals (Sweden)

Anna Rudzińska-Langwald

2014-01-01

Full Text Available In Limonium sinuatum Mill, plants with severe symptoms of aster yellows infection phytoplasmas were present not only in the phloem but also in some cortex parenchymas cells. These parenchyma cells were situated at some distance from the conducting bundles. The phytoplasmas were observed directly in parenchyma cells cytoplasm. The number of phytoplasmas present in each selected cell varies. The cells with a small number of phytoplasmas show little pathological changes compared with the unaffected cells of the same zone of the stem as well with the cells of healthy plants. The cells filled with a number of phytoplasmas had their protoplast very much changed. The vacuole was reduced and in the cytoplasm a reduction of the number of ribosomes was noted and regions of homogenous structure appeared. Mitochondria were moved in the direction of the tonoplast and plasma membrane. Compared to the cells unaffected by phytoplasma, the mitochondria were smaller and had an enlarged cristae internal space. The chloroplasts from affected cells had a very significant reduction in size and the tylacoids system had disappeared. The role of these changes for creating phytoplasma friendly enviroment is discused.

Phytoplasma infection in tomato is associated with re-organization of plasma membrane, ER stacks, and actin filaments in sieve elements.

Science.gov (United States)

Buxa, Stefanie V; Degola, Francesca; Polizzotto, Rachele; De Marco, Federica; Loschi, Alberto; Kogel, Karl-Heinz; di Toppi, Luigi Sanità; van Bel, Aart J E; Musetti, Rita

2015-01-01

Phytoplasmas, biotrophic wall-less prokaryotes, only reside in sieve elements of their host plants. The essentials of the intimate interaction between phytoplasmas and their hosts are poorly understood, which calls for research on potential ultrastructural modifications. We investigated modifications of the sieve-element ultrastructure induced in tomato plants by 'Candidatus Phytoplasma solani,' the pathogen associated with the stolbur disease. Phytoplasma infection induces a drastic re-organization of sieve-element substructures including changes in plasma membrane surface and distortion of the sieve-element reticulum. Observations of healthy and stolbur-diseased plants provided evidence for the emergence of structural links between sieve-element plasma membrane and phytoplasmas. One-sided actin aggregates on the phytoplasma surface also inferred a connection between phytoplasma and sieve-element cytoskeleton. Actin filaments displaced from the sieve-element mictoplasm to the surface of the phytoplasmas in infected sieve elements. Western blot analysis revealed a decrease of actin and an increase of ER-resident chaperone luminal binding protein (BiP) in midribs of phytoplasma-infected plants. Collectively, the studies provided novel insights into ultrastructural responses of host sieve elements to phloem-restricted prokaryotes.

DNA Barcoding for Identification of "Candidatus Phytoplasmas" Using a Fragment of the Elongation Factor Tu Gene

DEFF Research Database (Denmark)

Makarova, Olga; Contaldo, Nicoletta; Paltrinieri, Samanta

2012-01-01

Background Phytoplasmas are bacterial phytopathogens responsible for significant losses in agricultural production worldwide. Several molecular markers are available for identification of groups or strains of phytoplasmas. However, they often cannot be used for identification of phytoplasmas from...... different groups simultaneously or are too long for routine diagnostics. DNA barcoding recently emerged as a convenient tool for species identification. Here, the development of a universal DNA barcode based on the elongation factor Tu (tuf) gene for phytoplasma identification is reported. Methodology....../Principal Findings We designed a new set of primers and amplified a 420–444 bp fragment of tuf from all 91 phytoplasmas strains tested (16S rRNA groups -I through -VII, -IX through -XII, -XV, and -XX). Comparison of NJ trees constructed from the tuf barcode and a 1.2 kbp fragment of the 16S ribosomal gene revealed...

In-Depth Transcriptome Sequencing of Mexican Lime Trees Infected with Candidatus Phytoplasma aurantifolia.

Science.gov (United States)

Mardi, Mohsen; Karimi Farsad, Laleh; Gharechahi, Javad; Salekdeh, Ghasem Hosseini

2015-01-01

Witches' broom disease of acid lime greatly affects the production of Mexican lime in Iran. It is caused by a phytoplasma (Candidatus Phytoplasma aurantifolia). However, the molecular mechanisms that underlie phytoplasma pathogenicity and the mode of interactions with host plants are largely unknown. Here, high-throughput transcriptome sequencing was conducted to explore gene expression signatures associated with phytoplasma infection in Mexican lime trees. We assembled 78,185 unique transcript sequences (unigenes) with an average length of 530 nt. Of these, 41,805 (53.4%) were annotated against the NCBI non-redundant (nr) protein database using a BLASTx search (e-value ≤ 1e-5). When the abundances of unigenes in healthy and infected plants were compared, 2,805 transcripts showed significant differences (false discovery rate ≤ 0.001 and log2 ratio ≥ 1.5). These differentially expressed genes (DEGs) were significantly enriched in 43 KEGG metabolic and regulatory pathways. The up-regulated DEGs were mainly categorized into pathways with possible implication in plant-pathogen interaction, including cell wall biogenesis and degradation, sucrose metabolism, secondary metabolism, hormone biosynthesis and signalling, amino acid and lipid metabolism, while down-regulated DEGs were predominantly enriched in ubiquitin proteolysis and oxidative phosphorylation pathways. Our analysis provides novel insight into the molecular pathways that are deregulated during the host-pathogen interaction in Mexican lime trees infected by phytoplasma. The findings can be valuable for unravelling the molecular mechanisms of plant-phytoplasma interactions and can pave the way for engineering lime trees with resistance to witches' broom disease.

Molecular characterization of an aster yellows phytoplasma ...

African Journals Online (AJOL)

STORAGESEVER

2010-04-12

Apr 12, 2010 ... plants of the dogbane family, the Vincas are poisonous, although mildly. ... proliferation, little leaf and flower abortion. Scions from .... (1993b), in phytoplasma classification. After in silico ... diminished plant development.

Global epidemiology of phytoplasma diseases of economic importance in Southeast Europe

OpenAIRE

Mitrev, Sasa

2007-01-01

The network ‘Global epidemiology of phytoplasma diseases of economic importance in Southeast Europe’ will coordinate the efforts of plant pathologists, microbiologists and entomologists of Southeast European countries to better monitor phytoplasma strains propagation through nurseries and insect vectors, at the European scale. This will be investigated both in plants and insects using up to date molecular typing tools and real-time PCR detection technology. In addition, the network will initi...

Survey and molecular detection of phytoplasmas associated with potato in Romania and southern Russia

Science.gov (United States)

In recent years, emerging phytoplasma diseases of potato (Solanum tuberosum L.) have increasingly become important in central and eastern Europe. Accurate identification of phytoplasmas and their insect vectors is essential to developing effective management strategies for diseases caused by these p...

Detection and identification of phytoplasma DNA in symptomatic mushrooms of the genus Ramaria (O. Gomphales

Directory of Open Access Journals (Sweden)

Martín, María P.

2002-06-01

Full Text Available Using polymerase chain reaction assays with specific primers for amplifying phytoplasma 16S rDNA, the presence of phytoplasmas in Ramaria basidiomes with abnormal development has been detected for the first time in fungi. Phytoplasmas have not been detected in asymptomatic basidiomes. Sequence analyses based on parsimony and maximum likelihood place the phytoplasma in the Stolbur group.Mediante la reacci6n en cadena de la polimerasa y el uso de iniciadores específicos para la regidn 16S rDNA de fitoplasmas, se ha detectado por primera vez en hongos la presencia de estos organismos en basidiomas de Ramaria que presentaban un desarrollo anormal. El analisis filogen&ico de las secuencias por los criterios de parsimonia y de maxima verosimilitud confirman a este fitoplasma como del grupo "Stolbur".

Phytoplasma infection in tomato is associated with re-organization of plasma membrane, ER stacks, and actin filaments in sieve elements

OpenAIRE

Buxa, Stefanie V; Degola, Francesca; Polizzotto, Rachele; de Marco, Federica; Loschi, Alberto; Kogel, Karl-Heinz; di Toppi, Luigi Sanità; van Bel, Aart J. E.; Musetti, Rita

2015-01-01

Phytoplasmas, biotrophic wall-less prokaryotes, only reside in sieve elements of their host plants. The essentials of the intimate interaction between phytoplasmas and their hosts are poorly understood, which calls for research on potential ultrastructural modifications. We investigated modifications of the sieve-element ultrastructure induced in tomato plants by ‘Candidatus Phytoplasma solani,’ the pathogen associated with the stolbur disease. Phytoplasma infection induces a drastic re-organ...

Survey of Leafhopper Species in Almond Orchards Infected with Almond Witches'-Broom Phytoplasma in Lebanon

Science.gov (United States)

Hammad, Efat Abou-Fakhr; El-Mohtar, Choaa; Abou-Jawdah, Yusuf

2011-01-01

Leafhoppers (Hemiptera: Auchenorrhyncha: Cicadellidae) account for more than 80% of all “Auchenorrhynchous” vectors that transmit phytoplasmas. The leafhopper populations in two almond witches'-broom phytoplasma (AlmWB) infected sites: Tanboureet (south of Lebanon) and Bourj El Yahoudieh (north of Lebanon) were surveyed using yellow sticky traps. The survey revealed that the most abundant species was Asymmetrasca decedens, which represented 82.4% of all the leafhoppers sampled. Potential phytoplasma vectors in members of the subfamilies Aphrodinae, Deltocephalinae, and Megophthalminae were present in very low numbers including: Aphrodes makarovi, Cicadulina bipunctella, Euscelidius mundus, Fieberiella macchiae, Allygus theryi, Circulifer haematoceps, Neoaliturus transversalis, and Megophthalmus scabripennis. Allygus theryi (Horváth) (Deltocephalinae) was reported for the first time in Lebanon. Nested PCR analysis and sequencing showed that Asymmetrasca decedens, Empoasca decipiens, Fieberiella macchiae, Euscelidius mundus, Thamnottetix seclusis, Balclutha sp., Lylatina inexpectata, Allygus sp., and Annoplotettix danutae were nine potential carriers of AlmWB phytoplasma. Although the detection of phytoplasmas in an insect does not prove a definite vector relationship, the technique is useful in narrowing the search for potential vectors. The importance of this information for management of AlmWB is discussed. PMID:21864154

Ancient, recurrent phage attacks and recombination shaped dynamic sequence-variable mosaics at the root of phytoplasma genome evolution.

Science.gov (United States)

Wei, Wei; Davis, Robert E; Jomantiene, Rasa; Zhao, Yan

2008-08-19

Mobile genetic elements have impacted biological evolution across all studied organisms, but evidence for a role in evolutionary emergence of an entire phylogenetic clade has not been forthcoming. We suggest that mobile element predation played a formative role in emergence of the phytoplasma clade. Phytoplasmas are cell wall-less bacteria that cause numerous diseases in plants. Phylogenetic analyses indicate that these transkingdom parasites descended from Gram-positive walled bacteria, but events giving rise to the first phytoplasma have remained unknown. Previously we discovered a unique feature of phytoplasmal genome architecture, genes clustered in sequence-variable mosaics (SVMs), and suggested that such structures formed through recurrent, targeted attacks by mobile elements. In the present study, we discovered that cryptic prophage remnants, originating from phages in the order Caudovirales, formed SVMs and comprised exceptionally large percentages of the chromosomes of 'Candidatus Phytoplasma asteris'-related strains OYM and AYWB, occupying nearly all major nonsyntenic sections, and accounting for most of the size difference between the two genomes. The clustered phage remnants formed genomic islands exhibiting distinct DNA physical signatures, such as dinucleotide relative abundance and codon position GC values. Phytoplasma strain-specific genes identified as phage morons were located in hypervariable regions within individual SVMs, indicating that prophage remnants played important roles in generating phytoplasma genetic diversity. Because no SVM-like structures could be identified in genomes of ancestral relatives including Acholeplasma spp., we hypothesize that ancient phage attacks leading to SVM formation occurred after divergence of phytoplasmas from acholeplasmas, triggering evolution of the phytoplasma clade.

Multiplex Real-Time qPCR Assay for Simultaneous and Sensitive Detection of Phytoplasmas in Sesame Plants and Insect Vectors.

Science.gov (United States)

Ikten, Cengiz; Ustun, Rustem; Catal, Mursel; Yol, Engin; Uzun, Bulent

2016-01-01

Phyllody, a destructive and economically important disease worldwide caused by phytoplasma infections, is characterized by the abnormal development of floral structures into stunted leafy parts and contributes to serious losses in crop plants, including sesame (Sesamum indicum L.). Accurate identification, differentiation, and quantification of phyllody-causing phytoplasmas are essential for effective management of this plant disease and for selection of resistant sesame varieties. In this study, a diagnostic multiplex qPCR assay was developed using TaqMan® chemistry based on detection of the 16S ribosomal RNA gene of phytoplasmas and the 18S ribosomal gene of sesame. Phytoplasma and sesame specific primers and probes labeled with different fluorescent dyes were used for simultaneous amplification of 16SrII and 16SrIX phytoplasmas in a single tube. The multiplex real-time qPCR assay allowed accurate detection, differentiation, and quantification of 16SrII and 16SrIX groups in 109 sesame plant and 92 insect vector samples tested. The assay was found to have a detection sensitivity of 1.8 x 102 and 1.6 x 102 DNA copies for absolute quantification of 16SrII and 16SrIX group phytoplasmas, respectively. Relative quantification was effective and reliable for determination of phyllody phytoplasma DNA amounts normalized to sesame DNA in infected plant tissues. The development of this qPCR assay provides a method for the rapid measurement of infection loads to identify resistance levels of sesame genotypes against phyllody phytoplasma disease.

The major antigenic membrane protein of "Candidatus Phytoplasma asteris" selectively interacts with ATP synthase and actin of leafhopper vectors.

Directory of Open Access Journals (Sweden)

Luciana Galetto

Full Text Available Phytoplasmas, uncultivable phloem-limited phytopathogenic wall-less bacteria, represent a major threat to agriculture worldwide. They are transmitted in a persistent, propagative manner by phloem-sucking Hemipteran insects. Phytoplasma membrane proteins are in direct contact with hosts and are presumably involved in determining vector specificity. Such a role has been proposed for phytoplasma transmembrane proteins encoded by circular extrachromosomal elements, at least one of which is a plasmid. Little is known about the interactions between major phytoplasma antigenic membrane protein (Amp and insect vector proteins. The aims of our work were to identify vector proteins interacting with Amp and to investigate their role in transmission specificity. In controlled transmission experiments, four Hemipteran species were identified as vectors of "Candidatus Phytoplasma asteris", the chrysanthemum yellows phytoplasmas (CYP strain, and three others as non-vectors. Interactions between a labelled (recombinant CYP Amp and insect proteins were analysed by far Western blots and affinity chromatography. Amp interacted specifically with a few proteins from vector species only. Among Amp-binding vector proteins, actin and both the α and β subunits of ATP synthase were identified by mass spectrometry and Western blots. Immunofluorescence confocal microscopy and Western blots of plasma membrane and mitochondrial fractions confirmed the localisation of ATP synthase, generally known as a mitochondrial protein, in plasma membranes of midgut and salivary gland cells in the vector Euscelidius variegatus. The vector-specific interaction between phytoplasma Amp and insect ATP synthase is demonstrated for the first time, and this work also supports the hypothesis that host actin is involved in the internalization and intracellular motility of phytoplasmas within their vectors. Phytoplasma Amp is hypothesized to play a crucial role in insect transmission specificity.

Phytoplasma adapt to the diverse environments of their plant and insect hosts by altering gene expression

DEFF Research Database (Denmark)

Makarova, Olga; MacLean, Allyson M.; Nicolaisen, Mogens

2015-01-01

a role in host adaptation. 74 genes were up-regulated in insects and included genes involved in stress response, phospholipid synthesis, malate and pyruvate metabolism, hemolysin and transporter genes, multiple copies of thymidylate kinase, sigma factor and Zn-proteases genes. In plants, 34 genes...... encoding an immune dominant membrane protein, membrane-associated proteins, and multidrug resistance ABC-type transporters, were up-regulated. Differential regulation of gene expression thus appears to play an important role in host adaptation of phytoplasmas....

Multiplex Real-Time qPCR Assay for Simultaneous and Sensitive Detection of Phytoplasmas in Sesame Plants and Insect Vectors.

Directory of Open Access Journals (Sweden)

Cengiz Ikten

Full Text Available Phyllody, a destructive and economically important disease worldwide caused by phytoplasma infections, is characterized by the abnormal development of floral structures into stunted leafy parts and contributes to serious losses in crop plants, including sesame (Sesamum indicum L.. Accurate identification, differentiation, and quantification of phyllody-causing phytoplasmas are essential for effective management of this plant disease and for selection of resistant sesame varieties. In this study, a diagnostic multiplex qPCR assay was developed using TaqMan® chemistry based on detection of the 16S ribosomal RNA gene of phytoplasmas and the 18S ribosomal gene of sesame. Phytoplasma and sesame specific primers and probes labeled with different fluorescent dyes were used for simultaneous amplification of 16SrII and 16SrIX phytoplasmas in a single tube. The multiplex real-time qPCR assay allowed accurate detection, differentiation, and quantification of 16SrII and 16SrIX groups in 109 sesame plant and 92 insect vector samples tested. The assay was found to have a detection sensitivity of 1.8 x 102 and 1.6 x 102 DNA copies for absolute quantification of 16SrII and 16SrIX group phytoplasmas, respectively. Relative quantification was effective and reliable for determination of phyllody phytoplasma DNA amounts normalized to sesame DNA in infected plant tissues. The development of this qPCR assay provides a method for the rapid measurement of infection loads to identify resistance levels of sesame genotypes against phyllody phytoplasma disease.

Asaia symbionts interfere with infection by Flavescence dorée phytoplasma in leafhoppers

KAUST Repository

Gonella, Elena; Crotti, Elena; Mandrioli, Mauro; Daffonchio, Daniele; Alma, Alberto

2018-01-01

The transmission of microbial pathogens by insect vectors can be affected by the insect’s microbial symbionts, which may compete in colonizing organs, express antagonistic factors or activate host immune response. Acetic acid bacteria of the genus Asaia are symbionts of the leafhopper Scaphoideus titanus, which transmits Flavescence dorée phytoplasma. These bacteria could be used as control agents against the disease. Here, we experimentally investigated the interaction between different strains of Asaia and phytoplasma transmission in the laboratory by using the model leafhopper Euscelidius variegatus and the plant host Vicia faba. We found that uncultivable and low concentrations of Asaia phylotypes were associated with E. variegatus. When we supplied different Asaia strains isolated from other insects and exhibiting different phenotypes to E. variegatus orally, the bacteria stably colonized the leafhopper, reached relatively higher densities and could then be isolated from the host. We conducted transmission trials of Flavescence dorée phytoplasma with individuals colonized with three exogenous Asaia strains. When the phytoplasma became established in the bodies of E. variegatus, leafhoppers were able to transmit it to broad beans, with transmission rates ranging from 33 to 76% in different experiments. However, leafhoppers that were colonized by one of the Asaia strains producing an air–liquid interface biofilm exhibited significantly reduced phytoplasma acquisition, with infection rates at 5–28%, whereas they were 25–77% in control insects. Although the mechanisms regulating this interference remain to be elucidated, our results provide evidence of the potential use of Asaia as a biocontrol agent.

Asaia symbionts interfere with infection by Flavescence dorée phytoplasma in leafhoppers

KAUST Repository

Gonella, Elena

2018-03-20

The transmission of microbial pathogens by insect vectors can be affected by the insect’s microbial symbionts, which may compete in colonizing organs, express antagonistic factors or activate host immune response. Acetic acid bacteria of the genus Asaia are symbionts of the leafhopper Scaphoideus titanus, which transmits Flavescence dorée phytoplasma. These bacteria could be used as control agents against the disease. Here, we experimentally investigated the interaction between different strains of Asaia and phytoplasma transmission in the laboratory by using the model leafhopper Euscelidius variegatus and the plant host Vicia faba. We found that uncultivable and low concentrations of Asaia phylotypes were associated with E. variegatus. When we supplied different Asaia strains isolated from other insects and exhibiting different phenotypes to E. variegatus orally, the bacteria stably colonized the leafhopper, reached relatively higher densities and could then be isolated from the host. We conducted transmission trials of Flavescence dorée phytoplasma with individuals colonized with three exogenous Asaia strains. When the phytoplasma became established in the bodies of E. variegatus, leafhoppers were able to transmit it to broad beans, with transmission rates ranging from 33 to 76% in different experiments. However, leafhoppers that were colonized by one of the Asaia strains producing an air–liquid interface biofilm exhibited significantly reduced phytoplasma acquisition, with infection rates at 5–28%, whereas they were 25–77% in control insects. Although the mechanisms regulating this interference remain to be elucidated, our results provide evidence of the potential use of Asaia as a biocontrol agent.

In situ PCR detection of phytoplasma DNA in embryos from coconut palms with lethal yellowing disease.

Science.gov (United States)

Cordova, Ivan; Jones, Phil; Harrison, Nigel A; Oropeza, Carlos

2003-03-01

SUMMARY DNA of the lethal yellowing (LY) phytoplasma was detected in 13 of 72 embryos from fruits of four diseased Atlantic tall coconut palms by polymerase chain reaction (PCR) assays employing phytoplasma universal rRNA primer pair P1/P7, nested LY group-specific rRNA primer pair 503f/LY16Sr or LY phytoplasma-specific nonribosomal primer pair LYF1/R1. Phytoplasma distribution in sectioned tissues from six PCR positive embryos was determined by in situ PCR and digoxigenin-11-deoxy-UTP (Dig) labelling of amplification products. Dig-labeled DNA products detected by colourimetric assay were clearly evident on sections from the same three embryos investigated in detail by in situ PCRs employing primer pairs P1/P7 or LYF1/R1. Deposition of blue-green stain on sections as a result of each assay was restricted to areas of the embryos corresponding to the plumule and cells ensheathing it. By comparison, similarly treated embryo sections derived from fruits of a symptomless Atlantic tall coconut palm were consistently devoid of any stain. Presence of phytoplasma DNA in embryo tissues suggests the possible potential for seed transmission which remains to be demonstrated.

Transcriptomics-based analysis using RNA-Seq of the coconut (Cocos nucifera) leaf in response to yellow decline phytoplasma infection.

Science.gov (United States)

Nejat, Naghmeh; Cahill, David M; Vadamalai, Ganesan; Ziemann, Mark; Rookes, James; Naderali, Neda

2015-10-01

Invasive phytoplasmas wreak havoc on coconut palms worldwide, leading to high loss of income, food insecurity and extreme poverty of farmers in producing countries. Phytoplasmas as strictly biotrophic insect-transmitted bacterial pathogens instigate distinct changes in developmental processes and defence responses of the infected plants and manipulate plants to their own advantage; however, little is known about the cellular and molecular mechanisms underlying host-phytoplasma interactions. Further, phytoplasma-mediated transcriptional alterations in coconut palm genes have not yet been identified. This study evaluated the whole transcriptome profiles of naturally infected leaves of Cocos nucifera ecotype Malayan Red Dwarf in response to yellow decline phytoplasma from group 16SrXIV, using RNA-Seq technique. Transcriptomics-based analysis reported here identified genes involved in coconut innate immunity. The number of down-regulated genes in response to phytoplasma infection exceeded the number of genes up-regulated. Of the 39,873 differentially expressed unigenes, 21,860 unigenes were suppressed and 18,013 were induced following infection. Comparative analysis revealed that genes associated with defence signalling against biotic stimuli were significantly overexpressed in phytoplasma-infected leaves versus healthy coconut leaves. Genes involving cell rescue and defence, cellular transport, oxidative stress, hormone stimulus and metabolism, photosynthesis reduction, transcription and biosynthesis of secondary metabolites were differentially represented. Our transcriptome analysis unveiled a core set of genes associated with defence of coconut in response to phytoplasma attack, although several novel defence response candidate genes with unknown function have also been identified. This study constitutes valuable sequence resource for uncovering the resistance genes and/or susceptibility genes which can be used as genetic tools in disease resistance breeding.

Molecular Characterization of the 16S rRNA Gene of Phytoplasmas Detected in Two Leafhopper Species Associated with Alfalfa Plants Infected with Witches' Broom in Oman

Directory of Open Access Journals (Sweden)

A.J. Khan

2003-12-01

Full Text Available Two leafhopper species, Austroagallia avicula and Empoasca sp., were consistently found in alfalfa fields infected with witches’ broom phytoplasma (OmanAlfWB in the Al-Batinah, Dakhliya, North and South Sharqiya, Muscat, and Al-Bureimi regions of the Sultanate of Oman. Phytoplasmas from both leafhoppers were detected by specific polymerase chain reaction (PCR amplification of the 16S rRNA gene and the spacer region in direct PCR using P1/P7 primer pairs. Comparative RFLP profiles of the amplified rRNA gene and the spacer region from leafhopper phytoplasmas and from 20 phytoplasma controls yielded patterns referable to phytoplasmas belonging to the peanut witches’ broom group (16SrII group. In particular, extensive RFLP analyses with the endonucleases HpaII, Tru9I, Tsp509I, and RsaI indicated that the phytoplasmas in A. avicula and Empoasca sp. were identical but showed some differences from OmanAlfWB; however, RFLP patterns obtained with TaqI showed the OmanAlfWB and the phytoplasmas from the two leafhoppers to be identical. Direct PCR products amplified from phytoplasma leafhopper DNA using the P1/P7 primer pair were cloned and sequenced yielding 1758 bp and 1755 bp products from A. avicula and Empoasca sp. respectively; the homology of these sequences with OmanAlfWB and papaya yellow crinkle phytoplasmas was more than 98%. A phylogenetic tree based on the 16S rRNA gene and spacer region sequences from 44 phytoplasmas revealed that the phytoplasmas from the leafhoppers clustered with OmanAlfWB, papaya yellow crinkle, and gerbera phyllody phytoplasmas, all belonging to 16SrII group, but were distinct from lime witches’ broom phytoplasma, the most commonly found phytoplasma in the Sultanate of Oman.

An effector of apple proliferation phytoplasma targets TCP transcription factors-a generalized virulence strategy of phytoplasma?

Science.gov (United States)

Janik, Katrin; Mithöfer, Axel; Raffeiner, Margot; Stellmach, Hagen; Hause, Bettina; Schlink, Katja

2017-04-01

The plant pathogen Candidatus Phytoplasma mali (P. mali) is the causative agent of apple proliferation, a disease of increasing importance in apple-growing areas within Europe. Despite its economic importance, little is known about the molecular mechanisms of disease manifestation within apple trees. In this study, we identified two TCP (TEOSINTE BRANCHED/CYCLOIDEA/PROLIFERATING CELL FACTOR) transcription factors of Malus x domestica as binding partners of the P. mali SAP11-like effector ATP_00189. Phytohormone analyses revealed an effect of P. mali infection on jasmonates, salicylic acid and abscisic acid levels, showing that P. mali affects phytohormonal levels in apple trees, which is in line with the functions of the effector assumed from its binding to TCP transcription factors. To our knowledge, this is the first characterization of the molecular targets of a P. mali effector and thus provides the basis to better understand symptom development and disease progress during apple proliferation. As SAP11 homologues are found in several Phytoplasma species infecting a broad range of different plants, SAP11-like proteins seem to be key players in phytoplasmal infection. © 2016 BSPP AND JOHN WILEY & SONS LTD.

'Candidatus Phytoplasma noviguineense', a novel taxon associated with Bogia coconut syndrome and banana wilt disease on the island of New Guinea.

Science.gov (United States)

Miyazaki, Akio; Shigaki, Toshiro; Koinuma, Hiroaki; Iwabuchi, Nozomu; Rauka, Gou Bue; Kembu, Alfred; Saul, Josephine; Watanabe, Kiyoto; Nijo, Takamichi; Maejima, Kensaku; Yamaji, Yasuyuki; Namba, Shigetou

2018-01-01

Bogia coconut syndrome (BCS) is one of the lethal yellowing (LY)-type diseases associated with phytoplasma presence that are seriously threatening coconut cultivation worldwide. It has recently emerged, and is rapidly spreading in northern parts of the island of New Guinea. BCS-associated phytoplasmas collected in different regions were compared in terms of 16S rRNA gene sequences, revealing high identity among them represented by strain BCS-Bo R . Comparative analysis of the 16S rRNA gene sequences revealed that BCS-Bo R shared less than a 97.5 % similarity with other species of 'Candidatus Phytoplasma', with a maximum value of 96.08 % (with strain LY; GenBank accession no. U18747). This result indicates the necessity and propriety of a novel taxon for BCS phytoplasmas according to the recommendations of the IRPCM. Phylogenetic analysis was also conducted on 16S rRNA gene sequences, resulting in a monophyletic cluster composed of BCS-Bo R and other LY-associated phytoplasmas. Other phytoplasmas on the island of New Guinea associated with banana wilt and arecanut yellow leaf diseases showed high similarities to BCS-Bo R and were closely related to BCS phytoplasmas. Based on the uniqueness of their 16S rRNA gene sequences, a novel taxon 'Ca.Phytoplasma noviguineense' is proposed for these phytoplasmas found on the island of New Guinea, with strain BCS-Bo R (GenBank accession no. LC228755) as the reference strain. The novel taxon is described in detail, including information on the symptoms of associated diseases and additional genetic features of the secY gene and rp operon.

Phytoplasma effector SAP54 induces indeterminate leaf-like flower development in Arabidopsis plants.

Science.gov (United States)

MacLean, Allyson M; Sugio, Akiko; Makarova, Olga V; Findlay, Kim C; Grieve, Victoria M; Tóth, Réka; Nicolaisen, Mogens; Hogenhout, Saskia A

2011-10-01

Phytoplasmas are insect-transmitted bacterial plant pathogens that cause considerable damage to a diverse range of agricultural crops globally. Symptoms induced in infected plants suggest that these phytopathogens may modulate developmental processes within the plant host. We report herein that Aster Yellows phytoplasma strain Witches' Broom (AY-WB) readily infects the model plant Arabidopsis (Arabidopsis thaliana) ecotype Columbia, inducing symptoms that are characteristic of phytoplasma infection, such as the production of green leaf-like flowers (virescence and phyllody) and increased formation of stems and branches (witches' broom). We found that the majority of genes encoding secreted AY-WB proteins (SAPs), which are candidate effector proteins, are expressed in Arabidopsis and the AY-WB insect vector Macrosteles quadrilineatus (Hemiptera; Cicadellidae). To identify which of these effector proteins induce symptoms of phyllody and virescence, we individually expressed the effector genes in Arabidopsis. From this screen, we have identified a novel AY-WB effector protein, SAP54, that alters floral development, resulting in the production of leaf-like flowers that are similar to those produced by plants infected with this phytoplasma. This study offers novel insight into the effector profile of an insect-transmitted plant pathogen and reports to our knowledge the first example of a microbial pathogen effector protein that targets flower development in a host.

Unique morphological changes in plant pathogenic phytoplasma-infected petunia flowers are related to transcriptional regulation of floral homeotic genes in an organ-specific manner.

Science.gov (United States)

Himeno, Misako; Neriya, Yutaro; Minato, Nami; Miura, Chihiro; Sugawara, Kyoko; Ishii, Yoshiko; Yamaji, Yasuyuki; Kakizawa, Shigeyuki; Oshima, Kenro; Namba, Shigetou

2011-09-01

Abnormal flowers are often induced by infection of certain plant pathogens, e.g. phytoplasma, but the molecular mechanisms underlying these malformations have remained poorly understood. Here, we show that infection with OY-W phytoplasma (Candidatus Phytoplasma asteris, onion yellows phytoplasma strain, line OY-W) affects the expression of the floral homeotic genes of petunia plants in an organ-specific manner. Upon infection with OY-W phytoplasma, floral morphological changes, including conversion to leaf-like structures, were observed in sepals, petals and pistils, but not in stamens. As the expression levels of homeotic genes differ greatly between floral organs, we examined the expression levels of homeotic genes in each floral organ infected by OY-W phytoplasma, compared with healthy plants. The expression levels of several homeotic genes required for organ development, such as PFG, PhGLO1 and FBP7, were significantly downregulated by the phytoplasma infection in floral organs, except the stamens, suggesting that the unique morphological changes caused by the phytoplasma infection might result from the significant decrease in expression of some crucial homeotic genes. Moreover, the expression levels of TER, ALF and DOT genes, which are known to participate in floral meristem identity, were significantly downregulated in the phytoplasma-infected petunia meristems, implying that phytoplasma would affect an upstream signaling pathway of floral meristem identity. Our results suggest that phytoplasma infection may have complex effects on floral development, resulting in the unique phenotypes that were clearly distinct from the mutant flower phenotypes produced by the knock-out or the overexpression of certain homeotic genes. © 2011 The Authors. The Plant Journal © 2011 Blackwell Publishing Ltd.

Multiple gene analyses identify distinct “bois noir” phytoplasma genotypes in the Republic of Macedonia

Directory of Open Access Journals (Sweden)

Emilija KOSTADINOVSKA

2015-01-01

Full Text Available “Bois noir” (BN is a grapevine yellows disease, associated with phytoplasma strains related to ‘Candidatus Phytoplasma solani’, that causes severe losses to viticulture in the Euro-Mediterranean basin. Due to the complex ecological cycle of its etiological agent, BN epidemiology is only partially known, and no effective control strategies have been developed. Numerous studies have focused on molecular characterization of BN phytoplasma strains, to identify molecular markers useful to accurately describe their genetic diversity, geographic distribution and host range. In the present study, a multiple gene analysess were carried out on 16S rRNA, tuf, vmp1, and stamp genes to study the genetic variability among 18 BN phytoplasma strains detected in diverse regions of the Republic of Macedonia. Restriction fragment length polymorphism (RFLP assays showed the presence of one 16S rRNA (16SrXII-A, two tuf (tuf-type a, tuf-type b, five vmp1 (V2-TA, V3, V4, V14, V18, and three stamp (S1, S2, S3 gene patterns among the examined strains. Based on the collective RFLP patterns, seven genotypes (Mac1 to Mac7 were described as evidence for genetic heterogeneity, and highlighting their prevalence and distribution in the investigated regions. Phylogenetic analyses on vmp1 and stamp genes underlined the affiliation of Macedonian BN phytoplasma strains to clusters associated with distinct ecologies.

The linear chromosome of the plant-pathogenic mycoplasma 'Candidatus Phytoplasma mali'

Directory of Open Access Journals (Sweden)

Migdoll Alexander M

2008-06-01

Full Text Available Abstract Background Phytoplasmas are insect-transmitted, uncultivable bacterial plant pathogens that cause diseases in hundreds of economically important plants. They represent a monophyletic group within the class Mollicutes (trivial name mycoplasmas and are characterized by a small genome with a low GC content, and the lack of a firm cell wall. All mycoplasmas, including strains of 'Candidatus (Ca. Phytoplasma asteris' and 'Ca. P. australiense', examined so far have circular chromosomes, as is the case for almost all walled bacteria. Results Our work has shown that 'Ca. Phytoplasma mali', the causative agent of apple proliferation disease, has a linear chromosome. Linear chromosomes were also identified in the closely related provisional species 'Ca. P. pyri' and 'Ca. P. prunorum'. The chromosome of 'Ca. P. mali' strain AT is 601,943 bp in size and has a GC content of 21.4%. The chromosome is further characterized by large terminal inverted repeats and covalently closed hairpin ends. Analysis of the protein-coding genes revealed that glycolysis, the major energy-yielding pathway supposed for 'Ca. P. asteris', is incomplete in 'Ca. P. mali'. Due to the apparent lack of other metabolic pathways present in mycoplasmas, it is proposed that maltose and malate are utilized as carbon and energy sources. However, complete ATP-yielding pathways were not identified. 'Ca. P. mali' also differs from 'Ca. P. asteris' by a smaller genome, a lower GC content, a lower number of paralogous genes, fewer insertions of potential mobile DNA elements, and a strongly reduced number of ABC transporters for amino acids. In contrast, 'Ca. P. mali' has an extended set of genes for homologous recombination, excision repair and SOS response than 'Ca. P. asteris'. Conclusion The small linear chromosome with large terminal inverted repeats and covalently closed hairpin ends, the extremely low GC content and the limited metabolic capabilities reflect unique features of 'Ca

Endophytic bacterial community of grapevine leaves influenced by sampling date and phytoplasma infection process.

Science.gov (United States)

Bulgari, Daniela; Casati, Paola; Quaglino, Fabio; Bianco, Piero A

2014-07-21

Endophytic bacteria benefit host plant directly or indirectly, e.g. by biocontrol of the pathogens. Up to now, their interactions with the host and with other microorganisms are poorly understood. Consequently, a crucial step for improving the knowledge of those relationships is to determine if pathogens or plant growing season influence endophytic bacterial diversity and dynamic. Four healthy, four phytoplasma diseased and four recovered (symptomatic plants that spontaneously regain a healthy condition) grapevine plants were sampled monthly from June to October 2010 in a vineyard in north-western Italy. Metagenomic DNA was extracted from sterilized leaves and the endophytic bacterial community dynamic and diversity were analyzed by taxon specific real-time PCR, Length-Heterogeneity PCR and genus-specific PCR. These analyses revealed that both sampling date and phytoplasma infection influenced the endophytic bacterial composition. Interestingly, in June, when the plants are symptomless and the pathogen is undetectable (i) the endophytic bacterial community associated with diseased grapevines was different from those in the other sampling dates, when the phytoplasmas are detectable inside samples; (ii) the microbial community associated with recovered plants differs from that living inside healthy and diseased plants. Interestingly, LH-PCR database identified bacteria previously reported as biocontrol agents in the examined grapevines. Of these, Burkholderia, Methylobacterium and Pantoea dynamic was influenced by the phytoplasma infection process and seasonality. Results indicated that endophytic bacterial community composition in grapevine is correlated to both phytoplasma infection and sampling date. For the first time, data underlined that, in diseased plants, the pathogen infection process can decrease the impact of seasonality on community dynamic. Moreover, based on experimental evidences, it was reasonable to hypothesize that after recovery the restructured

Apple proliferation phytoplasma influences the pattern of plant volatiles emitted depending on pathogen virulence

Directory of Open Access Journals (Sweden)

Margit eRid

2016-01-01

Full Text Available Apple proliferation (AP and pear decline (PD are the most severe diseases in pome fruit growing areas. AP-infected trees show typical symptoms such as witches’ broom, enlarged stipules, tasteless and dwarf fruits. PD-infected pears show a progressive weakening, reduced terminal growth, smaller fruits and die within weeks (quick decline or years (slow decline. The diseases are caused by the cell-wall lacking bacteria Candidatus Phytoplasma mali (AP phytoplasma and Ca. P. pyri (PD phytoplasma, respectively. In previous studies it has been shown that AP-infected apple trees emitted higher amounts of the sesquiterpene β-caryophyllene, an attractant of the insect vector Cacopsylla picta (Hemiptera: Psyllidae, thereby facilitating the dispersal of AP phytoplasma. In the present study, volatile organic compounds (VOCs occurring in the headspace of plants infected with Ca. P. mali strains causing different severity of symptoms in apple plants were collected, analyzed and identified. Headspace samples from healthy and AP-infected model plant tobacco (Nicotiana occidentalis and apple (Malus domestica as well as from healthy and PD-infected pear (Pyrus communis were investigated via thermodesorption and GC-MS analysis. Significantly higher concentrations of ethyl benzoate were produced in all phytoplasma-infected plants compared to healthy ones and an as yet unidentified sesquiterpene differed between the odor bouquets of healthy and by Ca. P. mali infected tobacco plants. Additionally, statistically significant higher amounts of both compounds were measured in the headspace of plants infected by the virulent AP strain. In apple, significantly higher concentrations of ethyl benzoate and methyl salicylate were observed for trees infected with strains of Ca. P. mali. Ethyl benzoate was also detected in the headspace of pear trees infected with Ca. P. pyri.

Determining putative vectors of the Bogia Coconut Syndrome phytoplasma using loop-mediated isothermal amplification of single-insect feeding media

Science.gov (United States)

Lu, Hengyu; Wilson, Bree A. L.; Ash, Gavin J.; Woruba, Sharon B.; Fletcher, Murray J.; You, Minsheng; Yang, Guang; Gurr, Geoff M.

2016-01-01

Phytoplasmas are insect vectored mollicutes responsible for disease in many economically important crops. Determining which insect species are vectors of a given phytoplasma is important for managing disease but is methodologically challenging because disease-free plants need to be exposed to large numbers of insects, often over many months. A relatively new method to detect likely transmission involves molecular testing for phytoplasma DNA in sucrose solution that insects have fed upon. In this study we combined this feeding medium method with a loop-mediated isothermal amplification (LAMP) assay to study 627 insect specimens of 11 Hemiptera taxa sampled from sites in Papua New Guinea affected by Bogia coconut syndrome (BCS). The LAMP assay detected phytoplasma DNA from the feeding solution and head tissue of insects from six taxa belonging to four families: Derbidae, Lophopidae, Flatidae and Ricaniidae. Two other taxa yielded positives only from the heads and the remainder tested negative. These results demonstrate the utility of combining single-insect feeding medium tests with LAMP assays to identify putative vectors that can be the subject of transmission tests and to better understand phytoplasma pathosystems. PMID:27786249

Aster leafhopper survival and reproduction, and Aster yellows transmission under static and fluctuating temperatures, using ddPCR for phytoplasma quantification.

Science.gov (United States)

Bahar, Md H; Wist, Tyler J; Bekkaoui, Diana R; Hegedus, Dwayne D; Olivier, Chrystel Y

2018-01-10

Aster yellows (AY) is an important disease of Brassica crops and is caused by Candidatus Phytoplasma asteris and transmitted by the insect vector, Aster leafhopper (Macrosteles quadrilineatus). Phytoplasma-infected Aster leafhoppers were incubated at various constant and fluctuating temperatures ranging from 0 to 35 °C with the reproductive host plant barley (Hordium vulgare). At 0 °C, leafhopper adults survived for 18 days, but failed to reproduce, whereas at 35 °C insects died within 18 days, but successfully reproduced before dying. Temperature fluctuation increased thermal tolerance in leafhoppers at 25 °C and increased fecundity of leafhoppers at 5 and 20 °C. Leafhopper adults successfully infected and produced AY-symptoms in canola plants after incubating for 18 days at 0-20 °C on barley, indicating that AY-phytoplasma maintains its virulence in this temperature range. The presence and number of AY-phytoplasma in insects and plants were confirmed by droplet digital PCR (ddPCR) quantification. The number of phytoplasma in leafhoppers increased over time, but did not differ among temperatures. The temperatures associated with a typical crop growing season on the Canadian Prairies will not limit the spread of AY disease by their predominant insect vector. Also, ddPCR quantification is a useful tool for early detection and accurate quantification of phytoplasma in plants and insects.

Molecular Characterization of Extrachromosomal DNA Accompanying Primula Red Phytoplasma

Czech Academy of Sciences Publication Activity Database

Sarkisova, Tatiana; Lenz, Ondřej; Petrzik, Karel

2015-01-01

Roč. 163, č. 3 (2015), s. 222-226 ISSN 0931-1785 R&D Projects: GA MŠk LD12074 Institutional support: RVO:60077344 Keywords : Phylogenetic analysis * phytoplasma * rep gene * plasmid Subject RIV: EE - Microbiology, Virology Impact factor: 0.945, year: 2015

Recent advances in phytoplasma research: from genetic diversity and genome evolution to pathogenic redirection of plant stem cell fate

Science.gov (United States)

Parasitizing phloem sieve cells and being transmitted by insects, phytoplasmas are a unique group of cell wall-less bacteria responsible for numerous plant diseases worldwide. Due to difficulties in establishing axenic culture of phytoplasmas, phenotypic characters suitable for conventional microbia...

PHYTOPLASMAS IN POME FRUIT TREES: UPDATE OF THEIR PRESENCE AND THEIR VECTORS IN BELGIUM.

Science.gov (United States)

G, Peusens; K, De Jonghe; I, De Roo; S, Steyer; T, Olivier; F, Fauche; F, Rys; D, Bylemans; T, Beliën

2015-01-01

Among the numerous diseases that can attack pome fruit trees, apple proliferation and pear decline, both caused by a phytoplasma ('Candidatus Phytoplasma mali' (AP) and 'Ca. P. pyri' (PD), respectively), may result into important losses of quality and quantity of the crop. Until a few years ago, no scientific and reliable data on their presence in Belgium was available and so a 2-year survey was organised to obtain more detailed information on the status of both pathogens. Root and leaf samples collected in commercial orchards were analysed using molecular detection tools and tested positive for both phytoplasmas. Additionally, the presence and infectivity of Psyllidae, vectors of AP and PD, was assessed during this survey but no infected Cacopsylla-species were found. Lab trials revealed its vector capacity at the end of summer and autumn and its migration pattern 80 m in line and 10.5 m across trees in an orchard.

Molecular detection of ‘Candidatus Phytoplasma australasia’ and ‘Ca. P. cynodontis’ in Iraq

Directory of Open Access Journals (Sweden)

Alkuwaiti Nawres Abdulelah Sadeq

2017-10-01

Full Text Available The association of phytoplasma was investigated in symptomatic tomato (Solanum lycopersicum L., eggplant (Solanum melongen L., mallow (Malva spp. and Bermuda grass (Cynodon dactylon L. plants exhibiting witches’ broom and white leaf diseases, respectively. Total DNA was extracted from tomato (n=3, eggplant (n=2, mallow (n=2 and Bermuda grass (n=8 samples. Direct polymerase chain reaction (PCR was performed using P1/P7 primer set, then PCR products were sequenced. Sequences obtained from tomato, eggplant and mallow shared 99% maximum nucleotide identity with phytoplasma belonging to subgroup 16SrII-D, and resulted therefore ‘Candidatus Phytoplasma australasia’-related. Sequences obtained from Bermuda grass showed 100% maximum nucleotide identity to 16SrXIV-A subgroup and were ‘Ca. P. cynodontis’-related. The study presents the first molecular confirmation and sequence data of presence of ‘Ca. P. australasia’ and ‘Ca. P. cynodontis’ in Iraq.

One-step multiplex quantitative RT-PCR for the simultaneous detection of viroids and phytoplasmas of pome fruit trees.

Science.gov (United States)

Malandraki, Ioanna; Varveri, Christina; Olmos, Antonio; Vassilakos, Nikon

2015-03-01

A one-step multiplex real-time quantitative reverse transcription polymerase chain reaction (RT-qPCR) based on TaqMan chemistry was developed for the simultaneous detection of Pear blister canker viroid and Apple scar skin viroid along with universal detection of phytoplasmas, in pome trees. Total nucleic acids (TNAs) extraction was performed according to a modified CTAB protocol. Primers and TaqMan MGB probes for specific detection of the two viroids were designed in this study, whereas for phytoplasma detection published universal primers and probe were used, with the difference that the later was modified to carry a MGB quencher. The pathogens were detected simultaneously in 10-fold serial dilutions of TNAs from infected plant material into TNAs of healthy plant up to dilutions 10(-5) for viroids and 10(-4) for phytoplasmas. The multiplex real-time assay was at least 10 times more sensitive than conventional protocols for viroid and phytoplasma detection. Simultaneous detection of the three targets was achieved in composite samples at least up to a ratio of 1:100 triple-infected to healthy tissue, demonstrating that the developed assay has the potential to be used for rapid and massive screening of viroids and phytoplasmas of pome fruit trees in the frame of certification schemes and surveys. Copyright © 2014 Elsevier B.V. All rights reserved.

Real-Time PCR for Universal Phytoplasma Detection and Quantification

DEFF Research Database (Denmark)

Christensen, Nynne Meyn; Nyskjold, Henriette; Nicolaisen, Mogens

2013-01-01

Currently, the most efficient detection and precise quantification of phytoplasmas is by real-time PCR. Compared to nested PCR, this method is less sensitive to contamination and is less work intensive. Therefore, a universal real-time PCR method will be valuable in screening programs and in other...

Morphological changes of Paulownia seedlings infected phytoplasmas reveal the genes associated with witches' broom through AFLP and MSAP.

Directory of Open Access Journals (Sweden)

Xibing Cao

Full Text Available Paulownia witches' broom (PaWB caused by phytoplasma might result in devastating damage to the growth and wood production of Paulownia. To study the effect of phytoplasma on DNA sequence and to discover the genes related to PaWB occurrence, DNA polymorphisms and DNA methylation levels and patterns in PaWB seedlings, the ones treated with various concentration of methyl methane sulfonate (MMS and healthy seedlings were investigated with amplified fragment length polymorphism (AFLP and methylation-sensitive amplification polymorphism (MSAP. Our results indicated that PaWB seedlings recovered a normal morphology, similar to healthy seedlings, after treatment with more than 20 mg · L-1 MMS; Phytoplasma infection did not change the Paulownia genomic DNA sequence at AFLP level, but changed the global DNA methylation levels and patterns; Genes related to PaWB were discovered through MSAP and validated using quantitative real-time PCR (qRT-PCR. These results implied that changes of DNA methylation levels and patterns were closely related to the morphological changes of seedlings infected with phytoplasmas.

Candidatus Phytoplasma brasiliense associado ao superbrotamento do hibisco (Hibiscus rosa-sinensis L. no Estado de São Paulo Candidatus Phytoplasma brasiliense associated with hibiscus witches' broom in the State of São Paulo-Brazil

Directory of Open Access Journals (Sweden)

Eliane Gonçalves da Silva

2009-09-01

Full Text Available Plantas de hibisco com superbrotamento e definhamento seguido de morte têm sido observadas nos municípios de São Paulo, Campinas e Piracicaba. Como os sintomas são sugestivos daqueles induzidos por fitoplasmas, o presente trabalho buscou identificar o possível fitoplasma associado com a doença. Assim, 14 plantas sintomáticas de hibisco foram coletadas em Piracicaba (SP e submetidas ao PCR duplo com os primers P1/Tint-R16F2n/R2 e ao exame em microscópio eletrônico de transmissão. A identificação foi realizada por análise de RFLP com as enzimas de restrição BfaI, DraI, HaeIII, HhaI, HpaII, MboI, MseI, RsaI e TaqI. Testes de transmissão foram conduzidos com enxertia de ramos e uso de Cuscuta subinclusa. Os resultados de nested-PCR revelaram a presença consistente de fitoplasmas em todas as plantas sintomáticas e foram confirmados pela observação de corpúsculos pleomórficos no floema, através da microscopia eletrônica. A análise de RFLP mostrou que o fitoplasma encontrado em hibisco pertence ao grupo 16SrXV, o mesmo grupo do Candidatus Phytoplasma brasiliense. O fitoplasma foi transmitido de planta doente para sadia, tanto pela enxertia como pela C. subinclusa, demonstrando ser o agente do superbrotamento do hibisco.Ornamental hibiscus have been affected by shoot proliferation and decline followed by death in several cities in São Paulo State, especially São Paulo, Campinas and Piracicaba. As the symptoms are suggestives of those induced by phytoplasmas, the present work aimed to identify the possible phytoplasma associated with the disease. Fourteen symptomatic hibiscus were sampled in Piracicaba, submitted to nested-PCR with the primers P1/Tint-R16F2n/R2 and processed by transmission electron microscopy. The identification was made by RFLP analyses with the restriction enzymes BfaI, DraI, HaeIII, HhaI, HpaII, MboI, MseI, RsaI, and TaqI. Transmission assays were performed by grafting and Cuscuta subinclusa. The presence

Sharing information and collections on phytoplasmas: from QBOL to QBANK

DEFF Research Database (Denmark)

Bertaccini, Assunta; Paltrinieri, Samanta; Makarova, Olga

2011-01-01

A total of 154 phytoplasma strains from 15 ribosomal groups were employed for barcode sequences production. Besides strains in periwinkle, 36 strains in natural infected plants such as napier grass, grapevine, plum, jujube, apple, pear, spartium, pine tree, hibiscus and erigeron were employed...

Multigene Sequence Analysis of Aster Yellows Phytoplasma Associated with Primrose Yellows

Czech Academy of Sciences Publication Activity Database

Fránová, Jana; Přibylová, Jaroslava; Koloniuk, Igor; Podrábská, K.; Špak, Josef

2016-01-01

Roč. 164, č. 3 (2016), s. 166-176 ISSN 0931-1785 Institutional support: RVO:60077344 Keywords : Candidatus Phytoplasma asteris * pyrH-frr genes * Primula acaulis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.853, year: 2016

Phytoplasma protein effector SAP11 enhances insect vector reproduction by manipulating plant development and defense hormone biosynthesis

OpenAIRE

Sugio, Akiko; Kingdom, Heather N.; MacLean, Allyson M.; Grieve, Victoria M.; Hogenhout, Saskia A.

2011-01-01

Phytoplasmas are insect-transmitted phytopathogenic bacteria that can alter plant morphology and the longevity and reproduction rates and behavior of their insect vectors. There are various examples of animal and plant parasites that alter the host phenotype to attract insect vectors, but it is unclear how these parasites accomplish this. We hypothesized that phytoplasmas produce effectors that modulate specific targets in their hosts leading to the changes in plant development and insect per...

Aster Yellows Subgroup 16SrI-C Phytoplasma in Rhododendron hybridum

Czech Academy of Sciences Publication Activity Database

Přibylová, Jaroslava; Špak, Josef; Fránová, Jana

2013-01-01

Roč. 161, 7-8 (2013), s. 590-593 ISSN 0931-1785 R&D Projects: GA MŠk LD12074 Institutional support: RVO:60077344 Keywords : electron microscopy * PCR * phytoplasma Subject RIV: EE - Microbiology, Virology Impact factor: 0.921, year: 2013

Development of field-applicable tests for rapid and sensitive detection of Candidatus Phytoplasma oryzae.

Science.gov (United States)

Wambua, Lillian; Schneider, Bernd; Okwaro, Allan; Wanga, Joseph Odhiambo; Imali, Olive; Wambua, Peninah Nduku; Agutu, Lavender; Olds, Cassandra; Jones, Chris Stephen; Masiga, Daniel; Midega, Charles; Khan, Zeyaur; Jores, Joerg; Fischer, Anne

2017-10-01

Napier grass Stunt Disease (NSD) is a severe disease of Napier grass (Pennisetum purpureum) in Eastern Africa, caused by the leafhopper-transmitted bacterium Candidatus Phytoplasma oryzae. The pathogen severely impairs the growth of Napier grass, the major fodder for dairy cattle in Eastern Africa. NSD is associated with biomass losses of up to 70% of infected plants. Diagnosis of NSD is done by nested PCR targeting the phytoplasma DNA, which is difficult to perform in developing countries with little infrastructure. We report the development of an easy to use, rapid, sensitive and specific molecular assay for field diagnosis of NSD. The procedure is based on recombinase polymerase amplification and targets the imp gene encoding a pathogen-specific immunodominant membrane protein. Therefore we followed a two-step process. First we developed an isothermal DNA amplification method for real time fluorescence application and then transferred this assay to a lateral flow format. The limit of detection for both procedures was estimated to be 10 organisms. We simplified the template preparation procedure by using freshly squeezed phloem sap from Napier grass. Additionally, we developed a laboratory serological assay with the potential to be converted to a lateral flow assay. Two murine monoclonal antibodies with high affinity and specificity to the immunodominant membrane protein IMP of Candidatus Phytoplasma oryzae were generated. Both antibodies specifically reacted with the denatured or native 17 kDa IMP protein. In dot blot experiments of extracts from infected plant, phytoplasmas were detected in as little as 12,5 μg of fresh plant material. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

Endophytic bacterial community living in roots of healthy and 'Candidatus Phytoplasma mali'-infected apple (Malus domestica, Borkh.) trees.

Science.gov (United States)

Bulgari, Daniela; Bozkurt, Adem I; Casati, Paola; Cağlayan, Kadriye; Quaglino, Fabio; Bianco, Piero A

2012-11-01

'Candidatus Phytoplasma mali', the causal agent of apple proliferation (AP) disease, is a quarantine pathogen controlled by chemical treatments against insect vectors and eradication of diseased plants. In accordance with the European Community guidelines, novel strategies should be developed for sustainable management of plant diseases by using resistance inducers (e.g. endophytes). A basic point for the success of this approach is the study of endophytic bacteria associated with plants. In the present work, endophytic bacteria living in healthy and 'Ca. Phytoplasma mali'-infected apple trees were described by cultivation-dependent and independent methods. 16S rDNA sequence analysis showed the presence of the groups Proteobacteria, Acidobacteria, Bacteroidetes, Actinobacteria, Chlamydiae, and Firmicutes. In detail, library analyses underscored 24 and 17 operational taxonomic units (OTUs) in healthy and infected roots, respectively, with a dominance of Betaproteobacteria. Moreover, differences in OTUs number and in CFU/g suggested that phytoplasmas could modify the composition of endophytic bacterial communities associated with infected plants. Intriguingly, the combination of culturing methods and cloning analysis allowed the identification of endophytic bacteria (e.g. Bacillus, Pseudomonas, and Burkholderia) that have been reported as biocontrol agents. Future research will investigate the capability of these bacteria to control 'Ca. Phytoplasma mali' in order to develop sustainable approaches for managing AP.

Phytoplasma Effector SAP54 Induces Indeterminate Leaf-Like Flower Development in Arabidopsis Plants1[C][W][OA

Science.gov (United States)

MacLean, Allyson M.; Sugio, Akiko; Makarova, Olga V.; Findlay, Kim C.; Grieve, Victoria M.; Tóth, Réka; Nicolaisen, Mogens; Hogenhout, Saskia A.

2011-01-01

Phytoplasmas are insect-transmitted bacterial plant pathogens that cause considerable damage to a diverse range of agricultural crops globally. Symptoms induced in infected plants suggest that these phytopathogens may modulate developmental processes within the plant host. We report herein that Aster Yellows phytoplasma strain Witches’ Broom (AY-WB) readily infects the model plant Arabidopsis (Arabidopsis thaliana) ecotype Columbia, inducing symptoms that are characteristic of phytoplasma infection, such as the production of green leaf-like flowers (virescence and phyllody) and increased formation of stems and branches (witches’ broom). We found that the majority of genes encoding secreted AY-WB proteins (SAPs), which are candidate effector proteins, are expressed in Arabidopsis and the AY-WB insect vector Macrosteles quadrilineatus (Hemiptera; Cicadellidae). To identify which of these effector proteins induce symptoms of phyllody and virescence, we individually expressed the effector genes in Arabidopsis. From this screen, we have identified a novel AY-WB effector protein, SAP54, that alters floral development, resulting in the production of leaf-like flowers that are similar to those produced by plants infected with this phytoplasma. This study offers novel insight into the effector profile of an insect-transmitted plant pathogen and reports to our knowledge the first example of a microbial pathogen effector protein that targets flower development in a host. PMID:21849514

Occurrence of different phytoplasma infections in wild herbaceous dicots growing in vineyards affected by bois noir in Tuscany (Italy

Directory of Open Access Journals (Sweden)

Guido MARCHI

2015-12-01

Full Text Available Wild herbaceous dicotyledonous plants (dicots showing symptoms ascribable to phytoplasma disorders were found to be widely distributed in organic vineyards in central Tuscany (Italy affected by bois noir, a grapevine yellows disease caused by “Candidatus Phytoplasma solani”. In 2010 symptomatic dicots were tentatively identified to species level and the incidence of symptoms estimated in two selected vineyards in the province of Florence. Incidence ranged from 2 to 77%, and was not related to the relative abundance of hosts since very common species as well as relatively rare ones were consistently found to be symptomatic. PCR indexing and 16S rRNA sequence analyses indicated that two phytoplasmas co-existed in the vineyards: “Ca. P. solani”, infecting the root systems of 17 taxa, and a phytoplasma closely related to “Ca. P. phoenicium”, infecting 11 taxa, and occasionally co-infecting the same plant. Regardless of the high frequency of both pathogens in the vineyards, only “Ca. P. solani” could be detected in the grapevines. Population screening by means of tuf sequence analyses revealed the presence of only the tuf-b “Ca. P. solani” type both in dicot hosts and grapevine. This supports current notions of bois noir epidemiology, indicating that some infected dicots act as sources of “Ca. P. solani” inoculum whereas others are dead-end hosts. When the same specimens were screened by sequence analysis of the vmp1 gene, evidence was found that different phytoplasma genotypes may be predominant in grapevines and dicots.

Changes in carbohydrate metabolism in coconut palms infected with the lethal yellowing phytoplasma.

Science.gov (United States)

Maust, B E; Espadas, F; Talavera, C; Aguilar, M; Santamaría, J M; Oropeza, C

2003-08-01

ABSTRACT Lethal yellowing (LY), a disease caused by a phytoplasma, is the most devastating disease affecting coconut (Cocos nucifera) in Mexico. Thousands of coconut palm trees have died on the Yucatan peninsula while plantations in Central America and on the Pacific coast of Mexico are severely threatened. Polymerase chain reaction assays enable identification of incubating palm trees (stage 0+, phytoplasma detected but palm asymptomatic). With the development of LY, palm trees exhibit various visual symptoms such as premature nut fall (stage 1), inflorescence necrosis (stages 2 to 3), leaf chlorosis and senescence (stages 4 to 6), and finally palm death. However, physiological changes occur in the leaves and roots prior to onset of visual symptoms. Stomatal conductance, photosynthesis, and root respiration decreased in stages 0+ to 6. The number of active photosystem II (PSII) reaction centers decreased during stage 2, but maximum quantum use efficiency of PSII remained similar until stage 3 before declining. Sugar and starch concentrations in intermediate leaves (leaf 14) and upper leaves (leaf 4) increased from stage 0- (healthy) to stages 2 to 4, while root carbohydrate concentrations decreased rapidly from stage 0- to stage 0+ (incubating phytoplasma). Although photosynthetic rates and root carbohydrate concentrations decreased, leaf carbohydrate concentrations increased, suggesting inhibition of sugar transport in the phloem leading to stress in sink tissues and development of visual symptoms of LY.

Population genetic analysis reveals a low level of genetic diversity of 'Candidatus Phytoplasma aurantifolia' causing witches' broom disease in lime.

Science.gov (United States)

Al-Abadi, Shaikha Y; Al-Sadi, Abdullah M; Dickinson, Matthew; Al-Hammadi, Mohammed S; Al-Shariqi, Rashid; Al-Yahyai, Rashid A; Kazerooni, Elham A; Bertaccini, Assunta

2016-01-01

Witches' broom disease of lime (WBDL) is a serious phytoplasma disease of acid lime in Oman, the UAE and Iran. Despite efforts to study it, no systemic study attempted to characterize the relationship among the associated phytoplasma, ' Candidatus Phytoplasma aurantifolia', from the three countries. This study utilized sequences of the 16S rRNA, imp and secA genes to characterize 57 strains collected from Oman (38), the UAE (9) and Iran (10). Phylogenetic analysis based on the 16S rRNA gene showed that the 57 strains shared 98.5-100 % nucleotide similarity to each other and to strains of ' Ca . P. aurantifolia' available in GenBank. The level of genetic diversity was low based on the 16S rRNA (0-0.011), imp (0-0.002) and secA genes (0-0.015). The presence of low level of diversity among phytoplasma strains from Oman, the UAE and Iran can be explained by the movement of infected lime seedlings from one country to another through trading and exchange of infected plants. The study discusses implication of the findings on WBDL spread and management.

Heterogeneic dynamics of the structures of multiple gene clusters in two pathogenetically different lines originating from the same phytoplasma.

Science.gov (United States)

Arashida, Ryo; Kakizawa, Shigeyuki; Hoshi, Ayaka; Ishii, Yoshiko; Jung, Hee-Young; Kagiwada, Satoshi; Yamaji, Yasuyuki; Oshima, Kenro; Namba, Shigetou

2008-04-01

Phytoplasmas are phloem-limited plant pathogens that are transmitted by insect vectors and are associated with diseases in hundreds of plant species. Despite their small sizes, phytoplasma genomes have repeat-rich sequences, which are due to several genes that are encoded as multiple copies. These multiple genes exist in a gene cluster, the potential mobile unit (PMU). PMUs are present at several distinct regions in the phytoplasma genome. The multicopy genes encoded by PMUs (herein named mobile unit genes [MUGs]) and similar genes elsewhere in the genome (herein named fundamental genes [FUGs]) are likely to have the same function based on their annotations. In this manuscript we show evidence that MUGs and FUGs do not cluster together within the same clade. Each MUG is in a cluster with a short branch length, suggesting that MUGs are recently diverged paralogs, whereas the origin of FUGs is different from that of MUGs. We also compared the genome structures around the lplA gene in two derivative lines of the 'Candidatus Phytoplasma asteris' OY strain, the severe-symptom line W (OY-W) and the mild-symptom line M (OY-M). The gene organizations of the nucleotide sequences upstream of the lplA genes of OY-W and OY-M were dramatically different. The tra5 insertion sequence, an element of PMUs, was found only in this region in OY-W. These results suggest that transposition of entire PMUs and PMU sections has occurred frequently in the OY phytoplasma genome. The difference in the pathogenicities of OY-W and OY-M might be caused by the duplication and transposition of PMUs, followed by genome rearrangement.

Molecular characterization of phytoplasmas in lilies with fasciation in the Czech Republic

Czech Academy of Sciences Publication Activity Database

Bertaccini, A.; Fránová, Jana; Botti, S.; Tabanelli, D.

2005-01-01

Roč. 249, - (2005), s. 79-85 ISSN 0378-1097 R&D Projects: GA AV ČR(CZ) IBS5051014 Institutional research plan: CEZ:AV0Z50510513 Keywords : phytoplasma * Lilium spp. * molecular characterization Subject RIV: EE - Microbiology, Virology Impact factor: 2.057, year: 2005

Universal detection of phytoplasmas and Xylella spp. by TaqMan singleplex and multiplex real-time PCR with dual priming oligonucleotides.

Directory of Open Access Journals (Sweden)

Takao Ito

Full Text Available Phytoplasmas and Xylella spp. are bacteria that cause many economically important plant diseases worldwide. TaqMan probe-based quantitative real-time polymerase chain reaction (qPCR assays have been utilized to universally detect phytoplasmas or Xylella fastidiosa. To develop a superior universal qPCR method, we used a dual priming oligonucleotide (DPO with two annealing sites as a reverse primer to target the well-conserved bacterial 16S rDNA. The new qPCR assays universally detected various species of phytoplasmas and subspecies of X. fastidiosa as well as Xylella taiwanensis, and generally showed superior threshold cycle values when amplifying specific or non-specific products compared to current universal qPCR assays. The proposed qPCR assays were integrated to develop a multiplex qPCR assay that simultaneously detected phytoplasmas, Xylella spp., and an internal plant DNA positive control within 1 hour. This assay could detect a minimum of ten bacterial cells and was compatible with crude extractions used in the rapid screening of various plants. The amplicons were of sufficient lengths to be directly sequenced for preliminary identification, and the primers could be used in universal conventional PCR assays. Additionally, reverse DPO primers can be utilized to improve other probe-based qPCR assays.

Molecular identification of stolbur phytoplasma associated with red clover dwarf disease symptoms

Czech Academy of Sciences Publication Activity Database

Fránová, Jana; Navrátil, M.; Jakešová, H.

2009-01-01

Roč. 157, 7-8 (2009), s. 502-506 ISSN 0931-1785 R&D Projects: GA MZe QH71145 Institutional research plan: CEZ:AV0Z50510513 Keywords : Trifolium pratense * stolbur phytoplasma * PCR/RFLP * sequencing * rDNA Subject RIV: EE - Microbiology, Virology Impact factor: 0.983, year: 2009

First survey on blueberry viruses and phytoplasma in the Czech Republic

Czech Academy of Sciences Publication Activity Database

Špak, Josef; Kubelková, Darina; Přibylová, Jaroslava; Špaková, Vlastimila; Petrzik, Karel

2009-01-01

Roč. 148, July (2009), s. 48-49 ISSN 1866-590X. [International Conference on Virus and other Graft Transmissible Diseases of Fruit Crops /21./. 05.07.2009-10.07.2009, Neustadt] R&D Projects: GA MŠk OC09022 Institutional research plan: CEZ:AV0Z50510513 Keywords : Vaccinium * viruses * phytoplasma Subject RIV: EE - Microbiology, Virology

Phytoplasma PMU1 exists as linear chromosomal and circular extrachromosomal elements and has enhanced expression in insect vectors compared with plant hosts.

Science.gov (United States)

Toruño, Tania Y; Musić, Martina Seruga; Simi, Silvia; Nicolaisen, Mogens; Hogenhout, Saskia A

2010-09-01

Phytoplasmas replicate intracellularly in plants and insects and are dependent on both hosts for dissemination in nature. Phytoplasmas have small genomes lacking genes for major metabolic pathways. Nevertheless, their genomes harbour multicopy gene clusters that were named potential mobile units (PMUs). PMU1 is the largest most complete repeat among the PMUs in the genome of Aster Yellows phytoplasma strain Witches' Broom (AY-WB). PMU1 is c. 20 kb in size and contains 21 genes encoding DNA replication and predicted membrane-targeted proteins. Here we show that AY-WB has a chromosomal linear PMU1 (L-PMU1) and an extrachromosomal circular PMU1 (C-PMU1). The C-PMU1 copy number was consistently higher by in average approximately fivefold in insects compared with plants and PMU1 gene expression levels were also considerably higher in insects indicating that C-PMU1 synthesis and expression are regulated. We found that the majority of AY-WB virulence genes lie on chromosomal PMU regions that have similar gene content and organization as PMU1 providing evidence that PMUs contribute to phytoplasma host adaptation and have integrated into the AY-WB chromosome. © 2010 Blackwell Publishing Ltd.

First report of BLTVA phytoplasma in Capsicum annuum and Circulifer tenellus in Mexico

Science.gov (United States)

Pepper (Capsicum annuum) plants in Durango and Zacatecas, Mexico, in September and October, 2014, had small, chlorotic, curled leaves, plant stunting, and/or big bud symptoms characteristic of phytoplasma infection (Lee et al. 2004). Samples from symptomatic pepper fields included 33 collected near...

Phytoplasma protein effector SAP11 enhances insect vector reproduction by manipulating plant development and defense hormone biosynthesis.

Science.gov (United States)

Sugio, Akiko; Kingdom, Heather N; MacLean, Allyson M; Grieve, Victoria M; Hogenhout, Saskia A

2011-11-29

Phytoplasmas are insect-transmitted phytopathogenic bacteria that can alter plant morphology and the longevity and reproduction rates and behavior of their insect vectors. There are various examples of animal and plant parasites that alter the host phenotype to attract insect vectors, but it is unclear how these parasites accomplish this. We hypothesized that phytoplasmas produce effectors that modulate specific targets in their hosts leading to the changes in plant development and insect performance. Previously, we sequenced and mined the genome of Aster Yellows phytoplasma strain Witches' Broom (AY-WB) and identified 56 candidate effectors. Here, we report that the secreted AY-WB protein 11 (SAP11) effector modulates plant defense responses to the advantage of the AY-WB insect vector Macrosteles quadrilineatus. SAP11 binds and destabilizes Arabidopsis CINCINNATA (CIN)-related TEOSINTE BRANCHED1, CYCLOIDEA, PROLIFERATING CELL FACTORS 1 and 2 (TCP) transcription factors, which control plant development and promote the expression of lipoxygenase (LOX) genes involved in jasmonate (JA) synthesis. Both the Arabidopsis SAP11 lines and AY-WB-infected plants produce less JA on wounding. Furthermore, the AY-WB insect vector produces more offspring on AY-WB-infected plants, SAP11 transgenic lines, and plants impaired in CIN-TCP and JA synthesis. Thus, SAP11-mediated destabilization of CIN-TCPs leads to the down-regulation of LOX2 expression and JA synthesis and an increase in M. quadrilineatus progeny. Phytoplasmas are obligate inhabitants of their plant host and insect vectors, in which the latter transmits AY-WB to a diverse range of plant species. This finding demonstrates that pathogen effectors can reach beyond the pathogen-host interface to modulate a third organism in the biological interaction.

Aster leafhopper survival and reproduction, and Aster yellows transmission under static and fluctuating temperatures, using ddPCR for phytoplasma quantification

OpenAIRE

Bahar, Md H.; Wist, Tyler J.; Bekkaoui, Diana R.; Hegedus, Dwayne D.; Olivier, Chrystel Y.

2018-01-01

Aster yellows (AY) is an important disease of Brassica crops and is caused by Candidatus Phytoplasma asteris and transmitted by the insect vector, Aster leafhopper (Macrosteles quadrilineatus). Phytoplasma-infected Aster leafhoppers were incubated at various constant and fluctuating temperatures ranging from 0 to 35 °C with the reproductive host plant barley (Hordium vulgare). At 0 °C, leafhopper adults survived for 18 days, but failed to reproduce, whereas at 35 °C insects died within 18 day...

Detection and characterization of phytoplasmas infecting apple trees in Czech Republic during 2010

Czech Academy of Sciences Publication Activity Database

Fránová, Jana; Ludvíková, H.; Paprstein, F.

2011-01-01

Roč. 64, Suppl. (2011), s. 51-52 ISSN 1721-8861 R&D Projects: GA MŠk OC09021 Institutional research plan: CEZ:AV0Z50510513 Keywords : Apple proliferation phytoplasma * PCR/RFLP * Subgroups differentiation Subject RIV: EE - Microbiology, Virology Impact factor: 0.592, year: 2011

Sympatric diversification vs. immigration: deciphering host-plant specialization in a polyphagous insect, the stolbur phytoplasma vector Hyalesthes obsoletus (Cixiidae).

Science.gov (United States)

Imo, Miriam; Maixner, Michael; Johannesen, Jes

2013-04-01

The epidemiology of vector transmitted plant diseases is highly influenced by dispersal and the host-plant range of the vector. Widening the vector's host range may increase transmission potential, whereas specialization may induce specific disease cycles. The process leading to a vector's host shift and its epidemiological outcome is therefore embedded in the frameworks of sympatric evolution vs. immigration of preadapted populations. In this study, we analyse whether a host shift of the stolbur phytoplasma vector, Hyalesthes obsoletus from field bindweed to stinging nettle in its northern distribution range evolved sympatrically or by immigration. The exploitation of stinging nettle has led to outbreaks of the grapevine disease bois noir caused by a stinging nettle-specific phytoplasma strain. Microsatellite data from populations from northern and ancestral ranges provide strong evidence for sympatric host-race evolution in the northern range: Host-plant associated populations were significantly differentiated among syntopic sites (0.054 nettle-specific phytoplasma strain by plant-unspecific vectors. The evolution of host races in the northern range has led to specific vector-based bois noir disease cycles. © 2013 Blackwell Publishing Ltd.

Phytoplasmas in apricot, peach and sour cherry orchards in East Bohemia, Czech Republic

Czech Academy of Sciences Publication Activity Database

Ludvíková, H.; Fránová, Jana; Suchá, J.

2011-01-01

Roč. 64, Suppl. (2011), s. 67-68 ISSN 1721-8861 R&D Projects: GA MŠk OC09021 Institutional research plan: CEZ:AV0Z50510513 Keywords : Candidatus Phytoplasma prunorum * PCR/RFLP * apricot, peach and sour cherry orchards Subject RIV: EE - Microbiology, Virology Impact factor: 0.592, year: 2011

Fluorescence in situ hybridization for phytoplasma and endophytic bacteria localization in plant tissues.

Science.gov (United States)

Bulgari, Daniela; Casati, Paola; Faoro, Franco

2011-11-01

In the present study, we developed a rapid and efficient fluorescence in situ hybridization assay (FISH) in non-embedded tissues of the model plant Catharanthus roseus for co-localizing phytoplasmas and endophytic bacteria, opening new perspectives for studying the interaction between these microorganisms. Copyright © 2011 Elsevier B.V. All rights reserved.

Coconut lethal yellowing diseases: a phytoplasma threat to palms of global economic and social significance

Directory of Open Access Journals (Sweden)

Gurr M Geoff

2016-10-01

Full Text Available The recent discovery of Bogia Coconut Syndrome in Papua New Guinea is the first report of a lethal yellowing disease (LYD in Oceania. Numerous outbreaks of LYDs of coconut have been recorded in the Caribbean and Africa since the late 19th century and have caused the death of millions of palms across several continents during the 20th century. Despite the severity of economic losses, it was only in the 1970s that the causes of LYDs were identified as phytoplasmas, a group of insect-transmitted bacteria associated with diseases in many other economically important crop species. Since the development of polymerase chain reaction (PCR technology, knowledge of LYDs epidemiology, ecology and vectors has grown rapidly. There is no economically viable treatment for LYDs and vector-based management is hampered by the fact that vectors have been positively identified in very few cases despite many attempted transmission trials. Some varieties and hybrids of coconut palm are known to be less susceptible to LYD but none are completely resistant. Optimal and current management of LYD is through strict quarantine, prompt detection and destruction of symptomatic palms, and replanting with less susceptible varieties or crop species. Advances in technology such as loop mediated isothermal amplification (LAMP for detection and tracking of phytoplasma DNA in plants and insects, remote sensing for identifying symptomatic palms, and the advent of clustered regularly interspaced short palindromic repeats (CRISPR-based tools for gene editing and plant breeding are likely to allow rapid progress in taxonomy as well as understanding and managing LYD phytoplasma pathosystems.

Coconut Lethal Yellowing Diseases: A Phytoplasma Threat to Palms of Global Economic and Social Significance.

Science.gov (United States)

Gurr, Geoff M; Johnson, Anne C; Ash, Gavin J; Wilson, Bree A L; Ero, Mark M; Pilotti, Carmel A; Dewhurst, Charles F; You, Minsheng S

2016-01-01

The recent discovery of Bogia coconut syndrome in Papua New Guinea (PNG) is the first report of a lethal yellowing disease (LYD) in Oceania. Numerous outbreaks of LYDs of coconut have been recorded in the Caribbean and Africa since the late Nineteenth century and have caused the death of millions of palms across several continents during the Twentieth century. Despite the severity of economic losses, it was only in the 1970s that the causes of LYDs were identified as phytoplasmas, a group of insect-transmitted bacteria associated with diseases in many other economically important crop species. Since the development of polymerase chain reaction (PCR) technology, knowledge of LYDs epidemiology, ecology and vectors has grown rapidly. There is no economically viable treatment for LYDs and vector-based management is hampered by the fact that vectors have been positively identified in very few cases despite many attempted transmission trials. Some varieties and hybrids of coconut palm are known to be less susceptible to LYD but none are completely resistant. Optimal and current management of LYD is through strict quarantine, prompt detection and destruction of symptomatic palms, and replanting with less susceptible varieties or crop species. Advances in technology such as loop mediated isothermal amplification (LAMP) for detection and tracking of phytoplasma DNA in plants and insects, remote sensing for identifying symptomatic palms, and the advent of clustered regularly interspaced short palindromic repeats (CRISPR)-based tools for gene editing and plant breeding are likely to allow rapid progress in taxonomy as well as understanding and managing LYD phytoplasma pathosystems.

Coconut Lethal Yellowing Diseases: A Phytoplasma Threat to Palms of Global Economic and Social Significance

Science.gov (United States)

Gurr, Geoff M.; Johnson, Anne C.; Ash, Gavin J.; Wilson, Bree A. L.; Ero, Mark M.; Pilotti, Carmel A.; Dewhurst, Charles F.; You, Minsheng S.

2016-01-01

The recent discovery of Bogia coconut syndrome in Papua New Guinea (PNG) is the first report of a lethal yellowing disease (LYD) in Oceania. Numerous outbreaks of LYDs of coconut have been recorded in the Caribbean and Africa since the late Nineteenth century and have caused the death of millions of palms across several continents during the Twentieth century. Despite the severity of economic losses, it was only in the 1970s that the causes of LYDs were identified as phytoplasmas, a group of insect-transmitted bacteria associated with diseases in many other economically important crop species. Since the development of polymerase chain reaction (PCR) technology, knowledge of LYDs epidemiology, ecology and vectors has grown rapidly. There is no economically viable treatment for LYDs and vector-based management is hampered by the fact that vectors have been positively identified in very few cases despite many attempted transmission trials. Some varieties and hybrids of coconut palm are known to be less susceptible to LYD but none are completely resistant. Optimal and current management of LYD is through strict quarantine, prompt detection and destruction of symptomatic palms, and replanting with less susceptible varieties or crop species. Advances in technology such as loop mediated isothermal amplification (LAMP) for detection and tracking of phytoplasma DNA in plants and insects, remote sensing for identifying symptomatic palms, and the advent of clustered regularly interspaced short palindromic repeats (CRISPR)-based tools for gene editing and plant breeding are likely to allow rapid progress in taxonomy as well as understanding and managing LYD phytoplasma pathosystems. PMID:27833616

First Report of ‘Candidatus Phytoplasma trifolii’-Related Strain of 16SrVI-A Phytoplasma Subgroup, Associated with Elm Yellows Disease in American Elm ( Ulmus americana L.) in Ohio, U.S.A

Science.gov (United States)

C.E. Flower; N. Hayes-Plazolles; J.M. Slavicek; C. Rosa

2018-01-01

During the investigation of the sudden and early onset of yellowing and mortality of American elm (Ulmus americana L.) trees at the USDA Forest Service Northern Research Station in Delaware, OH, a phytoplasma of the clover proliferation group (16SrVI) was detected as the putative causal agent of the disease outbreak.

Plant-Pathogen Interaction-Related MicroRNAs and Their Targets Provide Indicators of Phytoplasma Infection in Paulownia tomentosa × Paulownia fortunei.

Directory of Open Access Journals (Sweden)

Guoqiang Fan

Full Text Available Paulownia witches' broom (PaWB caused by a phytoplasma, has caused extensive losses in the yields of paulownia timber and resulted in significant economic losses. However, the molecular mechanisms in Paulownia that underlie the phytoplasma stress are poorly characterized. In this study, we use an Illumina platform to sequence four small RNA libraries and four degradome sequencing libraries derived from healthy, PaWB-infected, and PaWB-infected 15 mg·L-1 and 30 mg·L-1 methyl methane sulfonate (MMS-treated plants. In total, 125 conserved and 118 novel microRNAs (miRNAs were identified and 33 miRNAs responsive to PaWB disease were discovered. Furthermore, 166 target genes for 18 PaWB disease-related miRNAs were obtained, and found to be involved in plant-pathogen interaction and plant hormone signal transduction metabolic pathways. Eleven miRNAs and target genes responsive to PaWB disease were examined by a quantitative real-time PCR approach. Our findings will contribute to studies on miRNAs and their targets in Paulownia, and provide new insights to further understand plant-phytoplasma interactions.

Temperature-dependent transmission of Candidatus phytoplasma asteris by the vector leafhopper Macrosteles quadripunctulatus Kirschbaum

Directory of Open Access Journals (Sweden)

F. Maggi

2014-10-01

Full Text Available A set of experiments was carried out to characterize how temperature affects the spread of chrysanthemum yellows phytoplasma (CYP, a strain of Candidatus Phytoplasma asteris, in Chrysanthemum carinatum plants transmitted by the Macrosteles quadripunctulatus leafhopper. Experiments provided data on CYP latency period in insect and plant host, M. quadripunctulatus adult mortality rate, and epidemics progression in plants under controlled conditions inside climatic chambers. Experiments were conducted at temperatures ranging between 15 and 30°C. Empirical laws for temperature-dependent epidemiological parameters were next derived and used in a dynamical model of the epidemics progression. Experiments showed that CYP epidemics was faster at higher temperatures and the model could replicate these observations with relatively high accuracy (correlation >98.03% and residuals <14.5%. The epidemics spreading rate increased linearly from 0.2 plants infected per day at 15°C to about 0.7 plants per day at 30°C, possibly due to: i faster CYP multiplication in the host plants and ii higher frequency of feeding bouts of M. quadripunctulatus at higher temperatures.

Napier grass stunt disease prevalence, incidence, severity and genetic variability of the associated phytoplasma in Uganda

DEFF Research Database (Denmark)

Kawube, Geofrey; Talwana, Herbert; Nicolaisen, Mogens

2015-01-01

The prevalence, incidence and severity of Napier grass stunt disease (NGSD) caused by phytoplasma on Pennisetum purpureum, the main fodder for livestock under intensive and semi-intensive management systems in Uganda were determined following a field survey carried out in 17 districts. A total...... of 298 Napier grass fields were visited and NGSD status visually assessed and 1192 samples collected for identification and confirmation of the phytoplasma by polymerase chain reaction (PCR) assays using universal primers P1/P6 nested with R16F2n/R16R2n and, tuf primers 890/340 nested with 835 and 400....... From these, 221 PCR products were sequenced and sequences aligned. Napier grass stunt disease is widely spread at an epidemic proportion, with the districts at different risk levels. The most affected districts are in central, East and North parts of the country while those in the west are least...

Candidatus Phytoplasma malaysianum, a novel taxon associated with virescence and phyllody of Madagascar periwinkle (Catharanthus roseus)

Science.gov (United States)

This study addressed the taxonomic position and group classification of a phytoplasma responsible for virescence and phyllody symptoms in naturally diseased Madagascar periwinkle plants in western Malaysia. Unique regions in the 16S rRNA gene from the Malaysian periwinkle virescence (MaPV) phytopla...

Biological Effects of Weak Electromagnetic Field on Healthy and Infected Lime (Citrus aurantifolia Trees with Phytoplasma

Directory of Open Access Journals (Sweden)

Fatemeh Abdollahi

2012-01-01

Full Text Available Exposure to electromagnetic fields (EMF has become an issue of concern for a great many people and is an active area of research. Phytoplasmas, also known as mycoplasma-like organisms, are wall-less prokaryotes that are pathogens of many plant species throughout the world. Effects of electromagnetic fields on the changes of lipid peroxidation, content of H2O2, proline, protein, and carbohydrates were investigated in leaves of two-year-old trees of lime (Citrus aurantifolia infected by the Candidatus Phytoplasma aurantifoliae. The healthy and infected plants were discontinuously exposed to a 10 KHz quadratic EMF with maximum power of 9 W for 5 days, each 5 h, at 25°C. Fresh and dry weight of leaves, content of MDA, proline, and protein increased in both healthy and infected plants under electromagnetic fields, compared with those of the control plants. Electromagnetic fields decreased hydrogen peroxide and carbohydrates content in both healthy and infected plants compared to those of the controls.

Phytoplasma associated with shoot proliferation in begonia Associação de fitoplasma ao superbrotamento de begônia

Directory of Open Access Journals (Sweden)

Luiz Fernando Caldeira Ribeiro

2006-10-01

Full Text Available Begonia is a very appreciated genus of ornamental plants, of economic relevancy, having species of flowers and foliage. In commercial croppings, plants exhibiting characteristic symptoms of phytoplasma infection have been observed, such as shoot proliferation, reduced plant, size small leaves and flowers, and phyllody. Leaves were sampled and total DNA was extracted to be used in nested Polymerase Chain Reaction (PCR, in order to detect and identify an expected phytoplasma. The results confirmed consistently the presence of a phytoplasma associated with symptomatic plants through the amplification of a typical genomic fragment of 1.2 kb by using the universal primers R16mF2/mR1 and R16F2n/R2. The use of specific primers R16(IIIF2/R1 allowed to identify the phytoplasma detected as a representative of the group 16SrIII. This information is very expressive, because different diseases caused by fungus, bacteria, virus and nematodes have been reported for begonia, however, reports have not been found for begonia diseases associated with phytoplasmas.Begônia é um gênero muito apreciado de plantas ornamentais, de relevância econômica, compreendendo espécies de flores e de folhagem. Em cultivo comercial foram observadas plantas apresentando sintomas característicos de infecção por fitoplasma, entre eles superbrotamento de ramos, redução no porte da planta, folhas e flores pequenas e filodia. A partir de amostras foliares foi feita extração de DNA para ser usado em duplo Polymerase Chain Reaction (PCR, visando 'a detecção de fitoplasma em tecido doente e a sua identificação ao nível de grupo de classificação. Os testes revelaram consistemente a associação de fitoplasma com os sintomas da doença, através da amplificação de um fragmento genômico típico de 1,2kb para os iniciadores universais R16mF2/mR1 e R16F2n/R2, usados na reação de PCR. O emprego de iniciadores específicos R16(IIIF2/R1 permitiu identificar o fitoplasma

Cauliflower is a new host of a subgroup 16SrVII-B phytoplasma associated with stunting disease

Science.gov (United States)

Cauliflower stunt has occurred with high levels of incidence and provoked significant yield reduction in Brazilian crops. Phytoplasmas belonging to the subgroups 16SrIII-J and 16SrXV-A were previously reported in association with the disease. In 2014, plants with typical symptoms of the disease were...

An abundant 'Candidatus Phytoplasma solani' tuf b strain is associated with grapevine, stinging nettle and Hyalesthes obsoletus.

Science.gov (United States)

Aryan, A; Brader, G; Mörtel, J; Pastar, M; Riedle-Bauer, M

2014-10-01

Bois noir (BN) associated with ' Candidatus Phytoplasma solani' (Stolbur) is regularly found in Austrian vine growing regions. Investigations between 2003 and 2008 indicated sporadic presence of the confirmed disease vector Hyalesthes obsoletus and frequent infections of bindweed and grapevine. Infections of nettles were rare. In contrast present investigations revealed a mass occurrence of H. obsoletus almost exclusively on stinging nettle. The high population densities of H. obsoletus on Urtica dioica were accompanied by frequent occurrence of ' Ca. P. solani' in nettles and planthoppers. Sequence analysis of the molecular markers secY, stamp, tuf and vmp1 of stolbur revealed a single genotype named CPsM4_At1 in stinging nettles and more than 64 and 90 % abundance in grapevine and H. obsoletus , respectively. Interestingly, this genotype showed tuf b type restriction pattern previously attributed to bindweed associated ' Ca. P. solani' strains, but a different sequence assigned as tuf b2 compared to reference tuf b strains. All other marker genes of CPsM4_At1 clustered with tuf a and nettle derived genotypes verifying distinct nettle phytoplasma genotypes. Transmission experiments with H. obsoletus and Anaceratagallia ribauti resulted in successful transmission of five different strains including the major genotype to Catharanthus roseus and in transmission of the major genotype to U. dioica . Altogether, five nettle and nine bindweed associated genotypes were described. Bindweed types were verified in 34 % of grapevine samples, in few positive Reptalus panzeri , rarely in bindweeds and occasionally in Catharanthus roseus infected by H. obsoletus or A. ribauti . ' Candidatus Phytoplasma convolvuli' (bindweed yellows) was ascertained in nettle and bindweed samples.

Grapevine yellows diseases in Spain: eight year survey of disease spread and molecular characterization of phytoplasmas involved

Directory of Open Access Journals (Sweden)

Torres, Ester

2005-12-01

Full Text Available Among grapevine yellows phytoplasma diseases in Europe, flavescence dorée (FD is the most devastating and in the last decade has reached Spanish vineyards, mainly in Catalonia. An eight-year survey was carried out in the areas where the disease has spread (Alt Empordà, Catalonia, Northern Spain and in the remaining vine-growing areas of Catalonia. Sequence analyses of a portion of the 16S-23S ribosomal DNA cistron, from selected grapevine samples from Catalonia, showed that the phytoplasmas involved in grapevine yellows belong to 16S ribosomal subgroups V-D (flavescence dorée, FD and XII-A (bois noir, BN. A set of Spanish FD isolates collected during these years were further studied by RFLP analyses of the 16S-23S ribosomal DNA fragment, as well as the rpS3 and SecY genes. All the FD phytoplasma strains studied were related to phytoplasmas belonging to ribosomal protein subgroup rp-E.La flavescencia dorada (FD es la enfermedad más agresiva de entre todas las enfermedades de fitoplasmas que causan amarilleos de vid en Europa, y que en la última década ha alcanzado también a los viñedos de España, principalmente en Cataluña. Se ha realizado un seguimiento durante ocho años en las zonas donde la enfermedad se había difundido (Alt Empordà, Cataluña y en el resto de zonas con cultivo de vid de Cataluña. El análisis del fragmento del gen DNA ribosomal 16S-23S, de una selección de muestras de vides de Cataluña, indica que los fitoplasmas que están implicados en los amarilleos de vid pertenecen a los subgrupos ribosomales 16S V-D (flavescencia dorada, FD y XII-A (bois noir, BN. Una selección de aislados españoles de FD obtenidos durante estos años se ha examinado mediante análisis RFLP del fragmento del gen ribosomal 16S-23S, y de los genes rpS3 y SecY. Todos los aislamientos de fitoplasmas FD estudiados están relacionados con fitoplasmas pertenecientes al subgrupo de proteína ribosomal rp-E.

Weedy hosts and prevalence of potential leafhopper vectors (Hemiptera: Cicadellidae) of a phytoplasma (16SrIX group) associated with Huanglongbing symptoms in citrus groves.

Science.gov (United States)

Marques, R N; Teixeira, D C; Yamamoto, P T; Lopes, J R S

2012-04-01

Huanglongbing (HLB) is a severe citrus (Citrus spp.) disease associated with the bacteria genus Candidatus Liberibacter, detected in Brazil in 2004. Another bacterium was found in association with HLB symptoms and characterized as a phytoplasma belonging to the 16SrIX group. The objectives of this study were to identify potential leafhopper vectors of the HLB-associated phytoplasma and their host plants. Leafhoppers were sampled every other week for 12 mo with sticky yellow cards placed at two heights (0.3 and 1.5 m) in the citrus tree canopy and by using a sweep net in the ground vegetation of two sweet orange, Citrus sinensis (L.) Osbeck, groves infected by the HLB-phytoplasma in São Paulo state. Faunistic analyses indicated one Agalliinae (Agallia albidula Uhler) and three Deltocephalinae [Balclutha hebe (Kirkaldy), Planicephalus flavicosta (Stål), and Scaphytopius (Convelinus) marginelineatus (Stål)] species, as the most abundant and frequent leafhoppers (Hemiptera: Cicadellidae). Visual observations indicated an association of leafhopper species with some weeds and the influence of weed species composition on leafhopper abundance in low-lying vegetation. S. marginelineatus and P. flavicosta were more frequent on Sida rhombifolia L. and Althernantera tenella Colla, respectively, whereas A. albidula was observed more often on Conyza bonariensis (L.) Cronq. and B. hebe only occurred on grasses. DNA samples of field-collected S. marginelineatus were positive by polymerase chain reaction and sequencing tests for the presence of the HLB-phytoplasma group, indicating it as a potential vector. The association of leafhoppers with their hosts may be used in deciding which management strategies to adopt against weeds and diseases in citrus orchards.

Rainfall and Coconut Accession Explain the Composition and Abundance of the Community of Potential Auchenorrhyncha Phytoplasma Vectors in Brazil.

Science.gov (United States)

Silva, Flaviana G; Passos, Eliana M; Diniz, Leandro E C; Farias, Adriano P; Teodoro, Adenir V; Fernandes, Marcelo F; Dollet, Michel

2018-04-05

Coconut plantations are attacked by the lethal yellowing (LY), which is spreading rapidly with extremely destructive effects in several countries. The disease is caused by phytoplasmas that occur in the plant phloem and are transmitted by Haplaxius crudus (Van Duzee) (Auchenorrhyncha: Cixiidae). Owing to their phloem-sap feeding habit, other planthopper species possibly act as vectors. Here, we aimed at assessing the seasonal variation in the Auchenorrhyncha community in six dwarf coconut accessions. Also, we assessed the relative contribution of biotic (coconut accession) and abiotic (rainfall, temperature) in explaining Auchenorrhyncha composition and abundance. The Auchenorrhyncha community was monthly evaluated for 1 yr using yellow sticky traps. Among the most abundant species, Oecleus sp., Balclutha sp., Deltocephalinae sp.2, Deltocephalinae sp.3, Cenchreini sp., Omolicna nigripennis Caldwell (Derbidae), and Cedusa sp. are potential phytoplasma vectors. The composition of the Auchenorrhyncha community differed between dwarf coconut accessions and periods, namely, in March and April (transition from dry to rainy season) and August (transition from rainy to dry season). In these months, Oecleus sp. was predominantly found in the accessions Cameroon Red Dwarf, Malayan Red Dwarf, and Brazilian Red Dwarf Gramame, while Cenchreini sp. and Bolbonota sp. were dominant in the accessions Brazilian Yellow Dwarf Gramame, Malayan Yellow Dwarf, and Brazilian Green Dwarf Jequi. We conclude that dwarf coconut host several Auchenorrhyncha species potential phytoplasma vectors. Furthermore, coconut accessions could be exploited in breeding programs aiming at prevention of LY. However, rainfall followed by accessions mostly explained the composition and abundance of the Auchenorrhyncha community.

Phytoplasma associated with witches´-broom disease of Ulmus minor in the Czech Republic. Electron microscopy and molecular characterization

Czech Academy of Sciences Publication Activity Database

Navrátil, M.; Šafářová, D.; Válová, P.; Fránová, Jana; Šimková, Marie

2009-01-01

Roč. 54, č. 1 (2009), s. 37-42 ISSN 0015-5632 R&D Projects: GA AV ČR(CZ) 1QS500510558 Institutional research plan: CEZ:AV0Z50510513 Keywords : Ulmus minor * Candidatus Phytoplasma ulmi * PCR * sequencing Subject RIV: EE - Microbiology, Virology Impact factor: 0.978, year: 2009

A gene expression analysis of cell wall biosynthetic genes in Malus × domestica infected by ‘Candidatus Phytoplasma mali’

Science.gov (United States)

Guerriero, Gea; Giorno, Filomena; Ciccotti, Anna Maria; Schmidt, Silvia; Baric, Sanja

2016-01-01

Apple proliferation (AP) represents a serious threat to several fruit-growing areas and is responsible for great economic losses. Several studies have highlighted the key role played by the cell wall in response to pathogen attack. The existence of a cell wall integrity signaling pathway which senses perturbations in the cell wall architecture upon abiotic/biotic stresses and activates specific defence responses has been widely demonstrated in plants. More recently a role played by cell wall-related genes has also been reported in plants infected by phytoplasmas. With the aim of shedding light on the cell wall response to AP disease in the economically relevant fruit-tree Malus × domestica Borkh., we investigated the expression of the cellulose (CesA) and callose synthase (CalS) genes in different organs (i.e., leaves, roots and branch phloem) of healthy and infected symptomatic outdoor-grown trees, sampled over the course of two time points (i.e., spring and autumn 2011), as well as in in vitro micropropagated control and infected plantlets. A strong up-regulation in the expression of cell wall biosynthetic genes was recorded in roots from infected trees. Secondary cell wall CesAs showed up-regulation in the phloem tissue from branches of infected plants, while either a down-regulation of some genes or no major changes were observed in the leaves. Micropropagated plantlets also showed an increase in cell wall-related genes and constitute a useful system for a general assessment of gene expression analysis upon phytoplasma infection. Finally, we also report the presence of several ‘knot’-like structures along the roots of infected apple trees and discuss the occurrence of this interesting phenotype in relation to the gene expression results and the modalities of phytoplasma diffusion. PMID:23086810

A Rapid Protocol of Crude RNA/DNA Extraction for RT-qPCR Detection and Quantification of 'Candidatus Phytoplasma prunorum'.

Science.gov (United States)

Minguzzi, Stefano; Terlizzi, Federica; Lanzoni, Chiara; Poggi Pollini, Carlo; Ratti, Claudio

2016-01-01

Many efforts have been made to develop a rapid and sensitive method for phytoplasma and virus detection. Taking our cue from previous works, different rapid sample preparation methods have been tested and applied to Candidatus Phytoplasma prunorum ('Ca. P. prunorum') detection by RT-qPCR. A duplex RT-qPCR has been optimized using the crude sap as a template to simultaneously amplify a fragment of 16S rRNA of the pathogen and 18S rRNA of the host plant. The specific plant 18S rRNA internal control allows comparison and relative quantification of samples. A comparison between DNA and RNA contribution to qPCR detection is provided, showing higher contribution of the latter. The method presented here has been validated on more than a hundred samples of apricot, plum and peach trees. Since 2013, this method has been successfully applied to monitor 'Ca. P. prunorum' infections in field and nursery. A triplex RT-qPCR assay has also been optimized to simultaneously detect 'Ca. P. prunorum' and Plum pox virus (PPV) in Prunus.

‘Candidatus Phytoplasma palmicola’, a novel taxon associated with a lethal yellowing-type disease (LYD) of coconut (Cocos nucifera L.) in Mozambique

Science.gov (United States)

In this study, the taxonomic position and group classification of the phytoplasma associated with a lethal yellowing-type disease (LYD) of coconut (Cocos nucifera L.) in Mozambique were addressed. Pairwise sequence similarity values based on alignment of near full-length 16SrRNA genes (1530 bp) reve...

Evidência molecular da ocorrência de um fitoplasma associado ao lenho mole da macieira Molecular evidence for an association of a phytoplasma with apple rubbery wood

Directory of Open Access Journals (Sweden)

Luiz Fernando Caldeira Ribeiro

2007-03-01

Full Text Available O lenho mole da macieira é uma doença relevante em diversas partes do mundo. Sintomas típicos desta doença têm sido observados em pomares instalados em estados do sul do território brasileiro desde a década de oitenta. Enxertia tem revelado a natureza infecciosa da doença e a observação de corpúsculos filamentosos no floema tem evidenciado possível associação com fitoplasma. No presente trabalho plantas com sintomas de lenho mole foram coletadas em pomar comercial, visando demonstrar a presença de fitoplasma em tecido doente, bem como identificar molecularmente este fitoplasma. Através do emprego de duplo PCR com iniciadores universais R16mF2/R1 e R16F2n/R2, fitoplasma foi consistentemente detectado em plantas sintomáticas. A identificação conduzida com duplo PCR usando-se iniciadores específicos R16(IIIF2/R demonstrou que o fitoplasma detectado pertencia ao grupo 16SrIII. Análises de RFLP conduzidas com as endonucleases AluI, KpnI, HinfI, HpaII, MseI, RsaI e SauIIIA confirmaram que o fitoplasma era um representante típico do grupo 16SrIII. A detecção e identificação molecular se constitui numa forte evidência que um fitoplasma está associado ao lenho mole da macieira no Brasil, complementando os trabalhos realizados anteriormente com transmissão por enxertia e observação por microscopia eletrônica .Apple rubbery wood is an important disease occurring worldwide. Typical symptoms have been observed since 80' decade in orchards located in the South part of Brazil. In previous studies, grafting has evidenciated that the disease had infeccious etiology and visualization of filamentous bodies inside phloem had indicated that a phytoplasma could be associated with the disease. In the present study, plants with symptoms of rubbery wood were sampled in a commercial orchard in order to demonstrate the presence of phytoplasma in infected tissue and to identify molecularly that the organism. Using nested PCR with universal

Characterization and molecular differentiation of 16SrI-E and 16SrIX-E phytoplasmas associated with blueberry stunt disease in New Jersey

Science.gov (United States)

A nested PCR assay was employed to detect the presence of phytoplasmas associated with 127 symptomatic blueberry plants collected during the 2010 and 2011 growing seasons from 11 commercial farms predominantly located in two major blueberry-growing counties in New Jersey, USA. Ninety plants exhibit...

Genetic variability of Brazilian phytoplasma and spiroplasma isolated from maize plants Variabilidade genética de fitoplasma e espiroplasma isolados de plantas de milho no Brasil

Directory of Open Access Journals (Sweden)

Eliane Aparecida Gomes

2004-01-01

Full Text Available The objective of this work was to characterize the genetic variability of phytoplasma and Spiroplasma kunkelii isolated from maize plants showing symptoms of stunt collected from different Brazilian geographic regions. A DNA fragment of 500 base pairs (bp was amplified from the spiralin gene in S. kunkelii and one fragment of 1,200 bp was generated from 16S rDNA gene in phytoplasma. The partial sequences of the spiralin gene showed similarity of 98% among the isolates of S. kunkelii analyzed. These sequences were compared with the sequence of the spiralin gene from other Spiroplasma species deposited in the GenBank, resulting in a similarity varying from 76.9% to 88.1%. The 16S rDNA sequence from the phytoplasma were completely similar within the Brazilian isolates and showed up to 98% of the similarity with sequences already found from other phytoplasmas. A very narrow genetic variability was detected by these gene fragments within phytoplasma and Spiroplasma analyzed. However, other genomic regions with higher polymorphic levels shall be identified in order to better evaluate the genetic diversity within these microorganisms population.O objetivo deste trabalho foi caracterizar a variabilidade genética de isolados de fitoplasma e de Spiroplasma kunkelii obtidos de plantas de milho, apresentando sintomas de enfezamento, coletados em diferentes regiões do Brasil. Um fragmento de 500 pares de bases (pb do gene que codifica a espiralina de S. kunkelii foi amplificado e um produto de amplificação de 1.200 pb foi gerado a partir do gene 16S rDNA de fitoplasma. As seqüências parciais do gene da espiralina mostraram similaridade de 98% entre os isolados de S. kunkelii analisados. Essas seqüências foram comparadas com a seqüência do gene da espiralina de outras espécies de Spiroplasma depositadas no GenBank, resultando em similaridade variável entre 76,9% e 88,1%. As seqüências do gene 16S rDNA dos isolados de fitoplasma foram

Characterization of Direct Current-Electrical Penetration Graph Waveforms and Correlation With the Probing Behavior of Matsumuratettix hiroglyphicus (Hemiptera: Cicadellidae), the Insect Vector of Sugarcane White Leaf Phytoplasma.

Science.gov (United States)

Roddee, J; Kobori, Y; Yorozuya, H; Hanboonsong, Y

2017-06-01

The leafhopper Matsumuratettix hiroglyphicus (Matsumura) (Hemiptera: Cicadellidae) is an important vector of phytoplasma causing white leaf disease in sugarcane. Thus, the aim of our study was to understand and describe the stylet-probing activities of this vector while feeding on sugarcane plants, by using direct current (DC) electrical penetration graph (EPG) monitoring. The EPG signals were classified into six distinct waveforms, according to amplitude, frequency, voltage level, and electrical origin of the observed traces during stylet penetration into the host plant tissues (probing). These six EPG waveforms of probing behavior comprise no stylet penetration (NP); stylet pathway through epidermis, mesophyll, and parenchymal cells (waveform A); contact at the bundle sheath layer (waveform B); salivation into phloem sieve elements (waveform C); phloem sap ingestion (waveform D); and short ingestion time of xylem sap (waveform E). The above waveform patterns were correlated with histological data of salivary sheath termini in plant tissue generated from insect stylet tips. The key findings of this study were that M. hiroglyphicus ingests the phloem sap at a relatively higher rate and for longer duration from any other cell type, suggesting that M. hiroglyphicus is mainly a phloem-feeder. Quantitative comparison of probing behavior revealed that females typically probe more frequently and longer in the phloem than males. Thus, females may acquire and inoculate greater amounts of phytoplasma than males, enhancing the efficiency of phytoplasma transmission and potentially exacerbating disease spreading. Overall, our study provides basic information on the probing behavior and transmission mechanism of M. hiroglyphicus. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Involvement of plasma membrane peroxidases and oxylipin pathway in the recovery from phytoplasma disease in apple (Malus domestica).

Science.gov (United States)

Patui, Sonia; Bertolini, Alberto; Clincon, Luisa; Ermacora, Paolo; Braidot, Enrico; Vianello, Angelo; Zancani, Marco

2013-06-01

Apple trees (Malus domestica Borkh.) may be affected by apple proliferation (AP), caused by 'Candidatus Phytoplasma mali'. Some plants can spontaneously recover from the disease, which implies the disappearance of symptoms through a phenomenon known as recovery. In this article it is shown that NAD(P)H peroxidases of leaf plasma membrane-enriched fractions exhibited a higher activity in samples from both AP-diseased and recovered plants. In addition, an increase in endogenous SA was characteristic of the symptomatic plants, since its content increased in samples obtained from diseased apple trees. In agreement, phenylalanine ammonia lyase (PAL) activity, a key enzyme of the phenylpropanoid pathway, was increased too. Jasmonic acid (JA) increased only during recovery, in a phase subsequent to the pathological state, and in concomitance to a decline of salicylic acid (SA). Oxylipin pathway, responsible for JA synthesis, was not induced during the development of AP-disease, but it appeared to be stimulated when the recovery occurred. Accordingly, lipoxygenase (LOX) activity, detected in plasma membrane-enriched fractions, showed an increase in apple leaves obtained from recovered plants. This enhancement was paralleled by an increase of hydroperoxide lyase (HPL) activity, detected in leaf microsomes, albeit the latter enzyme was activated in either the disease or recovery conditions. Hence, a reciprocal antagonism between SA- and JA-pathways could be suggested as an effective mechanism by which apple plants react to phytoplasma invasions, thereby providing a suitable defense response leading to the establishment of the recovery phenomenon. Copyright © Physiologia Plantarum 2012.

Genetic Variability of Stolbur Phytoplasma in Hyalesthes obsoletus (Hemiptera: Cixiidae) and its Main Host Plants in Vineyard Agroecosystems.

Science.gov (United States)

Landi, Lucia; Riolo, Paola; Murolo, Sergio; Romanazzi, Gianfranco; Nardi, Sandro; Isidoro, Nunzio

2015-08-01

Bois noir is an economically important grapevine yellows that is induced by 'Candidatus Phytoplasma solani' and principally vectored by the planthopper Hyalesthes obsoletus Signoret (Hemiptera: Cixiidae). This study explores the 'Ca. P. solani' genetic variability associated to the nettle-H. obsoletus and bindweed-H. obsoletus systems in vineyard agroecosystems of the central-eastern Italy. Molecular characterization of 'Ca. P. solani' isolates was carried out using polymerase chain reaction/restriction fragment length polymorphism to investigate the nonribosomal vmp1 gene. Seven phytoplasma vmp-types were detected among the host plants- and insect-associated field-collected samples. The vmp1 gene showed the highest polymorphism in the bindweed-H. obsoletus system, according to restriction fragment length polymorphism analysis, which is in agreement with nucleotide sequence analysis. Five vmp-types were associated with H. obsoletus from bindweed, of which one was solely restricted to planthoppers, with one genotype also in planthoppers from nettle. Type V12 was the most prevalent in both planthoppers and bindweed. H. obsoletus from nettle harbored three vmp-types, of which V3 was predominant. V3 was the only type detected for nettle. Our data demonstrate that planthoppers might have acquired some 'Ca. P. solani' profiles from other plant hosts before landing on nettle or bindweed. Overall, the different vmp1 gene rearrangements observed in these two plant hosts-H. obsoletus systems might represent different adaptations of the pathogen to the two host plants. Molecular information about the complex of vmp-types provides useful data for better understanding of Bois noir epidemiology in vineyard agroecosystem. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Identidade molecular dos fitoplasmas associados aos enfezamentos do tomateiro e da berinjela com base na análise do gene 16S rDNA Molecular identity of the phytoplasma associated to stunting of tomato and eggplant on the basis of analyses of the 16S rDNA

Directory of Open Access Journals (Sweden)

Ana Paula de Oliveira Amaral Mello

2007-09-01

Full Text Available Doenças de hortaliças de ocorrência no território brasileiro e em outras áreas do mundo têm sido associadas a diversos fitoplasmas. Na região de Piracicaba-SP e Bragança Paulista-SP, em plantas de tomate e berinjela foram observados sintomas típicos de enfezamento caracterizados por porte reduzido, clorose foliar, superbrotamento de ramos, desenvolvimento anormal do cálice, encurtamento de entre-nós, redução no tamanho de folhas, flores e frutos. Através de duplo PCR, utilizando os iniciadores R16 mF1/mR2 e R16 F2n/R2, fragmentos de DNA de 1,2 kb foram amplificados de amostras sintomáticas, demonstrando a presença de fitoplasma nos tecidos das plantas. O uso de iniciadores específicos demonstrou que estes fitoplasmas eram afiliados ao grupo 16SrIII. Análises de RFLP, usando as enzimas de restrição AluI, HpaII, KpnI, MboI, MseI e RsaI confirmaram que os fitoplasmas detectados eram representantes do grupo 16SrIII. Os fragmentos de DNA amplificados foram clonados em Escherichia coli, sequenciados e comparados, por homologia de seqüência, entre si e com outros fitoplasmas do grupo 16SrIII. Um índice de similaridade de seqüência acima de 95% foi encontrado quando seqüências dos fitoplasmas detectados em tomate e berinjela foram comparadas com aquelas de outros representantes do grupo 16SrIII. Um índice de 98-99% foi obtido quando seqüências dos fitoplasmas encontrados em tomate e berinjela foram comparadas entre si. Estes resultados evidenciaram que o enfezamento do tomateiro e da berinjela podem estar associados a um mesmo fitoplasma, com base na análise de seqüências do gene do 16S rDNA.Vegetable diseases occurring in the Brazilian territory and around the world have been associated with various phytoplasmas. In the region of Piracicaba-SP and Bragança-SP, in eggplant and tomato plants typical symptoms of stunting characterized by reduced canopy, leaf yellowing, proliferation of shoots, calix malformation

Presence of a Phytoplasma Associated with Witches’-Broom Disease in Ugni molinae Turcz. and Gaultheria phillyreifolia (Pers. Sleumer Determined by DAPI, PCR, and DNA Sequencing Presencia de un Fitoplasma Asociado a la Enfermedad de "Escoba de Bruja" en Ugni molinae Turcz. y Gaultheria phillyreifolia (Pers. Sleumer Determinado Mediante DAPI, PCR y Secuenciación de ADN

Directory of Open Access Journals (Sweden)

Nolberto Arismendi S

2010-03-01

Full Text Available Murta (Ugni molinae Turcz. and common chaura (Gaultheria phillyreifolia (Pers. Sleumer are native species of Chile. Plants of both species have shown over-branching like witches' broom. The causal agents of these symptoms in many plants are phytoplasma. To verify the presence of these microorganisms, DAPI (4',6-diamidino-2-phenylindole staining analysis and polymerase chain reaction (PCR were performed in symptomatic and asymptomatic plants. Positive PCR samples were sequenced to identify the pathogens involved. In individuals of both species with witches’ broom symptoms, DAPI staining showed fluorescent bodies in the phloem tissues, but not in asymptomatic plants. Verification by nested-PCR, phytoplasmatic DNA was amplified from diseased murta and chaura, but not in apparently healthy plants. Sequencing of amplified products allowed locating phytoplasma within the ash yellows group (16SrVII and related to Candidatus phytoplasma fraxini. This is the first report of phytoplasma in Chilean native species. Considering the diversity of plant species infected by the ash yellows group suggests that G. phillyreifolia and U. molinae could be a phytoplasma reservoir for other economically important agricultural crops.La murta (Ugni molinae Turcz. y la chaura común (Gaultheria phillyreifolia (Pers. Sleumer son especies nativas de Chile. En plantas de ambas especies se ha observado una sobre-ramificación de tipo "escoba de bruja". En muchas plantas los agentes causales de esta sintomatología son fitoplasmas. Para verificar la presencia de estos microorganismos se analizaron plantas con y sin síntomas mediante tinciones DAPI (4’,6-diamidino-2-fenilindol y reacción en cadena de la polimerasa (PCR. Muestras positivas en la PCR fueron secuenciadas para identificar al fitopatógeno implicado. En individuos de ambas especies con síntomas de escoba de bruja, la tinción DAPI permitió observar cuerpos fluorescentes en los tejidos del floema, situaci

Identification of potential insect vectors of the Cape Saint Paul Wilt Disease of coconut in Ghana by PCR

Directory of Open Access Journals (Sweden)

Pilet Fabian

2009-03-01

Full Text Available The vector of the phytoplasma responsible for the coconut lethal yellowing disease in West Africa is unknown to date. However, it is known that phytoplasmas are transmitted by leafhoppers and planthoppers, which are supposed to be the only ones able to inject the phytoplasma in the phloem. Whereas the presence of phytoplasma in the insect does not prove its capacity to transmit the disease. We have tested a large number of insects for the presence of phytoplamas by PCR (direct PCR and Nested PCR using both primer pairs specific for all phytoplasmas and those specific for the coconut lethal yellowing disease phytoplasma. In effect the evidence of one or several species carrying the phytoplasma would direct us on the insects to focus on in our transmission cages trials.

Sapu pada Kacang Hias (Arachis pintoi: Penyakit Baru yang Berasosiasi dengan Fitoplasma

Directory of Open Access Journals (Sweden)

Budiyarto .

2013-04-01

Full Text Available Pinto peanut (Arachis pintoi witches’ broom is a new disease found in Bogor at high incidence and has not yet been reported elsewhere. Symptom type of the disease is very similar to that of peanut (A. hypogea witches’ broom, which has been well known to be associated with phytoplasma. Both A. pintoi and A. hypogea witches’ broom causal agent are transmissible to both healthy A. pintoi or A. hypogea, with grafting or vector transmission using peanut witches’ broom phytoplasma specific vector, Orosius argentatus. All combination of transmission means resulted in an identical type of witches’ broom symptom. Further confirmation using polymerase chain reaction detection and identification of phytoplasma employing universal primer pair for phytoplasmas (P1/P7, showed that all of the diseased plants, either from field or transmitted plants is associated with phytoplasma. The A. pintoi witches’ broom phytoplasma is likely identical to that of A. hypogea.Key words: Arachis pintoi, Orosius argentatus, phytoplasma, witches’ broom

Deteksi dan Identifikasi Fitoplasma yang Berasosiasi dengan Penyakit Layu Kelapa Di Pulau Derawan, Kalimantan Timur

Directory of Open Access Journals (Sweden)

Agus Eko Prasetyo

2017-09-01

Full Text Available Coconut is a major commodity in Derawan island as source of additional income for the farmers. Research was conducted to detect and identify phytoplasmas associated with coconut wilt disease in Derawan island. Coconut wilt disease was indicated by the typical symptoms, i.e.  leaf yellowing, shorten of coconut sheaths and leaves, necrosis and collapse of old leaves, and also nut fall.  The presence of phytoplasmas in phloem tissues of coconut stem was observed using fluorescence and electron microscope.  Identification of phytoplasmas was carried out by nested-PCR and sequencing of the 16S rRNA gene.  DNA fragment of phytoplasma with the size of 1.25 kbp was successfully amplified using primer pairs P1/P7, followed by primer pairs R16F2n/R16R2.  Sequence analysis of the amplified fragments showed that phytoplasma associated with coconut wilt disease in Derawan island belongs to 16SrII (witches broom phytoplasma and 16SrXI (ca. Phytoplasma oryzae groups.

Identifikasi Molekuler Fitoplasma yang Berasosiasi dengan Tanaman Kaktus Hias Opuntia sp.

Directory of Open Access Journals (Sweden)

Ariny Prasetya

2017-11-01

Full Text Available Cactus species (Opuntia sp. is a popular ornamental succulent plant. Some ornamental cactus species in Indonesia showing proliferation and green mosaic pattern symptoms have been reported to be associated with phytoplasma infection. However, further molecular identification for accurate classification of the causal phytoplasma has not been done.  This study aimed to diagnose phytoplasma associated with Opuntia sp. based on molecular methods involving PCR standard combined with nested-PCR, cloning and DNA sequencing. Standard PCR was carried out using P1/P7 primers followed by nested-PCR using R16F2n/R16R2 or fU5/rU3 primer pairs which amplify the 16S rRNA gene targets of 1.2 kb and 880 bp, respectively. Amplified fragment of nested-PCR using R16F2n/R16R2 primers was chosen to be cloned and sequenced for further identification and classification of phytoplasma.  BLASTn analysis showed that the phytoplasma from Opuntia sp. was closely related to 16SrII group. Phylogenetic analysis and in silico RFLP indicated that phytoplasma strain infecting Opuntia sp. was a member of subgroup 16SrII-C (cactus witches’ broom phytoplasma. This is a newly report of cactus witches’ broom phytoplasma on Opuntia sp. in Indonesia.   

Penularan Fitoplasma Sapu pada Tanaman Kacang Tanah oleh Serangga Vektor Orosius argentatus dan Deteksi Molekuler dengan Teknik PCR

Directory of Open Access Journals (Sweden)

Tatit Sastrini

2014-02-01

Full Text Available Witches’ broom disease caused by phytoplasma is a very serious disease on peanut (Arachis hypogaea which may potentially lead to high yield loss. Insects are the most important agents of phytoplasma transmission in the field. The objective of this research was to examine the potential role of leafhoppers species as insect vector of phytoplasma and to determine their transmission characteristic. Two species of leafhopper i.e. O. argentatus and Empoasca sp. (both belong to Hemiptera: Cicadellidae were chosen for this study. The methodology involved were transmission study of phytoplasma by O. argentatus and Empoasca sp., and molecular detection of phytoplasma by PCR technique to confirm the association of pathogen, insect vector and symptomatic plants. The result showed that specific symptom was observed when using O. argentatus in the transmission study with number of insect as low as 1 insect per plant, whereas Empoasca sp. was not able to transmit the disease. Incubation period of phytoplasma in the host plant was affected by the number of insect, i.e. the more insect vector the shortest incubation period. The phytoplasma was successfully detected using P1/P7 primer in symptomatic plants as well as in the insect vector.Key words: Empoasca sp., leafhoppers, polymerase chain reaction

Data processing of qualitative results from an interlaboratory comparison for the detection of "Flavescence dorée" phytoplasma: How the use of statistics can improve the reliability of the method validation process in plant pathology.

Science.gov (United States)

Chabirand, Aude; Loiseau, Marianne; Renaudin, Isabelle; Poliakoff, Françoise

2017-01-01

A working group established in the framework of the EUPHRESCO European collaborative project aimed to compare and validate diagnostic protocols for the detection of "Flavescence dorée" (FD) phytoplasma in grapevines. Seven molecular protocols were compared in an interlaboratory test performance study where each laboratory had to analyze the same panel of samples consisting of DNA extracts prepared by the organizing laboratory. The tested molecular methods consisted of universal and group-specific real-time and end-point nested PCR tests. Different statistical approaches were applied to this collaborative study. Firstly, there was the standard statistical approach consisting in analyzing samples which are known to be positive and samples which are known to be negative and reporting the proportion of false-positive and false-negative results to respectively calculate diagnostic specificity and sensitivity. This approach was supplemented by the calculation of repeatability and reproducibility for qualitative methods based on the notions of accordance and concordance. Other new approaches were also implemented, based, on the one hand, on the probability of detection model, and, on the other hand, on Bayes' theorem. These various statistical approaches are complementary and give consistent results. Their combination, and in particular, the introduction of new statistical approaches give overall information on the performance and limitations of the different methods, and are particularly useful for selecting the most appropriate detection scheme with regards to the prevalence of the pathogen. Three real-time PCR protocols (methods M4, M5 and M6 respectively developed by Hren (2007), Pelletier (2009) and under patent oligonucleotides) achieved the highest levels of performance for FD phytoplasma detection. This paper also addresses the issue of indeterminate results and the identification of outlier results. The statistical tools presented in this paper and their

Cara Preservasi Fitoplasma dari Jaringan Kacang Tanah Bergejala Sapu untuk Deteksi DNA dengan Teknik PCR

Directory of Open Access Journals (Sweden)

Siska Irhamnawati Pulogu

2017-07-01

Full Text Available Witches‘ broom of peanut caused by phytoplasma is a common disease found in Indonesia. Phytoplasma is able to be detected using polymerase chain reaction (PCR technique. One of important factor which determine the successful of phytoplasma amplification is the DNA availability from fresh tissues. The research was aimed to evaluate some preservation methods of phytoplasma from infected plant samples. The aspects to be evaluated consisted of time (1, 2, 3, and 4 weeks, temperature (-20 °C, 4 °C, and 25 °C, and preservation medium (1X PGB buffer, 3 M NaCl, CTAB buffer, 70% ethanol, non medium, and FTA-card for storing the fresh phytoplasma infected samples. Good preservation method will optimize the phytoplasma DNA amplification using PCR standard technique followed by nested-PCR. The results showed that preservation of samples at -20 °C, 4 °C, and 25 °C in CTAB buffer was able to maintain the tissue freshness for 4 weeks and was able to provide the DNA of either quality or quantity sufficiently for PCR detection. PCR standard using a primer pair P1/P7 showed that not all of the preserved DNA of phytoplasma were amplified positively. However, standard PCR followed by nested-PCR using primer pair fU5/rU3 was able to increase the DNA detectability. Preserved samples derived from various medium and stored for 4 weeks gave positive results.  This results were in contrary with previous same samples which were detected negatively by standard PCR technique.

Data processing of qualitative results from an interlaboratory comparison for the detection of "Flavescence dorée" phytoplasma: How the use of statistics can improve the reliability of the method validation process in plant pathology.

Directory of Open Access Journals (Sweden)

Aude Chabirand

Full Text Available A working group established in the framework of the EUPHRESCO European collaborative project aimed to compare and validate diagnostic protocols for the detection of "Flavescence dorée" (FD phytoplasma in grapevines. Seven molecular protocols were compared in an interlaboratory test performance study where each laboratory had to analyze the same panel of samples consisting of DNA extracts prepared by the organizing laboratory. The tested molecular methods consisted of universal and group-specific real-time and end-point nested PCR tests. Different statistical approaches were applied to this collaborative study. Firstly, there was the standard statistical approach consisting in analyzing samples which are known to be positive and samples which are known to be negative and reporting the proportion of false-positive and false-negative results to respectively calculate diagnostic specificity and sensitivity. This approach was supplemented by the calculation of repeatability and reproducibility for qualitative methods based on the notions of accordance and concordance. Other new approaches were also implemented, based, on the one hand, on the probability of detection model, and, on the other hand, on Bayes' theorem. These various statistical approaches are complementary and give consistent results. Their combination, and in particular, the introduction of new statistical approaches give overall information on the performance and limitations of the different methods, and are particularly useful for selecting the most appropriate detection scheme with regards to the prevalence of the pathogen. Three real-time PCR protocols (methods M4, M5 and M6 respectively developed by Hren (2007, Pelletier (2009 and under patent oligonucleotides achieved the highest levels of performance for FD phytoplasma detection. This paper also addresses the issue of indeterminate results and the identification of outlier results. The statistical tools presented in this paper

Cloning and characterization of the immunodominant membrane ...

African Journals Online (AJOL)

ajl4

2012-09-27

Sep 27, 2012 ... A; Amp, antigenic membranes protein; AY, aster yellows; CPh, clover phyllody; JHP ... host-phytoplasma interactions and the IDPs are classified into three distinct types: type I was ..... Range of phytoplasma concentrations in ...

Nested PCR and RFLP analysis based on the 16S rRNA gene

Science.gov (United States)

Current phytoplasma detection and identification method is primarily based on nested PCR followed by restriction fragment length polymorphism analysis and gel electrophoresis. This method can potentially detect and differentiate all phytoplasmas including those previously not described. The present ...

Stylet penetration of Cacopsylla pyri; an electrical penetration graph (EPG) study

NARCIS (Netherlands)

Civolani, S.; Leis, M.; Grandi, G.; Garzo, E.; Pasqualini, E.; Musacchi, S.; Chicca, M.; Castaldelli, G.; Rossie, M.; Tjallingii, W.F.

2011-01-01

Detailed information on plant penetration activities by pear psylla Cacopsylla pyri L. (Hemiptera Psyllidae) is essential to study phytoplasma transmission of “Candidatus Phytoplasma pyri” responsible of pear decline disease (PD) and to trace and evaluate resistant traits in new pear tree selections

Monitoring of psyllid species (Hemiptera, Psylloidea) in apple and pear orchards in East Bohemia Překlad názvu do angličtiny:

Czech Academy of Sciences Publication Activity Database

Ludvíková, H.; Lauterer, P.; Suchá, J.; Fránová, Jana

2011-01-01

Roč. 64, Suppl. (2011), s. 121-122 ISSN 1721-8861 R&D Projects: GA MŠk OC09021 Institutional research plan: CEZ:AV0Z50510513 Keywords : Psyllid species * Candidatus Phytoplasma mali * Candidatus Phytoplasma pyri Subject RIV: EE - Microbiology, Virology Impact factor: 0.592, year: 2011

Detection of Russian olive witches’-broom disease and its insect vector in Northwestern Iran

Directory of Open Access Journals (Sweden)

Hajizadeh Abasalt

2017-09-01

Full Text Available Recently, Russian olive trees showing witches’-broom and little leaf symptoms have been widely observed in northwestern and central Iran. Polymerase chain reaction (PCR and nested PCR assays using phytoplasma universal primer pairs confirmed phytoplasma symptomatic infection of trees. Sequence analyses showed that ‘Candidatus Phytoplasma asteris’ was the causal agent of the disease in these regions. However, RFLP results using restriction enzymes HpaII, EcoRI, HinfI and AluI indicated that the collected isolates in these regions are genetically different. In addition, leafhopper Macropsis infuscata was recognized as a possible insect vector of the disease for the first time.

PCR and RFLP analyses based on the ribosomal protein operon

Science.gov (United States)

Differentiation and classification of phytoplasmas have been primarily based on the highly conserved 16Sr RNA gene. RFLP analysis of 16Sr RNA gene sequences has identified 31 16Sr RNA (16Sr) groups and more than 100 16Sr subgroups. Classification of phytoplasma strains can however, become more refin...

African fan palm (Borassus aethiopum) and oil palm (Elaeis ...

African Journals Online (AJOL)

Joao Bila

In this study, potential alternate hosts of the phytoplasma causing coconut lethal yellowing disease. (CLYD) in Mozambique were investigated based on 16S rRNA and secA genes. The results reveal that the naturalized palm species, Elaeis guineensis and Borassus aethiopum are alternate hosts of CLYD phytoplasma in ...

Widespread plant specialization in the polyphagous planthopper Hyalesthes obsoletus (Cixiidae), a major vector of stolbur phytoplasma: Evidence of cryptic speciation.

Science.gov (United States)

Kosovac, Andrea; Johannesen, Jes; Krstić, Oliver; Mitrović, Milana; Cvrković, Tatjana; Toševski, Ivo; Jović, Jelena

2018-01-01

The stolbur phytoplasma vector Hyalesthes obsoletus is generally considered as a polyphagous species associated with numerous wild and cultivated plants. However, recent research in southeastern Europe, the distribution centre of H. obsoletus and the area of most stolbur-inflicted crop diseases, points toward specific host-plant associations of the vector, indicating specific vector-based transmission routes. Here, we study the specificity of populations associated with four host-plants using mitochondrial and nuclear genetic markers, and we evaluate the evolution of host-shifts in H. obsoletus. Host-plant use was confirmed for Convolvulus arvensis, Urtica dioica, Vitex agnus-castus and Crepis foetida. Mitochondrial genetic analysis showed sympatric occurrence of three phylogenetic lineages that were ecologically delineated by host-plant preference, but were morphologically inseparable. Nuclear data supported the existence of three genetic groups (Evanno's ΔK(3) = 803.72) with average genetic membership probabilities > 90%. While populations associated with C. arvensis and U. dioica form a homogenous group, populations affiliated with V. agnus-castus and C. foetida constitute two independent plant-associated lineages. The geographical signal permeating the surveyed populations indicated complex diversification processes associated with host-plant selection and likely derived from post-glacial refugia in the eastern Mediterranean. This study provides evidence for cryptic species diversification within H. obsoletus sensu lato: i) consistent mitochondrial differentiation (1.1-1.5%) among host-associated populations in syntopy and in geographically distant areas, ii) nuclear genetic variance supporting mitochondrial data, and iii) average mitochondrial genetic distances among host-associated meta-populations are comparable to the most closely related, morphologically distinguishable species, i.e., Hyalesthes thracicus (2.1-3.3%).

Widespread plant specialization in the polyphagous planthopper Hyalesthes obsoletus (Cixiidae, a major vector of stolbur phytoplasma: Evidence of cryptic speciation.

Directory of Open Access Journals (Sweden)

Andrea Kosovac

Full Text Available The stolbur phytoplasma vector Hyalesthes obsoletus is generally considered as a polyphagous species associated with numerous wild and cultivated plants. However, recent research in southeastern Europe, the distribution centre of H. obsoletus and the area of most stolbur-inflicted crop diseases, points toward specific host-plant associations of the vector, indicating specific vector-based transmission routes. Here, we study the specificity of populations associated with four host-plants using mitochondrial and nuclear genetic markers, and we evaluate the evolution of host-shifts in H. obsoletus. Host-plant use was confirmed for Convolvulus arvensis, Urtica dioica, Vitex agnus-castus and Crepis foetida. Mitochondrial genetic analysis showed sympatric occurrence of three phylogenetic lineages that were ecologically delineated by host-plant preference, but were morphologically inseparable. Nuclear data supported the existence of three genetic groups (Evanno's ΔK(3 = 803.72 with average genetic membership probabilities > 90%. While populations associated with C. arvensis and U. dioica form a homogenous group, populations affiliated with V. agnus-castus and C. foetida constitute two independent plant-associated lineages. The geographical signal permeating the surveyed populations indicated complex diversification processes associated with host-plant selection and likely derived from post-glacial refugia in the eastern Mediterranean. This study provides evidence for cryptic species diversification within H. obsoletus sensu lato: i consistent mitochondrial differentiation (1.1-1.5% among host-associated populations in syntopy and in geographically distant areas, ii nuclear genetic variance supporting mitochondrial data, and iii average mitochondrial genetic distances among host-associated meta-populations are comparable to the most closely related, morphologically distinguishable species, i.e., Hyalesthes thracicus (2.1-3.3%.

Widespread plant specialization in the polyphagous planthopper Hyalesthes obsoletus (Cixiidae), a major vector of stolbur phytoplasma: Evidence of cryptic speciation

Science.gov (United States)

Kosovac, Andrea; Johannesen, Jes; Krstić, Oliver; Cvrković, Tatjana; Toševski, Ivo

2018-01-01

The stolbur phytoplasma vector Hyalesthes obsoletus is generally considered as a polyphagous species associated with numerous wild and cultivated plants. However, recent research in southeastern Europe, the distribution centre of H. obsoletus and the area of most stolbur-inflicted crop diseases, points toward specific host-plant associations of the vector, indicating specific vector-based transmission routes. Here, we study the specificity of populations associated with four host-plants using mitochondrial and nuclear genetic markers, and we evaluate the evolution of host-shifts in H. obsoletus. Host-plant use was confirmed for Convolvulus arvensis, Urtica dioica, Vitex agnus-castus and Crepis foetida. Mitochondrial genetic analysis showed sympatric occurrence of three phylogenetic lineages that were ecologically delineated by host-plant preference, but were morphologically inseparable. Nuclear data supported the existence of three genetic groups (Evanno’s ΔK(3) = 803.72) with average genetic membership probabilities > 90%. While populations associated with C. arvensis and U. dioica form a homogenous group, populations affiliated with V. agnus-castus and C. foetida constitute two independent plant-associated lineages. The geographical signal permeating the surveyed populations indicated complex diversification processes associated with host-plant selection and likely derived from post-glacial refugia in the eastern Mediterranean. This study provides evidence for cryptic species diversification within H. obsoletus sensu lato: i) consistent mitochondrial differentiation (1.1–1.5%) among host-associated populations in syntopy and in geographically distant areas, ii) nuclear genetic variance supporting mitochondrial data, and iii) average mitochondrial genetic distances among host-associated meta-populations are comparable to the most closely related, morphologically distinguishable species, i.e., Hyalesthes thracicus (2.1–3.3%). PMID:29738577

Review of Coconut “Lethal Yellowing” type diseases Diversity, variability and diagnosis

Directory of Open Access Journals (Sweden)

Dollet Michel

2009-03-01

Full Text Available Coconut palms (Cocos nucifera L. can be affected by several types of Lethal Yellowing (LY diseases worldwide. Some of the syndromes are caused by phytoplasmas, small bacteria that are impossible to detect by light microscopy. Amplification of a given gene of the phytoplasmas by polymerase chain reaction (PCR is the most convenient diagnosis method. The problem is that there are at least 28 “groups” of phytoplasmas and only one pair of primers -P1/P7- commonly used for PCR. As these primers belong to a very conserved gene, false positives are frequent. Consequently, alternative primers specific to one “strain” (or subgroup have to be used, such as LY-F/LY-R for the Caribbean LY, Rohde primers for LD Tanzania. Such specific primers are sometimes restrictive. Indeed, there is variability within each strain and the sequence of the primers has to be adapted to that variability. There are at least five LY subgroups. The subgroups can only be identified by restriction fragment length polymorphism or sequencing. In Africa, two subgroups of LY phytoplasmas have been identified so far.

A unique virulence factor for proliferation and dwarfism in plants identified from a phytopathogenic bacterium

OpenAIRE

Hoshi, Ayaka; Oshima, Kenro; Kakizawa, Shigeyuki; Ishii, Yoshiko; Ozeki, Johji; Hashimoto, Masayoshi; Komatsu, Ken; Kagiwada, Satoshi; Yamaji, Yasuyuki; Namba, Shigetou

2009-01-01

One of the most important themes in agricultural science is the identification of virulence factors involved in plant disease. Here, we show that a single virulence factor, tengu-su inducer (TENGU), induces witches' broom and dwarfism and is a small secreted protein of the plant-pathogenic bacterium, phytoplasma. When tengu was expressed in Nicotiana benthamiana plants, these plants showed symptoms of witches' broom and dwarfism, which are typical of phytoplasma infection. Transgenic Arabidop...

Survival relative to new and ancestral host plants, phytoplasma infection, and genetic constitution in host races of a polyphagous insect disease vector

Science.gov (United States)

Maixner, Michael; Albert, Andreas; Johannesen, Jes

2014-01-01

Dissemination of vectorborne diseases depends strongly on the vector's host range and the pathogen's reservoir range. Because vectors interact with pathogens, the direction and strength of a vector's host shift is vital for understanding epidemiology and is embedded in the framework of ecological specialization. This study investigates survival in host-race evolution of a polyphagous insect disease vector, Hyalesthes obsoletus, whether survival is related to the direction of the host shift (from field bindweed to stinging nettle), the interaction with plant-specific strains of obligate vectored pathogens/symbionts (stolbur phytoplasma), and whether survival is related to genetic differentiation between the host races. We used a twice repeated, identical nested experimental design to study survival of the vector on alternative hosts and relative to infection status. Survival was tested with Kaplan–Meier analyses, while genetic differentiation between vector populations was quantified with microsatellite allele frequencies. We found significant direct effects of host plant (reduced survival on wrong hosts) and sex (males survive longer than females) in both host races and relative effects of host (nettle animals more affected than bindweed animals) and sex (males more affected than females). Survival of bindweed animals was significantly higher on symptomatic than nonsymptomatic field bindweed, but in the second experiment only. Infection potentially had a positive effect on survival in nettle animals but due to low infection rates the results remain suggestive. Genetic differentiation was not related to survival. Greater negative plant-transfer effect but no negative effect of stolbur in the derived host race suggests preadaptation to the new pathogen/symbiont strain before strong diversifying selection during the specialization process. Physiological maladaptation or failure to accept the ancestral plant will have similar consequences, namely positive assortative

Search for alternate hosts of the coconut Cape Saint Paul Wilt Disease pathogen

Directory of Open Access Journals (Sweden)

Yankey Egya Ndede

2009-03-01

Full Text Available Lethal Yellowing disease locally called Cape Saint Paul wilt disease (CSPWD is the bane of the coconut industry in Ghana and is caused by a phytoplasma. In Ghana, there are areas where the disease has re-infected re-plantings long after decimating all the palms in the area. This brings to the fore the possibility of alternate hosts in the spread of the disease because the pathogen is an obligate parasite. In this work, a number of plants were screened for their host status to the CSPWD pathogen. The presence of phytoplasmas in these plants was tested by polymerase chain reaction analysis using universal phytoplasma primers P1/P7 and CSPWD-specific primers G813/GAKSR. Although Desmodium adscendens tested positive to the CSPWD-specific primers, cloning and sequencing did not confirm it as an alternate host. The identification of alternate hosts will help us to evolve sound control strategies against the spread of the disease.

A unique virulence factor for proliferation and dwarfism in plants identified from a phytopathogenic bacterium

Science.gov (United States)

Hoshi, Ayaka; Oshima, Kenro; Kakizawa, Shigeyuki; Ishii, Yoshiko; Ozeki, Johji; Hashimoto, Masayoshi; Komatsu, Ken; Kagiwada, Satoshi; Yamaji, Yasuyuki; Namba, Shigetou

2009-01-01

One of the most important themes in agricultural science is the identification of virulence factors involved in plant disease. Here, we show that a single virulence factor, tengu-su inducer (TENGU), induces witches' broom and dwarfism and is a small secreted protein of the plant-pathogenic bacterium, phytoplasma. When tengu was expressed in Nicotiana benthamiana plants, these plants showed symptoms of witches' broom and dwarfism, which are typical of phytoplasma infection. Transgenic Arabidopsis thaliana lines expressing tengu exhibited similar symptoms, confirming the effects of tengu expression on plants. Although the localization of phytoplasma was restricted to the phloem, TENGU protein was detected in apical buds by immunohistochemical analysis, suggesting that TENGU was transported from the phloem to other cells. Microarray analyses showed that auxin-responsive genes were significantly down-regulated in the tengu-transgenic plants compared with GUS-transgenic control plants. These results suggest that TENGU inhibits auxin-related pathways, thereby affecting plant development. PMID:19329488

ORF Alignment: NC_005303 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available phytoplasma OY-M] ... Length = 73 ... Query: 1 ... MKANIHPQFETVEVSCATCGKQHPIGTTVTSIKIETCSNCHPFYTGAQTFVVKAG...PVDKF 60 ... MKANIHPQFETVEVSCATCGKQHPIGTTVTSIKIETCSNCHPFYTGAQTFVVKAGPVDKF Sbjct: 1 ... MKANIHPQFETVEVSCATCGKQHPIGTTVTSIKIETCSNCHPFYTGAQTFVVKAGPVDKF 60 ...

ORF Alignment: NC_005303 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available phytoplasma OY-M] ... Length = 91 ... Query: 5 ... YDLVKAPIITELTNKLIERQNKYTFKVAKTANKVEIKKALESIFQVKVLSVNTRN...VLPQF 64 ... YDLVKAPIITELTNKLIERQNKYTFKVAKTANKVEIKKALESIFQVKVLSVNTRNVLPQF Sbjct: 1 ... YDLVKAPIITELTNKLIERQNKYTFKVAKTANKVEIKKALESIFQVKVLSVNTRNVLPQF 60 ...

ORF Alignment: NC_005303 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... phytoplasma OY-M] ... Length = 97 ... Query: 5 ... AERLSSLIQKELVLINDVIQDEQIGYINLTDVKVTKDLSFANV...YYTILSDDPTVLKLTEE 64 ... AERLSSLIQKELVLINDVIQDEQIGYINLTDVKVTKDLSFANVYYTILS...DDPTVLKLTEE Sbjct: 1 ... AERLSSLIQKELVLINDVIQDEQIGYINLTDVKVTKDLSFANVYYTILSDDPTVLKLTEE 60 ...

ORF Alignment: NC_005303 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... protein [Onion yellows phytoplasma OY-M] ... Length = 102 ... Query: 2 ... LNNIQLIGRITHDPEKQYINS...NNEQIPKIDFQLAVNQTKDKVQYIPCVVFRTQAENFHKY 61 ... LNNIQLIGRITHDPEKQYINSNNEQIP...KIDFQLAVNQTKDKVQYIPCVVFRTQAENFHKY Sbjct: 1 ... LNNIQLIGRITHDPEKQYINSNNEQIPKIDFQLAVNQTKDKVQYIPCVVFRTQAENFHKY 60 ...

Vitex agnus-castus is a preferred host plant for Hyalesthes obsoletus.

Science.gov (United States)

Sharon, Rakefet; Soroker, Victoria; Wesley, S Daniel; Zahavi, Tirtza; Harari, Ally; Weintraub, Phyllis G

2005-05-01

Hyalesthes obsoletus Signoret (Homoptera: Cixiidae) is a polyphagous planthopper that transmits stolbur phytoplasma (a causative agent of "yellows" disease) to various weeds, members of the Solanaceae, and wine grapes (Vitis vinifera L.) in Europe and the Middle East. Planthoppers were collected by hand vacuuming eight native plant species. Vitex agnus-castus L., a shrub in the Verbenaceae, hosted the largest number of H. obsoletus, although Olea europaea L. also served as a host for adults. Using a Y-olfactometer, we compared the planthoppers relative preference for V. agnus-castus, Convolvulus arvensis, and V. vinifera. V. agnus-castus was more attractive to both male and female H. obsoletus than the other plants. H. obsoletus antennal response was stronger to volatiles collected from V. agnuscastus than from Cabernet Sauvignon variety of V. vinifera. To determine if V. agnus-castus would serve as a reservoir for the pathogen, H. obsoletus were collected from leaf and stem samples of native V. agnus-castus, and were tested by polymerase chain reaction (PCR) for the presence of phytoplasma DNA. While 14% and 25% (2003 and 2004, respectively) of the insects tested positive for phytoplasma DNA, none of the plant samples tested positive. To determine if V. agnus-castus could serve as a host plant for the development of the planthopper, we placed emergence cages beneath field shrubs and enclosed wild-caught H. obsoletus in a cage with a potted young shrub. We found adult H. obsoletus in the emergence cases and planthopper nymphs in the soil of the potted plant. We concluded that V. agnus-castus is attractive to H. obsoletus, which seems to be refractory to phytoplasma infections and warrants further testing as a trap plant near vineyards.

A Bacterial Parasite Effector Mediates Insect Vector Attraction in Host Plants Independently of Developmental Changes

Science.gov (United States)

Orlovskis, Zigmunds; Hogenhout, Saskia A.

2016-01-01

Parasites can take over their hosts and trigger dramatic changes in host appearance and behavior that are typically interpreted as extended phenotypes that promote parasite survival and fitness. For example, Toxoplasma gondii is thought to manipulate the behaviors of infected rodents to aid transmission to cats and parasitic trematodes of the genus Ribeiroia alter limb development in their amphibian hosts to facilitate predation of the latter by birds. Plant parasites and pathogens also reprogram host development and morphology. However, whereas some parasite-induced morphological alterations may have a direct benefit to the fitness of the parasite and may therefore be adaptive, other host alterations may be side effects of parasite infections having no adaptive effects on parasite fitness. Phytoplasma parasites of plants often induce the development of leaf-like flowers (phyllody) in their host plants, and we previously found that the phytoplasma effector SAP54 generates these leaf-like flowers via the degradation of plant MADS-box transcription factors (MTFs), which regulate all major aspects of development in plants. Leafhoppers prefer to reproduce on phytoplasma-infected and SAP54-trangenic plants leading to the hypothesis that leafhopper vectors are attracted to plants with leaf-like flowers. Surprisingly, here we show that leafhopper attraction occurs independently of the presence of leaf-like flowers. First, the leafhoppers were also attracted to SAP54 transgenic plants without leaf-like flowers and to single leaves of these plants. Moreover, leafhoppers were not attracted to leaf-like flowers of MTF-mutant plants without the presence of SAP54. Thus, the primary role of SAP54 is to attract leafhopper vectors, which spread the phytoplasmas, and the generation of leaf-like flowers may be secondary or a side effect of the SAP54-mediated degradation of MTFs. PMID:27446117

Effects of Bois noir on carbon assimilation, transpiration, stomatal conductance of leaves and yield of grapevine (Vitis vinifera) cv. Chardonnay.

Science.gov (United States)

Endeshaw, Solomon T; Murolo, Sergio; Romanazz, Gianfranco; Neri, Davide

2012-06-01

Bois noir (BN) is one of the main phytoplasma diseases of grapevine (Vitis vinifera). It is widespread, and can cause severe losses in European vineyards. The infective agent colonizes phloem elements and induces visible symptoms of leaf yellowing or reddening after a relatively long incubation period. As the most sensitive cultivars to BN, Chardonnay plants were grouped as healthy or symptomatic in spring, based on the records from the previous year. Leaf gas exchange and chlorophyll a fluorescence were measured weekly from July to September in healthy plants, and in symptomatic and asymptomatic leaves from symptomatic plants. The midday relative water content (mRWC) was measured once per month. The detection of phytoplasma DNA by nested-polymerase chain reaction revealed BN infection in symptomatic leaf samples at the end of September. A significant decrease in pigment content and maximum quantum efficiency of photosystem II (Fv/Fm) of these symptomatic leaves was detected from July to September, although in the asymptomatic leaves of the symptomatic plants the net photosynthesis (Pn) decrease was not significant. In the leaves from the healthy plants, Pn and transpiration were relatively stable. Of note, in July, an initially healthy plant showed a strong Pn reduction that was followed by visible leaf yellowing symptoms only in August. The phytoplasma infection also stimulated significant reductions in mRWC of the symptomatic leaves, with a final large decrease in yield.

Dicty_cDB: Contig-U02501-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ) Aster yellows witches'-broom phytoplasma AYWB, co... 38 0.006 12 ( FG289263 ) 1108793295629 New World Scre...FG290297 ) 1108793315558 New World Screwworm Egg 9261 ESTs C... 44 9.4 1 ( FE7256

Effective methods of preserving SCWL-diseased sugarcane leaves ...

African Journals Online (AJOL)

Administrator

2011-09-14

Sep 14, 2011 ... two types of bags: brown paper bags and plastic bags with punctured holes. Leaf materials ... Phytoplasmas are wall-less bacteria inhabiting the phloem sieve ... lead to problems involving degradation of DNA. Therefore, it is ...

Maintenance of primary cell cultures of immunocytes from Cacopsylla sp. psyllids: a new in vitrio tool for the study of pest insects

Science.gov (United States)

Psyllid species are major vectors of plant pathogens, such as phytoplasmas and Liberibacter bacteria, which threaten economic stability of fruit tee crops and vegetable production worldwide. Primary cell cultures of immunocytes have been developed from the three psyllid species, Cacopsylla melanone...

Planthopper pests of grapevine (in French)

Science.gov (United States)

In the French vineyards occur two main insect pests belonging to Fulgoromorpha, Hyalesthes obsoletus Signoret (Cixiidae) and Metcalfa pruinosa (Say) (Flatidae). Hyalesthes obsoletus is inducing economic losses by transmitting a phytoplasma, called Stolbur, from wild plants (bindweed, nettle, etc.) t...

EPG monitoring of the probing behaviour of the common brown leafhopper Orosius orientalis on artificial diet and selected host plants

NARCIS (Netherlands)

Trebicki, P.; Tjallingii, W.F.; Harding, R.M.; Rodoni, B.C.; Powell, K.S.

2012-01-01

The common brown leafhopper Orosius orientalis (Hemiptera: Cicadellidae) is a polyphagous vector of a range of economically important pathogens, including phytoplasmas and viruses, which infect a diverse range of crops. Studies on the plant penetration behaviour by O. orientalis were conducted using

Determination of the activity signature of key carbohydrate metabolism enzymes in phenolic-rich grapevine tissues

Czech Academy of Sciences Publication Activity Database

Convigton, E. D.; Roitsch, Thomas; Dernastia, M.

2016-01-01

Roč. 63, č. 4 (2016), s. 757-762 ISSN 1318-0207 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : AGPase * carbohydrates * invertases * sucrose synthase * panel of enzyme activity assays * phytoplasma Subject RIV: EH - Ecology, Behaviour Impact factor: 0.983, year: 2016

Mycoplasmas, plants, insect vectors: a matrimonial triangle.

Science.gov (United States)

Garnier, M; Foissac, X; Gaurivaud, P; Laigret, F; Renaudin, J; Saillard, C; Bové, J M

2001-10-01

Plant pathogenic mycoplasmas were discovered by electron microscopy, in 1967, long after the discovery and culture in 1898 of the first pathogenic mycoplasma of animal origin, Mycoplasma mycoides. Mycoplasmas are Eubacteria of the class Mollicutes, a group of organisms phylogenetically related to Gram-positive bacteria. Their more characteristic features reside in the small size of their genomes, the low guanine (G) plus cytosine (C) content of their genomic DNA and the lack of a cell wall. Plant pathogenic mycoplasmas are responsible for several hundred diseases and belong to two groups: the phytoplasmas and the spiroplasmas. The phytoplasmas (previously called MLOs, for mycoplasma like organisms) were discovered first; they are pleiomorphic, and have so far resisted in vitro cultivation. Phytoplasmas represent the largest group of plant pathogenic Mollicutes. Only three plant pathogenic spiroplasmas are known today. Spiroplasma citri, the agent of citrus stubborn was discovered and cultured in 1970 and shown to be helical and motile. S. kunkelii is the causal agent of corn stunt. S. phoeniceum, responsible for periwinkle yellows, was discovered in Syria. There are many other spiroplasmas associated with insects and ticks. Plant pathogenic mycoplasmas are restricted to the phloem sieve tubes in which circulates the photosynthetically-enriched sap, the food for many phloem-feeding insects (aphids, leafhoppers, psyllids, etc.). Interestingly, phytopathogenic mycoplasmas are very specifically transmitted by leafhoppers or psyllid species. In this paper, the most recent knowledge on phytopathogenic mycoplasmas in relation with their insect and plant habitats is presented as well as the experiments carried out to control plant mycoplasma diseases, by expression of mycoplasma-directed-antibodies in plants (plantibodies).

Quantitative proteome-level analysis of paulownia witches’ broom disease with methyl methane sulfonate assistance reveals diverse metabolic changes during the infection and recovery processes

Directory of Open Access Journals (Sweden)

Zhe Wang

2017-07-01

Full Text Available Paulownia witches’ broom (PaWB disease caused by phytoplasma is a fatal disease that leads to considerable economic losses. Although there are a few reports describing studies of PaWB pathogenesis, the molecular mechanisms underlying phytoplasma pathogenicity in Paulownia trees remain uncharacterized. In this study, after building a transcriptome database containing 67,177 sequences, we used isobaric tags for relative and absolute quantification (iTRAQ to quantify and analyze the proteome-level changes among healthy P. fortunei (PF, PaWB-infected P. fortunei (PFI, and PaWB-infected P. fortunei treated with 20 mg L−1 or 60 mg L−1 methyl methane sulfonate (MMS (PFI-20 and PFI-60, respectively. A total of 2,358 proteins were identified. We investigated the proteins profiles in PF vs. PFI (infected process and PFI-20 vs. PFI-60 (recovered process, and further found that many of the MMS-response proteins mapped to “photosynthesis” and “ribosome” pathways. Based on our comparison scheme, 36 PaWB-related proteins were revealed. Among them, 32 proteins were classified into three functional groups: (1 carbohydrate and energy metabolism, (2 protein synthesis and degradation, and (3 stress resistance. We then investigated the PaWB-related proteins involved in the infected and recovered processes, and discovered that carbohydrate and energy metabolism was inhibited, and protein synthesis and degradation decreased, as the plant responded to PaWB. Our observations may be useful for characterizing the proteome-level changes that occur at different stages of PaWB disease. The data generated in this study may serve as a valuable resource for elucidating the pathogenesis of PaWB disease during phytoplasma infection and recovery stages.

Restructuring of endophytic bacterial communities in grapevine yellows-diseased and recovered Vitis vinifera L. plants.

Science.gov (United States)

Bulgari, Daniela; Casati, Paola; Crepaldi, Paola; Daffonchio, Daniele; Quaglino, Fabio; Brusetti, Lorenzo; Bianco, Piero Attilio

2011-07-01

Length heterogeneity-PCR assays, combined with statistical analyses, highlighted that the endophytic bacterial community associated with healthy grapevines was characterized by a greater diversity than that present in diseased and recovered plants. The findings suggest that phytoplasmas can restructure the bacterial community by selecting endophytic strains that could elicit a plant defense response.

Detección de Ca Liberibacter solanacearum y fitoplasmas en cultivo de papa (Solanum tuberosum L. en el Valle de Toluca

Directory of Open Access Journals (Sweden)

Ana Tarin Gutiérrez-Ibáñez

2013-01-01

Full Text Available Título en ingles: Detection of Ca Liberibacter solanacearum and phytoplasma in potato crop (Solanum tuberosum L. in Toluca Valley Título corto: Detección de Ca Liberibacter solanacearum y fitoplasmas Resumen En México y Centro América se han detectado tubérculos de papa con manchado interno. Recientemente en Texas EUA a esta enfermedad se le ha denominado “Zebra Chip” (ZC o rayado de la papa, los síntomas foliares se asemejan al síndrome denominado “Punta Morada de la Papa” (PMP o enfermedad del “amarillamiento por psilidos” la cual es asociada con la presencia de “Candidatus Liberibacter solanacearum”. El objetivo de esta investigación fue detectar la presencia de esta bacteria y de fitoplasmas en plantas de papa que presentaban la coloración purpura de los foliolos. Durante el ciclo primavera – verano 2011 y 2012 se hizo un muestreo en los municipios de Tenango del Valle, Zinacantepec, Villa de Allende y San José del Rincón, del Estado de México. La detección de ambos patógenos se realizó mediante la reacción en cadena de la polimerasa (PCR con los iniciadores específicos para fitoplasmas: P1/P7, R16mF2/R16mR1 y para Ca Liberibacter solanacearum: OA2/Oi2c, resultando el 35,8% de las plantas positivas para fitoplasmas y el 11,6% para la bacteria. Los resultados indican  que en algunas regiones productoras de papa del Estado de México,  los dos presuntos agentes causales del síndrome de  PMP, fitoplasmas y Ca. Liberibacter solanacearum, pueden estar asociados. Palabras clave: Candidatus Liberibacter solanacearum; Fitoplasma; punta morada. Abstract In Mexico and Central America have been detected stained potato tubers with internal browning; recently in Texas, USA, this disease has been called "Zebra Chip" (ZC or striped potato, foliar symptoms resemble the syndrome called "Potato Purple Top" (PPT or "psyllid yellows" disease which is associated with the presence of "Candidatus liberibacter solanacearum�

Restructuring of Endophytic Bacterial Communities in Grapevine Yellows-Diseased and Recovered Vitis vinifera L. Plants ▿

Science.gov (United States)

Bulgari, Daniela; Casati, Paola; Crepaldi, Paola; Daffonchio, Daniele; Quaglino, Fabio; Brusetti, Lorenzo; Bianco, Piero Attilio

2011-01-01

Length heterogeneity-PCR assays, combined with statistical analyses, highlighted that the endophytic bacterial community associated with healthy grapevines was characterized by a greater diversity than that present in diseased and recovered plants. The findings suggest that phytoplasmas can restructure the bacterial community by selecting endophytic strains that could elicit a plant defense response. PMID:21622794

Control of Huanglongbing (HLB) disease with reference to its ...

African Journals Online (AJOL)

WBDL is a phloem limited phytoplasma disease of lime. HLB disease causing citrus greening (Candidatus liberibacter spp.) is the second most severe disease on citrus industry all over the world. HLB has destroyed an estimated 60 million trees in Africa and Asia. More than 40 countries were infected by HLB in Africa, Asia ...

Environment

DEFF Research Database (Denmark)

Valentini, Chiara

2017-01-01

The term environment refers to the internal and external context in which organizations operate. For some scholars, environment is defined as an arrangement of political, economic, social and cultural factors existing in a given context that have an impact on organizational processes and structures....... For others, environment is a generic term describing a large variety of stakeholders and how these interact and act upon organizations. Organizations and their environment are mutually interdependent and organizational communications are highly affected by the environment. This entry examines the origin...... and development of organization-environment interdependence, the nature of the concept of environment and its relevance for communication scholarships and activities....

Novel insights into the elm yellows phytoplasma genome and into the metagenome of elm yellows-infected elms

Science.gov (United States)

Christina Rosa; Paolo Margaria; Scott M. Geib; Erin D. Scully

2017-01-01

In North America, American elms were historically present throughout the northeastern United States and southeastern Canada. The longevity of these trees, their resistance to the harsh urban environment, and their aesthetics led to their wide use in landscaping and streetscaping over several decades. American elms were one of most cultivated plants in the United States...

Incidência de viroses e enfezamentos e estimativa de perdas causadas por molicutes em milho no Paraná Occurrence of viruses and stunting diseases and estimative of yield losses by mollicutes in corn in Paraná State, Brazil

Directory of Open Access Journals (Sweden)

Elizabeth de Oliveira

2003-01-01

Full Text Available O objetivo deste trabalho foi avaliar a incidência de viroses e enfezamentos e estimar as perdas causadas por enfezamentos na cultura do milho safrinha. Os diagnósticos baseados em sintomas foram confirmados por PCR ou RTPCR. Em todas as lavouras, foram identificadas plantas com sintomas de enfezamentos, em incidência de 6,2% a 49,9% (média de 20,7%. Na identificação de insetos vetores desses patógenos, a cigarrinha Dalbulus maidis foi detectada em 20 lavouras das 24 amostradas, constituindo 66,6% do total de espécimens de cigarrinhas coletadas. A perda potencial causada pelos enfezamentos no período foi estimada em cerca de 16,5 milhões de dólares. A ocorrência de plantas com sintomas de "Maize rayado fino virus" e "Maize dwarf mosaic virus" foi baixa e o diagnóstico confirmado por RTPCR. A análise de 441 amostras suspeitas de infecção por "Mal de Río Cuarto virus", por DASELISA, mostrou ausência desse vírus. Resultados de PCR indicaram a presença de um possível fitoplasma distinto de "Maize bushy stunt phytoplasma" em duas plantas apresentando nanismo acentuado, folhas estreitas, enrijecidas, com deformações, e grãos na inflorescência, havendo necessidade de mais estudos para a confirmação da identidade desse possível novo fitoplasma.The objective of this work was to evaluate the occurence and yield losses by corn stunting diseases and maize viruses in "safrinha" season. Disease diagnostics based on plant symptoms were confirmed by PCR or RTPCR assays. Insect samples were collected in 24 fields for identification of vectors of the pathogens. Corn stunting diseases symptoms were observed in all crops evaluated, with incidence levels ranging from 6.2% to 49.9% (average 20.7% and the presence of the leafhopper Dalbulus maidis, was detected in 20 of the 24 areas evaluated. This insect species was prevalent, representing 66,6% of total leafhoppers specimens collected. The potential yield losses caused by mollicutes was

International environment, enterprise environment and energy environment giving different look

Energy Technology Data Exchange (ETDEWEB)

Kubo, Shunsuke

1987-04-01

0he international environment, enterprise environment and energy environment surrounding Japan are changing their looks. In such situation, what Japan should do for the development of the world was discussed. Internationally, in the Western Pacific economical block including Japan and Asian NICs, Japan promotes the international exchange of materials, capital, technology, information and people, and creates various international public properties. Enterprisers should have global mind, and cope with the internationalization, technical innovation and information orientation which are in progress at present through international exchange, interindustrial exchange, industry-university-government exchange and so on. In the aspect of energy environment, Japan carries out the technical development of energy conservation, energy, creation and the exploration of energy resources, in this way, contributes to the stabilization of energy in the world. (3 figs, 1 tab)

Evolving Robot Controllers for Structured Environments Through Environment Decomposition

DEFF Research Database (Denmark)

Moreno, Rodrigo; Faiña, Andres; Støy, Kasper

2015-01-01

In this paper we aim to develop a controller that allows a robot to traverse an structured environment. The approach we use is to decompose the environment into simple sub-environments that we use as basis for evolving the controller. Specifically, we decompose a narrow corridor environment...... environments and that the order in which the decomposed sub-environments are presented in sequence impacts the performance of the evolutionary algorithm....

Childhood temperament: passive gene-environment correlation, gene-environment interaction, and the hidden importance of the family environment.

Science.gov (United States)

Lemery-Chalfant, Kathryn; Kao, Karen; Swann, Gregory; Goldsmith, H Hill

2013-02-01

Biological parents pass on genotypes to their children, as well as provide home environments that correlate with their genotypes; thus, the association between the home environment and children's temperament can be genetically (i.e., passive gene-environment correlation) or environmentally mediated. Furthermore, family environments may suppress or facilitate the heritability of children's temperament (i.e., gene-environment interaction). The sample comprised 807 twin pairs (mean age = 7.93 years) from the longitudinal Wisconsin Twin Project. Important passive gene-environment correlations emerged, such that home environments were less chaotic for children with high effortful control, and this association was genetically mediated. Children with high extraversion/surgency experienced more chaotic home environments, and this correlation was also genetically mediated. In addition, heritability of children's temperament was moderated by home environments, such that effortful control and extraversion/surgency were more heritable in chaotic homes, and negative affectivity was more heritable under crowded or unsafe home conditions. Modeling multiple types of gene-environment interplay uncovered the complex role of genetic factors and the hidden importance of the family environment for children's temperament and development more generally.

FEMME, a flexible environment for mathematically modelling the environment

NARCIS (Netherlands)

Soetaert, K.E.R.; DeClippele, V.; Herman, P.M.J.

2002-01-01

A new, FORTRAN-based, simulation environment called FEMME (Flexible Environment for Mathematically Modelling the Environment), designed for implementing, solving and analysing mathematical models in ecology is presented. Three separate phases in ecological modelling are distinguished: (1) the model

An Action Environment

DEFF Research Database (Denmark)

van den Brand, Mark; Iversen, Jørgen; Mosses, Peter David

2004-01-01

constructs underlying Core ML. The paper also describes the Action Environment, a new environment supporting use and validation of ASDF descriptions. The Action Environment has been implemented on top of the ASF+SDF Meta-Environment, exploiting recent advances in techniques for integration of different...... formalisms, and inheriting all the main features of the Meta-Environment....

Global Environment Facility |

Science.gov (United States)

environment Countries pledge US$4.1 billion to the Global Environment Facility Ringtail lemur mom with two of paradise Nations rally to protect global environment Countries pledge US$4.1 billion to the Global Environment Facility Stockholm, Sweden birds-eye view Events GEF-7 Replenishment Trung Truong Son Landscapes

Performative Environments

DEFF Research Database (Denmark)

Thomsen, Bo Stjerne

2008-01-01

The paper explores how performative architecture can act as a collective environment localizing urban flows and establishing public domains through the integration of pervasive computing and animation techniques. The NoRA project introduces the concept of ‘performative environments,' focusing on ...... of local interactions and network behaviour, building becomes social infrastructure and prompts an understanding of architectural structures as quasiobjects, which can retain both variation and recognisability in changing social constellations.......The paper explores how performative architecture can act as a collective environment localizing urban flows and establishing public domains through the integration of pervasive computing and animation techniques. The NoRA project introduces the concept of ‘performative environments,' focusing...

Visual Variables in Physical Environments and Virtual Environments

DEFF Research Database (Denmark)

Mullins, Michael

, then to locate them and identify their shape on scaled drawings.  Results are presented together with statistical analysis. In a discussion of the results, the paper addresses the assertions that depth perception in physical reality and its virtual representations in CAVE and Panorama are quantifiably different......; that differences are attributable to prior contextual experience and spatial ability of the viewer; and that general attributes of virtual environments may be drawn from the experiments findings. The paper discusses implications of spatial ability for virtual environments in architectural education......This study compares aspects of spatial perception in a physical environment and its virtual representations in a CAVE and Panorama, based on the author?s recent empirical research. Participants in an experiment were shown objects identically placed in the virtual and physical environments...

Environment-quality demands

International Nuclear Information System (INIS)

Delfini, M.G.; Leenhouts, H.P.

1988-12-01

In the framework of the Environment Quality Requirements (MKE) project a model has been designed in which environment-quality demands have been defined and quantified, and a measuring strategy has been developed. In the model it is required for the quality of the environment that the radionuclide concentration in the various environment compartiments remains limited in order to keep the effective dose equivalence for the 'reference man' under a certain reference level. In order to be able to determine the maximum nuclide concentration it is necessary to quantify the relation between the concentration in the environment and the dose for the people. The quantitative relation between concentration and dose has been established on the base of parameters (Derived Activity Limits (DAL's) which have to be calculated for each environment compartiment, each nuclide and each exposure pathway. This model has been described and, as example, the DAL's have been calculated for the compartiment air (for which the two exposure pathways inhalation and direct radiation were considered). For the other environment compartiments a similar elaboration is needed. The feasibility of application of the MKE-model in the actual practice of measurements in the environment and examination of dose for the population depends upon the possibility for performing nuclide specific measurements in all environment compartiments, the level of the dose resulting from the contamination of the environment and the related accurateness of the measurements

Extreme environment electronics

CERN Document Server

Cressler, John D

2012-01-01

Unfriendly to conventional electronic devices, circuits, and systems, extreme environments represent a serious challenge to designers and mission architects. The first truly comprehensive guide to this specialized field, Extreme Environment Electronics explains the essential aspects of designing and using devices, circuits, and electronic systems intended to operate in extreme environments, including across wide temperature ranges and in radiation-intense scenarios such as space. The Definitive Guide to Extreme Environment Electronics Featuring contributions by some of the world's foremost exp

Encapsulated environment

NARCIS (Netherlands)

McLellan, Tom M.; Daanen, Hein A M; Cheung, Stephen S.

2013-01-01

In many occupational settings, clothing must be worn to protect individuals from hazards in their work environment. However, personal protective clothing (PPC) restricts heat exchange with the environment due to high thermal resistance and low water vapor permeability. As a consequence, individuals

Encapsulated Environment

NARCIS (Netherlands)

McLellan, T.M.; Daanen, H.A.M.; Cheung, S.S.

2013-01-01

In many occupational settings, clothing must be worn to protect individuals from hazards in their work environment. However, personal protective clothing (PPC) restricts heat exchange with the environment due to high thermal resistance and low water vapor permeability. As a consequence, individuals

Environment and sustainability

DEFF Research Database (Denmark)

Paavola, Jouni; Røpke, Inge

2015-01-01

This chapter reviews socio-economic research on the environment and sustainability. The chapter first explores core aspects of socio-economics, examines how socio-economics has related to the agenda of research on the environment, and assesses how socio-economic research on the environment became...... institutionalized. We consider that the environment has not been high on the agenda of the socio-economic research community but that there is a substantial amount of socio-economic research on the environment in the ecological economics and other research communities. The chapter then examines the research...... on institutional sources of environmental problems on monetary valuation and environmental decision-making as two areas where socio-economics has had a particularly strong influence. The chapter concludes that the acknowledgement in these areas of research of ecological and social embeddedness has given rise...

Pesticides and the Environment

Science.gov (United States)

; Environment Human Health Animal Health Safe Use Practices Food Safety Environment Air Water Soil Wildlife Home Page Pesticides and the Environment Related Topics: What Happens to Pesticides Released into the Environment? Pesticide Storage Pesticide Disposal Pesticide Products Integrated Pest Management (IPM) How Safe

Association of phytoplasmas and viruses with malformed clovers

Czech Academy of Sciences Publication Activity Database

Fránová, Jana; Paltrinieri, S.; Botti, S.; Šimková, Marie; Bertaccini, A.

2004-01-01

Roč. 49, č. 5 (2004), s. 617-624 ISSN 0015-5632 R&D Projects: GA AV ČR IBS5051014 Institutional research plan: CEZ:AV0Z5051902 Keywords : mycoplasma-like organismus * viruses * clovers * classification Subject RIV: EE - Microbiology, Virology Impact factor: 1.034, year: 2004

Diverse phytoplasmas associated with leguminus crops in Russia

Science.gov (United States)

A large scale survey of diseased legume plants (mainly clover and alfalfa in the Fabaceae family) was conducted from 2009-2013 in four Economic Regions of Russia - Northern (Arkhangelsk and Vologda oblast), Central (Moscow oblast), Volga (Samara oblast) and West Siberian (Novosibirsk oblast). The m...

Computing environment logbook

Science.gov (United States)

Osbourn, Gordon C; Bouchard, Ann M

2012-09-18

A computing environment logbook logs events occurring within a computing environment. The events are displayed as a history of past events within the logbook of the computing environment. The logbook provides search functionality to search through the history of past events to find one or more selected past events, and further, enables an undo of the one or more selected past events.

DCE. Future IHEP's computing environment

International Nuclear Information System (INIS)

Zheng Guorui; Liu Xiaoling

1995-01-01

IHEP'S computing environment consists of several different computing environments established on IHEP computer networks. In which, the BES environment supported HEP computing is the main part of IHEP computing environment. Combining with the procedure of improvement and extension of BES environment, the authors describe development of computing environments in outline as viewed from high energy physics (HEP) environment establishment. The direction of developing to distributed computing of the IHEP computing environment based on the developing trend of present distributed computing is presented

Parliamentarians and environment

International Nuclear Information System (INIS)

Boy, D.

2004-01-01

The data presented in this report come from an inquiry carried out by Sofres between March 5 and April 23, 2003, with a sample of 200 parliamentarians (122 deputies and 78 senators) who explained their attitude with respect to the question of environment. The questionnaire comprises 5 main dimensions dealing with: the relative importance of the environment stake, the attitudes with respect to past, present and future environment policies, the attitude with respect to specific stakes (energy, wastes), the attitude with respect to some problems of conservation of the natural heritage, and the attitude with respect to the participation of the public to some environment-related decisions. (J.S.)

Energy and environment

International Nuclear Information System (INIS)

Spurny, Z.

1987-01-01

The objectives and the proceedings are presented of the conference ''Energy and the environment'' held in Pardubice, Czechoslovakia, on 9-10 June, 1987. A total of 31 papers were presented; 4 papers were centred on nuclear power: an assessment of the impact of ionizing radiation from power generation on the health of the population and on the environment; an assessment of the impact of the nuclear power plant complex in the Jaslovske Bohunice locality on the environment; an assessment of the impact of the Vychodni Cechy (Eastern Bohemia) plant on the environment; and a paper on the ecological optimization of the landscape during the development of the uranium industry. (J.B.)

The COURAGE Built Environment Outdoor Checklist: an objective built environment instrument to investigate the impact of the environment on health and disability.

Science.gov (United States)

Quintas, Rui; Raggi, Alberto; Bucciarelli, Paola; Franco, Maria Grazia; Andreotti, Alessandra; Caballero, Francisco Félix; Olaya, Beatriz; Chatterji, Somnath; Galas, Aleksander; Meriläinen-Porras, Satu; Frisoni, Giovanni; Russo, Emanuela; Minicuci, Nadia; Power, Mick; Leonardi, Matilde

2014-01-01

A tool to assess the built environment, which takes into account issues of disability, accessibility and the need for data comparable across countries and populations, is much needed. The Collaborative Research on Ageing in Europe (COURAGE) in Europe Built Environment Outdoor Checklist (CBE-OUT) helps us to understand when features of the neighbourhood environment have either a positive or negative impact on the accessibility of neighbourhoods for healthy ageing. The CBE-OUT is composed of 128 items that can be recorded when present in the evaluated environment. Audits were performed in households randomly selected from each cluster of the sample for Finland, Poland and Spain, following precise rules defined by experts. Global scores were computed both section by section and in the overall checklist, rescaling the resulting scores from 0 (negative environment) to 100 (positive). The total number of completed CBE-OUT checklists was 2452 (Finland, 245; Poland, 972; and Spain, 1235). Mean global score for our sample is 49.3, suggesting an environment composed both of facilitating and hindering features. Significant differences were observed in the built environment features of the three countries and in particular between Finland and the other two. The assessment of features of built environment is crucial when thinking about ageing and enhanced participation. The COURAGE in Europe project developed this tool to collect information on built environment in an objective evaluation of environmental features and is a recommended methodology for future studies. The CBE-OUT checklist is an objective evaluation of the built environment and is centred on technical measurement of features present in the environment and has its foundations in the concepts of disability and accessibility operating in the International Classification of Functioning, Disability and Health (ICF) model. The CBE-OUT checklist can be analysed using both the total score and the single section score

Perennial Environment Observatory

International Nuclear Information System (INIS)

Plas, Frederic

2014-07-01

The Perennial Environment Observatory [Observatoire Perenne de l'Environnement - OPE] is a unique approach and infrastructure developed and implemented by ANDRA, the French National Radioactive Waste Management Agency, as part of its overall project of deep geological disposal for radioactive waste. Its current mission is to assess the initial state of the rural (forest, pasture, open-field and aquatic) environment, prior to repository construction. This will be followed in 2017 (pending construction authorizations) and for a period exceeding a century, by monitoring of any impact the repository may have on the environment. In addition to serving its own industrial purpose of environmental monitoring, ANDRA also opens the OPE approach, infrastructure and acquired knowledge (database...) to the scientific community to support further research on long term evolution of the environment subjected to natural and anthropogenic stresses, and to contribute to a better understanding of the interaction between the various compartments of the environment

The marketing environment

OpenAIRE

Camilleri, Mark Anthony

2017-01-01

The tourism marketing environment consists of internal and external forces which could impact the organisations’ performance. To be successful, companies must adapt to ongoing trends and developments in their macro and micro environments. When organisations scan their marketing environment they will be in a position to deal with any possible threats from the market and to capitalise on any available opportunities. Therefore, this chapter explains the external environmental factors, including;...

INTERNAL ENVIRONMENT ANALYSIS TECHNIQUES

Directory of Open Access Journals (Sweden)

Caescu Stefan Claudiu

2011-12-01

Full Text Available Theme The situation analysis, as a separate component of the strategic planning, involves collecting and analysing relevant types of information on the components of the marketing environment and their evolution on the one hand and also on the organization’s resources and capabilities on the other. Objectives of the Research The main purpose of the study of the analysis techniques of the internal environment is to provide insight on those aspects that are of strategic importance to the organization. Literature Review The marketing environment consists of two distinct components, the internal environment that is made from specific variables within the organization and the external environment that is made from variables external to the organization. Although analysing the external environment is essential for corporate success, it is not enough unless it is backed by a detailed analysis of the internal environment of the organization. The internal environment includes all elements that are endogenous to the organization, which are influenced to a great extent and totally controlled by it. The study of the internal environment must answer all resource related questions, solve all resource management issues and represents the first step in drawing up the marketing strategy. Research Methodology The present paper accomplished a documentary study of the main techniques used for the analysis of the internal environment. Results The special literature emphasizes that the differences in performance from one organization to another is primarily dependant not on the differences between the fields of activity, but especially on the differences between the resources and capabilities and the ways these are capitalized on. The main methods of analysing the internal environment addressed in this paper are: the analysis of the organizational resources, the performance analysis, the value chain analysis and the functional analysis. Implications Basically such

Synthetic environments

Science.gov (United States)

Lukes, George E.; Cain, Joel M.

1996-02-01

The Advanced Distributed Simulation (ADS) Synthetic Environments Program seeks to create robust virtual worlds from operational terrain and environmental data sources of sufficient fidelity and currency to interact with the real world. While some applications can be met by direct exploitation of standard digital terrain data, more demanding applications -- particularly those support operations 'close to the ground' -- are well-served by emerging capabilities for 'value-adding' by the user working with controlled imagery. For users to rigorously refine and exploit controlled imagery within functionally different workstations they must have a shared framework to allow interoperability within and between these environments in terms of passing image and object coordinates and other information using a variety of validated sensor models. The Synthetic Environments Program is now being expanded to address rapid construction of virtual worlds with research initiatives in digital mapping, softcopy workstations, and cartographic image understanding. The Synthetic Environments Program is also participating in a joint initiative for a sensor model applications programer's interface (API) to ensure that a common controlled imagery exploitation framework is available to all researchers, developers and users. This presentation provides an introduction to ADS and the associated requirements for synthetic environments to support synthetic theaters of war. It provides a technical rationale for exploring applications of image understanding technology to automated cartography in support of ADS and related programs benefitting from automated analysis of mapping, earth resources and reconnaissance imagery. And it provides an overview and status of the joint initiative for a sensor model API.

Environment | Argonne National Laboratory

Science.gov (United States)

Skip to main content Argonne National Laboratory Toggle Navigation Toggle Search Energy Environment Laboratory About Safety News Careers Education Community Diversity Directory Energy Environment National Security User Facilities Science Work with Us Environment Atmospheric and Climate Science Ecological

Global environment and cogeneration

International Nuclear Information System (INIS)

Miyahara, Atsushi

1992-01-01

The environment problems on global scale have been highlighted in addition to the local problems due to the rapid increase of population, the increase of energy demand and so on. The global environment summit was held in Brazil. Now, global environment problems are the problems for mankind, and their importance seems to increase toward 21st century. In such circumstances, cogeneration can reduce carbon dioxide emission in addition to energy conservation, therefore, attention has been paid as the countermeasure for global environment. The background of global environment problems is explained. As to the effectiveness of cogeneration for global environment, the suitability of city gas to environment, energy conservation, the reduction of carbon dioxide and nitrogen oxides emission are discussed. As for the state of spread of cogeneration, as of March, 1992, those of 2250 MW in terms of power generation capacity have been installed in Japan. It is forecast that cogeneration will increase hereafter. As the future systems of cogeneration, city and industry energy center conception, industrial repowering, multiple house cogeneration and fuel cells are described. (K.I.)

Optimization of dairy cattle breeding programs for different environment with genotype by environment interaction

NARCIS (Netherlands)

Mulder, H.A.; Veerkamp, R.F.; Ducro, B.J.; Arendonk, van J.A.M.; Bijma, P.

2006-01-01

Dairy cattle breeding organizations tend to sell semen to breeders operating in different environments and genotype × environment interaction may play a role. The objective of this study was to investigate optimization of dairy cattle breeding programs for 2 environments with genotype × environment

Enacting Environments

DEFF Research Database (Denmark)

Lippert, Ingmar

2013-01-01

Enacting Environments is an ethnography of the midst of the encounter between corporations, sustainable development and climate change. At this intersection 'environmental management' and 'carbon accounting' are put into practice. Purportedly, these practices green capitalism. Drawing on fieldwork...... of day-to-day practices of corporate environmental accountants and managers, Ingmar Lippert reconstructs their work as achieving to produce a reality of environment that is simultaneously stable and flexible enough for a particular corporate project: to stage the company, and in consequence capitalism......, as in control over its relations to an antecedent environment. Not confined to mere texts or meetings between shiny stakeholders co-governing the corporation – among them some of the world's biggest auditing firms, an environmental non-governmental organisation (NGO) and standards – control is found...

Virtual interface environment

Science.gov (United States)

Fisher, Scott S.

1986-01-01

A head-mounted, wide-angle, stereoscopic display system controlled by operator position, voice and gesture has been developed for use as a multipurpose interface environment. The system provides a multisensory, interactive display environment in which a user can virtually explore a 360-degree synthesized or remotely sensed environment and can viscerally interact with its components. Primary applications of the system are in telerobotics, management of large-scale integrated information systems, and human factors research. System configuration, application scenarios, and research directions are described.

Visualization Design Environment

Energy Technology Data Exchange (ETDEWEB)

Pomplun, A.R.; Templet, G.J.; Jortner, J.N.; Friesen, J.A.; Schwegel, J.; Hughes, K.R.

1999-02-01

Improvements in the performance and capabilities of computer software and hardware system, combined with advances in Internet technologies, have spurred innovative developments in the area of modeling, simulation and visualization. These developments combine to make it possible to create an environment where engineers can design, prototype, analyze, and visualize components in virtual space, saving the time and expenses incurred during numerous design and prototyping iterations. The Visualization Design Centers located at Sandia National Laboratories are facilities built specifically to promote the ''design by team'' concept. This report focuses on designing, developing and deploying this environment by detailing the design of the facility, software infrastructure and hardware systems that comprise this new visualization design environment and describes case studies that document successful application of this environment.

Hacking the hospital environment

DEFF Research Database (Denmark)

Boisen, Kirsten A; Boisen, Anne Bank; Thomsen, Stine Legarth

2017-01-01

BACKGROUND: There is a need for youth-friendly hospital environments as the ward environment may affect both patient satisfaction and health outcomes. OBJECTIVE: To involve young people in designing youth-friendly ward environment. METHODS: We arranged a design competition lasting 42 h (Hackathon...

The Integration of Personal Learning Environments & Open Network Learning Environments

Science.gov (United States)

Tu, Chih-Hsiung; Sujo-Montes, Laura; Yen, Cherng-Jyh; Chan, Junn-Yih; Blocher, Michael

2012-01-01

Learning management systems traditionally provide structures to guide online learners to achieve their learning goals. Web 2.0 technology empowers learners to create, share, and organize their personal learning environments in open network environments; and allows learners to engage in social networking and collaborating activities. Advanced…

Working Environment and Technological Development

DEFF Research Database (Denmark)

Clausen, Christian; Nielsen, Klaus T.; Jensen, Per Langaa

1997-01-01

and their and their concept of working environment2) Technology renewal, which considers the role of the working environment in connection with the development and use of concrete technologies3) Working environment planning, which considers the existing efforts to place the working environment in a planning process.......The paper describes the purpose, themes, overarching research questions and specific projects of the programme: Working Environment and Technological Development. The major research themes are:1) Management concepts and the working environment, which considers the visions...

Environment-effect reporting. Chapter 6

International Nuclear Information System (INIS)

Hermens, P.A.H.

1989-01-01

Environment-effect reporting is a tool in the resolution of one or more government bodies about activities which may have important disadvantageous impacts upon the environment. This chapter gives a treatment of environment-effect reporting as a process consisting of the preparation, draw-up, judgement and use of an environment-effect report (MER), followed by an evaluation. The contentsof an environment-effect report are indicated. The role of environment-effect reporting in relation with other procedures is discussed. Some experience with the application of environment-effect reporting is presented and a number of experiences in the application are discussed. (H.W.). 5 refs.; 3 figs.; 3 tabs

The PSIM environment architecture

NARCIS (Netherlands)

Goossenaerts, J.B.M.; Reyneri, C.; van den Berg, R.J.; Eijnatten, van F.M.

2002-01-01

Abstract. This chapter describes the architecture of the PSIM environment. It briefly presents the PSIM objectives and the role the PSIM environment plays in meeting these objectives. It then states the role and place of each of technological components of the environment: the ontology, the

Work environment quality

DEFF Research Database (Denmark)

Knudsen, Herman; Busck, Ole Gunni; Lind, Jens

2011-01-01

The article explores how employee participation influences the quality of the work environment and workers’ well-being at 11 Danish workplaces from within six different industries. Both direct participation and representative forms of participation at the workplace level were studied. Statistical...... as well as qualitative comparative analyses reveal that work environment quality and high levels of participation go hand in hand. Within a typology of participation models the highest level of participation, including strong elements of collective participation, and also the best work environment...

A palliative environment

DEFF Research Database (Denmark)

Timmermann, Connie; Uhrenfeldt, Lisbeth; Høybye, Mette Terp

2015-01-01

The findings show a tension between clinical and technical sensory impressions and more aesthetic ones in the hospital environment. Aesthetic elements in an environment dominated by many clinical impressions proved important for the patients’ positive thoughts and feelings. Aesthetic sensory...... impressions caused a sense of homeliness and familiarity in the hospital environment that was perceived by the patients as carrying a positive meaning. Clinical impressions, on the other hand, were generally associated with unfamiliarity and insecurity and were experienced as creating a negative mood....

Bluetooth helper environment

Science.gov (United States)

Zhang, Junbiao

2001-10-01

Handheld devices are gaining great popularity and becoming a common commodity on the market primarily due to their small sizes and mobile nature. However, these devices are all limited in capabilities, especially in terms of screen display, processing power, storage space and network access. Some of these limitations, such as the small screen sizes, are inherently difficult to improve given the usage model of these devices. In this paper, we propose a framework in which small handheld devices can use their environment, the devices around them, to expand their limited capabilities. Such an environment can be deployed in the office, at home for user convenience or in a public access area as a revenue generating service. A handheld device interacts with the helper environment through several essential steps including device discovery, service query, request transfer and remote control. In order to ensure the proper operation of such an environment, the framework provides essential system components for admission control, resource allocation, task scheduling and device coordination. We refer to such a framework as the device helper environment and discuss its system architecture and usage scenarios in this paper.

Global environment outlook GEO5. Environment for the future we want

Energy Technology Data Exchange (ETDEWEB)

NONE

2012-05-15

The main goal of UNEP's Global Environment Outlook (GEO) is to keep governments and stakeholders informed of the state and trends of the global environment. Over the past 15 years, the GEO reports have examined a wealth of data, information and knowledge about the global environment; identified potential policy responses; and provided an outlook for the future. The assessments, and their consultative and collaborative processes, have worked to bridge the gap between science and policy by turning the best available scientific knowledge into information relevant for decision makers. The GEO-5 report is made up of 17 chapters organized into three distinct but linked parts. Part 1 - State and trends of the global environment; Part 2 - Policy options from the regions; Part 3 - Opportunities for a global response.

Global environment outlook GEO5. Environment for the future we want

Energy Technology Data Exchange (ETDEWEB)

NONE

2012-05-15

The main goal of UNEP's Global Environment Outlook (GEO) is to keep governments and stakeholders informed of the state and trends of the global environment. Over the past 15 years, the GEO reports have examined a wealth of data, information and knowledge about the global environment; identified potential policy responses; and provided an outlook for the future. The assessments, and their consultative and collaborative processes, have worked to bridge the gap between science and policy by turning the best available scientific knowledge into information relevant for decision makers. The GEO-5 report is made up of 17 chapters organized into three distinct but linked parts. Part 1 - State and trends of the global environment; Part 2 - Policy options from the regions; Part 3 - Opportunities for a global response.

Virtual interface environment workstations

Science.gov (United States)

Fisher, S. S.; Wenzel, E. M.; Coler, C.; Mcgreevy, M. W.

1988-01-01

A head-mounted, wide-angle, stereoscopic display system controlled by operator position, voice and gesture has been developed at NASA's Ames Research Center for use as a multipurpose interface environment. This Virtual Interface Environment Workstation (VIEW) system provides a multisensory, interactive display environment in which a user can virtually explore a 360-degree synthesized or remotely sensed environment and can viscerally interact with its components. Primary applications of the system are in telerobotics, management of large-scale integrated information systems, and human factors research. System configuration, research scenarios, and research directions are described.

ENVIRONMENTS and EOL

DEFF Research Database (Denmark)

Pafilis, Evangelos; Pletscher-Frankild, Sune; Schnetzer, Julia

2015-01-01

are needed to facilitate large-scale analyses. Therefore, we developed ENVIRONMENTS, a fast dictionary-based tagger capable of identifying Environment Ontology (ENVO) terms in text. We evaluate the accuracy of the tagger on a new manually curated corpus of 600 Encyclopedia of Life (EOL) species pages. We use...... the tagger to associate taxa with environments by tagging EOL text content monthly, and integrate the results into the EOL to disseminate them to a broad audience of users. Availability and implementation: The software and the corpus are available under the open-source BSD and the CC-BY-NC-SA 3.0 licenses...

Environment and Growth

DEFF Research Database (Denmark)

Horii, Ryo; Ikefuji, Masako

. In a less developed country, this link, which we call “limits to growth,” emerges as the “poverty-environment trap,” which explains the persistent international inequality both in terms of income and environment. This link also threatens the sustainability of the world’s economic growth, particularly when...... the emission of greenhouse gases raises the risk of natural disasters. Stronger environmental policies are required to overcome this link. While there is a trade-off between the environment and growth in the short run, we show that an appropriate policy can improve both in the long run....

The modern research environment

DEFF Research Database (Denmark)

Topsøe, Flemming

1993-01-01

Information Technology, research environment, structured documents, networked information retrieval......Information Technology, research environment, structured documents, networked information retrieval...

Wood fuel and the environment

International Nuclear Information System (INIS)

Foster, C.A.

1992-01-01

The purpose of this paper is to try and demonstrate the role that the use of Wood as a Fuel can play in our environment. The term ''Wood Fuel'', for the purposes of these proceedings, refers to the use of wood obtained from the forest or the farm. It does not refer to waste wood from for example buildings. The role of wood fuel in the environment can be assessed at many different levels. In this paper three different scales of ''Environment'' and the role of wood fuel in each, will be considered. These three scales are namely the global environment, the local environment, and the National (community) environment. (Author)

Environment control system

International Nuclear Information System (INIS)

Sammarone, D.G.

1978-01-01

Disclosed is a system for controlling the environment of an enclosed area in nuclear reactor installations. The system permits the changing of the environment from nitrogen to air, or from air to nitrogen, without the release of any radioactivity or process gas to the outside atmosphere

Space radiation environment

International Nuclear Information System (INIS)

Garrett, H.B.

1998-01-01

Coupled with the increasing concern over trapped radiation effects on microelectronics, the availability of new data, long term changes in the Earth's magnetic field, and observed variations in the trapped radiation fluxes have generated the need for better, more comprehensive tools for modeling and predicting the Earth's trapped radiation environment and its effects on space systems. The objective of this report is to describe the current status of those efforts and review methods for attacking the issues associated with modeling the trapped radiation environment in a systematic, practical fashion. The ultimate goal will be to point the way to increasingly better methods of testing, designing, and flying reliable microelectronic systems in the Earth's radiation environment. The review will include a description of the principal models of the trapped radiation environment currently available--the AE8 and AP8 models. Recent results rom radiation experiments on spacecraft such as CRRES, SAMPEX, and CLEMENTINE will then be described. (author)

Mycotoxins in the soil environment

OpenAIRE

Elmholt, S.

2008-01-01

The paper outlines the current knowledge concerning fate of mycotoxins in the soil environment, including - outline of mycotoxins addressed (trichothecenes, zearalenone, fumonisins, aflatoxins, ochratoxins and patulin) - routes by which the mycotoxins enter the soil environment - routes by which they are immobilised or removed from the soil environment - mycotoxigenic fungi and mycotoxins in the soil environment

Nutrients in the Canadian environment: reporting on the state of Canada's environment

National Research Council Canada - National Science Library

Ironside, G. R

2001-01-01

.... This state of the environment (SOE) report on nutrients looks at how the Canadian environment is being affected by nitrogen and phosphorus compounds that are released as a result of human activities...

Mining the Home Environment.

Science.gov (United States)

Cook, Diane J; Krishnan, Narayanan

2014-12-01

Individuals spend a majority of their time in their home or workplace and for many, these places are our sanctuaries. As society and technology advance there is a growing interest in improving the intelligence of the environments in which we live and work. By filling home environments with sensors and collecting data during daily routines, researchers can gain insights on human daily behavior and the impact of behavior on the residents and their environments. In this article we provide an overview of the data mining opportunities and challenges that smart environments provide for researchers and offer some suggestions for future work in this area.

Mining the Home Environment

Science.gov (United States)

Cook, Diane J.; Krishnan, Narayanan

2014-01-01

Individuals spend a majority of their time in their home or workplace and for many, these places are our sanctuaries. As society and technology advance there is a growing interest in improving the intelligence of the environments in which we live and work. By filling home environments with sensors and collecting data during daily routines, researchers can gain insights on human daily behavior and the impact of behavior on the residents and their environments. In this article we provide an overview of the data mining opportunities and challenges that smart environments provide for researchers and offer some suggestions for future work in this area. PMID:25506128

Nurses' role transition from the clinical ward environment to the critical care environment.

Science.gov (United States)

Gohery, Patricia; Meaney, Teresa

2013-12-01

To explore the experiences of nurses moving from the ward environment to the critical care environment. Critical care areas are employing nurses with no critical care experience due to staff shortage. There is a paucity of literature focusing on the experiences of nurses moving from the ward environment to the critical care environment. A Heideggerian phenomenology research approach was used in this study. In-depth semi structured interviews, supported with an interview guide, were conducted with nine critical care nurses. Data analysis was guided by Van Manen (1990) approach to phenomenological analysis. Four main themes emerged: The highs and lows, you need support, theory-practice gap, struggling with fear. The participants felt ill prepared and inexperienced to work within the stressful and technical environment of critical care due to insufficient education and support. The study findings indicated that a variety of feelings and emotions are experienced by ward nurses who move into the stressful and technical environment of critical care due to insufficient skills and knowledge. More education and support is required to improve this transition process. Copyright © 2013 Elsevier Ltd. All rights reserved.

40 CFR 1508.14 - Human environment.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Human environment. 1508.14 Section 1508.14 Protection of Environment COUNCIL ON ENVIRONMENTAL QUALITY TERMINOLOGY AND INDEX § 1508.14 Human environment. Human environment shall be interpreted comprehensively to include the natural and...

Radioactivity and environment

Energy Technology Data Exchange (ETDEWEB)

Trivedi, R N [Fertilizer Association of India, New Delhi

1977-12-01

Power generation from radioisotopes is one of the major applications of nuclear energy for peaceful purposes and is in practice in over twenty countries including India. Other well-known applications of radioactive substances are in medicine, industry, scientific and industrial research programs, and nuclear weapons. The only serious disadvantage with the radioisotopes and their waste products is the constant release of radiation energy which contaminates the environment and endangers the life. An attempt has been made to identify the major sources of radioactivity in the environment and assess its potential impact on the environment. Recent developments in safety measures for prevention of contamination and control of radioactivity and in radioactive wastes management are also discussed.

Built environment and diabetes

Science.gov (United States)

Pasala, Sudhir Kumar; Rao, Allam Appa; Sridhar, G. R.

2010-01-01

Development of type 2 diabetes mellitus is influenced by built environment, which is, ‘the environments that are modified by humans, including homes, schools, workplaces, highways, urban sprawls, accessibility to amenities, leisure, and pollution.’ Built environment contributes to diabetes through access to physical activity and through stress, by affecting the sleep cycle. With globalization, there is a possibility that western environmental models may be replicated in developing countries such as India, where the underlying genetic predisposition makes them particularly susceptible to diabetes. Here we review published information on the relationship between built environment and diabetes, so that appropriate modifications can be incorporated to reduce the risk of developing diabetes mellitus. PMID:20535308

International cooperation for the environment

DEFF Research Database (Denmark)

Engfeldt, Lars-Göran; Kjellén, Bo; Liefferink, Duncan

2003-01-01

global environmental conference, the United Nations Conference on the Human Environment, was convened on 5 June 1972 in Stockholm. This day in June is now yearly celebrated as the World Environment Day. The motto of the Conference “Only One Earth,” was a revolutionary concept for its time, but is today...... go on without concern for the environment. The international agenda for the environment influences the life of everyone: it determines the price for gasoline, where we can build summer houses, and what food we can buy. This chapter will describe how international cooperation for the environment has...

America's Children and the Environment

Science.gov (United States)

... Labs and Research Centers America's Children and the Environment (ACE) Contact Us Share ACE presents key information ... of updates to ACE . America's Children and the Environment (ACE) America's Children and the Environment (ACE) is ...

Annual environment report 2012 - EDF Flamanville (annual report 2012 of environment survey)

International Nuclear Information System (INIS)

Delauge, A.

2013-01-01

After a presentation of the Flamanville site (history, operation principle of a nuclear plant, life of both units, impacts on the environment, organization, legislation, actions performed in 2012, ability management and communication regarding the management of the environment), this report presents the activity of Flamanville: production, events and incidents. It gives an overview of issues related to the control of impacts on the environment: radioactive releases, chemical and thermal releases, water resource management, dredging operations, conventional and nuclear wastes, radiological cleanliness, noise. Controls and inspections are indicated and briefly reported

DPC materials and corrosion environments.

Energy Technology Data Exchange (ETDEWEB)

Ilgen, Anastasia Gennadyevna; Bryan, Charles R.; Teich-McGoldrick, Stephanie; Hardin, Ernest

2014-10-01

After an exposition of the materials used in DPCs and the factors controlling material corrosion in disposal environments, a survey is given of the corrosion rates, mechanisms, and products for commonly used stainless steels. Research needs are then identified for predicting stability of DPC materials in disposal environments. Stainless steel corrosion rates may be low enough to sustain DPC basket structural integrity for performance periods of as long as 10,000 years, especially in reducing conditions. Uncertainties include basket component design, disposal environment conditions, and the in-package chemical environment including any localized effects from radiolysis. Prospective disposal overpack materials exist for most disposal environments, including both corrosion allowance and corrosion resistant materials. Whereas the behavior of corrosion allowance materials is understood for a wide range of corrosion environments, demonstrating corrosion resistance could be more technically challenging and require environment-specific testing. A preliminary screening of the existing inventory of DPCs and other types of canisters is described, according to the type of closure, whether they can be readily transported, and what types of materials are used in basket construction.

Environment, safety and health

International Nuclear Information System (INIS)

Luzianovich, L.Ch.; Fardeau, J.C.; Darras, M.

2000-01-01

Environment, safety and health were the three topics discussed by the WOC 8 working group of the worldwide gas congress. Environment protection has become a major preoccupation and constraint for natural gas industry at the dawn of the new millennium. It is closely linked with the safety of installation and with the health of workmen who exploit or use natural gas energy: methane emissions, health and safety in gas industry, environment management and evaluation. (J.S.)

Path planning in changeable environments

NARCIS (Netherlands)

Nieuwenhuisen, D.

2007-01-01

This thesis addresses path planning in changeable environments. In contrast to traditional path planning that deals with static environments, in changeable environments objects are allowed to change their configurations over time. In many cases, path planning algorithms must facilitate quick

Asparagus officinalis: A New Host of 'Candidatus Phytoplasma asteris'

Czech Academy of Sciences Publication Activity Database

Fránová, Jana; Petrzik, Karel

2010-01-01

Roč. 158, č. 4 (2010), s. 317-320 ISSN 0931-1785 R&D Projects: GA AV ČR(CZ) 1QS500510558 Institutional research plan: CEZ:AV0Z50510513 Keywords : 16S Ribosomal-RNA * mycoplasmalike organisms * gene-sequences Subject RIV: EE - Microbiology, Virology Impact factor: 0.937, year: 2010

Metacognitive components in smart learning environment

Science.gov (United States)

Sumadyo, M.; Santoso, H. B.; Sensuse, D. I.

2018-03-01

Metacognitive ability in digital-based learning process helps students in achieving learning goals. So that digital-based learning environment should make the metacognitive component as a facility that must be equipped. Smart Learning Environment is the concept of a learning environment that certainly has more advanced components than just a digital learning environment. This study examines the metacognitive component of the smart learning environment to support the learning process. A review of the metacognitive literature was conducted to examine the components involved in metacognitive learning strategies. Review is also conducted on the results of study smart learning environment, ranging from design to context in building smart learning. Metacognitive learning strategies certainly require the support of adaptable, responsive and personalize learning environments in accordance with the principles of smart learning. The current study proposed the role of metacognitive component in smart learning environment, which is useful as the basis of research in building environment in smart learning.

Environment, Trade, and Investment

Science.gov (United States)

Environment, trade, and investment are fundamentally linked as the environment provides many basic inputs of economic activity – forests, fisheries, metals, minerals – as well as the energy used to process those materials.

Fermi UNIX trademark environment

International Nuclear Information System (INIS)

Nicholls, J.

1991-03-01

The introduction of UNIX at Fermilab involves multiple platforms and multiple vendors. Additionally, a single user may have to use more than one platform. This heterogeneity and multiplicity makes it necessary to define a Fermilab environment for UNIX so that as much as possible the systems ''look and feel'' the same. We describe our environment, including both the commercial products and the local tools used to support it. Other products designed for the UNIX environment are also described. 19 refs

Radiation monitoring in the NPP environment, control of radioactivity in NPP-environment system

International Nuclear Information System (INIS)

Egorov, Yu.A.

1987-01-01

Problems of radiation monitoring and control of the NPP-environment system (NPPES) are considered. Radiation control system at the NPP and in the environment provides for the control of the NPP, considered as the source of radioactive releases in the environment and for the environmental radiation climate control. It is shown, that the radiation control of the NPP-environment system must be based on the ecological normalization principles of the NPP environmental impacts. Ecological normalization should be individual for the NPP region of each ecosystem. The necessity to organize and conduct radiation ecological monitoring in the NPP regions is pointed out. Radiation ecological monitoring will provide for both environmental current radiation control and information for mathematical models, used in the NPPES radiation control

Molds in the Environment

Science.gov (United States)

... on Facebook Tweet Share Compartir Molds in the Environment What are molds? What are some of the ... molds found? Molds are found in virtually every environment and can be detected, both indoors and outdoors, ...

The redefined environment

International Nuclear Information System (INIS)

Hermelin, Michel

1992-01-01

Although it seems an audacity to try to redefine the environment, the current interpretation of the concept of natural environment in Colombia makes necessary that task, with the purpose of arriving at the same time to a focus but realist and useful for those who should keep it in mind in the planning and in the taking of decisions. The definition of effective environment for most of the Colombians and diffused by entities like the Inderena it corresponds to a partial vision of the national reality. It is necessary to show to the country that that version is no-alone incomplete but dangerous, just as they have checked it the catastrophes of the last years that caused many kill and lost, fortunately the tendency of the last years on the part of some planners has been the one of conferring to the threats and the mineral resources the importance that it deserve. God willing that tendency be returns the denominator common of the whole studies dedicated to the ordination of the territory, so much urban as rural. This work recaptures and wide concepts that were presented previously by the author in several conferences and publications. The work understands a revision of the evolution of the environment concept in the first place in Colombia. They are made some observations next about the necessity of keeping in mind the geosciences in the use of the natural environment and are it finishes with the way to integrate those in the process of physical planning that it receives the name of environmental planning universally

Controlled Environment Specimen Transfer

DEFF Research Database (Denmark)

Damsgaard, Christian Danvad; Zandbergen, Henny W.; Hansen, Thomas Willum

2014-01-01

an environmental transmission electron microscope to an in situ X-ray diffractometer through a dedicated transmission electron microscope specimen transfer holder, capable of sealing the specimen in a gaseous environment at elevated temperatures. Two catalyst material systems have been investigated; Cu/ZnO/Al2O3...... transferred in a reactive environment to the environmental transmission electron microscope where further analysis on the local scale were conducted. The Co/Al2O3 catalyst was reduced in the environmental microscope and successfully kept reduced outside the microscope in a reactive environment. The in situ......Specimen transfer under controlled environment conditions, such as temperature, pressure, and gas composition, is necessary to conduct successive complementary in situ characterization of materials sensitive to ambient conditions. The in situ transfer concept is introduced by linking...

Quantum Darwinism in a Mixed Environment

Science.gov (United States)

Zwolak, Michael; Quan, H. T.; Zurek, Wojciech H.

2009-09-01

Quantum Darwinism recognizes that we—the observers—acquire our information about the “systems of interest” indirectly from their imprints on the environment. Here, we show that information about a system can be acquired from a mixed-state, or hazy, environment, but the storage capacity of an environment fragment is suppressed by its initial entropy. In the case of good decoherence, the mutual information between the system and the fragment is given solely by the fragment’s entropy increase. For fairly mixed environments, this means a reduction by a factor 1-h, where h is the haziness of the environment, i.e., the initial entropy of an environment qubit. Thus, even such hazy environments eventually reveal the state of the system, although now the intercepted environment fragment must be larger by ˜(1-h)-1 to gain the same information about the system.

Quantum Darwinism in hazy environments

Science.gov (United States)

Zwolak, Michael; Quan, H. T.; Zurek, Wojciech

2010-03-01

Quantum Darwinism provides an information-theoretic framework for the emergence of the classical world from the quantum substrate. It recognizes that we - the observers - acquire our information about the ``systems of interest'' indirectly from their imprints on the environment. Objectivity, a key property of the classical world, arises via the proliferation of redundant information into the environment where many observers can then intercept it and independently determine the state of the system. After a general introduction to this framework, we demonstrate how non-ideal initial states of the environment (e.g., mixed states) affect its ability to act as a communication channel for information about the system. The environment's capacity for transmitting information is directly related to its ability to increase its entropy. Therefore, environments that remain nearly invariant under the Hamiltonian dynamics, such as very mixed states, have a diminished ability to transmit information. However, despite this, the environment almost always redundantly transmits information about the system.

The hovercraft environment.

Science.gov (United States)

Lovesey, E J

1970-06-01

In just over a decade the hovercraft has progressed from first prototype to a successful commercial form of transport which also has the ability to penetrate many environments hitherto virtually inaccessible to manned vehicles. Comparison with rival short range vehicles such as the helicopter and hydrofoil show that the hovercraft has become one of the most versatile forms of transport available. This versatility and ability to operate in unusual or extreme environments has been accompanied by the problems of control and of protection of the occupants of the hovercraft from the hazards associated with these environments. Several of these problems are discussed, together with their possible solutions. This article is based on a paper given to the Nederlands Vereniging Voor Ergonomie/Ergonomics Research Society joint conference at Noordwijk in Holland, 11-13 June, 1969.

A User-Centric View of Intelligent Environments: User Expectations, User Experience and User Role in Building Intelligent Environments

Directory of Open Access Journals (Sweden)

Eija Kaasinen

2012-12-01

Full Text Available Our everyday environments are gradually becoming intelligent, facilitated both by technological development and user activities. Although large-scale intelligent environments are still rare in actual everyday use, they have been studied for quite a long time, and several user studies have been carried out. In this paper, we present a user-centric view of intelligent environments based on published research results and our own experiences from user studies with concepts and prototypes. We analyze user acceptance and users’ expectations that affect users’ willingness to start using intelligent environments and to continue using them. We discuss user experience of interacting with intelligent environments where physical and virtual elements are intertwined. Finally, we touch on the role of users in shaping their own intelligent environments instead of just using ready-made environments. People are not merely “using” the intelligent environments but they live in them, and they experience the environments via embedded services and new interaction tools as well as the physical and social environment. Intelligent environments should provide emotional as well as instrumental value to the people who live in them, and the environments should be trustworthy and controllable both by regular users and occasional visitors. Understanding user expectations and user experience in intelligent environments, and providing users with tools to influence the environments can help to shape the vision of intelligent environments into meaningful, acceptable and appealing service entities for all those who live and act in them.

Engineering Compensations in Web Service Environment

DEFF Research Database (Denmark)

Schäfer, Micahel; Dolog, Peter; Nejdl, Wolfgang

2007-01-01

Business to business integration has recently been performed by employing Web service environments. Moreover, such environments are being provided by major players on the technology markets. Those environments are based on open specifications for transaction coordination. When a failure in such a......Business to business integration has recently been performed by employing Web service environments. Moreover, such environments are being provided by major players on the technology markets. Those environments are based on open specifications for transaction coordination. When a failure...... in such an environment occurs, a compensation can be initiated to recover from the failure. However, current environments have only limited capabilities for compensations, and are usually based on backward recovery. In this paper, we introduce an engineering approach and an environment to deal with advanced...... compensations based on forward recovery principles. We extend the existing Web service transaction coordination architecture and infrastructure in order to support flexible compensation operations. A contract-based approach is being used, which allows the specification of permitted compensations at runtime. We...

Dicty_cDB: Contig-U08834-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available .. 40 0.012 11 ( AM422018 ) Candidatus Phytoplasma australiense complete genome. 36 0.012 19 ( AC005308 ) Pl...tig VV78X172452.29, whole genom... 42 0.081 3 ( FL645023 ) TS46-F4 Reticulitermes flavipes symbiont library ...AF053733 |pid:none) Expression vector pPK113, complete... 206 2e-51 T51932( T51932 ) kinesin [imported...*** f... 38 0.018 6 ( ER570718 ) 1093015791013 Global-Ocean-Sampling_GS-36-01-01-2... 46 0.018 3 ( DY888602 ...ulans strain w501 ki... 189 1e-46 AF319546_1( AF319546 |pid:none) Trypanosoma brucei C-term

40 CFR 1502.15 - Affected environment.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Affected environment. 1502.15 Section 1502.15 Protection of Environment COUNCIL ON ENVIRONMENTAL QUALITY ENVIRONMENTAL IMPACT STATEMENT § 1502.15 Affected environment. The environmental impact statement shall succinctly describe the...

Beyond Comfort in Built Environments

NARCIS (Netherlands)

Bazley, C.M.

2015-01-01

Every person on the planet lives a significant portion of his or her life in a built indoor environment. Ideally, the built environment serves as protection from the extremes of the outdoor environment and is preferably comfortable. The first ‘built environment’ was a painted cave. The cave served

24 CFR 1003.605 - Environment.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Environment. 1003.605 Section 1003... § 1003.605 Environment. (a) In order to assure that the policies of the National Environmental Policy Act... grantee shall comply with the Environment Review Procedures for Entities Assuming HUD Environmental...

Services for a radioactive environment

International Nuclear Information System (INIS)

Campbell, D.; Brown, P.E.

1981-01-01

Services for a radioactive environment are introduced through a plug in an enclosure for the radioactive environment. The plug is connectable to the enclosure by means of a double door unit so that removal of the plug can be effected without disturbing the integrity of the radioactive environment. To enable the plug to be removed, one of the doors is used to seal the enclosure, and the other door used to cover that portion of the plug that has been exposed to the radioactive environment. (author)

Heuristic Environments

Directory of Open Access Journals (Sweden)

Ines Giunta

2011-10-01

Full Text Available The purpose of this research is the identification of a paradigm which fixes the basic concepts and the type of logical relationships between them, whereby direct, govern and evaluate choises on new technologies. The contribution is based on the assumption that the complexity of knowledge is correlated with the complexity of the learning environment. From the existence of this correlation will descend a series of consequences that contribute to the definition of a theoretical construct in which the logical categories of learning become the guiding criteria on which to design learning environments and, consequently, also the indicators on by which to evaluate its effectiveness.

Smile: Student Modification in Learning Environments. Establishing Congruence between Actual and Preferred Classroom Learning Environment.

Science.gov (United States)

Yarrow, Allan; Millwater, Jan

1995-01-01

This study investigated whether classroom psychosocial environment, as perceived by student teachers, could be improved to their preferred level. Students completed the College and University Classroom Environment Inventory, discussed interventions, then completed it again. Significant deficiencies surfaced in the learning environment early in the…

Family environment and child development

Directory of Open Access Journals (Sweden)

Tina Kavčič

2005-04-01

Full Text Available The paper presents an overview of research findings on influence of family environment, especially parental behaviour, on child's development. Contemporary authors question early socialization researchers' claims that family characteristics and parental behaviour have important influence on behaviour of their children. Later researchers examined the size and durability of possible effects of family environment on child development. In addition, they focused on establishing whether it is actually the parental behaviour that influences child's development or, on the contrary, parental behaviour represents mainly a reaction to child's characteristics. Behaviour genetic studies have provided evidence that many traditional measures of family environment, including measures of parental behaviour, show genetic influence, thus reflecting genetically influenced child characteristics. Behaviour geneticists also suggest that environmental influences on child (personality development include predominantly non-shared environment, i.e. individual child's specific experiences, his/her own perceptions and interpretations of objectively same events. Based on empirically determined significant genetic effects on most behavioural traits and inconclusive results of studies on effects of family environment on child development some authors believe that it is not the parents, but rather genetic factor and/or peers who have the key role in child development. With respect to findings of behaviour genetics numerous recent studies of relations between family environment and child development involve child specific measures of (extrafamilial environment and examine the interactions between characteristics of an individual and those of his/her environment.

From virtual environment to virtual community

NARCIS (Netherlands)

Nijholt, Antinus; Terano, Takao; Nishida, Toyoaki; Namatame, Akira; Tsumoto, Syusaku; Ohsawa, Yukido; Washio, Takashi

2001-01-01

We discuss a virtual reality theater environment and its transition to a virtual community by adding domain agents and by allowing multiple users to visit this environment. The environment has been built using VRML (Virtual Reality Modeling Language). We discuss how our ideas about this environment

Animated BDP agents in virtual environments

NARCIS (Netherlands)

Nijholt, Antinus; Egges, A.; op den Akker, Hendrikus J.A.; Zwiers, Jakob; Krose, B.; de Rijke, M.; Schreiber, G.; van Someren, M.

2001-01-01

We introduce a Believes, Desires and Plans (BDP) agent that acts in a virtual environment using multi-modal interaction with the user. The environment is our virtual theatre environment. In this environment different agents have been introduced. In order to obtain a more uniform framework for agent

Space Flight Ionizing Radiation Environments

Science.gov (United States)

Koontz, Steve

2017-01-01

The space-flight ionizing radiation (IR) environment is dominated by very high-kinetic energy-charged particles with relatively smaller contributions from X-rays and gamma rays. The Earth's surface IR environment is not dominated by the natural radioisotope decay processes. Dr. Steven Koontz's lecture will provide a solid foundation in the basic engineering physics of space radiation environments, beginning with the space radiation environment on the International Space Station and moving outward through the Van Allen belts to cislunar space. The benefits and limitations of radiation shielding materials will also be summarized.

Environment, Safety & Health at SLAC

Science.gov (United States)

and safety of our staff, the community, and the environment as we carry out our scientific mission. We integral to each job. As stewards of our land, SLAC also seeks to minimize pollution to our environment and to protect our resources and biota. See the SLAC Environment, Safety and Health Policy for more

BISEN: Biochemical simulation environment

NARCIS (Netherlands)

Vanlier, J.; Wu, F.; Qi, F.; Vinnakota, K.C.; Han, Y.; Dash, R.K.; Yang, F.; Beard, D.A.

2009-01-01

The Biochemical Simulation Environment (BISEN) is a suite of tools for generating equations and associated computer programs for simulating biochemical systems in the MATLAB® computing environment. This is the first package that can generate appropriate systems of differential equations for

Precision in harsh environments

NARCIS (Netherlands)

French, P.; Krijnen, G.; Roozeboom, F.

2016-01-01

Microsystems are increasingly being applied in harsh and/or inaccessible environments, but many markets expect the same level of functionality for long periods of time. Harsh environments cover areas that can be subjected to high temperature, (bio)-chemical and mechanical disturbances,

Environment and Development

International Nuclear Information System (INIS)

Wandiga, S.O.; Abuodha, N.L.; Abuodha, N.L.; Beigutt, K.S.A.

1996-01-01

It contains research papers presented at Kenya Academy of Sciecnes on the theme 'Envoronment and Development' whose objectives are: to highlight levels of achievement and endeavour in scientific research in environment, it's management and related areas, provide a forum debate and exchange of ideas between researchers, policy makers, and the general public on environmental issues and their effect on society, identify gaps in environmental knowledge as a basis for further research. The following titles of the following papers summarizes the details of the presentations; Kenya Eco-systems and global climate change, Integrated Coastal Zone Management related to the Kenyan Coast, Global Climate Change:Implications of the low lying area coastal parts of Kenya, Organochlorine Pesticides:Curse or blessings of the Tropical Environment, Environmental Degradation and Health in Kenya, Urban Environment and City Health Crisis in Kenya: The planning and Resource Allocation Question, Women and Food Security, Food Production and Village based Food Processing Industries of selected plants, Impact of Earthquakes, volcanic Eruptions on the Environment and Human Induced Climate Changes,Myth or reality and The Practice and Principles in Environmental Law for Kenya. this an 'Analytic' record describing research paper presented at the proceedings and published on page 157-168

Community Food Environment, Home Food Environment, and Fruit and Vegetable Intake of Children and Adolescents

Science.gov (United States)

Ding, Ding; Sallis, James F.; Norman, Gregory J.; Saelens, Brian E.; Harris, Sion Kim; Kerr, Jacqueline; Rosenberg, Dori; Durant, Nefertiti; Glanz, Karen

2012-01-01

Objectives: To determine (1) reliability of new food environment measures; (2) association between home food environment and fruit and vegetable (FV) intake; and (3) association between community and home food environment. Methods: In 2005, a cross-sectional survey was conducted with readministration to assess test-retest reliability. Adolescents,…

Environment report 1990 of the Federal Minister for the Environment, Nature Protection and Reactor Safety

International Nuclear Information System (INIS)

1990-01-01

The 'Environment Report 1990' describes the environmental situation in the Federal Republic of Germany; draws a balance of environmental policy measures taken and introduced; gives information on future fields of action in environmental policy. The 'Environment Report 1990' also deals with the 'Environment Expert Opinion 1987', produced by the board of experts on environmental questions. It contains surveys of the following sectors: Protection against hazardous materials air pollution abatement, water management, waste management, nature protection and preservation of the countryside, soil conservation, noise abatement, radiation protection, reactor safety. A separate part of the 'Environment Report 1990' deals with the progress made in 'interdisciplinary fields' (general law on the protection of the environment, instruments of environmental policy, environmental information and environmental research, transfrontier environmental policy). (orig./HP) [de

Energy and environment

International Nuclear Information System (INIS)

Barrere, M.

1978-01-01

Energy problems will play a fundamental role in the near future and researchers, engineers, economists and ecologists must work together to increase existing non-fossil energy sources and to develop new sources or techniques using less energy without pollution of the environment. Four aspects of future activities in this field are considered. First, energy sources, ie solar, fossil, nuclear, geothermal, and others such as wind energy or wave energy are considered in relation to the environment. Secondly the use of these sources by industry and by transportation, domestic, and agricultural sectors are examined. The problem of energy conservation in all fields is then considered. Finally the overall optimisation is analysed. This is the search for a compromise between the cost of usable energy and that of a degradation function taking into account the effect on the environment. (U.K.)

Fungal contamination in hospital environments.

Science.gov (United States)

Perdelli, F; Cristina, M L; Sartini, M; Spagnolo, A M; Dallera, M; Ottria, G; Lombardi, R; Grimaldi, M; Orlando, P

2006-01-01

To assess the degree of fungal contamination in hospital environments and to evaluate the ability of air conditioning systems to reduce such contamination. We monitored airborne microbial concentrations in various environments in 10 hospitals equipped with air conditioning. Sampling was performed with a portable Surface Air System impactor with replicate organism detection and counting plates containing a fungus-selective medium. The total fungal concentration was determined 72-120 hours after sampling. The genera most involved in infection were identified by macroscopic and microscopic observation. The mean concentration of airborne fungi in the set of environments examined was 19 +/- 19 colony-forming units (cfu) per cubic meter. Analysis of the fungal concentration in the different types of environments revealed different levels of contamination: the lowest mean values (12 +/- 14 cfu/m(3)) were recorded in operating theaters, and the highest (45 +/- 37 cfu/m(3)) were recorded in kitchens. Analyses revealed statistically significant differences between median values for the various environments. The fungal genus most commonly encountered was Penicillium, which, in kitchens, displayed the highest mean airborne concentration (8 +/- 2.4 cfu/m(3)). The percentage (35%) of Aspergillus documented in the wards was higher than that in any of the other environments monitored. The fungal concentrations recorded in the present study are comparable to those recorded in other studies conducted in hospital environments and are considerably lower than those seen in other indoor environments that are not air conditioned. These findings demonstrate the effectiveness of air-handling systems in reducing fungal contamination.

Appropriating the Environment

DEFF Research Database (Denmark)

Meyer, Jan-Henrik

2011-01-01

Environmental policy has become an important area of European Union (EU) policy making, even though it had not originally been foreseen in the Treaty of Rome. Its emergence in the early 1970s can be understood as a result of a transfer of the novel policy idea of the environment to the European...... of the environment as a political concept emerging in the context of international organizations at the time. Secondly, an analysis of the first Environmental Action Programme of 1973 will be used to show how the EC conceptualized the environment, including the definition of problems and potential remedies. Thirdly...... level. This paper thus inquires into the emergence of a European environmental policy from a diffusion of ideas perspective. Rather than focusing on multi-level policy making it seeks to trace the diffusion of environmental ideas from the level of international organizations to the European Communities...

CERN and the environment

CERN Multimedia

Corinne Pralavorio

2016-01-01

New webpages answer common questions about CERN and the environment.   One of the new public webpages dedicated to CERN and the environment. Do your neighbours ever ask you about CERN’s environmental impact? And about radiation in particular? If so, the answers to those questions can now be found online on a new set of public webpages dedicated to CERN and the environment. These pages, put together by the Occupational Health, Safety and Environmental Protection (HSE) unit and the groups responsible for CERN's site maintenance, contain a wealth of information on topics linked to the environment, such as biodiversity at CERN, waste management, ionising radiation, and water and electricity consumption. “CERN forms part of the local landscape, with its numerous sites and scientific activities. It’s understandable that people living nearby have questions about the impact of these activities and it’s important that we respond with complete transp...

RIPE [robot independent programming environment]: A robot independent programming environment

International Nuclear Information System (INIS)

Miller, D.J.; Lennox, R.C.

1990-01-01

Remote manual operations in radiation environments are typically performed very slowly. Sensor-based computer-controlled robots hold great promise for increasing the speed and safety of remote operations; however, the programming of robotic systems has proven to be expensive and difficult. Generalized approaches to robot programming that reuse available software modules and employ programming languages which are independent of the specific robotic and sensory devices being used are needed to speed software development and increase overall system reliability. This paper discusses the robot independent programming environment (RIPE) developed at Sandia National Laboratories (SNL). The RIPE is an object-oriented approach to robot system architectures; it is a software environment that facilitates rapid design and implementation of complex robot systems for diverse applications. An architecture based on hierarchies of distributed multiprocessors provides the computing platform for a layered programming structure that models applications using software objects. These objects are designed to support model-based automated programming of robotic and machining devices, real-time sensor-based control, error handling, and robust communication

Mobile Robots in Human Environments

DEFF Research Database (Denmark)

Svenstrup, Mikael

intelligent mobile robotic devices capable of being a more natural and sociable actor in a human environment. More specific the emphasis is on safe and natural motion and navigation issues. First part of the work focus on developing a robotic system, which estimates human interest in interacting......, lawn mowers, toy pets, or as assisting technologies for care giving. If we want robots to be an even larger and more integrated part of our every- day environments, they need to become more intelligent, and behave safe and natural to the humans in the environment. This thesis deals with making...... as being able to navigate safely around one person, the robots must also be able to navigate in environments with more people. This can be environments such as pedestrian streets, hospital corridors, train stations or airports. The developed human-aware navigation strategy is enhanced to formulate...

The environments of Markarian galaxies

International Nuclear Information System (INIS)

Mackenty, J.W.; Simpson, C.; Mclean, B.

1990-01-01

The extensively studied Markarian sample of 1500 ultraviolet excess galaxies contains many Seyfert, starburst, and peculiar galaxies. Using the 20 minute V plates obtained for the construction of the Hubble Space Telescope Guide Star Catalog, the authors investigated the morphologies of the Markarian galaxies and the environments in which they are located. The relationship between the types of nuclear activity and the morphologies and environments of the Markarian galaxies is discussed. The authors conclude that the type of nuclear activity present in the galaxies of the Markarian sample is not dependent on either the morphology or the local environment of the galaxy. This is not to imply that nuclear activity per se is not influenced by the environment in which the nucleus is located. Rather the type of nuclear activity (at least in the Markarian population) does not appear to be determined by the environment

Environment stakes and policies

International Nuclear Information System (INIS)

Tronquoy, Ph.

2002-01-01

This document devoted to the environment discusses on the following topics: the environmental policies, the threats for the environment (climatic change, water management and risks), the deforestation, the sustainable development of cities, the safety first principle, the energy challenge, the international cooperation, the North-South relations. (A.L.B.)

Empowering a healthy practice environment.

Science.gov (United States)

Kushner, Jodi; Ruffin, Tasha

2015-03-01

This article provides frontline nurses a tool kit so they can advocate a healthy practice environment. The healthy nurse, healthy work hours, job satisfaction, adequate sleep, power naps at work, and balancing family/work are discussed. The overweight nurse, nurse fatigue, compassion fatigue, shift work sleep disorder, and role strain are discussed as barriers to a healthy practice environment. Case reports with analysis and recommendations are discussed to overcome these barriers. Resources are presented for frontline nurses to develop a tool kit for transforming their environment to a healthy practice environment and to empower them to become healthy nurses. Copyright © 2015 Elsevier Inc. All rights reserved.

Dust in cosmic plasma environments

International Nuclear Information System (INIS)

Mendis, D.A.

1979-01-01

Cosmic dust is invariably immersed in a plasma and a radiative environment. Consequently, it is charged to some electrostatic potential which depends on the properties of the environment as well as the nature of the dust. This charging affects the physical and dynamical properties of the dust. In this paper the basic aspects of this dust-plasma interaction in several cosmic environments - including planetary magnetospheres, the heliosphere and the interstellar medium - are discussed. The physical and dynamical consequences of the interaction, as well as the pertinent observational evidence, are reviewed. Finally, the importance of the surface charge during the condensation process in plasma environments is stressed. (Auth.)

Indoor Environment Program

International Nuclear Information System (INIS)

Daisey, J.M.

1993-06-01

This paper reports progress during the year 1992 in the Indoor Environment Program in the Energy and Environment Division of Lawrence Berkeley Laboratory. Studies in the following areas are reported: energy performance and ventilation in buildings; physical and chemical characterization of indoor air pollutants; indoor radon; indoor air quality; exposure to indoor air pollutants and risk analysis. Pollutants of particular interest include: radon; volatile, semi-volatile and particulate organic compounds; and combustion emissions including environmental tobacco smoke, carbon monoxide, and nitrogen oxides

Actions for the environment

CERN Document Server

Colloca, C

2003-01-01

As an International Organization, one the most important issues that CERN has to respect and guarantee is the protection of the environment. Several of ST activities and operations have a direct impact on the environment: civil engineering works, electrical (transformers) and air-cooling operation, chemical products storage, various waste disposal etc.... Important measures, taken in the past, have to be kept and new ones should be applied in order to insure the conformity of the infrastructure with existing legislation, the correct operation of equipment and systems, the constant monitoring of the different situations and the traceability of the events. Moreover good management of the environment would bring large savings to CERN.

School and workplace as learning environments

DEFF Research Database (Denmark)

Jørgensen, Christian Helms

In vocational education and training the school and the workplace are two different learning environments. But how should we conceive of a learning environment, and what characterizes the school and the workplace respectively as learning environments? And how can the two environ-ments be linked......? These questions are treated in this paper. School and workplace are assessed us-ing the same analytical approach. Thereby it is pointed out how different forms of learning are en-couraged in each of them and how different forms of knowledge are valued. On this basis sugges-tions are made about how to understand...

Anthropogenic radionuclides in the environment

Energy Technology Data Exchange (ETDEWEB)

Hu, Q; Weng, J; Wang, J

2007-11-15

Studies of radionuclides in the environment have entered a new era with the renaissance of nuclear energy and associated fuel reprocessing, geological disposal of high-level nuclear wastes, and concerns about national security with respect to nuclear non-proliferation. This work presents an overview of anthropogenic radionuclide contamination in the environment, as well as the salient geochemical behavior of important radionuclides. We first discuss the following major anthropogenic sources and current development that contribute to the radionuclide contamination of the environment: (1) nuclear weapons program; (2) nuclear weapons testing; (3) nuclear power plants; (4) commercial fuel reprocessing; (5) geological repository of high-level nuclear wastes, and (6) nuclear accidents. Then, we summarize the geochemical behavior for radionuclides {sup 99}Tc, {sup 129}I, and {sup 237}Np, because of their complex geochemical behavior, long half-lives, and presumably high mobility in the environment. Biogeochemical cycling and environment risk assessment must take into account speciation of these redox-sensitive radionuclides.

Nuclear installations and their environment

International Nuclear Information System (INIS)

Rieu, Ch.; Berge-Thierry, C.; Duval, C.; Bonnet, Ch.; Gaubert, B.; Riffard, Th.; Greffier, G.; Cervantes, J.C.; Le Breton, F.; Clement, C.; Charbonnier, R.; Andreani, A.M.; Maubert, H.; Maisonneuve, A.

2002-01-01

This dossier deals with protection of nuclear installations against external risks. The articles come from the presentations of the Conference on 'Nuclear installations and their environment', held by the 'Safety and Environment Protection' Section of the French Nuclear Energy Society on October 15, 2002. Floods, earthquakes, winter cold, snow-falls, wind, fires are the main natural risks taken into account. Risks from industrial environment and communication lines are also considered. (authors)

Natural radiation environment

International Nuclear Information System (INIS)

Vohra, K.G.; Mishra, U.C.; Pillai, K.C.; Sadasivan, S.

1982-01-01

The volume presented contains papers presented at the Second Special Symposium on Natural Radiation Environment held at Bombay, India, during January 1981. The papers deal with such topics as : 1)high natural radiation background areas; 2)environmental natural radioactivity; 3)measurement techniques; 4)technologically enhanced radioactivity; 5)indoor radiation environment; 6)radon and daughters in ambient air, and 7)applications in Geosciences. Each of the 87 papers presented has been abstracted and indexed for the U.S. Department of Energy Technical Information Center's Energy Data Base

Gamification, Social Networks and Sustainable Environments

Directory of Open Access Journals (Sweden)

Fábio Silva

2013-12-01

Full Text Available Intelligent environments and ambient intelligence enabled systems provide means to gather rich information from both environments and its users. With the help of such systems, it is possible to foster communities of ambient intelligence systems with community driven knowledge, which is created by individual actions and setups in each of the environments. Such arrangements provides the potential to build systems that promote better practices and more efficient and sustainable environments by promoting the community best examples and engaging users to adopt and develop proactive behaviors to improve their standings in the community. This work aims to use knowledge from communities of intelligent environments to their own benefit. The approach presented in this work uses information from different environments, ranking them according to their sustainability assessment. Recommendations are then computed using similarity and clustering functions ranking users and environments, updating their previous records and launching new recommendations in the process. Gamification concepts are used in order to keep users motivation and engage them actively to produce better results in terms of sustainability.

[Healthy school environments].

Science.gov (United States)

Quintero-Corzo, Josefina; Munévar-Molina, Raúl A; Munévar-Quintero, Fabio I

2015-04-01

Objective To determine factors that characterizes school environments and their relationship with student learning, welfare and health. Method This is a case study supported by a comprehensive qualitative paradigm applied to classroom ecology. The fieldwork was carried out in six public schools for students in economic strata one and two that use computers in virtual classrooms. The information was collected through field journals, film recordings, observation, and recordings of interviews. The information was analyzed by categories in open general and focused cycles. Results The virtual era has enriched the debate about the importance of the environment in pedagogical processes. Nonetheless, the emergence of new diseases is a risk which students are exposed to. Pollution and overcrowding factors prevail in traditional classroom activities, while in the computer rooms the environment is healthier. Hence the need to incorporate these issues into the curriculum reforms and action plans to guide healthy living of schoolchildren and their families. Despite budget constraints, innovative ideas and projects were found. Schools have developed free preventive and corrective strategies such as workshops, talks and lectures by invited specialists, trainees, and students writing theses. They have also introduced controlled Internet access. Conclusion The educational community understands that the concept of health is at the heart of a comprehensive concept of education. In addition, classroom ecology has determining implications for learning and living together in pleasant and healthy environments that are incorporated into institutional educational projects.

Suppressing decoherence by preparing the environment

International Nuclear Information System (INIS)

Landon-Cardinal, Olivier; MacKenzie, Richard

2013-01-01

To protect a quantum system from decoherence due to interaction with its environment, we investigate the existence of initial states of the environment allowing for decoherence-free evolution of the system. For a class of models in which a two-state system and a dynamical environment interact through a Hamiltonian restricted to be a tensor product, we prove that such states exist if and only if the interaction and self-evolution Hamiltonians of the environment share an eigenstate. If decoherence by state preparation is not possible, we show that initial states minimizing decoherence result from a delicate compromise between the environment and interaction dynamics

Pollutant dispersion in built environment

CERN Document Server

Ming, Tingzhen; Gong, Tingrui; Li, Zhengtong

2017-01-01

This book discusses energy transfer, fluid flow and pollution in built environments. It provides a comprehensive overview of the highly detailed fundamental theories as well as the technologies used and the application of heat and mass transfer and fluid flow in built environments, with a focus on the mathematical models and computational and experimental methods. It is a valuable resource for researchers in the fields of buildings and environment, heat transfer and global warming.

Ionizing radiation in environment

International Nuclear Information System (INIS)

Jandl, J.; Petr, I.

1988-01-01

The basic terms are explained such as the atom, radioactivity, nuclear reaction, interaction of ionizing radiation with matter, etc. The basic dosimetric variables and units and properties of radionuclides and ionizing radiation are given. Natural and artificial sources of ionizing radiation are discussed with regard to the environment and the propagation and migration of radionuclides is described in the environment to man. The impact is explained of ionizing radiation on the cell and the somatic and genetic effects of radiation on man are outlined. Attention is devoted to protection against ionizing radiation and to radiation limits, also to the detection, dosimetry and monitoring of ionizing radiation in the environment. (M.D.). 92 figs., 40 tabs. 74 refs

Gamification, social networks and sustainable environments

OpenAIRE

Silva, Fábio; Analide, César; Rosa, Luís; Felgueiras, Gilberto; Pimenta, Cedric

2013-01-01

Intelligent environments and ambient intelligence enabled systems provide means to gather rich information from both environments and its users. With the help of such systems, it is possible to foster communities of ambient intelligence systems with community driven knowledge, which is created by individual actions and setups in each of the environments. Such arrangements provides the potential to build systems that promote better practices and more efficient and sustainable environments by p...

Anatomy education environment measurement inventory: A valid tool to measure the anatomy learning environment.

Science.gov (United States)

Hadie, Siti Nurma Hanim; Hassan, Asma'; Ismail, Zul Izhar Mohd; Asari, Mohd Asnizam; Khan, Aaijaz Ahmed; Kasim, Fazlina; Yusof, Nurul Aiman Mohd; Manan Sulong, Husnaida Abdul; Tg Muda, Tg Fatimah Murniwati; Arifin, Wan Nor; Yusoff, Muhamad Saiful Bahri

2017-09-01

Students' perceptions of the education environment influence their learning. Ever since the major medical curriculum reform, anatomy education has undergone several changes in terms of its curriculum, teaching modalities, learning resources, and assessment methods. By measuring students' perceptions concerning anatomy education environment, valuable information can be obtained to facilitate improvements in teaching and learning. Hence, it is important to use a valid inventory that specifically measures attributes of the anatomy education environment. In this study, a new 11-factor, 132-items Anatomy Education Environment Measurement Inventory (AEEMI) was developed using Delphi technique and was validated in a Malaysian public medical school. The inventory was found to have satisfactory content evidence (scale-level content validity index [total] = 0.646); good response process evidence (scale-level face validity index [total] = 0.867); and acceptable to high internal consistency, with the Raykov composite reliability estimates of the six factors are in the range of 0.604-0.876. The best fit model of the AEEMI is achieved with six domains and 25 items (X 2  = 415.67, P education environment in Malaysia. A concerted collaboration should be initiated toward developing a valid universal tool that, using the methods outlined in this study, measures the anatomy education environment across different institutions and countries. Anat Sci Educ 10: 423-432. © 2017 American Association of Anatomists. © 2017 American Association of Anatomists.

Environment as datascape

DEFF Research Database (Denmark)

Lippert, Ingmar

2014-01-01

as configuring carbon-as-dataspace, I argue, allows grasping adequately the contingency and constraints of managing carbon as a particular mate- rial-discursive form of environment. In conclusion I generalise the environmental management office as a space that can be configured to stage, beyond carbon, other......Ecological modernist approaches to climate change are premised upon knowing carbon emissions. I ask how corporate environmental managers know and do carbon, i.e., shape the reality of emissions. I argue that for managers’ practical purposes carbon exists as malleable data. Based on ethnographic...... global environments as well....

Pervasive Learning Environments

DEFF Research Database (Denmark)

Hundebøl, Jesper; Helms, Niels Henrik

2006-01-01

The potentials of pervasive communication in learning within industry and education are right now being explored through different R&D projects. This paper outlines the background for and the possible learning potentials in what we describe as pervasive learning environments (PLE). PLE?s differ...... from virtual learning environments (VLE) primarily because in PLE?s the learning content is very much related to the actual context in which the learner finds himself. Two local (Denmark) cases illustrate various aspects of pervasive learning. One is the eBag, a pervasive digital portfolio used...

Designing Creative Learning Environments

Directory of Open Access Journals (Sweden)

Thomas Cochrane

2015-05-01

Full Text Available Designing creative learning environments involves not only facilitating student creativity, but also modeling creative pedagogical practice. In this paper we explore the implementation of a framework for designing creative learning environments using mobile social media as a catalyst for redefining both lecturer pedagogical practice, as well as redesigning the curriculum around student generated m-portfolios.

Environment annual report 1993

International Nuclear Information System (INIS)

1994-01-01

In the 1993 Environment Annual Report for BNFL, data are presented for radioactive discharges to the environment and their associated doses to the criteria group members of the public in the vicinity of Sellafield, Drigg, Chapelcross, Springfields and Capenhurst. Similarly, data are also presented for non-radioactive discharges to water and air for each site. (UK)

Exploring the Bacterial Microbiota of Colombian Fermented Maize Dough "Masa Agria" (Maiz Añejo).

Science.gov (United States)

Chaves-Lopez, Clemencia; Serio, Annalisa; Delgado-Ospina, Johannes; Rossi, Chiara; Grande-Tovar, Carlos D; Paparella, Antonello

2016-01-01

Masa Agria is a naturally fermented maize dough produced in Colombia, very common in the traditional gastronomy. In this study we used culture-dependent and RNA-based pyrosequencing to investigate the bacterial community structure of Masa Agria samples produced in the south west of Colombia. The mean value of cell density was 7.6 log CFU/g of presumptive lactic acid bacteria, 5.4 log cfu/g for presumptive acetic bacteria and 5.6 og CFU/g for yeasts. The abundance of these microorganisms is also responsible for the low pH (3.1-3.7) registered. Although the 16S rRNA pyrosequencing revealed that the analyzed samples were different in bacteria richness and diversity, the genera Lactobacillus, Weissella, and Acetobacter were predominant. In particular, the most common species were Lactobacillus plantarum and Acetobacter fabarum, followed by L. fermentum, L. vaccinostercus, and Pediococcus argentinicus. Several microorganisms of environmental origin, such as Dechloromonas and most of all Sphingobium spp., revealed in each sample, were detected, and also bacteria related to maize, such as Phytoplasma. In conclusion, our results elucidated for the first time the structures of the bacterial communities of Masa Agria samples obtained from different producers, identifying the specific dominant species and revealing a complete picture of the bacterial consortium in this specific niche. The selective pressure of tropical environments may favor microbial biodiversity characterized by a useful technological potential.

Environment, Health, and Safety - Construction Subcontractors Documents |

Science.gov (United States)

NREL Environment, Health, and Safety - Construction Subcontractors Documents Environment Environment, Health and Safety (EH&S) requirements are understood by construction subcontractors and with these requirements before submitting proposals and/or environment, health and safety plans for the

Maternal-by-environment but not genotype-by-environment interactions in a fish without parental care.

Science.gov (United States)

Vega-Trejo, Regina; Head, Megan L; Jennions, Michael D; Kruuk, Loeske E B

2018-01-01

The impact of environmental conditions on the expression of genetic variance and on maternal effects variance remains an important question in evolutionary quantitative genetics. We investigate here the effects of early environment on variation in seven adult life history, morphological, and secondary sexual traits (including sperm characteristics) in a viviparous poeciliid fish, the mosquitofish Gambusia holbrooki. Specifically, we manipulated food availability during early development and then assessed additive genetic and maternal effects contributions to the overall phenotypic variance in adults. We found higher heritability for female than male traits, but maternal effects variance for traits in both sexes. An interaction between maternal effects variance and rearing environment affected two adult traits (female age at maturity and male size at maturity), but there was no evidence of trade-offs in maternal effects across environments. Our results illustrate (i) the potential for pre-natal maternal effects to interact with offspring environment during development, potentially affecting traits through to adulthood and (ii) that genotype-by-environment interactions might be overestimated if maternal-by-environment interactions are not accounted for, similar to heritability being overestimated if maternal effects are ignored. We also discuss the potential for dominance genetic variance to contribute to the estimate of maternal effects variance.

From 'circumstances' to 'environment': Herbert Spencer and the origins of the idea of organism-environment interaction.

Science.gov (United States)

Pearce, Trevor

2010-09-01

The word 'environment' has a history. Before the mid-nineteenth century, the idea of a singular, abstract entity--the organism--interacting with another singular, abstract entity--the environment--was virtually unknown. In this paper I trace how the idea of a plurality of external conditions or circumstances was replaced by the idea of a singular environment. The central figure behind this shift, at least in Anglo-American intellectual life, was the philosopher Herbert Spencer. I examine Spencer's work from 1840 to 1855, demonstrating that he was exposed to a variety of discussions of the 'force of circumstances' in this period, and was decisively influenced by the ideas of Auguste Comte in the years preceding the publication of Principles of psychology (1855). It is this latter work that popularized the word 'environment' and the corresponding idea of organism--environment interaction--an idea with important metaphysical and methodological implications. Spencer introduced into the English-speaking world one of our most enduring dichotomies: organism and environment. Copyright © 2010 Elsevier Ltd. All rights reserved.

Energy and environment design guide

Energy Technology Data Exchange (ETDEWEB)

Harman, K. [Royal Australian Institute of Architects, Canberra, ACT (Australia)

1996-04-01

The Royal Australian Institute of Architects (RAIA) released an Environment Policy for architects in September 1994 which forms part of the RAIA Code of Professional Conduct. Prior to releasing the policy, it was recognised that members needed information and education in the area of energy and environment in order to adopt and implement the guide. This document is a report on the scope, work programme and achievements of a project to provide an easy reference resource for architects and other building designers, and bring together a wide range of information and research. It includes the Environment Policy as an appendix. The project produced 24 notes entitled the `Environment Design Guide - energy/environment notes` covering a wide range of topics, and four newsletters. Feedback received from architects to date indicates that the development of the notes has had a positive effect on their knowledge of these issues, resulting in the making of informed design decisions. The topics covered by the notes are expected to expand in 1996 with the preparation of additional notes which provide information on products and sustainable construction.

Entanglement reactivation in separable environments

International Nuclear Information System (INIS)

Pirandola, Stefano

2013-01-01

Combining two entanglement-breaking channels into a correlated-noise environment restores the distribution of entanglement. Surprisingly, this reactivation can be induced by the injection of separable correlations from the composite environment. In any dimension (finite or infinite), we can construct classically correlated ‘twirling’ environments which are entanglement-breaking in the transmission of single systems but entanglement-preserving when two systems are transmitted. Here entanglement is simply preserved by the existence of decoherence-free subspaces. Remarkably, even when such subspaces do not exist, a fraction of the input entanglement can still be distributed. This is found in separable Gaussian environments, where distillable entanglement is able to survive the two-mode transmission, despite being broken in any single-mode transmission by the strong thermal noise. In the Gaussian setting, entanglement restoration is a threshold process, occurring only after a critical amount of correlations has been injected. Such findings suggest new perspectives for distributing entanglement in realistic environments with extreme decoherence, identifying separable correlations and classical memory effects as physical resources for ‘breaking entanglement-breaking’. (paper)

Cogema and the environment. Environmental policy. The Cogema group in the environment service

International Nuclear Information System (INIS)

1997-01-01

This document presents the organization of the environmental policy at Cogema facilities. The first part presents the environmental policy of the group: integration of environment management at all levels, reduction of effluents and control of their environmental impact, integrating environment protection at the design stage of facilities, quality and improvement policy, expenses devoted to environment protection (investments, R and D, funds), public information. The second part concerns the transfer of Cogema's know-how in environmental engineering towards other industrial sectors: radioactivity measurements, mine and quarry sites rehabilitation, industrial wastes and effluents processing, decontamination and rehabilitation of ancient polluted industrial sites, foreign activities (rehabilitation of US-DOE military sites, aid to Eastern countries. (J.S.)

Interactive Environment Design in Smart City

Science.gov (United States)

Deng, DeXiang; Chen, LanSha; Zhou, Xi

2017-08-01

The interactive environment design of smart city is not just an interactive progress or interactive mode design, rather than generate an environment such as the “organic” life entity as human beings through interactive design, forming a smart environment with perception, memory, thinking, and reaction.

The aquatic environment

Energy Technology Data Exchange (ETDEWEB)

NONE

1975-10-15

The rapid increase in technological development and the broad societal benefit it has brought has been accompanied by a corresponding increase in environmental and societal problems. This has established a need to asses the impacts of new technologies, including nuclear industries. We are now entering an age which will see a rapid proliferation of nuclear power plants all over the world. As long as man continues to utilize nuclear energy, some releases of radioactive materials to the environment seem to be inescapable consequences. The problem therefore is to limit and control such releases, so that adverse effects on man and his environment can be reduced to acceptable levels. We can now draw on three decades of experience of the environmental impact of radioactive materials. To review this experience and to survey recent results of studies related to the safety of releases of nuclear facilities into fresh water, estuaries and sea water, the International Symposium on 'Radiological Impacts of Releases from Nuclear Facilities into Aquatic Environments' was held at Otaniemi, near Helsinki, Finland. (author)

Silicon carbide microsystems for harsh environments

CERN Document Server

Wijesundara, Muthu B J

2011-01-01

Silicon Carbide Microsystems for Harsh Environments reviews state-of-the-art Silicon Carbide (SiC) technologies that, when combined, create microsystems capable of surviving in harsh environments, technological readiness of the system components, key issues when integrating these components into systems, and other hurdles in harsh environment operation. The authors use the SiC technology platform suite the model platform for developing harsh environment microsystems and then detail the current status of the specific individual technologies (electronics, MEMS, packaging). Additionally, methods

Quantum Darwinism for mixed-state environment

Science.gov (United States)

Quan, Haitao; Zwolak, Michael; Zurek, Wojciech

2009-03-01

We exam quantum darwinism when a system is in the presence of a mixed environment, and we find a general relation between the mutual information for the mixed-state environment and the change of the entropy of the fraction of the environment. We then look at a particular solvable model, and we numerically exam the time evolution of the ``mutual information" for large environment. Finally we discuss about the exact expressions for all entropies and the mutual information at special time.

Trade, Environment & Animal Welfare

DEFF Research Database (Denmark)

Morrison, Peter; Nielsen, Laura

2013-01-01

Regulation of animal welfare and the environment under the WTO GATT and GATS Agreements - including introduction of the innovative idea of limiting consumption abroad (mode 2) for e.g. bull fights.......Regulation of animal welfare and the environment under the WTO GATT and GATS Agreements - including introduction of the innovative idea of limiting consumption abroad (mode 2) for e.g. bull fights....

An Investigation of Person-Environment Congruence

Science.gov (United States)

McMurray, Marissa Johnstun

2013-01-01

This study tested a hypothesis derived from Holland's (1997) theory of personality and environment that congruence between person and environment would influence satisfaction with doctoral training environments and career certainty. Doctoral students' (N = 292) vocational interests were measured using questions from the Interest Item Pool, and…

42 CFR 460.72 - Physical environment.

Science.gov (United States)

2010-10-01

... 42 Public Health 4 2010-10-01 2010-10-01 false Physical environment. 460.72 Section 460.72 Public...) PACE Administrative Requirements § 460.72 Physical environment. (a) Space and equipment—(1) Safe design..., sanitary, functional, accessible, and comfortable environment for the delivery of services that protects...

[Working environment and educational environment are two sides of the same coin].

Science.gov (United States)

Kannegaard, Pia Nimann; Holm, Ellen Astrid

2014-01-20

Educational environment is of major importance for job satisfaction and it consists of several components including curriculum and values of the organization. Educational climate is the environment, as the individual physicians perceive it. Motivation is important for job satisfaction as well as for learning. Autonomy, responsibility, supervision, feedback are all important factors influencing motivation and learning. These factors must be supported through appropriate organization of work in hospital departments and in general practice.

Age-friendly environments and life satisfaction among South Korean elders: person-environment fit perspective.

Science.gov (United States)

Park, Sojung; Lee, Sangchul

2017-07-01

Drawing on the person-environment (P-E) fit perspective, this study examined the role of environment on the well-being of vulnerable older adults in a non-western context. Using the indicators from the World Health Organization's (WHO) framework for age friendly cities (ACF), we examined life satisfaction among South Korean older adults, exploring the extent to which multidimensional environmental characteristics are associated with low socioeconomic status (SES). Using the regionally representative data from the Seoul City-wide needs assessment of middle- and old-aged adults, an analytic sample (N = 1657) focused on community-living individuals aged 65 and older. Multilevel regression models examined interaction between SES subgroups and varying aspects of the environment (i.e. physical, social, and service environment) as related to life satisfaction. Consistent with the environmental docility hypothesis, members of the most vulnerable subgroup in the Korean context - older adults who are living alone and poor - are more likely to have higher life satisfaction when they have higher levels of support in physical and social environments. Interestingly, a higher level of support in the service environment was related to lower life satisfaction for this subgroup. This study provides an empirical foundation for efforts to identify age-friendly environmental characteristics as modifiable environmental resources that can improve older adults' psychological well-being. As the first attempt to use WHO ACF indicators within the P-E fit perspective in a non-Western context, our study provides a foundation for designing support services or programs that effectively meet the needs of vulnerable older adults.

Accounts for the Environment 2008

International Nuclear Information System (INIS)

2009-11-01

Economic developments have an impact on the environment. Environmental accounts describe the relationship between the Dutch economy and the environment. Because the environmental accounts are integrated with concepts from the national accounts, developments in the field of the environment and macro-economic developments in the Netherlands can be directly compared. Key indicators can also be derived from the environmental accounts; these provide an insight into the sustainability of the development of the environment and the economy. The integrated system makes it possible to quantify and analyse the underlying causes of changes in environmental indicators. These effects of changes in - among other things - economic growth, environmental efficiency and international trade can be expressed in figures. This publication presents the results of the environmental accounts developed by Statistics Netherlands. [nl

Mitigation of pollutants for clean environment: proceedings of the fifteenth national symposium on environment

International Nuclear Information System (INIS)

Puranik, V.D.; Pandit, G.G.; Ramachandran, T.V.; Tripathi, R.M.; Saradhi, I.V.; Hegde, A.G.

2007-01-01

The main theme of this volume is mitigation of pollutants for clean environment. The topics covered are technologies for clean environment, monitoring and modeling of pollutants and their transport, environmental radioactivity, environmental awareness, education and regulatory aspects. Papers relevant to INIS are indexed separately

38 CFR 52.200 - Physical environment.

Science.gov (United States)

2010-07-01

... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Physical environment. 52...) PER DIEM FOR ADULT DAY HEALTH CARE OF VETERANS IN STATE HOMES Standards § 52.200 Physical environment. The physical environment must be designed, constructed, equipped, and maintained to protect the health...

Robotic environments

NARCIS (Netherlands)

Bier, H.H.

2011-01-01

Technological and conceptual advances in fields such as artificial intelligence, robotics, and material science have enabled robotic architectural environments to be implemented and tested in the last decade in virtual and physical prototypes. These prototypes are incorporating sensing-actuating

Jupiter Environment Tool

Science.gov (United States)

Sturm, Erick J.; Monahue, Kenneth M.; Biehl, James P.; Kokorowski, Michael; Ngalande, Cedrick,; Boedeker, Jordan

2012-01-01

The Jupiter Environment Tool (JET) is a custom UI plug-in for STK that provides an interface to Jupiter environment models for visualization and analysis. Users can visualize the different magnetic field models of Jupiter through various rendering methods, which are fully integrated within STK s 3D Window. This allows users to take snapshots and make animations of their scenarios with magnetic field visualizations. Analytical data can be accessed in the form of custom vectors. Given these custom vectors, users have access to magnetic field data in custom reports, graphs, access constraints, coverage analysis, and anywhere else vectors are used within STK.

Across-environment genetic correlations and the frequency of selective environments shape the evolutionary dynamics of growth rate in Impatiens capensis.

Science.gov (United States)

Stinchcombe, John R; Izem, Rima; Heschel, M Shane; McGoey, Brechann V; Schmitt, Johanna

2010-10-01

Trade-offs can exist within and across environments, and constrain evolutionary trajectories. To examine the effects of competition and resource availability on trade-offs, we grew individuals of recombinant inbred lines of Impatiens capensis in a factorial combination of five densities with two light environments (full light and neutral shade) and used a Bayesian logistic growth analysis to estimate intrinsic growth rates. To estimate across-environment constraints, we developed a variance decomposition approach to principal components analysis, which accounted for sample size, model-fitting, and within-RIL variation prior to eigenanalysis. We detected negative across-environment genetic covariances in intrinsic growth rates, although only under full-light. To evaluate the potential importance of these covariances, we surveyed natural populations of I. capensis to measure the frequency of different density environments across space and time. We combined our empirical estimates of across-environment genetic variance-covariance matrices and frequency of selective environments with hypothetical (yet realistic) selection gradients to project evolutionary responses in multiple density environments. Selection in common environments can lead to correlated responses to selection in rare environments that oppose and counteract direct selection in those rare environments. Our results highlight the importance of considering both the frequency of selective environments and the across-environment genetic covariances in traits simultaneously. © 2010 The Author(s). Journal compilation © 2010 The Society for the Study of Evolution.

Energetics of the built environment

Energy Technology Data Exchange (ETDEWEB)

Yeang, K

1974-07-01

Energetics, the study of energy transformations within ecosystems, provide a useful framework for examining the relationships between the built environment (a manmade ecosystem) and the natural environment. Values are provided for using energy indices in modeling, comparing design alternatives, improving designed systems, conserving nonrenewable resources, comparing impacts, and studying energy utilization patterns as a whole. The accounting of the energy cost of a proposed project would provide additional criteria for evaluating the impact of human developments on the natural environment. (3 diagrams, 12 tables)

Radioecology of the aquatic environment

International Nuclear Information System (INIS)

Amiard-Triquet, C.; Amiard, J.C.

1980-01-01

This book is divided into nine parts as follows: origin of radionuclides in the aquatic environment; assessment of radioactive contamination of the aquatic environment; evolution of radionuclides in waters; behaviour of radionuclides in sediments; quantitative data on accumulation, distribution and biological release of radioactive pollutants; mechanisms of the biological accumulation; influence of ecological factors on radioactive contamination of ecosystems; effects of irradiation on aquatic organisms. The last part is devoted to general conclusions on sanitary and ecological consequences of radioactive pollution of the aquatic environment [fr

Food-and-beverage environment and procurement policies for healthier work environments.

Science.gov (United States)

Gardner, Christopher D; Whitsel, Laurie P; Thorndike, Anne N; Marrow, Mary W; Otten, Jennifer J; Foster, Gary D; Carson, Jo Ann S; Johnson, Rachel K

2014-06-01

The importance of creating healthier work environments by providing healthy foods and beverages in worksite cafeterias, in on-site vending machines, and at meetings and conferences is drawing increasing attention. Large employers, federal and state governments, and hospital systems are significant purchasers and providers of food and beverages. The American Heart Association, federal government, and other organizations have created procurement standards to guide healthy purchasing by these entities. There is a need to review how procurement standards are currently implemented, to identify important minimum criteria for evaluating health and purchasing outcomes, and to recognize significant barriers and challenges to implementation, along with success stories. The purpose of this policy paper is to describe the role of food-and-beverage environment and procurement policy standards in creating healthier worksite environments; to review recently created national model standards; to identify elements across the standards that are important to consider for incorporation into policies; and to delineate issues to address as standards are implemented across the country. © 2014 International Life Sciences Institute.

Assessing associations between socio-economic environment and self-reported health in Amsterdam using bespoke environments.

Directory of Open Access Journals (Sweden)

Eleonore M Veldhuizen

Full Text Available The study of the relationship between residential environment and health at micro area level has a long time been hampered by a lack of micro-scale data. Nowadays data is registered at a much more detailed scale. In combination with Geographic Information System (GIS-techniques this creates opportunities to look at the relationship at different scales, including very local ones. The study illustrates the use of a 'bespoke environment' approach to assess the relationship between health and socio-economic environment.We created these environments by buffer-operations and used micro-scale data on 6-digit postcode level to describe these individually tailored areas around survey respondents in an accurate way. To capture the full extent of area effects we maximized variation in socio-economic characteristics between areas. The area effect was assessed using logistic regression analysis.Although the contribution of the socio-economic environment in the explanation of health was not strong it tended to be stronger at a very local level. A positive association was observed only when these factors were measured in buffers smaller than 200 meters. Stronger associations were observed when restricting the analysis to socioeconomically homogeneous buffers. Scale effects proved to be highly important but potential boundary effects seemed not to play an important role. Administrative areas and buffers of comparable sizes came up with comparable area effects.This study shows that socio-economic area effects reveal only on a very micro-scale. It underlines the importance of the availability of micro-scale data. Through scaling, bespoke environments add a new dimension to study environment and health.

Information Space, Information Field, Information Environment

Directory of Open Access Journals (Sweden)

Victor Ya. Tsvetkov

2014-08-01

Full Text Available The article analyzes information space, information field and information environment; shows that information space can be natural and artificial; information field is substantive and processual object and articulates the space property; information environment is concerned with some object and acts as the surrounding in relation to it and is considered with regard to it. It enables to define information environment as a subset of information space. It defines its passive description. Information environment can also be defined as a subset of information field. It corresponds to its active description.

Contemporary state of spacecraft/environment interaction research

CERN Document Server

Novikov, L S

1999-01-01

Various space environment effects on spacecraft materials and equipment, and the reverse effects of spacecrafts and rockets on space environment are considered. The necessity of permanent updating and perfection of our knowledge on spacecraft/environment interaction processes is noted. Requirements imposed on models of space environment in theoretical and experimental researches of various aspects of the spacecraft/environment interaction problem are formulated. In this field, main problems which need to be solved today and in the nearest future are specified. The conclusion is made that the joint analysis of both aspects of spacecraft/environment interaction problem promotes the most effective solution of the problem.

Corporate environment protection as a legal problem

International Nuclear Information System (INIS)

Kloepfer, M.

1993-01-01

It is discussed what legal instruments companies have for integrating environment protection into their corporate policy: Industrial self-monitoring; the environmental health officer as an instrument of corporate environment protection (environmental health officer, radiation protection officer); obligations to disclose information on corporate organisation pursuant to Article 52 a of the Federal Emmission Control Act; corporate environment protection as a general obligation of the operator. Possible ways of strengthening corporate environment protection are considered de lege ferende, e.g. the additional instruments of corporate self-monitoring laid down in the General Part of the Environmental Code, audits on environment protection, corporate environment protection through quality assurance systems. (orig.) [de

Tourism in Rural Environment

Directory of Open Access Journals (Sweden)

MIHAI IELENICZ

2013-01-01

Full Text Available Rural tourism is now determined by limited economic opportunities, poor infrastructure, low motivation to possible offers, lack of proper service guarantees. Nearly 500 Romanian villages are already tourist locations, with certain characteristics determined by a heritage item, or complex ones when multiple components lead to various activities. This paper includes a typology of tourist villages in Romania according to the types of practiced tourist activities, insisting on the use of a more comprehensive terminology: tourism in rural environment, participative and creative tourism in rural areas. Tourism becomes a system accepted in the rural environment as a real opportunity for economic development with multiple social consequences. By multiplying tourism potential to meet tourists’ demands, many villages will get tourism valences with various activities in this filed, including environment protection.

Radioruthenium in the environment

International Nuclear Information System (INIS)

Iwashima, Kiyoshi; Morita, Shigeki.

1979-01-01

A change in the amount of radioruthenium in the environment (due to nuclear tests and drainage from atomic energy plants) and the exposure dose are discussed. The level of 106 Ru in the environment due to radioactive fallout, changes in the level, and the characteristics of these changes are reported. Pollution caused by 106 Ru in drainage from atomic energy plants, especially from the Windscale reprocessing factory in the United Kingdom (which release Ru in the greatest amount), changes in the amount of Ru released and in the levels of environmental pollution, and the movement of Ru in the environment are considered. The intake of Ru into the human body by consumption of food produced in polluted areas and by inspiration of Ru present in the air is estimated. (Tsunoda, M.)

Work environment and school dropout

DEFF Research Database (Denmark)

Hansen, Claus D.; Andersen, Johan Hviid; Lund, Thomas

Aim The aim of this presentation is to examine the possible impact of work environment (and especially psychosocial work environment) on school dropout. The questions raised are: to what extent do psychosocial work environment and especially the social relations between young apprentices...... and their colleagues and managers play a role in dropping out of upper secondary education? Methods A cohort of 3058 adolescents born in 1989 and a cohort of approximately 2000 young adults born in 1983 are used to examine the associations between work environment and subsequent dropout in upper secondary educational...... indicated that ‘being treated badly by superior’ was part of the reason for doing so. Further analyses show that reporting repetitive and monotonous work tasks increases the risk of dropping out (OR: 1.74) and that reporting bad working climate at ones work place increases the risk of considering...

Images of Environment and Management Practice

DEFF Research Database (Denmark)

Schmidt, Kirsten; Remmen, Arne

; environment as a part of quality management; environment as a part of corporate branding and environment as a part of customer relations. The different images are distributed and coexist throughout the organization, where they may be a potential for conflicting priorities or a platform for organizational......Different images of environment can be found in relation to various understandings of environmental problems and solutions, such as cleaner production, environmental management, cleaner products and sustainability. Ascribed to these images are: environment as a part of license to operate...... as a technical issue as part of a formalized system created barriers for organizational learning in relation to sustainability, while the broader concept of social responsibility shaped a platform from which the employees could create meanings on sustainability more in line with their daily practices....

Creating Optimal Environments for Talent Development

DEFF Research Database (Denmark)

Henriksen, Kristoffer; Storm, Louise Kamuk; Larsen, Carsten Hvid

The holistic ecological approach (HEA) to talent development in sport shifts researchers’ attention from the individual athletes to the broader environment in which they develop. The HEA provides a theoretical grounding, ecologically inferred definitions of talent development, two working models......, and methodological guidelines. The HEA highlights two interconnected ways of analyzing athletic talent development environments (ATDE). First, there is a focus on the structure of the environment, particularly the roles and cooperation of key persons. Second, there is a focus on the organizational culture...... of the team. A number of in-depth case studies of successful talent development environments in Scandinavia have shown that while each environment is unique, they also share a number of features. They are characterized by proximal role modeling; an integration of efforts among the different agents (family...

Quality Of Educational Environment At Wah Medical College: Assessment By Using Dundee Ready Educational Environment Measure.

Science.gov (United States)

Mushtaq, Robina; Ansar, Ambreen; Bibi, Anwar; Ramzan, Musarat; Munir, Arif; Zaheer, Amna; Ahmad, Afsa; Barlas, Aisha

2017-01-01

Educational environment not only has an impact on the students during the academic years but has its reflections throughout their medical career. The Dundee Ready Educational Environment Measure (DREEM) is an internationally accepted useful tool to analyse undergraduate educational environments in the health professionals. The purpose of this study was to assess how students, across all the five years in a private medical college, perceive their educational environment. It was a cross sectional study, which used the DREEM inventory at Wah Medical College over the course of 6 months (January-June 2015). All 500 students were included in the study. The fifty items DREEM inventory, having the maximum score of two hundred indicating ideal educational environment was used for data collection. The questionnaire was completed by 400 undergraduate medical students (response rate 80%). The overall DREEM score was 122.63/200 (61.3%), indicating that the perception of the learning environment was more positive than negative. Among the highest scoring categories were students' participation in classes, relaxed atmosphere and confidence in passing the annual exams. However, many areas requiring improvement were also brought to attention. Overall, the student's perception of their learning environment at Wah Medical College was found to be positive. This study did bring to light some areas that could be improved upon. This should enable the faculty to adopt changes in their teaching methods to make the learning process more productive and enjoyable for future students.

State of the research environment - 2013

Energy Technology Data Exchange (ETDEWEB)

Phillips, Julia Mae; Simmons, Jerry Alvon; Weaver, Karla

2014-02-01

This report describes the condition of the research environment at Sandia National Laboratories and outlines key environment improvement activities undertaken by the Office of the Chief Technology Officer and the Sandia Research Leadership Team during fiscal year 2013. The report also outlines Lab-level objectives related to the research environment for fiscal year 2014.

Conceptual Model of Dynamic Geographic Environment

Directory of Open Access Journals (Sweden)

Martínez-Rosales Miguel Alejandro

2014-04-01

Full Text Available In geographic environments, there are many and different types of geographic entities such as automobiles, trees, persons, buildings, storms, hurricanes, etc. These entities can be classified into two groups: geographic objects and geographic phenomena. By its nature, a geographic environment is dynamic, thus, it’s static modeling is not sufficient. Considering the dynamics of geographic environment, a new type of geographic entity called event is introduced. The primary target is a modeling of geographic environment as an event sequence, because in this case the semantic relations are much richer than in the case of static modeling. In this work, the conceptualization of this model is proposed. It is based on the idea to process each entity apart instead of processing the environment as a whole. After that, the so called history of each entity and its spatial relations to other entities are defined to describe the whole environment. The main goal is to model systems at a conceptual level that make use of spatial and temporal information, so that later it can serve as the semantic engine for such systems.

Facilitated variation: how evolution learns from past environments to generalize to new environments.

Directory of Open Access Journals (Sweden)

Merav Parter

2008-11-01

Full Text Available One of the striking features of evolution is the appearance of novel structures in organisms. Recently, Kirschner and Gerhart have integrated discoveries in evolution, genetics, and developmental biology to form a theory of facilitated variation (FV. The key observation is that organisms are designed such that random genetic changes are channeled in phenotypic directions that are potentially useful. An open question is how FV spontaneously emerges during evolution. Here, we address this by means of computer simulations of two well-studied model systems, logic circuits and RNA secondary structure. We find that evolution of FV is enhanced in environments that change from time to time in a systematic way: the varying environments are made of the same set of subgoals but in different combinations. We find that organisms that evolve under such varying goals not only remember their history but also generalize to future environments, exhibiting high adaptability to novel goals. Rapid adaptation is seen to goals composed of the same subgoals in novel combinations, and to goals where one of the subgoals was never seen in the history of the organism. The mechanisms for such enhanced generation of novelty (generalization are analyzed, as is the way that organisms store information in their genomes about their past environments. Elements of facilitated variation theory, such as weak regulatory linkage, modularity, and reduced pleiotropy of mutations, evolve spontaneously under these conditions. Thus, environments that change in a systematic, modular fashion seem to promote facilitated variation and allow evolution to generalize to novel conditions.

Technology Of Controlled-Environment Agriculture

Science.gov (United States)

Bubenheim, David L.; Bates, Maynard E.

1995-01-01

Report discusses controlled-environment agriculture (CEA) for commercial production of organisms, whether plants or animals. Practiced in greenhouses to produce food on nonarable lands. Describes conceptual regenerative system that incorporates biological, physical, and chemical processes to support humans in extraterrestrial environments.

Affective appraisal of virtual environments

NARCIS (Netherlands)

Houtkamp, J.M.

2012-01-01

Interactive navigable 3D visualisations of built and natural environments have become commonplace in design and planning of urban environments and landscapes, and are regarded as potent prototyping and communication tools. In training applications, for instance for fire fighters, virtual

Precision in harsh environments

OpenAIRE

French, P.; Krijnen, G.; Roozeboom, F.

2016-01-01

Microsystems are increasingly being applied in harsh and/or inaccessible environments, but many markets expect the same level of functionality for long periods of time. Harsh environments cover areas that can be subjected to high temperature, (bio)-chemical and mechanical disturbances, electromagnetic noise, radiation, or high vacuum. In the field of actuators, the devices must maintain stringent accuracy specifications for displacement, force, and response times, among others. These new requ...

The energy-development-environment nexus

International Nuclear Information System (INIS)

Schneider, Bertrand

1992-01-01

Energy is the key factor in tackling two of the major problems now facing humanity: the environment and development. Adequate and appropriate energy supplies are essential to economic and social development, especially for Third World countries, but at the same time energy production and utilization are responsible for much of the damage being done to the environment. As everyone now knows, the combustion of fossil fuels is the main source of greenhouse gases and of the threat to the stability of world climate. Nuclear power, which once seemed an answer to the constantly increasing demand for energy, is now challenged by public opinion in many countries as a result of various nuclear accidents and the problems of processing and storing nuclear waste. So how do we extricate ourselves from the energy environment-development tangle? Clearly, advanced countries have an interest in transferring environment-friendly technologies to developing countries in order to reduce the pollution which puts the global as well as the local environment at risk. The North is, by and large, becoming aware of the choices involved in protecting the environment versus industrial growth and unlimited use of motor vehicles. For the South, these choices are a luxury they can ill afford, given the imperative of rapid development. The solution must be for greater international co-operation, with the North assisting the South (and the former Communist bloc) financially and through transfer of appropriate technologies at affordable cost. Reconciling the environment and development with respect to the energy cycle is a task of fundamental importance for the future. The prime responsibility for this task obviously lies with industries, but action is also required from governments, to enable them to play their part effectively. Advanced countries must demonstrate that development is fully compatible with protecting the environment. They can do so by using market forces, provided that the appropriate

The environment of the Slovak Republic

International Nuclear Information System (INIS)

Klinda, J.; Brechtl, J.; Havlikova, J.; Herdova, V.; Klindova, A.; Kmitova, V.; Lacikova, D.; Lacova, L.; Lieskovska, Z.; Mrva, I.; Plesnikova, T.; Sestakova, Z.; Toma, P.; Vilinovic, K.

1999-01-01

This report of the Ministry of the Environment of the Slovak Republic deals with next areas of the environment of the Slovak Republic in 1999: (1) Basic information about the Slovak republic; (2) The environmental protection; (3) The cultural monuments protection; (4) The world and natural heritage; (5) The biodiversity; (6) The territorial system of ecological stability; (7) The environmental regional partition; (8) Components of the environment and their protection; (9) Environmental risk factors (radiation and others); (10) Health and age of population; (11) Ministration on environment; (12 ) International co-operation. Alphabetical list of abbreviations and texts to pictures are included

Latex in the Hospital Environment

Science.gov (United States)

LATEX in the Hospital Environment Updated Fall 2015 This list provides a guide to some of the most common objects containing latex and offers some ... remover–Sepha Pharm) 1 LATEX in the Hospital Environment (continued) Frequently contains LATEX OR/Infection Control masks, ...

Work environments for employee creativity.

Science.gov (United States)

Dul, Jan; Ceylan, Canan

2011-01-01

Innovative organisations need creative employees who generate new ideas for product or process innovation. This paper presents a conceptual framework for the effect of personal, social-organisational and physical factors on employee creativity. Based on this framework, an instrument to analyse the extent to which the work environment enhances creativity is developed. This instrument was applied to a sample of 409 employees and support was found for the hypothesis that a creative work environment enhances creative performance. This paper illustrates how the instrument can be used in companies to select and implement improvements. STATEMENT OF RELEVANCE: The ergonomics discipline addresses the work environment mainly for improving health and safety and sometimes productivity and quality. This paper opens a new area for ergonomics: designing work environments for enhancing employee creativity in order to strengthen an organisation's capability for product and process innovation and, consequently, its competitiveness.

An environment-mediated quantum deleter

International Nuclear Information System (INIS)

Srikanth, R.; Banerjee, Subhashish

2007-01-01

Environment-induced decoherence presents a great challenge to realizing a quantum computer. We point out the somewhat surprising fact that decoherence can be useful, indeed necessary, for practical quantum computation, in particular, for the effective erasure of quantum memory in order to initialize the state of the quantum computer. The essential point behind the deleter is that the environment, by means of a dissipative interaction, furnishes a contractive map towards a pure state. We present a specific example of an amplitude damping channel provided by a two-level system's interaction with its environment in the weak Born-Markov approximation. This is contrasted with a purely dephasing, non-dissipative channel provided by a two-level system's interaction with its environment by means of a quantum nondemolition interaction. We point out that currently used state preparation techniques, for example using optical pumping, essentially perform as quantum deleters

Self-organized Learning Environments

DEFF Research Database (Denmark)

Dalsgaard, Christian; Mathiasen, Helle

2007-01-01

system actively. The two groups used the system in their own way to support their specific activities and ways of working. The paper concludes that self-organized learning environments can strengthen the development of students’ academic as well as social qualifications. Further, the paper identifies......The purpose of the paper is to discuss the potentials of using a conference system in support of a project based university course. We use the concept of a self-organized learning environment to describe the shape of the course. In the paper we argue that educational technology, such as conference...... systems, has a potential to support students’ development of self-organized learning environments and facilitate self-governed activities in higher education. The paper is based on an empirical study of two project groups’ use of a conference system. The study showed that the students used the conference...

Children's Environment in ECEC

DEFF Research Database (Denmark)

Koch, Anette Boye; Laursen, Hanne; Jørgensen, Hanne Hede

2017-01-01

such as play and artwork when they asked to describe the best child environmental practice. Children’s perspectives on their environment still are to be investigated. The study offers knowledge regarding children as active participants in a Nordic ECE culture with educated staff and a long tradition......Danish Legislation prescribes that children’s environment in Early Childhood Education (ECE) is evaluated and enhanced as an integrated part of curriculum work. Children’s perspectives must be included in the efforts. During the last 10 years, pedagogues have endeavoured to include children...... in evaluations of physical, psychological and aesthetic environmental dimensions of education. The present study aims to elucidate how professionals and children co-operate in order to develop children’s environments and study the impact of children’s perspectives on pedagogy and children’s processes of ‘bildung...

Elephant logging and environment

International Nuclear Information System (INIS)

Tin-Aung-Hla

1995-01-01

The natural environment comprises non-biological elements such as air, water, light, heat and biological elements of animal and plant life; all interact with each other to create an ecosystem. Human activities like over-exploitation of forest results in deforestation and desertification. This consequently changes ecological balance. Topics on: (1) history of elephants utilization; (2) elephant logging; (3) classification of elephants; (4) dragging gear; (5) elephant power; (6) elephant logging and environment, are discussed

The role of environment design in an educational Multi-User Virtual Environment

DEFF Research Database (Denmark)

Papachristos, Nikiforos; Vrellis, Ioannis; Natsis, Antonios

2014-01-01

This paper presents empirical results from an exploratory study conducted in an authentic educational situation with preservice education students enrolled in an undergraduate course, which was partially taught in Second Life. The study investigated the effect of environment design on presence, l...... necessary for all students to become familiar with the virtual environment and possible time losses due to technical issues. This study could act as support to construct and test hypotheses regarding the role of educational setting design in teaching and learning in MUVEs....

13 CFR 302.1 - Environment.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Environment. 302.1 Section 302.1 Business Credit and Assistance ECONOMIC DEVELOPMENT ADMINISTRATION, DEPARTMENT OF COMMERCE GENERAL TERMS AND CONDITIONS FOR INVESTMENT ASSISTANCE § 302.1 Environment. EDA will undertake environmental reviews...

Qubits in a random environment

International Nuclear Information System (INIS)

Akhalwaya, I; Fannes, M; Petruccione, F

2007-01-01

Decoherence phenomena in a small quantum system coupled to a complex environment can be modelled with random matrices. We propose a simple deterministic model in the limit of a high dimensional environment. The model is investigated numerically and some analytically addressable questions are singled out

Sonic Virtuality, Environment, and Presence

DEFF Research Database (Denmark)

Grimshaw, Mark

2018-01-01

The article presents a brief introduction to the concept of sonic virtuality, a view of sound as a multi-modal, emergent perception that provides a framework that has since been used to provide an explanation of the formation of environments. Additionally, the article uses such concepts to explain...... the phenomenon of presence, not only in virtual worlds but also in actual worlds. The view put forward is that environment is an emergent perception, formed from the hypothetical modelling of salient worlds of sensory things, and it is in the environment that we feel present. The article ends with some thoughts...

Nursing leadership style and psychosocial work environment.

Science.gov (United States)

Malloy, Terry; Penprase, Barbara

2010-09-01

This study examines the relationship between leadership style and the psychosocial work environment of registered nurses. Research consistently supports the positive relationship between transformational leadership style and job satisfaction. There is less evidence, which identifies the relationship between leadership style and psychosocial work environment. The Multifactor Leadership Questionnaire 5× was used to identify the leadership style. The Copenhagen Psychosocial Questionnaire was used to measure psychosocial work environment dimensions. Statistical analysis included Pearson's r correlation between leadership style and psychosocial work environment and anova to analyse group means. There is a significant correlation between leadership style and 22 out of the 37 dimensions of the psychosocial work environment. This correlation was significant ranging from r = 0.88, P leadership scores of the immediate supervisor report significant differences in their psychosocial work environment. This study supports the significant correlation between leadership style and psychosocial work environment for registered nurses. The results of this study suggest that there would be an improvement in the nursing psychosocial work environment by implementation of transformational and contingent reward leadership behaviours. © 2010 The Authors. Journal compilation © 2010 Blackwell Publishing Ltd.

Global Military Operating Environments (GMOE) Phase I: Linking Natural Environments, International Security, and Military Operations

Science.gov (United States)

2013-01-30

diverse range of natural environments and will require that U.S. forces adapt to a wide range of terrain, climate, and associated hazards within these...Synthetic Environment Core Area), baseline terrain information, and application of remote‐sensing technologies for Warfighter and Chameleon . The

Environment compendium 1999. The environment in figures

International Nuclear Information System (INIS)

1999-01-01

The detailed information in this compendium forms the basis for the condition of the environment in the Netherlands and for measures to be taken to stabilize or improve the environmental quality. First, an overview is given of the social developments, e.g. economic and volume developments within target sectors (section A), the use of natural resources (section B) and the resulting environmental pressure (section C). The environmental load is described according to the environmental themes and the target groups as formulated and distinguished in the Dutch environmental policy. Next, the environmental quality is described (section D), effected by the continuous emission of materials into the air, surface water, ground water and soil. Also attention is paid to noise pollution and odor pollution, the impacts on the external safety and ionizing radiation of radioactive materials. The final effects on nature and public health are dealt with in section E. The costs of environmental measures to be taken by the Dutch government and businesses to stabilize or improve the environmental quality are dealt with in section F. Finally, in section G, attention is paid to the relation and integration of environment and economy, based on the system of National Accounts (so-called NAMEA). refs

Environment compendium 2001. The environment in figures

International Nuclear Information System (INIS)

2001-01-01

The detailed information in this compendium forms the basis for the condition of the environment in the Netherlands and for measures to be taken to stabilize or improve the environmental quality. First, an overview is given of the social developments, e.g. economic and volume developments within target sectors (section A), the use of natural resources (section B) and the resulting environmental pressure (section C). The environmental load is described according to the environmental themes and the target groups as formulated and distinguished in the Dutch environmental policy (section D). Next, the environmental quality is described (section E), effected by the continuous emission of materials into the air, surface water, ground water and soil. Also attention is paid to noise pollution and odor pollution, the impacts on the external safety and ionizing radiation of radioactive materials. The final effects on nature and public health are dealt with in section F. The costs of environmental measures to be taken by the Dutch government and businesses to stabilize or improve the environmental quality are dealt with in section G. Finally, in section H, attention is paid to the relation and integration of environment and economy, based on the system of National Accounts (so-called NAMEA). refs

Earth Trek...Explore Your Environment.

Science.gov (United States)

Environmental Protection Agency, Washington, DC. Office of Public Affairs.

This booklet for children emphasizes the exploration and protection of the environment. An introduction discusses the interaction between humankind and the environment, emphasizing that the earth is a closed system. Chapter 1, "Mission: Protect the Water," addresses human dependence on water, water pollution, and water treatment. Chapter…

Virtualization in control system environment

International Nuclear Information System (INIS)

Shen, L.R.; Liu, D.K.; Wan, T.M.

2012-01-01

In large scale distributed control system, there are lots of common service composed an environment for the entire control system, such as the server system for the common software base library, application server, archive server and so on. This paper gives a description of a virtualization realization for control system environment including the virtualization for server, storage, network system and application for the control system. With a virtualization instance of the EPICS based control system environment that was built by the VMware vSphere v4, we tested the whole functionality of this virtualization environment in the SSRF control system, including the common server of the NFS, NIS, NTP, Boot and EPICS base and extension library tools, we also have applied virtualization to application servers such as the Archive, Alarm, EPICS gateway and all of the network based IOC. Specially, we test the high availability and VMotion for EPICS asynchronous IOC successful under the different VLAN configuration of the current SSRF control system network. (authors)

Individually Controlled Indoor Environment

DEFF Research Database (Denmark)

Melikov, Arsen Krikor

2004-01-01

The thermal environment and inhaled air quality in buildings to which occupants are exposed has an effect on their health, comfort, performance and productivity. Heating, ventilating and air-conditioning (HVAC) of buildings today is designed to provide a uniform environment. However, large...... individual differences in physiological and psychological response, clothing insulation, activity, preference for air temperature and movement, etc., exist between people. Environmental conditions acceptable for most of the occupants in buildings may be achieved by providing each occupant...

Components of the environment

International Nuclear Information System (INIS)

Klinda, J.; Lieskovska, Z.

1998-01-01

This report of the Ministry of the Environment of the Slovak Republic deals with the components of the environment. The results of monitoring of air (emission situation), ambient air quality, atmospheric precipitation, tropospheric ozone, water (surface water, groundwater resources, waste water and drinking water), geological factors (geothermal energy, fuel deposits, ore deposits, non-metallic ore deposits), soil (area statistics, soil contamination. soil reaction and active extractable aluminium, soil erosion), flora and fauna (national strategy of biodiversity protection) are presented

Radiation environment at Kalpakkam

International Nuclear Information System (INIS)

Iyengar, M.A.R.

1989-01-01

Nuclear facilities located at Kalpakkam in Tamil Nadu State of India include at present nuclear power reactors, a fast breeder reactor, a nuclear research centre and a waste management facility. Active wastes generated at the site are collected, treated and safely disposed. High-level wastes are stored underground in RCC trenches and tile hole and low-level wastes in the from of liquid effluents are discharged into the sea. Off-gases are dispersed through stacks in the atmosphere. Environmental survey laboratory established at the site in 1974 carries out radiation surveillance of the environment, evaluates radiological impacts on environment and public, and assesses radiation exposure of the population. It is observed that even after five years of operation of the nuclear power station, radioactivity and radiation levels in the environment have virtually remained at the pre-operational levels. (M.G.B.). 14 figs., 4 tabs

Students’ digital learning environments

DEFF Research Database (Denmark)

Caviglia, Francesco; Dalsgaard, Christian; Davidsen, Jacob

2018-01-01

The objective of the paper is to examine the nature of students’ digital learning environments to understand the interplay of institutional systems and tools that are managed by the students themselves. The paper is based on a study of 128 students’ digital learning environments. The objectives...... used tools in the students’ digital learning environments are Facebook, Google Drive, tools for taking notes, and institutional systems. Additionally, the study shows that the tools meet some very basic demands of the students in relation to collaboration, communication, and feedback. Finally...... of the study are 1) to provide an overview of tools for students’ study activities, 2) to identify the most used and most important tools for students and 3) to discover which activities the tools are used for. The empirical study reveals that the students have a varied use of digital media. Some of the most...

Radioactivity in the environment

International Nuclear Information System (INIS)

Valkovic, V.

2000-01-01

Numerous sources of ionizing radiation can lead to human exposure: natural sources, nuclear explosions, nuclear power generation, use of radiation in medical, industrial and research purposes, and radiation emitting consumer products. Before assessing the radiation dose to a population one requires a precise knowledge of the activity of a number of radionuclides. The basis for the assessment of the dose to a population from a release of radioactivity to the environment, the estimation of the potential clinical heath effects due to the dose received and, ultimately, the implementation of countermeasures to protect the population, is the measurement of radioactive contamination in the environment after the release. It is the purpose of this book to present the facts about the presence of radionuclides in the environment, natural and man made. There is no aspect of radioactivity, which has marked the passing century, not mentioned or discussed in this book. refs

African Environment

African Journals Online (AJOL)

Environmental Studies and Regional Planning Bulletin African Environment is published in French and English, and for some issues, in Arabic. (only the issue below has been received by AJOL). Vol 10, No 3 (1999). DOWNLOAD FULL TEXT Open Access DOWNLOAD FULL TEXT Subscription or Fee Access. Table of ...

Functional Analysis in Virtual Environments

Science.gov (United States)

Vasquez, Eleazar, III; Marino, Matthew T.; Donehower, Claire; Koch, Aaron

2017-01-01

Functional analysis (FA) is an assessment procedure involving the systematic manipulation of an individual's environment to determine why a target behavior is occurring. An analog FA provides practitioners the opportunity to manipulate variables in a controlled environment and formulate a hypothesis for the function of a behavior. In previous…

Profiling medical school learning environments in Malaysia: a validation study of the Johns Hopkins Learning Environment Scale

Directory of Open Access Journals (Sweden)

Sean Tackett

2015-07-01

Full Text Available Purpose: While a strong learning environment is critical to medical student education, the assessment of medical school learning environments has confounded researchers. Our goal was to assess the validity and utility of the Johns Hopkins Learning Environment Scale (JHLES for preclinical students at three Malaysian medical schools with distinct educational and institutional models. Two schools were new international partnerships, and the third was school leaver program established without international partnership. Methods: First- and second-year students responded anonymously to surveys at the end of the academic year. The surveys included the JHLES, a 28-item survey using five-point Likert scale response options, the Dundee Ready Educational Environment Measure (DREEM, the most widely used method to assess learning environments internationally, a personal growth scale, and single-item global learning environment assessment variables. Results: The overall response rate was 369/429 (86%. After adjusting for the medical school year, gender, and ethnicity of the respondents, the JHLES detected differences across institutions in four out of seven domains (57%, with each school having a unique domain profile. The DREEM detected differences in one out of five categories (20%. The JHLES was more strongly correlated than the DREEM to two thirds of the single-item variables and the personal growth scale. The JHLES showed high internal reliability for the total score (α=0.92 and the seven domains (α, 0.56-0.85. Conclusion: The JHLES detected variation between learning environment domains across three educational settings, thereby creating unique learning environment profiles. Interpretation of these profiles may allow schools to understand how they are currently supporting trainees and identify areas needing attention.

Chemistry and sustainable environment (abstract)

International Nuclear Information System (INIS)

Hussain, M.

2011-01-01

Chemistry is one of the oldest branches of science; the human beings had ever come across. It has consistently contributed towards meeting the human needs from the dawn of civilization. However, its role has multiplied since the inception of industrial revolution. Although anthropogenic activities have made the human life comfortable and even luxurious yet their impacts on the physical, biological and socio-economic environments had been destructive. Numerous kinds of chemicals have engulfed us and our environment. Modern chemistry has leading role in sculpting the present as well as future of human lifestyle. It is serving the man and other biodiversity by providing countless products in every sphere of life. At the same time it is playing villain role in the destruction of environment at an alarming rate. Today the world is confronted with heinous environmental issues hitherto unknown to the living beings mostly triggered by chemicals. Thousands of chemicals are used in industrial products, agricultural chemicals, persistent organic pollutants, freezers, pharmaceuticals, chemical and radiological warfare, construction industry, synthetic materials, electrical goods, medical gadgets etc. Some natural sources of chemicals are acid rains, volcanic eruptions, eutrophication and photochemical smog. The fact of matter is that chemicals are being consistently added into atmosphere, biosphere and lithosphere. For the sustainable environment it is imperative that the chemicals must not be added into human environment beyond its carrying capacity. It is responsibility of chemists to introduce environmentally benign and biodegradable chemicals. All types of chemistry need to be green and environment friendly. The scientists and engineers should develop chemicals and technologies which do not harm the living creatures during any stage of their life-cycle. (author)

Environment protection and energy politics

International Nuclear Information System (INIS)

Grawe, J.

1993-01-01

The lecture first deals with the aims and legal basis in German and European law of environment protection with regard to energy politics. It then goes to deal with European regulations for environment protection and their effects on the energy supply: Air pollution abatement, tax for the protection of the climate, internalisation of external costs. The following European energy-political measures impinge on environment protection: Sponsored projects, least-cost planning, third-party access to the public electricity supply. The discrepancy between European and national policies can be lessened or resolved by the following means: Harmonisation, subsidiarity principle, and scope for entrepreneurial solutions. (orig.) [de

Development and the global environment

International Nuclear Information System (INIS)

Colombo, U.

1992-01-01

The development of the Third World and the protection of the environment are two major global problems interconnected by energy - the motor of economic growth and the main cause of deterioration of the global environment. They can no longer be separated. The threats of ozone, acid rain, and global warming are global in scope and solutions must involve energy consumption, conservations, and renewable resources. The precept that development should hinge on sound management of natural resources and the environment no longer has merely local or regional significance. It is a global concern and each person should feel a sense of ethical commitment as a world citizen

Career development in cross-cultural environment

OpenAIRE

Balčiūnaitienė, Asta; Barvydienė, Violeta; Petkevičiūtė, Nijolė

2013-01-01

The aim of this paper is to discuss the peculiarities of career development and cultural competence in crosscultural environment. The idea of career development in a cross-cultural environment is usually linked to personal, communication skills, social and cultural issues. Understanding of the concept of peculiarities of career development and cross-cultural communication competence is of crucial significance in a multicultural environment. The main factors of career development in cross-cult...

Authoring multimedia in the CMIF environment

OpenAIRE

Hardman, Lynda; Rossum, Guido; Bulterman, Dick

1993-01-01

textabstractWe present the user interface to the CMIF authoring environment for constructing and playing multimedia presentations. Within the environment an author constructs a presentation in terms of its structure and additional synchronization constraints, from which the actual timing information is derived. The CMIF authoring environment presents three main views of a multimedia presentation: a hierarchy view for manipulating and viewing a presentation’s hierarchical structure; a channel ...

Smile (System/Machine-Independent Local Environment)

Energy Technology Data Exchange (ETDEWEB)

Fletcher, J.G.

1988-04-01

This document defines the characteristics of Smile, a System/machine-independent local environment. This environment consists primarily of a number of primitives (types, macros, procedure calls, and variables) that a program may use; these primitives provide facilities, such as memory allocation, timing, tasking and synchronization beyond those typically provided by a programming language. The intent is that a program will be portable from system to system and from machine to machine if it relies only on the portable aspects of its programming language and on the Smile primitives. For this to be so, Smile itself must be implemented on each system and machine, most likely using non-portable constructions; that is, while the environment provided by Smile is intended to be portable, the implementation of Smile is not necessarily so. In order to make the implementation of Smile as easy as possible and thereby expedite the porting of programs to a new system or a new machine, Smile has been defined to provide a minimal portable environment; that is, simple primitives are defined, out of which more complex facilities may be constructed using portable procedures. The implementation of Smile can be as any of the following: the underlying software environment for the operating system of an otherwise {open_quotes}bare{close_quotes} machine, a {open_quotes}guest{close_quotes} system environment built upon a preexisting operating system, an environment within a {open_quotes}user{close_quotes} process run by an operating system, or a single environment for an entire machine, encompassing both system and {open_quotes}user{close_quotes} processes. In the first three of these cases the tasks provided by Smile are {open_quotes}lightweight processes{close_quotes} multiplexed within preexisting processes or the system, while in the last case they also include the system processes themselves.

How Does Leader’s Support for Environment Promote Organizational Citizenship Behaviour for Environment? A Multi-Theory Perspective

OpenAIRE

Hewawasam Puwakpitiyage Rasika Priyankara; Fan Luo; Amer Saeed; Saviour Ayertey Nubuor; Mahabaduge Prasad Fernando Jayasuriya

2018-01-01

Organizational citizenship behaviour for environment of employees is indispensable in realizing environmental sustainability goals of organizations. However, in the growing literature of employee green behaviour at work, scant attention has been paid on the impact of leader’s specific support for environment, and the mechanisms through which it impacts organizational citizenship behaviour for environment. Drawing upon social exchange theory, self-determination theory and theory of normative c...

Learning Environment and Student Effort

Science.gov (United States)

Hopland, Arnt O.; Nyhus, Ole Henning

2016-01-01

Purpose: The purpose of this paper is to explore the relationship between satisfaction with learning environment and student effort, both in class and with homework assignments. Design/methodology/approach: The authors use data from a nationwide and compulsory survey to analyze the relationship between learning environment and student effort. The…

A Virtual Environments Editor for Driving Scenes

Directory of Open Access Journals (Sweden)

Ronald R. Mourant

2003-12-01

Full Text Available The goal of this project was to enable the rapid creation of three-dimensional virtual driving environments. We designed and implemented a high-level scene editor that allows a user to construct a driving environment by pasting icons that represent 1 road segments, 2 road signs, 3 trees and 4 buildings. These icons represent two- and three-dimensional objects that have been predesigned. Icons can be placed in the scene at specific locations (x, y, and z coordinates. The editor includes the capability of a user to "drive" a vehicle using a computer mouse for steering, accelerating and braking. At any time during the process of building a virtual environment, a user may switch to "Run Mode" and inspect the three-dimensional scene by "driving" through it using the mouse. Adjustments and additions can be made to the virtual environment by going back to "Build Mode". Once a user is satisfied with the threedimensional virtual environment, it can be saved in a file. The file can used with Java3D software that enables the traversing of three-dimensional environments. The process of building virtual environments from predesigned icons can be applied to many other application areas. It will enable novice computer users to rapidly construct and use three-dimensional virtual environments.

Environmental confounding in gene-environment interaction studies.

Science.gov (United States)

Vanderweele, Tyler J; Ko, Yi-An; Mukherjee, Bhramar

2013-07-01

We show that, in the presence of uncontrolled environmental confounding, joint tests for the presence of a main genetic effect and gene-environment interaction will be biased if the genetic and environmental factors are correlated, even if there is no effect of either the genetic factor or the environmental factor on the disease. When environmental confounding is ignored, such tests will in fact reject the joint null of no genetic effect with a probability that tends to 1 as the sample size increases. This problem with the joint test vanishes under gene-environment independence, but it still persists if estimating the gene-environment interaction parameter itself is of interest. Uncontrolled environmental confounding will bias estimates of gene-environment interaction parameters even under gene-environment independence, but it will not do so if the unmeasured confounding variable itself does not interact with the genetic factor. Under gene-environment independence, if the interaction parameter without controlling for the environmental confounder is nonzero, then there is gene-environment interaction either between the genetic factor and the environmental factor of interest or between the genetic factor and the unmeasured environmental confounder. We evaluate several recently proposed joint tests in a simulation study and discuss the implications of these results for the conduct of gene-environment interaction studies.

Intelligent Motion and Interaction Within Virtual Environments

Science.gov (United States)

Ellis, Stephen R. (Editor); Slater, Mel (Editor); Alexander, Thomas (Editor)

2007-01-01

What makes virtual actors and objects in virtual environments seem real? How can the illusion of their reality be supported? What sorts of training or user-interface applications benefit from realistic user-environment interactions? These are some of the central questions that designers of virtual environments face. To be sure simulation realism is not necessarily the major, or even a required goal, of a virtual environment intended to communicate specific information. But for some applications in entertainment, marketing, or aspects of vehicle simulation training, realism is essential. The following chapters will examine how a sense of truly interacting with dynamic, intelligent agents may arise in users of virtual environments. These chapters are based on presentations at the London conference on Intelligent Motion and Interaction within a Virtual Environments which was held at University College, London, U.K., 15-17 September 2003.

System–environment correlations and non-Markovian dynamics

International Nuclear Information System (INIS)

Pernice, A; Helm, J; Strunz, W T

2012-01-01

We determine the total state dynamics of a dephasing open quantum system using the standard environment of harmonic oscillators. Of particular interest are random unitary approaches to the same reduced dynamics and system–environment correlations in the full model. Concentrating on a model with an at times negative dephasing rate, the issue of ‘non-Markovianity’ will also be addressed. Crucially, given the quantum environment, the appearance of non-Markovian dynamics turns out to be accompanied by a loss of system–environment correlations. Depending on the initial purity of the qubit state, these system–environment correlations may be purely classical over the whole relevant time scale, or there may be intervals of genuine system–environment entanglement. In the latter case, we see no obvious relation between the build-up or decay of these quantum correlations and ‘non-Markovianity’. (paper)

Games and Entertainment in Ambient Intelligence Environments

NARCIS (Netherlands)

Nijholt, Antinus; Reidsma, Dennis; Poppe, Ronald Walter; Aghajan, H.; López-Cózar Delgado, R.; Augusto, J.C.

2009-01-01

In future ambient intelligence (AmI) environments we assume intelligence embedded in the environment and its objects (floors, furniture, mobile robots). These environments support their human inhabitants in their activities and interactions by perceiving them through sensors (proximity sensors,

Is Learning in Low Immersive Environments Carried over to High Immersive Environments?

Directory of Open Access Journals (Sweden)

Dror David Lev

2012-01-01

Full Text Available One of the more debated issues regarding training simulators is their validity for transfer of skills to sensory environments that differ from the simulator. In two experiments, the advantages of three-dimensional (3D and collocated (Col visual displays were evaluated in a realistic and complex visuomotor task. The two factors were evaluated independently, comparing Col-2D with dislocated-2D (experiment 1 and with Col-3D (experiment 2. As expected, in both cases the more immersive presentation condition facilitated better performance. Furthermore, improvement following training in the more immersive condition carried over to the following less immersive condition but there was no carry over in the opposing order of presentation. This is taken as an indication for the differential development of skills conditioned by the level of immersiveness of the training environment. This further suggests that learning of complex realistic tasks is not carried over from less immersive simulator to the complex sensory environment of reality, due to the large gap in sensory patterns.

MANAGE INTERESTED PARTIES IN PROJECT ENVIRONMENT

Directory of Open Access Journals (Sweden)

BILOKON A. I.

2016-04-01

Full Text Available The success or failure of the project often depends on factors which related to the environment, surrounded by the project and which are outside of the direct control of the project manager. The concept of the project environment, the processes of environmental analysis of the project and the ways in which managers can identify potential problems and develop a plan of action to ensure the success of the project. The management strategy the main factors of the environment includes both organizational forms and measures which aimed at the development process. For alignment of the organizational forms of communication manager must have a clear idea: what kind of interested persons and their actions (functions need to monitor, and in what form to maintain communication (bilateral relations of interdependence. This information is key to the further construction of the formal organization that supports interaction, the definition of its functions, competencies, allocation of roles, areas of responsibility, instructions, forms and methods of work. Purpose. Summarize, analyze and form an idea of the potential of existing approaches to the management of the project environment. Object of study. Management processes of the persons, who interested in the project environment. Subject of study. Methods and tools for the project management environment.

Nursing work environment in Saudi Arabia.

Science.gov (United States)

Aboshaiqah, Ahmad E

2015-05-01

The purpose of this study was to assess the work environment as perceived by nurses in a large tertiary hospital in Saudi Arabia. The quality of patient care services has been associated with the quality of work environment of nurses. It is therefore important to assess the work environment in order to acquire baseline data and enable the institution to benchmark their status from established quality standards. This study used a descriptive survey with 1007 staff nurses across service units of a 1000-bed government-operated hospital. The American Association of Critical-Care Nurses (AACN) Healthy Work Environment Assessment Questionnaire was used for data collection. Scores were aggregated and interpreted. Effective decision making, authentic leadership, appropriate staffing, true collaboration, skilled communication and meaningful recognition were rated as good (mean range 3.53-3.76). Healthy work environments mutually benefit patients, nurses, nurse managers, health care providers, the health team, administration, the institution and the community at large. Valuable baseline data on the status of the work environment in this setting were generated. This should allow administrators and staff to work together in improving weaknesses and strengthening further whatever gains that are attained to ensure consistent provision of safe and quality patient care. © 2013 John Wiley & Sons Ltd.

Bacteriological Evaluation of Kwale General Hospital Environment ...

African Journals Online (AJOL)

... Pharmacy (40.7%) and Theatre (18.5%). This study showed that Kwale General Hospital environment is heavily contaminated and therefore underlies the necessity for regular evaluation of the hospital environment. Keywords: Bacteriological evaluation, hospital, environment. Journal of Medical Laboratory Sciences Vol.

The Control of Environment Management Through Administrative Court

Science.gov (United States)

Putrijanti, Aju

2018-02-01

Environment is important in human life. Conflict of interest comes between development of economy sector, citizenship needs and Governance, as it becomes completely difficult to analyze. The environment's lawsuit is increase from the beginning of the Court established. The duty of Administrative Court are to investigate, decide and settle administrative disputes. The Governance has to pay attention before issuing the Government's decree by put principle of good governance as priority. The issue in this paper is strengthening the role of Administrative Court to maintain the environment reuse by settle environment disputes based on the importance of environment. The administrative decisions in environment field may cause a loss or damage for the people. When the public officer did not put the appreciation to the reuse of environment and principle of good governance, it will become problems. The decision should be environmentally friendly. There should be certified judge to settle the dispute. The method of this research by examines the Judge's verdict in environment disputes, and its relation with regulations and the newest issues. The conclusion is increase the role of the Administrative Court to maintain the environment by law enforcement through settle environment disputes.

Natural radiation in the environment

International Nuclear Information System (INIS)

Moeller, D.W.

1990-01-01

The speaker discusses natural radiation in the environment. He outlines the external sources of exposure (cosmic and terrestrial), as well as the internal sources (ingestion and inhalation). He states that a clear understanding of these sources and their impacts is necessary in order to properly evaluate both the environment and human radiation exposure

Environment Modules on the Peregrine System | High-Performance Computing |

Science.gov (United States)

NREL Environment Modules on the Peregrine System Environment Modules on the Peregrine System Peregrine uses environment modules to easily manage software environments. Environment modules facilitate modules commands set up a basic environment for the default compilers, tools and libraries, such as the

2013 Information Sharing Environment Performance Data

Data.gov (United States)

Information Sharing Environment — This is a survey of federal departments and agencies who share terrorism information and are therefore considered part of the Information Sharing Environment. The...

2012 Information Sharing Environment Performance Data

Data.gov (United States)

Information Sharing Environment — This is a survey of federal departments and agencies who share terrorism information and are therefore considered part of the Information Sharing Environment. The...

Women and environment. A socio-ecological study for women on the reformation of the environment

International Nuclear Information System (INIS)

Kappel, I.

2000-05-01

This study addresses the following issues: contributions to improve our environment; the impact of pollutants on our health; the pollution of food and water; water quality regulations. Protection of the environment is defined as the sum total of measures that safeguard woman's natural environment and maintain a biological equilibrium. The efficiency of technological solutions to protect the environment is strictly limited by ecological factors. The goal of environmental protection is to ensure the survival of womankind. Just like plants and animals, the human race is part of an ecosystem. Once this system is destroyed, there is nothing technical measures of environmental protection can do to reverse the process. Life on earth depends on the equilibrium between the oxygen produced by chlorophyllous plants and the oxygen consumed by human beings, animals and technological processes. My interviews with young women and children show that women could contribute very much to the melioration of the environment. The majority of women is trying to switch to non-chemically engineered products, which improves the quality of our water. Biological gardening is preferred by a small minority of women only, but many women take the separation of waste very seriously. However, individual actions can do little to solve the problem of pollution caused by road and air traffic. Life in the fast lane condemns us to the use of cars and airplanes. In the foreseeable future, this means more rather than less pollution. With genetic engineering developing at a breathtaking rate, it seems impossible to avoid a large-scale modification of our food and agricultural produce. So far, many Austrian women fail to appreciate the trend towards genetic manipulation. Neither on the farm nor in the food products themselves is it possible to distinguish genetically engineered innovations. However, behind the consumer's back, this revolution of the food industry is pushed through at an ever greater speed

Designing an adaptive salutogenic care environment

OpenAIRE

Dalton, Cathy; Harrison, Jim D.

2011-01-01

Humans are profoundly affected by the surroundings which they inhabit. Environmental psychologists have produced numerous credible theories describing optimal human environments, based on the concept of congruence or “fit” (1, 2). Lack of person/environment fit can lead to stress-related illness and lack of psychosocial well-being (3). Conversely, appropriately designed environments can promote wellness (4) or “salutogenesis” (5). Increasingly, research in the area of Evidence-Based Design, l...

Managing Workplace Conflict in the School Environment ...

African Journals Online (AJOL)

Managing Workplace Conflict in the School Environment: Challenges, ... Annals of Humanities and Development Studies ... in a working environment, differences in opinion, attitudes and beliefs are bound to ... Conflict, if constructively handled, can be very helpful in making necessary changes within the work environment.

Design and management of sustainable built environments

CERN Document Server

2013-01-01

Climate change is believed to be a great challenge to built environment professionals in design and management. An integrated approach in delivering a sustainable built environment is desired by the built environment professional institutions. The aim of this book is to provide an advanced understanding of the key subjects required for the design and management of modern built environments to meet carbon emission reduction targets. In Design and Management of Sustainable Built Environments, an international group of experts provide comprehensive and the most up-to-date knowledge, covering sustainable urban and building design, management and assessment. The best practice case studies of the implementation of sustainable technology and management from the BRE Innovation Park are included. Design and Management of Sustainable Built Environments will be of interest to urban and building designers, environmental engineers, and building performance assessors.  It will be particularly useful as a reference book ...

Space Environment Modeling

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Collection includes presentation materials and outputs from operational space environment models produced by the NOAA Space Weather Prediction Center (SWPC) and...

Rich Environments for Adult Learners

Science.gov (United States)

Bentham, Renee

2008-01-01

Unaware of the messages a bare adult learning environment sends and its effect on adult learners, a trainer attends an intensive Reggio Emilia course and learns that the physical environment is the "third teacher"--for adults as well as for children. Using principles of Reggio, she offers suggestions for enhancing adult learning spaces and…

Agent Supported Serious Game Environment

Science.gov (United States)

Terzidou, Theodouli; Tsiatsos, Thrasyvoulos; Miliou, Christina; Sourvinou, Athanasia

2016-01-01

This study proposes and applies a novel concept for an AI enhanced serious game collaborative environment as a supplementary learning tool in tertiary education. It is based on previous research that investigated pedagogical agents for a serious game in the OpenSim environment. The proposed AI features to support the serious game are the…

Chemistry of complexing molecules and environment. Report of the working group of the Cea ''mission environment''

International Nuclear Information System (INIS)

Petit, J.C.

1998-01-01

The Working group 'Chemistry of Complexing Molecules and Environment' of the Mission Environment (AG/ENV) identified themes for an original positioning of CEA on important issues of environmental research if a sufficiently strong demand appears. The research of CEA on the environment should be complementary to actions undertaken by other partners (official institutions, research organizations and industrial firms). The themes suggested are: the synthesis of new chelating molecules and new materials having specific properties, with the support of theoretical chemistry and modeling, analytical physical chemistry and speciation of species in relation to their eco-toxicity and their biogeochemical mobility in the natural environment. These themes, illustrated by examples of actions in progress at CEA or likely to be launched quickly, draw largely from recognized competences of the teams, generally developed for finalized nuclear applications: experimental, theoretical and instrumental competences. (author)

ISS Local Environment Spectrometers (ISLES)

Science.gov (United States)

Krause, Linda Habash; Gilchrist, Brian E.

2014-01-01

In order to study the complex interactions between the space environment surrounding the ISS and the ISS surface materials, we propose to use lowcost, high-TRL plasma sensors on the ISS robotic arm to probe the ISS space environment. During many years of ISS operation, we have been able to condut effective (but not perfect) extravehicular activities (both human and robotic) within the perturbed local ISS space environment. Because of the complexity of the interaction between the ISS and the LEO space environment, there remain important questions, such as differential charging at solar panel junctions (the so-called "triple point" between conductor, dielectric, and space plasma), increased chemical contamination due to ISS surface charging and/or thruster activation, water dumps, etc, and "bootstrap" charging of insulating surfaces. Some compelling questions could synergistically draw upon a common sensor suite, which also leverages previous and current MSFC investments. Specific questions address ISS surface charging, plasma contactor plume expansion in a magnetized drifting plasma, and possible localized contamination effects across the ISS.

Environment and health

Energy Technology Data Exchange (ETDEWEB)

Paert, P. (and others)

2005-07-01

Public concerns, evidence from research and increasing scientific knowledge are all driving widespread discussions on environment and health problems. The issue of environment and health is characterised by multi-causality with different strengths of association. This means that the links between exposures and their health consequences depend on the environmental pollutants and diseases being considered, but are also influenced by factors such as genetic constitution, age, nutrition and lifestyle, and socioeconomic factors such as poverty and level of education. Chapter headings are: Introduction; Environmental burden of disease; Respiratory disease, asthma and allergies; Cancer; Neurodevelopmental disorders; Endocrine disruption; Body burden of chemicals; Wildlife as early warning signals for human impacts; and Climate change and health. 35 refs., 12 figs., 3 tabs.

Virtual Satellite Integration Environment, Phase II

Data.gov (United States)

National Aeronautics and Space Administration — An integrated environment for rapid design studies of small satellite missions will be developed. This environment will be designed to streamline processes at the...

42 CFR 494.60 - Condition: Physical environment.

Science.gov (United States)

2010-10-01

... 42 Public Health 5 2010-10-01 2010-10-01 false Condition: Physical environment. 494.60 Section 494... Patient Safety § 494.60 Condition: Physical environment. The dialysis facility must be designed..., and comfortable treatment environment. (a) Standard: Building. The building in which dialysis services...

Climate change consequences for the indoor environment

NARCIS (Netherlands)

Ariës, M.B.C.; Bluyssen, P.M.

2009-01-01

Scientists warn us about climate change and its effects on the outdoor environment. These effects can have significant consequences for the indoor environment, also in the Netherlands. Climate changes will affect different aspects of the indoor environment as well as the stakeholders of that indoor

Cancer and environment - collective expertise

International Nuclear Information System (INIS)

Baldi, Isabelle; Bard, Denis; Barouki, Robert; Benhamou, Simone; Benichou, Jacques; Bernier, Marie-Odile; Bouchot, Olivier; Carayon, Pierre; Ceraline, Jocelyn; Charafe-Jauffret, Emmanuelle; Clavel, Jacqueline; Clavel-Chapelon, Francoise; De Vathaire, Florent; Gerber, Mariette; Gilg Soit Ilg, Anabelle; Guenel, Pascal; Guillouzo, Andre; Hainaut, Pierre; Jaurand, Marie-Claude; Jougla, Eric; Launoy, Guy; Laurier, Dominique; Levi, Yves; Maynadie, Marc; Momas, Isabelle; Pairon, Jean-Claude; Paris, Christophe; Parmentier, Claude; Sanson, Marc; Savouret, Jean-Francois; Stuecker, Isabelle; Thonneau, Patrick; Walschaerts, Marie; Billon-Galland, Marie-Annick; Coignard, Florence; Grosclaude, Pascale; Guignon, Nicole; Hours, Martine; Molinie, Florence; Sandret, Nicolas; Multigner, Luc; Sasco, Annie; Bonnin, Fabienne; Chenu, Catherine; Etiemble, Jeanne; Gomis, Cecile; Labro, Marie-Therese; Pellier, Anne-Laure; Rondet-Grellier, Chantal

2008-01-01

This document reports the work of two groups of experts on the impact of the environment on some cancers the incidence of which has increased during the past twenty years. After a first part discussing the general mechanisms of toxicity, the report discusses various aspects (notably classification, incidence and evolution, mortality, known and debated risk factors) for different cancer types: lung cancer, mesothelioma, malignant hemopathies, brain tumours, breast cancer, ovarian cancer, testicular cancer, prostate cancer, thyroid cancer. It also discusses knowledge on the exposure to chemical and physical agents (assessment modalities and exposure data in general environment and in professional environment, exposure to ionizing radiation, to electromagnetic fields and to endocrine disrupters)

Collaborative Environment and Agile Development

Directory of Open Access Journals (Sweden)

Bogdan GHILIC-MICU

2014-01-01

Full Text Available Over time, information and communications technology development has made a direct impact on human activity in the individual context as well as familial, economic and social. This has laid the premise for adoption of new and modern paradigms in individual and organizational activity management. The evolutionary climax of the social universe is called nowadays knowledge society. The knowledge society succeeds the information society, emphasizing the development of the opportunities brought by collaborative work environment and agile approach. In this paper we will highlight the use of collaborative environment in agile software development, as an instrument for managing organizations in knowledge society. Thus, we will emphasize the paradigms of agile testing, validation and verification in collaborative environment.

A study on environment public spending

Directory of Open Access Journals (Sweden)

Wellington Bueno

2013-12-01

Full Text Available This text deals with the importance of studying environment public spending. Initially, we discuss the concept of environment public spending and how it became a public accounting function. Later, an analysis of several studies on the theme was carried out to promote a discussion on the environment public funds allocated by governments. Next, a discussion on the relevance of the theme and the need for further studies is presented, since investments on environment management still need to be better allocated and duly dimensioned. Currently, transparence in public spending has promoted the realization of more studies, leading to a more careful observation of environmental issues by the society, showing that these issues still need more attention from the goverment.

Learning Environment And Pupils Academic Performance ...

African Journals Online (AJOL)

Learning Environment And Pupils Academic Performance: Implications For Counselling. ... facilities as well as learning materials to make teaching and learning easy. In addition, teachers should provide conducive classroom environment to ...

The built environment and public health

National Research Council Canada - National Science Library

Lopez, Russ

2012-01-01

"This text combines an examination of how the physical environment affects our health with a description of how public health and urban planning can work together to create environments that improve...

40 CFR 68.33 - Defining offsite impacts-environment.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 15 2010-07-01 2010-07-01 false Defining offsite impacts-environment. 68.33 Section 68.33 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... impacts—environment. (a) The owner or operator shall list in the RMP environmental receptors within a...

Indoor Thermal Environment in Tropical Climate Residential Building

Directory of Open Access Journals (Sweden)

Jamaludin Nazhatulzalkis

2014-01-01

Full Text Available Indoor thermal environment is one of the criteria in sustainable building. This criterion is important in ensuring a healthy indoor environment for the occupants. The consideration of environmental concerns at the early design stage would effectively integrate the sustainability of the building environment. Global climate changes such as global warming do affect human comfort since people spend most of their time and activities in the building. The increasing of urban population required additional housing for households, as well as places to shop, office and other facilities. Occupants are now more conscious the importance of sustainability for a better quality of life. Good thermal environment is essential for human wellness and comfort. A residential environment will influence residents’ health and safety. The global warming increase the earth’s temperature and greenhouse emission to the atmosphere cause adverse effects to the outdoor environment. Residential developments modify the materials, structure and energy balance in urban climate effects of human economic activities. As an indoor environment is influenced by the outdoor condition, the factors affecting indoor thermal environment are crucial in improving a comfortable and healthy environment in residential building. The microclimatic of a site such as temperature and relative humidity, and wind movement led to the variation of indoor thermal environment in the building.

Stress corrosion in gaseous environment

International Nuclear Information System (INIS)

Miannay, Dominique.

1980-06-01

The combined influences of a stress and a gaseous environment on materials can lead to brittleness and to unexpected delayed failure by stress corrosion cracking, fatigue cracking and creep. The most important parameters affering the material, the environment, the chemical reaction and the stress are emphasized and experimental works are described. Some trends for further research are given [fr

Environment and power; Umwelt und Energie

Energy Technology Data Exchange (ETDEWEB)

Franz, W.; Ramser, H.J.; Stadler, M. (eds.)

2006-07-01

Within the scope of the 35th economic seminar with he title '' Environment and power'' held between 18th and 21st September, 2006, at the monastery Ottobeuren (Federal Republic of Germany), the following lectures were held: (a) Environment and power: introduction into the subject matter (Karl Heinrich Opplaender); (b) Theoretical fundamentals of the sustainability (Wolfgang Buchholz); (c) Ecological fiscal reform and double dividend (Ronnie Schoeb); (d) ''My friend, that is all mere theory'' - Notes to the emission trading (Christoph Boehringer); (e) Environmental policy and locational competition (Michael Rauscher); (f) Dynamical incentives of environment political instruments - a survey (Till Requate); (g) Product differentiation in the presence of environmental concern, network effects and compatibility: The automobile market (Klaus Conrad); (h) The liability right as an instrument of environment policy (Alfred Endres); (i) environment economy and experimental evidence (Joachim Weimann); (j) Market design in the energy economy (Felix Muesgen, Axel Ockenfels); (k) Re-regulation of the liberalized energy markets in Europe (Carl Christian von Weizsaecker).

Democratizing Authority in the Built Environment

Energy Technology Data Exchange (ETDEWEB)

Andersen, Michael P [UC Berkeley; Kolb, John [UC Berkeley; Chen, Kaifei [UC Berkeley; Culler, David [UC Berkeley; Katz, Randy [UC Berkeley

2017-11-08

Operating systems and applications in the built environment have relied upon central authorization and management mechanisms which restrict their scalability, especially with respect to administrative overhead. We propose a new set of primitives encompassing syndication, security, and service execution that unifies the management of applications and services across the built environment, while enabling participants to individually delegate privilege across multiple administrative domains with no loss of security or manageability. We show how to leverage a decentralized authorization syndication platform to extend the design of building operating systems beyond the single administrative domain of a building. The authorization system leveraged is based on blockchain smart contracts to permit decentralized and democratized delegation of authorization without central trust. Upon this, a publish/subscribe syndication tier and a containerized service execution environment are constructed. Combined, these mechanisms solve problems of delegation, federation, device protection and service execution that arise throughout the built environment. We leverage a high-fidelity city-scale emulation to verify the scalability of the authorization tier, and briefly describe a prototypical democratized operating system for the built environment using this foundation.

Peat exploitation - Environment. Effects and measures

International Nuclear Information System (INIS)

Stenbeck, G.

1996-01-01

This report gives a detailed description of the influence of peat exploitation on the land-, water- and atmospheric environments. Proposals for mitigatory measures to minimize damage to the environment are also given

42 CFR 416.44 - Condition for coverage-Environment.

Science.gov (United States)

2010-10-01

... 42 Public Health 3 2010-10-01 2010-10-01 false Condition for coverage-Environment. 416.44 Section... for coverage—Environment. The ASC must have a safe and sanitary environment, properly constructed, equipped, and maintained to protect the health and safety of patients. (a) Standard: Physical environment...

Space Environment Information System (SPENVIS)

Science.gov (United States)

Kruglanski, Michel; de Donder, Erwin; Messios, Neophytos; Hetey, Laszlo; Calders, Stijn; Evans, Hugh; Daly, Eamonn

SPENVIS is an ESA operational software developed and maintained at BIRA-IASB since 1996. It provides standardized access to most of the recent models of the hazardous space environment, through a user-friendly Web interface (http://www.spenvis.oma.be/). The system allows spacecraft engineers to perform a rapid analysis of environmental problems related to natural radiation belts, solar energetic particles, cosmic rays, plasmas, gases, magnetic fields and micro-particles. Various reporting and graphical utilities and extensive help facilities are included to allow engineers with relatively little familiarity to produce reliable results. SPENVIS also contains an active, integrated version of the ECSS Space Environment Standard and access to in-flight data on the space environment. Although SPENVIS in the first place is designed to help spacecraft designers, it is also used by technical universities in their educational programs. In the framework of the ESA Space Situational Awareness Preparatory Programme, SPENVIS will be part of the initial set of precursor services of the Space Weather segment. SPENVIS includes several engineering models to assess to effects of the space environment on spacecrafts such as surface and internal charging, energy deposition, solar cell damage and SEU rates. The presentation will review how such models could be connected to in situ measurements or forecasting models of the space environment in order to produce post event analysis or in orbit effects alert. The last developments and models implemented in SPENVIS will also be presented.

Quasars in galaxy cluster environments

International Nuclear Information System (INIS)

Ellingson, E.

1989-01-01

The evolution of radio loud quasars is found to be strongly dependent upon their galaxy cluster environment. Previous studies have shown that bright quasars are found in rich clusters, while high luminosity quasars are found only in poorer environments. The analysis of low luminosity radio quiet quasars indicate that they are never found in rich environments, suggesting that they are a physically different class of objects. Properties of the quasar environment are investigated to determine constraints on the physical mechanisms of quasar formation and evolution. The optical cluster morphology indicates that the cluster cores have smaller radii and higher galaxy densities than are typical for low redshift clusters of similar richness. Radio morphologies may indicate that the formation of a dense intra-cluster medium is associated with the quasars' fading at these epochs. Galaxy colors appear to be normal, but there may be a tendency for clusters associated with high luminosity quasars to contain a higher fraction of gas-rich galaxies than those associated with low luminosity quasars. Multislit spectroscopic observations of galaxies associated with high luminosity quasars indicate that quasars are preferentially located in regions of low relative velocity dispersion, either in rich clusters of abnormally low dispersion, or in poor groups which are dynamically normal. This suggests that galaxy-galaxy interactions may play a role in quasar formation and sustenanace. Virialization of rich clusters and the subsequent increase in galaxy velocities may therefore be responsible for the fading of quasars in rich environments

Dynamic thermal environment and thermal comfort.

Science.gov (United States)

Zhu, Y; Ouyang, Q; Cao, B; Zhou, X; Yu, J

2016-02-01

Research has shown that a stable thermal environment with tight temperature control cannot bring occupants more thermal comfort. Instead, such an environment will incur higher energy costs and produce greater CO2 emissions. Furthermore, this may lead to the degeneration of occupants' inherent ability to combat thermal stress, thereby weakening thermal adaptability. Measured data from many field investigations have shown that the human body has a higher acceptance to the thermal environment in free-running buildings than to that in air-conditioned buildings with similar average parameters. In naturally ventilated environments, occupants have reported superior thermal comfort votes and much greater thermal comfort temperature ranges compared to air-conditioned environments. This phenomenon is an integral part of the adaptive thermal comfort model. In addition, climate chamber experiments have proven that people prefer natural wind to mechanical wind in warm conditions; in other words, dynamic airflow can provide a superior cooling effect. However, these findings also indicate that significant questions related to thermal comfort remain unanswered. For example, what is the cause of these phenomena? How we can build a comfortable and healthy indoor environment for human beings? This article summarizes a series of research achievements in recent decades, tries to address some of these unanswered questions, and attempts to summarize certain problems for future research. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

PubChem atom environments.

Science.gov (United States)

Hähnke, Volker D; Bolton, Evan E; Bryant, Stephen H

2015-01-01

Atom environments and fragments find wide-spread use in chemical information and cheminformatics. They are the basis of prediction models, an integral part in similarity searching, and employed in structure search techniques. Most of these methods were developed and evaluated on the relatively small sets of chemical structures available at the time. An analysis of fragment distributions representative of most known chemical structures was published in the 1970s using the Chemical Abstracts Service data system. More recently, advances in automated synthesis of chemicals allow millions of chemicals to be synthesized by a single organization. In addition, open chemical databases are readily available containing tens of millions of chemical structures from a multitude of data sources, including chemical vendors, patents, and the scientific literature, making it possible for scientists to readily access most known chemical structures. With this availability of information, one can now address interesting questions, such as: what chemical fragments are known today? How do these fragments compare to earlier studies? How unique are chemical fragments found in chemical structures? For our analysis, after hydrogen suppression, atoms were characterized by atomic number, formal charge, implicit hydrogen count, explicit degree (number of neighbors), valence (bond order sum), and aromaticity. Bonds were differentiated as single, double, triple or aromatic bonds. Atom environments were created in a circular manner focused on a central atom with radii from 0 (atom types) up to 3 (representative of ECFP_6 fragments). In total, combining atom types and atom environments that include up to three spheres of nearest neighbors, our investigation identified 28,462,319 unique fragments in the 46 million structures found in the PubChem Compound database as of January 2013. We could identify several factors inflating the number of environments involving transition metals, with many

Nuclear energy and environment of China

International Nuclear Information System (INIS)

Zhang Kunmin

1993-01-01

The paper included following contents: China needs to develop nuclear energy; China pays attention to the radiation environment management; the role of China National Environmental Protection Agency in nuclear energy and the environment

Energy, Environment and IMCC

DEFF Research Database (Denmark)

Mogensen, Mogens Bjerg

2012-01-01

This paper gives a brief description of the important role that the ionic and mixed conducting ceramics (IMCC) type of materials will play in the R&D of energy and environment technologies of the - presumably - near future. IMCC materials based technologies for energy harvesting, conversion...... and storage as well as for monitoring and protection of our environment are exemplified. The strong impact of the international IMCC research on development of devices based on such materials is illustrated, and some recent trends in the scientific exploration of IMCC are highlighted. Important groups...

WWW-based environments for collaborative group work

NARCIS (Netherlands)

Collis, Betty

1998-01-01

Since 1994, we have been involved in the design and use of a series of WWW-based environments to support collaborative group work for students in a technical university in The Netherlands. These environments, and the course re-design that accompanies each new environment, began in April 1994 and

Open environments to support systems engineering tool integration: A study using the Portable Common Tool Environment (PCTE)

Science.gov (United States)

Eckhardt, Dave E., Jr.; Jipping, Michael J.; Wild, Chris J.; Zeil, Steven J.; Roberts, Cathy C.

1993-01-01

A study of computer engineering tool integration using the Portable Common Tool Environment (PCTE) Public Interface Standard is presented. Over a 10-week time frame, three existing software products were encapsulated to work in the Emeraude environment, an implementation of the PCTE version 1.5 standard. The software products used were a computer-aided software engineering (CASE) design tool, a software reuse tool, and a computer architecture design and analysis tool. The tool set was then demonstrated to work in a coordinated design process in the Emeraude environment. The project and the features of PCTE used are described, experience with the use of Emeraude environment over the project time frame is summarized, and several related areas for future research are summarized.

Micro-computer cards for hard industrial environment

Energy Technology Data Exchange (ETDEWEB)

Breton, J M

1984-03-15

Approximately 60% of present or future distributed systems have, or will have, operational units installed in hard environments. In these applications, which include canalization and industrial motor control, robotics and process control, systems must be easily applied in environments not made for electronic use. The development of card systems in this hard industrial environment, which is found in petrochemical industry and mines is described. National semiconductor CIM card system CMOS technology allows the real time micro computer application to be efficient and functional in hard industrial environments.

Architecture & Environment

Science.gov (United States)

Erickson, Mary; Delahunt, Michael

2010-01-01

Most art teachers would agree that architecture is an important form of visual art, but they do not always include it in their curriculums. In this article, the authors share core ideas from "Architecture and Environment," a teaching resource that they developed out of a long-term interest in teaching architecture and their fascination with the…

The farrier's work environment.

Science.gov (United States)

Löfqvist, Lotta; Pinzke, Stefan

2012-01-01

The horse industry in Sweden has rapidly expanded in recent years. This increasing number of horses implies a greater need for more farriers. Shoeing a horse is hard physical work, and includes awkward work postures and repetitive movements. It is well known that hard physical work increases the risk of injuries and musculoskeletal problems. The risk is especially high for musculoskeletal disorders when certain movements are constantly repeated. Heavy or repeated unilateral loads lead to considerable stress on the muscles, which can lead to rupture and fatigue that can cause long term problems. A case study showed that farriers worked 75% of their work time with their backs in bent positions (often more than 70 degrees). Farriers are also exposed to risk factors in their physical environment like dust, noise and poor lighting. Risk of kicks and bites, eye injuries and burns are other factors that make their work environment hazardous. There are only a few studies available that have documented the farriers' working environment and these are not of recent date. A US study from 1984 described kicks and bites from horses, metal splinters in the eyes, heat exhaustion and problematic postures to be perceived as the greatest risks in their work. The back, knees and wrists were the most exposed body regions. There is a need for more current and in-depth studies investigating the farriers' working conditions in order to gain more knowledge of their health and work environment. The aim of the present study is to investigate the physical health and work environment of farriers. The investigation will use questionnaires, work load measurements and workplace analysis. The results will serve as a base for improvements concerning the design of the workplace, equipment, tools and aids as well as supplying recommendations about physical exercise and the correct work technique, etc. The results are planned to be incorporated in the education of farriers.

CONTROL ENVIRONMENT IN KOSOVO PUBLIC INSTITUTIONS

Directory of Open Access Journals (Sweden)

Shaqir M. REXHEPI

2015-06-01

Full Text Available The study on how is Internal Control System developed in public institutions is of a special importance for modalities, forms and the manner of the application of relevant strategies for the functioning of internal control environment in public institutions. In this paper, there is treated the existing situation of internal control system environment of public finances and its implementation in public sector. For internal control system environment in public finances to function effectively, there should exist a coherent control environment which includes responsibilities for financial management from managers of Publicly Owned Enterprises and with complete functioning of internal audit, which exists in the function of development to add value. In Kosovo public institutions, this framework is offered by legislation and by institutional mechanism for the implementation of legislation according to these parameters.

Biodegradation of bioplastics in natural environments.

Science.gov (United States)

Emadian, S Mehdi; Onay, Turgut T; Demirel, Burak

2017-01-01

The extensive production of conventional plastics and their use in different commercial applications poses a significant threat to both the fossil fuels sources and the environment. Alternatives called bioplastics evolved during development of renewable resources. Utilizing renewable resources like agricultural wastes (instead of petroleum sources) and their biodegradability in different environments enabled these polymers to be more easily acceptable than the conventional plastics. The biodegradability of bioplastics is highly affected by their physical and chemical structure. On the other hand, the environment in which they are located, plays a crucial role in their biodegradation. This review highlights the recent findings attributed to the biodegradation of bioplastics in various environments, environmental conditions, degree of biodegradation, including the identified bioplastic-degrading microorganisms from different microbial communities. Copyright © 2016 Elsevier Ltd. All rights reserved.

Ada Run Time Support Environments and a common APSE Interface Set. [Ada Programming Support Environment

Science.gov (United States)

Mckay, C. W.; Bown, R. L.

1985-01-01

The paper discusses the importance of linking Ada Run Time Support Environments to the Common Ada Programming Support Environment (APSE) Interface Set (CAIS). A non-stop network operating systems scenario is presented to serve as a forum for identifying the important issues. The network operating system exemplifies the issues involved in the NASA Space Station data management system.

Development and evaluation of a food environment survey in three urban environments of Kunming, China

Science.gov (United States)

2014-01-01

Background Given the rapid pace of urbanization and Westernization and the increasing prevalence of obesity, there is a need for research to better understand the influence of the built environment on overweight and obesity in world’s developing regions. Culturally-specific food environment survey instruments are important tools for studying changing food availability and pricing. Here, we present findings from an effort to develop and evaluate food environment survey instruments for use in a rapidly developing city in southwest China. Methods We developed two survey instruments (for stores and restaurants), each designed to be completed within 10 minutes. Two pairs of researchers surveyed a pre-selected 1-km stretch of street in each of three socio-demographically different neighborhoods to assess inter-rater reliability. Construct validity was assessed by comparing the food environments of the neighborhoods to cross-sectional height and weight data obtained on 575 adolescents in the corresponding regions of the city. Results 273 food establishments (163 restaurants and 110 stores) were surveyed. Sit-down, take-out, and fast food restaurants accounted for 40%, 21% and 19% of all restaurants surveyed. Tobacco and alcohol shops, convenience stores and supermarkets accounted for 25%, 12% and 11%, respectively, of all stores surveyed. We found a high percentage of agreement between teams (>75%) for all categorical variables with moderate kappa scores (0.4-0.6), and no statistically significant differences between teams for any of the continuous variables. More developed inner city neighborhoods had a higher number of fast food restaurants and convenience stores than surrounding neighborhoods. Adolescents who lived in the more developed inner neighborhoods also had a higher percentage of overweight, indicating well-founded construct validity. Depending on the cutoff used, 19% to 36% of male and 10% to 22% of female 16-year old adolescents were found to be overweight

Development and evaluation of a food environment survey in three urban environments of Kunming, China.

Science.gov (United States)

Hua, Jenna; Seto, Edmund; Li, Yan; Wang, May C

2014-03-06

Given the rapid pace of urbanization and Westernization and the increasing prevalence of obesity, there is a need for research to better understand the influence of the built environment on overweight and obesity in world's developing regions. Culturally-specific food environment survey instruments are important tools for studying changing food availability and pricing. Here, we present findings from an effort to develop and evaluate food environment survey instruments for use in a rapidly developing city in southwest China. We developed two survey instruments (for stores and restaurants), each designed to be completed within 10 minutes. Two pairs of researchers surveyed a pre-selected 1-km stretch of street in each of three socio-demographically different neighborhoods to assess inter-rater reliability. Construct validity was assessed by comparing the food environments of the neighborhoods to cross-sectional height and weight data obtained on 575 adolescents in the corresponding regions of the city. 273 food establishments (163 restaurants and 110 stores) were surveyed. Sit-down, take-out, and fast food restaurants accounted for 40%, 21% and 19% of all restaurants surveyed. Tobacco and alcohol shops, convenience stores and supermarkets accounted for 25%, 12% and 11%, respectively, of all stores surveyed. We found a high percentage of agreement between teams (>75%) for all categorical variables with moderate kappa scores (0.4-0.6), and no statistically significant differences between teams for any of the continuous variables. More developed inner city neighborhoods had a higher number of fast food restaurants and convenience stores than surrounding neighborhoods. Adolescents who lived in the more developed inner neighborhoods also had a higher percentage of overweight, indicating well-founded construct validity. Depending on the cutoff used, 19% to 36% of male and 10% to 22% of female 16-year old adolescents were found to be overweight. The prevalence of

Social Interaction Development through Immersive Virtual Environments

Science.gov (United States)

Beach, Jason; Wendt, Jeremy

2014-01-01

The purpose of this pilot study was to determine if participants could improve their social interaction skills by participating in a virtual immersive environment. The participants used a developing virtual reality head-mounted display to engage themselves in a fully-immersive environment. While in the environment, participants had an opportunity…

System survivability in nuclear and space environments

International Nuclear Information System (INIS)

Rudie, N.J.

1987-01-01

Space systems must operate in the hostile natural environment of space. In the event of a war, these systems may also be exposed to the radiation environments created by the explosions of nuclear warheads. The effects of these environments on a space system and hardening techniques are discussed in the paper

The Future of the Global Environment: A Model-based Analysis Supporting UNEP's First Global Environment Outlook

NARCIS (Netherlands)

Bakkes JA; Woerden JW van; Alcamo J; Berk MM; Bol P; Born GJ van den; Brink BJE ten; Hettelingh JP; Langeweg F; Niessen LW; Swart RJ; United Nations Environment; MNV

1997-01-01

This report documents the scenario analysis in UNEP's first Global Environment Outlook, published at the same time as the scenario analysis. This Outlook provides a pilot assessment of developments in the environment, both global and regional, between now and 2015, with a further projection to

Interaction Between Physical Environment, Social Environment, and Child Characteristics in Determining Physical Activity at Child Care

NARCIS (Netherlands)

Gubbels, J.S.; Kremers, S.P.J.; Kann, D.H.H. van; Stafleu, A.; Candel, M.J.J.M.; Dagnelie, P.C.; Thijs, C.; Vries, N.K.de

2011-01-01

Objective: To investigate the association between the child-care environment and physical activity of 2- and 3-year-olds. Based on an ecological view of environmental influences on health behavior, we hypothesized that the social and physical environment, as well as child characteristics (age and

The International Macro-Environment of an Organization

Directory of Open Access Journals (Sweden)

Ileana (Badulescu Anastase

2016-01-01

Full Text Available The international macro-environment (supranational macro-environment brings together allthe uncontrollable factors with a global impact, and it is related to the organization’s indirectrelationships on international markets. Romania’s globalization and the EU integration increasedthe importance of the macro-environment for all organizations, regardless of their degree ofinternationalization. In marketing, we must master the main agreements between countries and theregulations emanating from general international bodies, reflecting on their business, on differentforeign markets. Knowledge of the international environment is possible only through an analysisof its components (Anastase, I., 2012, p.41.

Securing collaborative environments

Energy Technology Data Exchange (ETDEWEB)

Agarwal, Deborah [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Jackson, Keith [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Thompson, Mary [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

2002-05-16

The diverse set of organizations and software components involved in a typical collaboratory make providing a seamless security solution difficult. In addition, the users need support for a broad range of frequency and locations for access to the collaboratory. A collaboratory security solution needs to be robust enough to ensure that valid participants are not denied access because of its failure. There are many tools that can be applied to the task of securing collaborative environments and these include public key infrastructure, secure sockets layer, Kerberos, virtual and real private networks, grid security infrastructure, and username/password. A combination of these mechanisms can provide effective secure collaboration capabilities. In this paper, we discuss the requirements of typical collaboratories and some proposals for applying various security mechanisms to collaborative environments.

Pervasive Learning Environments

DEFF Research Database (Denmark)

Helms, Niels Henrik; Hundebøl, Jesper

2006-01-01

The potentials of pervasive communication in learning within industry and education are right know being explored through different R&D projects. This paper outlines the background for and the possible learning potentials in what we describe as pervasive learning environments (PLE). PLE's differ...... from virtual learning environments (VLE) primarily because in PLE's the learning content is very much related to the actual context in which the learner finds himself. Two local (Denmark) cases illustrate various aspects of pervasive learning. One is the eBag, a pervasive digital portfolio used...... in schools. The other is moreover related to work based learning in that it foresees a community of practitioners accessing, sharing and adding to knowledge and learning objects held within a pervasive business intelligence system. Limitations and needed developments of these and other systems are discussed...

Balancing media environments

DEFF Research Database (Denmark)

Olesen, Mogens

The paper examines how students in Danish upper secondary schools experience the uses and effects of the digital environment in relation to their school activities. Theoretically a media ecological perspective (Strate 2006) is applied which understands teaching and learning practices as shaped...... by the interrelation between teacher, student and the media technologies. According to this perspective, media creates an environment that shapes our possibilities for acting and communicating. In a basic sense, teaching and learning is a communicative situation where, traditionally, the teacher sends information...... to the receiving students through a medium (e.g. speech, blackboard, book or online learning platform). Digital media challenge this situation due to their affordances (Gibson 1979) for interactivity. Affordance has become an increasingly popular term within media studies for describing a complementary...

Ecohealth Works: Health in Urban Environments

International Development Research Centre (IDRC) Digital Library (Canada)

Cities attract millions of people seeking a better life and greater opportunities. ... By looking at urban environments ... Urban environments are changing, exposing people to new .... the river basin that are now actively engaged in promoting ...

42 CFR 485.62 - Condition of participation: Physical environment.

Science.gov (United States)

2010-10-01

... 42 Public Health 5 2010-10-01 2010-10-01 false Condition of participation: Physical environment... of participation: Physical environment. The facility must provide a physical environment that...) Standard: Sanitary environment. The facility must maintain a sanitary environment and establish a program...

Cooling tower and environment

International Nuclear Information System (INIS)

Becker, J.; Ederhof, A.; Gosdowski, J.; Harms, A.; Ide, G.; Klotz, B.; Kowalczyk, R.; Necker, P.; Tesche, W.

The influence of a cooling tower on the environment, or rather the influence of the environment on the cooling tower stands presently -along with the cooling water supply - in the middle of much discussion. The literature on these questions can hardly be overlooked by the experts concerned, especially not by the power station designers and operators. The document 'Cooling Tower and Environment' is intented to give a general idea of the important publications in this field, and to inform of the present state of technology. In this, the explanations on every section make it easier to get to know the specific subject area. In addition to older standard literature, this publication contains the best-known literature of recent years up to spring 1975, including some articles written in English. Further English literature has been collected by the ZAED (KFK) and is available at the VGB-Geschaefsstelle. Furthermore, The Bundesumweltamt compiles the literature on the subject of 'Environmental protection'. On top of that, further documentation centres are listed at the end of this text. (orig.) [de

Greening the built environment

Energy Technology Data Exchange (ETDEWEB)

Smith, Maf; Whitelegg, John; Williams, Nick J.

1998-07-15

The built environment incorporates our homes, our workplaces and places of leisure. Under the influence of a complex web of social and economic processes, it is where many issues of human and environmental well-being come to a head - whether of space, mobility, energy consumption, pollution, health or security. All too often, concerns such as cost are put before the things we value for a fulfilling life, including peace and quiet and health and happiness. Getting the built environment right is fundamental to a sustainable society and requires an integrated approach. This important new book, published in association with the World Wide Fund For Nature (WWF-UK), provides us with a firm understanding of the interrelationships of many of the issues and problems of the built environment and describes the holistic models of development, management and planning necessary for urban sustainability. It draws attention to the major challenges and policy implications and offers analysis, approaches and vision for moving towards sustainable towns and cities that in turn will facilitate sustainable lifestyles. (Author)

Interactive learning environments in augmented reality technology

Directory of Open Access Journals (Sweden)

Rafał Wojciechowski

2010-01-01

Full Text Available In this paper, the problem of creation of learning environments based on augmented reality (AR is considered. The concept of AR is presented as a tool for safe and cheap experimental learning. In AR learning environments students may acquire knowledge by personally carrying out experiments on virtual objects by manipulating real objects located in real environments. In the paper, a new approach to creation of interactive educational scenarios, called Augmented Reality Interactive Scenario Modeling (ARISM, is mentioned. In this approach, the process of building learning environments is divided into three stages, each of them performed by users with different technical and domain knowledge. The ARISM approach enables teachers who are not computer science experts to create AR learning environments adapted to the needs of their students.

Video personalization for usage environment

Science.gov (United States)

Tseng, Belle L.; Lin, Ching-Yung; Smith, John R.

2002-07-01

A video personalization and summarization system is designed and implemented incorporating usage environment to dynamically generate a personalized video summary. The personalization system adopts the three-tier server-middleware-client architecture in order to select, adapt, and deliver rich media content to the user. The server stores the content sources along with their corresponding MPEG-7 metadata descriptions. Our semantic metadata is provided through the use of the VideoAnnEx MPEG-7 Video Annotation Tool. When the user initiates a request for content, the client communicates the MPEG-21 usage environment description along with the user query to the middleware. The middleware is powered by the personalization engine and the content adaptation engine. Our personalization engine includes the VideoSue Summarization on Usage Environment engine that selects the optimal set of desired contents according to user preferences. Afterwards, the adaptation engine performs the required transformations and compositions of the selected contents for the specific usage environment using our VideoEd Editing and Composition Tool. Finally, two personalization and summarization systems are demonstrated for the IBM Websphere Portal Server and for the pervasive PDA devices.

Standardization of green building technologies for environment design

Directory of Open Access Journals (Sweden)

Benuzh Andrey

2016-01-01

Full Text Available The article describes the structure and field of standardization ISO / TC 205 “Building environment design”, provides examples of green building technologies. The main purpose of the article is to show the interaction between international ISO / TC 205 “Building environment design” and created in Russia in 2016 the Technical Committee of Standardization № 366 “Green technology of the build environment and green innovative products”. Both of these technical committees promote green building technologies for environment design, thereby deal with the negative impact on the environment and the reasons of global warming. Instead of buildings that attempt to suppress and overcome nature, why not design buildings that integrate with the environment, on every possible level? The international standardization work which ISO/TC 205 “Building environment design” performs seeks, in addition to lowering trade barriers for engineering design, to promote and facilitate the design of high performance buildings: higher performing as economic assets for their owners, higher performing as buildings that provide amenable indoor environment for their occupants, and higher performing with respect to resource utilization and environmental impact.

Silence and table manners: when environments activate norms.

Science.gov (United States)

Joly, Janneke F; Stapel, Diederik A; Lindenberg, Siegwart M

2008-08-01

Two studies tested the conditions under which an environment (e.g., library, restaurant) raises the relevance of environment-specific social norms (e.g., being quiet, using table manners). As hypothesized, the relevance of such norms is raised when environments are goal relevant ("I am going there later") and when they are humanized with people or the remnants of their presence (e.g., a glass of wine on a table). Two studies show that goal-relevant environments and humanized environments raise the perceived importance of norms (Study 1) and the intention to conform to norms (Study 2). Interestingly, in both studies, these effects reach beyond norms related to the environments used in the studies.

Analysis of methods. [information systems evolution environment

Science.gov (United States)

Mayer, Richard J. (Editor); Ackley, Keith A.; Wells, M. Sue; Mayer, Paula S. D.; Blinn, Thomas M.; Decker, Louis P.; Toland, Joel A.; Crump, J. Wesley; Menzel, Christopher P.; Bodenmiller, Charles A.

1991-01-01

Information is one of an organization's most important assets. For this reason the development and maintenance of an integrated information system environment is one of the most important functions within a large organization. The Integrated Information Systems Evolution Environment (IISEE) project has as one of its primary goals a computerized solution to the difficulties involved in the development of integrated information systems. To develop such an environment a thorough understanding of the enterprise's information needs and requirements is of paramount importance. This document is the current release of the research performed by the Integrated Development Support Environment (IDSE) Research Team in support of the IISEE project. Research indicates that an integral part of any information system environment would be multiple modeling methods to support the management of the organization's information. Automated tool support for these methods is necessary to facilitate their use in an integrated environment. An integrated environment makes it necessary to maintain an integrated database which contains the different kinds of models developed under the various methodologies. In addition, to speed the process of development of models, a procedure or technique is needed to allow automatic translation from one methodology's representation to another while maintaining the integrity of both. The purpose for the analysis of the modeling methods included in this document is to examine these methods with the goal being to include them in an integrated development support environment. To accomplish this and to develop a method for allowing intra-methodology and inter-methodology model element reuse, a thorough understanding of multiple modeling methodologies is necessary. Currently the IDSE Research Team is investigating the family of Integrated Computer Aided Manufacturing (ICAM) DEFinition (IDEF) languages IDEF(0), IDEF(1), and IDEF(1x), as well as ENALIM, Entity

The rehabilitation team: staff perceptions of the hospital environment, the interdisciplinary team environment, and interprofessional relations.

Science.gov (United States)

Strasser, D C; Falconer, J A; Martino-Saltzmann, D

1994-02-01

Although inpatient rehabilitation is an interdisciplinary activity organized around a treatment team, there is a limited understanding of the workings of the interdisciplinary process. To elucidate staff perceptions of key aspects of the rehabilitation treatment process, we surveyed staff (n = 113) from selected inpatient teams. The staff completed social psychological instruments that measure perceptions of the hospital environment (The Ward Atmosphere Scale [WAS]), the team's environment (the Group Environment Scale [GES]), and interprofessional relations (Interprofessional Perception Scale [IPS]). Rehabilitation staff generally endorse the team approach, but express concerns over professional boundaries. Interprofessional difficulties seemed to be independent of team membership or professional training. Compared with published data from other settings, rehabilitation teams resembled task-oriented groups, but showed significant differences across teams in their perceptions of the team and hospital environments. The task-oriented character of rehabilitation teams, team-specific characteristics, and discord in interprofessional relationships may need to be considered in studies of rehabilitation teams effectiveness.

Radioactivity in the Marine Environment. Chapter 1

International Nuclear Information System (INIS)

Zal U'yun Wan Mahmood; Abdul Kadir Ishak; Norfaizal Mohamad; Wo, Y.M.; Kamarudin Samuding

2015-01-01

Radionuclide (radioactive isotopes or radioisotopes is widely distributed on the ground primarily in marine environments. Nowadays, more than 340 isotopes has been identified exist in our earth especially in marine environment. From that total, 80 isotopes was radioactive. The existence of radioactivity in the marine environment is through the direct and indirect distribution of radionuclides

Space environment studies for the SZ-4 spacecraft

International Nuclear Information System (INIS)

Ye Zonghai

2004-01-01

The space environment, especially the solar-terrestrial space environment, has close bearings on mankind's astronautical activities. An overview is presented of the space environment and safeguard services on the 'SZ' series of spacecraft, with special reference to the SZ-4 spacecraft. These include monitoring of the space environment on SZ-4, studies on its distribution, variation and effects on astronautical performance, as well as space environment forecasts for safe launching, normal operation and safe return of SZ-4. Current progress both in China and overseas is covered

Bringing the environment down to earth.

Science.gov (United States)

Reinhardt, F L

1999-01-01

The debate on business and the environment has typically been framed in simple yes-or-no terms: "Does it pay to be green?" But the environment, like other business issues, requires a more complex approach--one that demands more than such all-or-nothing thinking. Managers need to ask instead, "Under what circumstances do particular kinds of environmental investments deliver returns to shareholders?" This article presents five approaches that managers can take to identify those circumstances and integrate the environment into their business thinking. These approaches will enable companies with the right industry structure, competitive position, and managerial skills to reconcile their responsibility to shareholders with the pressure to be faithful stewards of the earth's resources. Some companies can distance themselves from competitors by differentiating their products and commanding higher prices for them. Others may be able to "manage" their competitors by imposing a set of private regulations or by helping to shape the rules written by government officials. Still others may be able to cut costs and help the environment simultaneously. Almost all can learn to improve their management of risk and thus reduce the outlays associated with accidents, lawsuits, and boycotts. And some companies may even be able to make systemic changes that will redefine competition in their markets. All five approaches can help managers bring the environment down to earth. And that means bringing the environment back into the fold of business problems and determining when it really pays to be green.

Authoring multimedia in the CMIF environment

NARCIS (Netherlands)

L. Hardman (Lynda); G. van Rossum (Guido); D.C.A. Bulterman (Dick)

1993-01-01

textabstractWe present the user interface to the CMIF authoring environment for constructing and playing multimedia presentations. Within the environment an author constructs a presentation in terms of its structure and additional synchronization constraints, from which the actual

Medical education and social environment.

Science.gov (United States)

Rasool, Ahsan; Qayum, Iftikhar; Ahmad, Ashfaq; Farooq, Umer; Shah, Awais Ali; Waqas, Muhammad; Rasool, Maleeha; Hameed, Sania; Kanwal, Rana; Azmat, Muneeba; Marwat, Saleem; Afridit, Faheem

2014-01-01

A positive learning environment and quality of course content have an imperative role in academic achievement of students. This study aims to assess students' point of view about the quality of education and social environment of a public sector medical college in Pakistan. Relative scarcity of data from students' perspective merited this study. A cross-sectional survey was undertaken at Ayub Medical College, Abbottabad, Pakistan, including 300 medical students from all five years of the MBBS course. Systematic random sampling was used with a kth interval of 4 for each class. Self-administered questionnaire was used and contained items related to academics, learning environment, learning resources, teaching methodologies and student-friendly activities. The data were analysed using SPSS-16. There were 265 respondents (88.3%) to the questionnaire with males accounting for 58.9% (n=156). In general students showed satisfaction with quality of content being taught; however there was discontent towards various academic and non- academic facilities provided to the students. Only 44.10% and 31.50% students reported provision of academic related facilities and interactive sessions as up to mark respectively; 83% students reported that undergraduate medical research was in need of improvement; 55.5% and 60.2% reported that facilities in hostel and recreational facilities needed improvement respectively; and 52.8% students stated presence of a healthy, student friendly, encouraging environment was not up to mark. Although course content and teaching methodologies are generally satisfactory, a healthy, student friendly, encouraging environment is vet to be created to help students foster their abilities completely.

Fluid Mechanics of Urban Environments

Science.gov (United States)

Fernando, Harindra J.

2008-11-01

The rapid urbanization of the Earth has led to highly populated cities that act as concentrated centers of anthropogenic stressors on the natural environment. The degradation of environmental quality due to such stressors, in turn, greatly impacts human behavior. Anthropogenic stressors largely originate as a result of coupling between man-made urban elements (i.e., networks of engineering and socio-economic infrastructures) and the environment, for which surrounding fluid motions play a key role. In recent years, research efforts have been directed at the understanding and modeling of fluid motions in urban areas, infrastructure dynamics and interactions thereof, with the hope of identifying environmental impacts of urbanization and complex outcomes (or ``emergent properties'') of nominally simple interactions between infrastructures and environment. Such consequences play an important role in determining the ``resilience'' of cities under anthropogenic stressors, defined as maintaining the structure and essential functions of an urbanity without regime shifts. Holistic integrated models that meld the dynamics of infrastructures and environment as well as ``quality of life'' attributes are becoming powerful decision-making tools with regard to sustainability of urban areas (continuance or even enhancement of socio-economic activities in harmony with the environment). The rudimentary forms of integrated models are beginning to take shape, augmented by comprehensive field studies and advanced measurement platforms to validate them. This presentation deals with the challenges of modeling urban atmosphere, subject to anthropogenic forcing. An important emergent property, the Urban Heat Island, and its role in determining resilience and sustainability of cities will be discussed based on the prediction of a coupled model.

Nurse burnout and the working environment.

Science.gov (United States)

O'Mahony, Nuria

2011-09-01

This article examines levels of burnout experienced by emergency nurses and the characteristics of their work environment to determine if there is a relationship between the two. A literature review of recent articles on emergency nurses' burnout and contributing factors was undertaken. A quantitative study, in which nurses were asked to indicate the extent of their agreement with a series of statements on burnout and the working environment, was then undertaken, and the results were analysed to ascertain the extent to which the two topic are related. The results indicate that 52 per cent of nurses in an emergency department in Ireland experience high levels of emotional exhaustion and depersonalisation, which are significantly related to the nature of their work environment. Improvements to the environment and to education are required to reduce the risk of nurses developing burnout in the future.

Nuclear Arms Race and Environment

OpenAIRE

Li, Anpeng

2012-01-01

This paper introduces a new factor, environment, into nuclear arms race model. In this model, nuclear weapons produce larger defense power compared with conventional arms, but hurt the environment meanwhile. In the global welfare maximum level, both conventional and nuclear weapons budget are zero. However, the competitive equilibrium may not achieve the optimum. I give the condition to jump out of the prisoner's dilemma.

Genetic polymorphisms in varied environments.

Science.gov (United States)

Powell, J R

1971-12-03

Thirteen experimenital populationis of Drosophila willistoni were maintained in cages, in some of which the environments were relatively constant and in others varied. After 45 weeks, the populations were assayed by gel electrophoresis for polymorphisms at 22 protein loci. The average heterozygosity per individual and the average unmber of alleles per locus were higher in populations maintained in heterogeneous environments than in populations in more constant enviroments.

Wireless Communications in Reverberant Environments

Science.gov (United States)

2015-01-01

Dedications For Mom, Dad , Michelle, Tyler, and Emily. iii Acknowledgments Moshe once told us that we would learn more from our lab mates than we would...in reverberant environments, such as industrial facilities, naval vessels, aircraft, and spacecraft, has proven challenging, because rich ...environments are characterized by rich electromagnetic scattering which is a result of the low absorption of electromagnetic radiation by the surfaces

A TRUSTWORTHY CLOUD FORENSICS ENVIRONMENT

OpenAIRE

Zawoad , Shams; Hasan , Ragib

2015-01-01

Part 5: CLOUD FORENSICS; International audience; The rapid migration from traditional computing and storage models to cloud computing environments has made it necessary to support reliable forensic investigations in the cloud. However, current cloud computing environments often lack support for forensic investigations and the trustworthiness of evidence is often questionable because of the possibility of collusion between dishonest cloud providers, users and forensic investigators. This chapt...

Polymers preparation under methane plasma environment

International Nuclear Information System (INIS)

Yang Wubao; Cai Zeyong; Zhao Zhen; Qi Lu

2008-01-01

Polymers are prepared under methane plasma environment, and appear to be white, slightly yellow, soft thread-like powders and floc under optical microscope. The polymers contain --CH 3 , -CH 2 , C-O, -C=C-,-OH etc. functional groups, but no simplex carbons. It is found that the solubility of this polymer is less than 0.1mg·ml -1 in different organic solvent. The productivity of the polymers is higher under a plasma environment with higher ionization, higher polarization of neutral gas, lower environment temperature and less permittivity. (authors)

TELEMETRY CIRCUITS IN A RADIATION ENVIRONMENT

Energy Technology Data Exchange (ETDEWEB)

Olesen, H. L.

1963-05-15

Radiation effects are a serious problem for designers of space vehicle electronic equipment. By simulating the environment and irradiating various components and circuits, more and more data become available for engineering application. However, it is not possible to simulate the pulsed radiation environment correctly, because it is not possible to obtain the high radiation intensities occurring in the actual environment. The following represents experimental data obtained at radiation intensities >10/sup 12/ rad/sec. This is an intensity 4 to 5 orders of magnitude greater than previous experimental data. (auth)

ENVIRONMENTS and EOL: identification of Environment Ontology terms in text and the annotation of the Encyclopedia of Life.

Science.gov (United States)

Pafilis, Evangelos; Frankild, Sune P; Schnetzer, Julia; Fanini, Lucia; Faulwetter, Sarah; Pavloudi, Christina; Vasileiadou, Katerina; Leary, Patrick; Hammock, Jennifer; Schulz, Katja; Parr, Cynthia Sims; Arvanitidis, Christos; Jensen, Lars Juhl

2015-06-01

The association of organisms to their environments is a key issue in exploring biodiversity patterns. This knowledge has traditionally been scattered, but textual descriptions of taxa and their habitats are now being consolidated in centralized resources. However, structured annotations are needed to facilitate large-scale analyses. Therefore, we developed ENVIRONMENTS, a fast dictionary-based tagger capable of identifying Environment Ontology (ENVO) terms in text. We evaluate the accuracy of the tagger on a new manually curated corpus of 600 Encyclopedia of Life (EOL) species pages. We use the tagger to associate taxa with environments by tagging EOL text content monthly, and integrate the results into the EOL to disseminate them to a broad audience of users. The software and the corpus are available under the open-source BSD and the CC-BY-NC-SA 3.0 licenses, respectively, at http://environments.hcmr.gr. © The Author 2015. Published by Oxford University Press.

Mission environments for the Isotope Brayton Flight System (preliminary)

International Nuclear Information System (INIS)

1975-01-01

The mission environments for the Isotope Brayton Flight Systems (IBFS) are summarized. These are based on (1) those environments established for the MHW-RTG system in the LES 8/9 and Mariner J/S and (2) engineering projections of those likely to exit for the IBFS. The pre-launch environments address transportation, storage, handling and assembly (to spacecraft) and checkout, field transportation, and launch site operations. Launch environments address the Titan IIIC and Shuttle launch vehicles. Operational mission environments address normal space temperature and meteoroide environments. Special environments that may be applicable to DOD missions are not included. Accident environments address explosion and fire for the Titan IIIC and the Shuttle, reentry, earth impact and post impact

Beliefs about motivation and work with quality, environment and working environment in small organisations

OpenAIRE

Lindmark, Camilla

1999-01-01

Three small organisations in Sweden were studied in order to describe found motives for and against work with quality, environment and working environment among people in a small organisation. Some motives for work within the three areas mainly expressed beliefs about increased production results and increased psychological well-being of people. The work was also thought to have a positive impact on the organisation in terms of coping with changes in the surrounding. Arguments why small organ...

The Standard Deviation of Launch Vehicle Environments

Science.gov (United States)

Yunis, Isam

2005-01-01

Statistical analysis is used in the development of the launch vehicle environments of acoustics, vibrations, and shock. The standard deviation of these environments is critical to accurate statistical extrema. However, often very little data exists to define the standard deviation and it is better to use a typical standard deviation than one derived from a few measurements. This paper uses Space Shuttle and expendable launch vehicle flight data to define a typical standard deviation for acoustics and vibrations. The results suggest that 3dB is a conservative and reasonable standard deviation for the source environment and the payload environment.

Creative Collaborative Exploration in Multiple Environments

DEFF Research Database (Denmark)

Overholt, Daniel; Turk, Matthew; Hollerer, Tobias

2008-01-01

We seek to support creativity in science, engineering, and design applications by building infrastructure that offers new capabilities for creative collaborative exploration of complex data in a variety of non-traditional computing environments. We describe particular novel environments and devic...

Proceeding of Radiation Safety and Environment

International Nuclear Information System (INIS)

1996-01-01

Scientific Presentation of Radiation Safety and Environment was held on 20-21 august 1996 at Center of Research Atomic Energy Pasar Jum'at, Jakarta, Indonesia. Have presented 50 papers about Radiation Safety, dosimetry and standardization, environment protection and radiation effect

Heterogeneous Embedded Real-Time Systems Environment

Science.gov (United States)

2003-12-01

AFRL-IF-RS-TR-2003-290 Final Technical Report December 2003 HETEROGENEOUS EMBEDDED REAL - TIME SYSTEMS ENVIRONMENT Integrated...HETEROGENEOUS EMBEDDED REAL - TIME SYSTEMS ENVIRONMENT 6. AUTHOR(S) Cosmo Castellano and James Graham 5. FUNDING NUMBERS C - F30602-97-C-0259

Negotiation and Monitoring in Open Environments

NARCIS (Netherlands)

Clark, K.P.

2014-01-01

Large scale, distributed, digital environments offer vast potential. Within these environments, software systems will provide unprecedented support for daily life. Offering access to vast amounts of knowledge and resources, these systems will enable wider participation of society, at large. An

The Near-Earth Space Radiation Environment

Science.gov (United States)

Xapsos, Michael

2008-01-01

This viewgraph presentation reviews the effects of the Near-Earth space radiation environment on NASA missions. Included in this presentation is a review of The Earth s Trapped Radiation Environment, Solar Particle Events, Galactic Cosmic Rays and Comparison to Accelerator Facilities.

Healthy building environments for ageing adults

NARCIS (Netherlands)

Kort, Helianthe S.M.

2017-01-01

A healthy building environment, when looking from a gerontechnology perspective, should facilitate ageing adults' functioning, self-esteem, and prosperity. Creating healthy environments is becoming more and more relevant in society. Older adults tend to stay more indoors when compared to younger

The bibliometrics of atmospheric environment

Science.gov (United States)

Brimblecombe, Peter; Grossi, Carlota M.

Bibliometric analysis is an important tool in the management of a journal. SCOPUS output is used to assess the increase in the quantity of material in Atmospheric Environment and stylistic changes in the way authors choose words and punctuation in titles and assemble their reference lists. Citation analysis is used to consider the impact factor of the journal, but perhaps more importantly the way in which it reflects the importance authors give to papers published in Atmospheric Environment. The impact factor of Atmospheric Environment (2.549 for 2007) from the Journal Citation Reports suggests it performs well within the atmospheric sciences, but it conceals the long term value authors place on papers appearing in the journal. Reference lists show that a fifth come through citing papers more than a decade old.

Trends in Virtualized User Environments

Directory of Open Access Journals (Sweden)

Diane Barrett

2008-06-01

Full Text Available Virtualized environments can make forensics investigation more difficult. Technological advances in virtualization tools essentially make removable media a PC that can be carried around in a pocket or around a neck. Running operating systems and applications this way leaves very little trace on the host system. This paper will explore all the newest methods for virtualized environments and the implications they have on the world of forensics. It will begin by describing and differentiating between software and hardware virtualization. It will then move on to explain the various methods used for server and desktop virtualization. Next, it will explain how virtualization affects the basic forensic process. Finally, it will describe the common methods to find virtualization artifacts and identify virtual activities that affect the examination process of certain virtualized user environments.

Energy and environment efficiency analysis based on an improved environment DEA cross-model: Case study of complex chemical processes

International Nuclear Information System (INIS)

Geng, ZhiQiang; Dong, JunGen; Han, YongMing; Zhu, QunXiong

2017-01-01

Highlights: •An improved environment DEA cross-model method is proposed. •Energy and environment efficiency analysis framework of complex chemical processes is obtained. •This proposed method is efficient in energy-saving and emission reduction of complex chemical processes. -- Abstract: The complex chemical process is a high pollution and high energy consumption industrial process. Therefore, it is very important to analyze and evaluate the energy and environment efficiency of the complex chemical process. Data Envelopment Analysis (DEA) is used to evaluate the relative effectiveness of decision-making units (DMUs). However, the traditional DEA method usually cannot genuinely distinguish the effective and inefficient DMU due to its extreme or unreasonable weight distribution of input and output variables. Therefore, this paper proposes an energy and environment efficiency analysis method based on an improved environment DEA cross-model (DEACM) method. The inputs of the complex chemical process are divided into energy and non-energy inputs. Meanwhile, the outputs are divided into desirable and undesirable outputs. And then the energy and environment performance index (EEPI) based on the cross evaluation is used to represent the overall performance of each DMU. Moreover, the improvement direction of energy-saving and carbon emission reduction of each inefficiency DMU is quantitatively obtained based on the self-evaluation model of the improved environment DEACM. The results show that the improved environment DEACM method has a better effective discrimination than the original DEA method by analyzing the energy and environment efficiency of the ethylene production process in complex chemical processes, and it can obtain the potential of energy-saving and carbon emission reduction of ethylene plants, especially the improvement direction of inefficient DMUs to improve energy efficiency and reduce carbon emission.

Performance Implications of Environment-Strategy-Governance Misfit

Directory of Open Access Journals (Sweden)

Lindawati Gani

2009-01-01

Full Text Available This study examines the impacts of matching competitive environment, business strategy, and corporate governance structure on firm performance. We predict that in a dynamic environment, firms pursuing a product differentiation strategy will perform better than firms pursuing a strategy of cost leadership, but the performance differential is affected by the level of board independence and managerial share ownership. In a stable environment, we predict that firms pursuing a strategy of cost leadership will perform better than firms pursuing a product differentiation strategy, and the performance differential is affected by the level of board independence and managerial share ownership. Overall, the results are consistent with the predictions of this study. Board independence and managerial ownership affect the performance differential between product differentiators and cost leaders in a dynamic environment. In a stable environment, however, the results are not statistically significant.

Animal models of gene-environment interactions in schizophrenia.

Science.gov (United States)

Ayhan, Yavuz; Sawa, Akira; Ross, Christopher A; Pletnikov, Mikhail V

2009-12-07

The pathogenesis of schizophrenia and related mental illnesses likely involves multiple interactions between susceptibility genes of small effects and environmental factors. Gene-environment interactions occur across different stages of neurodevelopment to produce heterogeneous clinical and pathological manifestations of the disease. The main obstacle for mechanistic studies of gene-environment interplay has been the paucity of appropriate experimental systems for elucidating the molecular pathways that mediate gene-environment interactions relevant to schizophrenia. Recent advances in psychiatric genetics and a plethora of experimental data from animal studies allow us to suggest a new approach to gene-environment interactions in schizophrenia. We propose that animal models based on identified genetic mutations and measurable environment factors will help advance studies of the molecular mechanisms of gene-environment interplay.

Environment, 1980-1993

International Nuclear Information System (INIS)

1994-01-01

This document lists all sales publications of the International Atomic Energy Agency dealing with Environment issued during the period 1980-1993. It gives a short abstract and contents of these issues along with their costs in Austrian Schillings

Navigating the obesogenic environment: how psychological sensitivity to the food environment and self-regulatory competence are associated with adolescent unhealthy snacking.

Science.gov (United States)

Stok, F Marijn; De Vet, Emely; Wardle, Jane; Chu, Maria T; De Wit, John; De Ridder, Denise T D

2015-04-01

Living in an obesogenic environment may not affect all adolescents to the same extent, depending on their psychological sensitivity to the food environment and their self-regulatory competence. The purpose of the current study was to examine associations of these two factors with unhealthy snacking among adolescents. We also investigated whether self-regulatory competence could attenuate the negative effects of being sensitive to the food environment. A survey was completed by 11,392 European adolescents (10-17years old). The survey measured psychological sensitivity to the food environment, self-regulatory competence and self-reported unhealthy snack intake. Higher food environment sensitivity and lower self-regulatory competence were associated with more unhealthy snacking. The two factors also interacted, with self-regulatory competence attenuating the influence of high food environment sensitivity. Adolescents who are sensitive to the food environment reported higher unhealthy snack intake. More frequent use of self-regulation strategies on the other hand was associated with lower unhealthy snack intake. Moreover, self-regulatory competence was found to moderate the influence of psychological sensitivity to the food environment on unhealthy snacking, although the effect size was small. Fostering adolescents' self-regulatory competence can help enable them to better navigate the obesogenic environment. Copyright © 2014 Elsevier Ltd. All rights reserved.

Emerging semantics to link phenotype and environment

Directory of Open Access Journals (Sweden)

Anne E. Thessen

2015-12-01

Full Text Available Understanding the interplay between environmental conditions and phenotypes is a fundamental goal of biology. Unfortunately, data that include observations on phenotype and environment are highly heterogeneous and thus difficult to find and integrate. One approach that is likely to improve the status quo involves the use of ontologies to standardize and link data about phenotypes and environments. Specifying and linking data through ontologies will allow researchers to increase the scope and flexibility of large-scale analyses aided by modern computing methods. Investments in this area would advance diverse fields such as ecology, phylogenetics, and conservation biology. While several biological ontologies are well-developed, using them to link phenotypes and environments is rare because of gaps in ontological coverage and limits to interoperability among ontologies and disciplines. In this manuscript, we present (1 use cases from diverse disciplines to illustrate questions that could be answered more efficiently using a robust linkage between phenotypes and environments, (2 two proof-of-concept analyses that show the value of linking phenotypes to environments in fishes and amphibians, and (3 two proposed example data models for linking phenotypes and environments using the extensible observation ontology (OBOE and the Biological Collections Ontology (BCO; these provide a starting point for the development of a data model linking phenotypes and environments.

Pervasive Learning Environments

DEFF Research Database (Denmark)

Hundebøl, Jesper; Helms, Niels Henrik

in schools. The other is moreover related to work based learning in that it foresees a community of practitioners accessing, sharing and adding to knowledge and learning objects held within a pervasive business intelligence system. Limitations and needed developments of these and other systems are discussed......Abstract: The potentials of pervasive communication in learning within industry and education are right know being explored through different R&D projects. This paper outlines the background for and the possible learning potentials in what we describe as pervasive learning environments (PLE). PLE......'s differ from virtual learning environments (VLE) primarily because in PLE's the learning content is very much related to the actual context in which the learner finds himself. Two local (Denmark) cases illustrate various aspects of pervasive learning. One is the eBag, a pervasive digital portfolio used...

Fetal environment

International Nuclear Information System (INIS)

Kinare, Arun

2008-01-01

The intrauterine environment has a strong influence on pregnancy outcome. The placenta and the umbilical cord together form the main supply line of the fetus. Amniotic fluid also serves important functions. These three main components decide whether there will be an uneventful pregnancy and the successful birth of a healthy baby. An insult to the intrauterine environment has an impact on the programming of the fetus, which can become evident in later life, mainly in the form of cardiovascular diseases, diabetes, and certain learning disabilities. The past two decades have witnessed major contributions from researchers in this field, who have included ultrasonologists, epidemiologists, neonatologists, and pediatricians. Besides being responsible for these delayed postnatal effects, abnormalities of the placenta, umbilical cord, and amniotic fluid also have associations with structural and chromosomal disorders. Population and race also influence pregnancy outcomes to some extent in certain situations. USG is the most sensitive imaging tool currently available for evaluation of these factors and can offer considerable information in this area. This article aims at reviewing the USG-related developments in this area and the anatomy, physiology, and various pathologies of the placenta, umbilical cord, and the amniotic fluid

A system of UAV application in indoor environment

DEFF Research Database (Denmark)

Khosiawan, Yohanes; Nielsen, Izabela Ewa

2016-01-01

In recent years, there has been an increased demand in the use of multiple unmanned aerial vehicles (UAVs) in indoor environments such as material handling task in a manufacturing environment and plant/environment monitoring task in a greenhouse. However, there is a lack of work reported on this ......In recent years, there has been an increased demand in the use of multiple unmanned aerial vehicles (UAVs) in indoor environments such as material handling task in a manufacturing environment and plant/environment monitoring task in a greenhouse. However, there is a lack of work reported...... on this topic. This paper presents a detailed study on several UAV systems and UAV scheduling systems. It is followed by a proposed system of UAV application in indoor environment, which comprises components of UAV system addressed in detail; focused on scheduler as the heart of operations. Consequently, system...... architecture of UAV scheduling system is presented and the framework of scheduler component is included. Scheduler component works in a phased manner to provide a systematic abstraction and achieve an efficient computation time. This study serves as a reference guide for UAV application in indoor environment....

Occupational health and environment research 1983: Health, Safety, and Environment Division. Progress report

International Nuclear Information System (INIS)

Voelz, G.L.

1985-05-01

The primary responsibility of the Health, Safety, and Environment (HSE) Division at the Los Alamos National Laboratory is to provide comprehensive occupational health and safety programs, waste processing, and environmental protection. These activities are designed to protect the workers, the public, and the environment. Evaluation of respiratory protective equipment included the XM-30 and M17A1 military masks, use of MAG-1 spectacles in respirators, and eight self-contained units. The latter units were used in an evaluation of test procedures used for Bureau of Mines approval of breathing apparatuses. Analyses of air samples from field studies of a modified in situ oil shale retorting facility were performed for total cyclohexane extractables and selected polynuclear aromatic hydrocarbons. Aerosols generation and characterization of effluents from oil shale processing were continued as part of an inhalation toxicology study. Additional data on plutonium excretion in urine are presented and point up problems in using the Langham equation to predict plutonium deposition in the body from long-term excretion data. Environmental surveillance at Los Alamos during 1983 showed the highest estimated radiation dose from Laboratory operations to be about 26% of the natural background radiation dose. Several studies on radionuclides and their transport in the Los Alamos environment are described. The chemical quality of surface and ground water near the geothermal hot dry rock facility is described. Short- and long-term consequences to man from releases of radionuclides into the environment can be simulated by the BIOTRAN computer model, which is discussed brirfly

A music educational environment for preschoolers

NARCIS (Netherlands)

Jansen, A.E.; van Dijk, Elisabeth M.A.G.; Retra, J.

2008-01-01

This paper describes the design and evaluation of an interactive computer environment that envisions to contribute to young children's musical learning. The intent is to stimulate the child's inherent musical abilities by engaging the child in active musical interaction with the environment. The

Environment in the European Union 1995

DEFF Research Database (Denmark)

The update to the 1992 report on the state of the environment in the European Union requested by the European Commission......The update to the 1992 report on the state of the environment in the European Union requested by the European Commission...

The International Macro-Environment of an Organization

OpenAIRE

Ileana (Badulescu) Anastase; Cornel Grigorut

2016-01-01

The international macro-environment (supranational macro-environment) brings together allthe uncontrollable factors with a global impact, and it is related to the organization’s indirectrelationships on international markets. Romania’s globalization and the EU integration increasedthe importance of the macro-environment for all organizations, regardless of their degree ofinternationalization. In marketing, we must master the main agreements between countries and theregulations emanating from ...

Supportability Analysis in LCI Environment

OpenAIRE

Dragan Vasiljevic; Ana Horvat

2013-01-01

Starting from the basic pillars of the supportability analysis this paper queries its characteristics in LCI (Life Cycle Integration) environment. The research methodology contents a review of modern logistics engineering literature with the objective to collect and synthesize the knowledge relating to standards of supportability design in e-logistics environment. The results show that LCI framework has properties which are in fully compatibility with the requirement of s...

Object-Oriented Software Development Environments

DEFF Research Database (Denmark)

The book "Object-Oriented Environments - The Mjølner Approach" presents the collective results of the Mjølner Project. The project was set up to work on the widely recognized problems of developing, maintaining and understanding large software systems. The starting point was to use object...... and realizations User interfaces for environments and realizations Grammar-based software architectures Structure-based editing Language implementation, runtime organization, garbage collection Incremental compilation techniques...

Measuring Presence in Virtual Environments

Science.gov (United States)

1994-10-01

viewpoint to change what they see, or to reposition their head to affect binaural hearing, or to search the environment haptically, they will experience a...increase presence in an alternate environment. For example a head mounted display that isolates the user from the real world may increase the sense...movement interface devices such as treadmills and trampolines , different gloves, and auditory equipment. Even as a low end technological implementation of

Vagrant virtual development environment cookbook

CERN Document Server

Thompson, Chad

2015-01-01

If you are a software developer or administrator who wishes to create simple, reusable environments using Vagrant, this book is the perfect choice for you. Whether you are a system administrator with extensive experience in virtualization or a developer wishing to create development scripts for cloud deployment, you will find easy-to-follow recipes and techniques in this book that will allow you to create robust and reproducible virtual environments.

Archaeal Viruses from High-Temperature Environments.

Science.gov (United States)

Munson-McGee, Jacob H; Snyder, Jamie C; Young, Mark J

2018-02-27

Archaeal viruses are some of the most enigmatic viruses known, due to the small number that have been characterized to date. The number of known archaeal viruses lags behind known bacteriophages by over an order of magnitude. Despite this, the high levels of genetic and morphological diversity that archaeal viruses display has attracted researchers for over 45 years. Extreme natural environments, such as acidic hot springs, are almost exclusively populated by Archaea and their viruses, making these attractive environments for the discovery and characterization of new viruses. The archaeal viruses from these environments have provided insights into archaeal biology, gene function, and viral evolution. This review focuses on advances from over four decades of archaeal virology, with a particular focus on archaeal viruses from high temperature environments, the existing challenges in understanding archaeal virus gene function, and approaches being taken to overcome these limitations.

Archaeal Viruses from High-Temperature Environments

Directory of Open Access Journals (Sweden)

Jacob H. Munson-McGee

2018-02-01

Full Text Available Archaeal viruses are some of the most enigmatic viruses known, due to the small number that have been characterized to date. The number of known archaeal viruses lags behind known bacteriophages by over an order of magnitude. Despite this, the high levels of genetic and morphological diversity that archaeal viruses display has attracted researchers for over 45 years. Extreme natural environments, such as acidic hot springs, are almost exclusively populated by Archaea and their viruses, making these attractive environments for the discovery and characterization of new viruses. The archaeal viruses from these environments have provided insights into archaeal biology, gene function, and viral evolution. This review focuses on advances from over four decades of archaeal virology, with a particular focus on archaeal viruses from high temperature environments, the existing challenges in understanding archaeal virus gene function, and approaches being taken to overcome these limitations.

Typology of person-environment fit constellations: a platform addressing accessibility problems in the built environment for people with functional limitations.

Science.gov (United States)

Slaug, Björn; Schilling, Oliver; Iwarsson, Susanne; Carlsson, Gunilla

2015-09-02

Making the built environment accessible for all regardless of functional capacity is an important goal for public health efforts. Considerable impediments to achieving this goal suggest the need for valid measurements of acccessibility and for greater attention to the complexity of person-environment fit issues. To address these needs, this study aimed to provide a methodological platform, useful for further research and instrument development within accessibility research. This was accomplished by the construction of a typology of problematic person-environment fit constellations, utilizing an existing methodology developed to assess and analyze accessibility problems in the built environment. By means of qualitative review and statistical methods we classified the person-environment fit components covered by an existing application which targets housing accessibility: the Housing Enabler (HE) instrument. The International Classification of Functioning, Disability and Health (ICF) was used as a conceptual framework. Qualitative classification principles were based on conceptual similarities and for quantitative analysis of similarities, Principal Component Analysis was carried out. We present a typology of problematic person-environment fit constellations classified along three dimensions: 1) accessibility problem range and severity 2) aspects of functioning 3) environmental context. As a result of the classification of the HE components, 48 typical person-environment fit constellations were recognised. The main contribution of this study is the proposed typology of person-environment fit constellations. The typology provides a methodological platform for the identification and quantification of problematic person-environment fit constellations. Its link to the globally accepted ICF classification system facilitates communication within the scientific and health care practice communities. The typology also highlights how relations between aspects of functioning

Exploring the Bacterial Microbiota of Colombian Fermented Maize Dough “Masa Agria” (Maiz Añejo)

Science.gov (United States)

Chaves-Lopez, Clemencia; Serio, Annalisa; Delgado-Ospina, Johannes; Rossi, Chiara; Grande-Tovar, Carlos D.; Paparella, Antonello

2016-01-01

Masa Agria is a naturally fermented maize dough produced in Colombia, very common in the traditional gastronomy. In this study we used culture-dependent and RNA-based pyrosequencing to investigate the bacterial community structure of Masa Agria samples produced in the south west of Colombia. The mean value of cell density was 7.6 log CFU/g of presumptive lactic acid bacteria, 5.4 log cfu/g for presumptive acetic bacteria and 5.6 og CFU/g for yeasts. The abundance of these microorganisms is also responsible for the low pH (3.1–3.7) registered. Although the 16S rRNA pyrosequencing revealed that the analyzed samples were different in bacteria richness and diversity, the genera Lactobacillus, Weissella, and Acetobacter were predominant. In particular, the most common species were Lactobacillus plantarum and Acetobacter fabarum, followed by L. fermentum, L. vaccinostercus, and Pediococcus argentinicus. Several microorganisms of environmental origin, such as Dechloromonas and most of all Sphingobium spp., revealed in each sample, were detected, and also bacteria related to maize, such as Phytoplasma. In conclusion, our results elucidated for the first time the structures of the bacterial communities of Masa Agria samples obtained from different producers, identifying the specific dominant species and revealing a complete picture of the bacterial consortium in this specific niche. The selective pressure of tropical environments may favor microbial biodiversity characterized by a useful technological potential. PMID:27524979

Exploring the bacterial microbiota of Colombian fermented maize dough “Masa Agria” (Maiz Añejo

Directory of Open Access Journals (Sweden)

Clemencia Chaves

2016-07-01

Full Text Available Masa Agria is a naturally fermented maize dough produced in Colombia, very common in the traditional gastronomy. In this study we used culture-dependent and RNA-based pyrosequencing to investigate the bacterial community structure of Masa Agria samples produced in the south west of Colombia. The mean value of cell density was 7.6 Log CFU/g of presumptive lactic acid bacteria (LAB, 5.4 Log cfu/g for presumptive acetic bacteria and 5.6 Log CFU/g for yeasts. The abundance of these microorganisms is also responsible for the low pH (3.1-3.7 registered. Although the 16S rRNA pyrosequencing revealed that the analyzed samples were different in bacteria richness and diversity, the genera Lactobacillus, Weissella and Acetobacter were predominant. In particular, the most common species were Lactobacillus plantarum and Acetobacter fabarum, followed by Lb. fermentum, Lb. vaccinostercus and Pediococcus argentinicus. Several microorganisms of environmental origin, such as Dechloromonas and most of all Sphingobium spp., revealed in each sample, were detected, and also bacteria related to maize, such as Phytoplasma. In conclusion, our results elucidated for the first time the structures of the bacterial communities of Masa Agria samples obtained from different producers, identifying the specific dominant species and revealing a complete picture of the bacterial consortium in this specific niche. The selective pressure of tropical environments may favour microbial biodiversity characterized by a useful technological potential.

Robust Tests for Additive Gene-Environment Interaction in Case-Control Studies Using Gene-Environment Independence

DEFF Research Database (Denmark)

Liu, Gang; Lee, Seunggeun; Lee, Alice W

2018-01-01

test with case-control data. Our simulation studies suggest that the EB approach uses the gene-environment independence assumption in a data-adaptive way and provides power gain compared to the standard logistic regression analysis and better control of Type I error when compared to the analysis......There have been recent proposals advocating the use of additive gene-environment interaction instead of the widely used multiplicative scale, as a more relevant public health measure. Using gene-environment independence enhances the power for testing multiplicative interaction in case......-control studies. However, under departure from this assumption, substantial bias in the estimates and inflated Type I error in the corresponding tests can occur. This paper extends the empirical Bayes (EB) approach previously developed for multiplicative interaction that trades off between bias and efficiency...

Data on the global environment. The state of Denmark's environment compared with other industrial countries

International Nuclear Information System (INIS)

1995-01-01

A summary, and a selection of significant information, taken from the OECD (Organization for Economic Co-operation and Development) documents: The State of the Environment (1991) and Environmental Indicators (1991) and the ECE (United Nations Economic Commission for Europe) report: The Environment in Europe and North America: Annotated Statistics 1992, and from a few other sources. The document is a translation of the Swedish publication: Miljoevaer(l)den. Statistics and other information relate to air pollution, flora and fauna, the condition of forests and of the North and Baltic Seas, water pollution, wastes, chemicals, oil spills, energy production and consumption, traffic, environmental hazards, public anxiety related to the environment, environmental protection, population densities during 1989 and international conventions on environmental protection. Most of the datas relate to the nineteen eighties. (AB)

Hanford site environment

International Nuclear Information System (INIS)

Isaacson, R.E.

1976-01-01

A synopsis is given of the detailed characterization of the existing environment at Hanford. The following aspects are covered: demography, land use, meteorology, geology, hydrology, and seismology. It is concluded that Hanford is one of the most extensively characterized nuclear sites

Assessing Educational Environments.

Science.gov (United States)

New Directions for Testing and Measurement, 1980

1980-01-01

Educational environment data derived from classroom settings strongly suggest the positive contribution that climate variables can make in accounting for learning performance. Such measures are not only related to productivity but may constitute criterion variables in and of themselves. (Author)

Directed Hidden-Code Extractor for Environment-Sensitive Malwares

Science.gov (United States)

Jia, Chunfu; Wang, Zhi; Lu, Kai; Liu, Xinhai; Liu, Xin

Malware writers often use packing technique to hide malicious payload. A number of dynamic unpacking tools are.designed in order to identify and extract the hidden code in the packed malware. However, such unpacking methods.are all based on a highly controlled environment that is vulnerable to various anti-unpacking techniques. If execution.environment is suspicious, malwares may stay inactive for a long time or stop execution immediately to evade.detection. In this paper, we proposed a novel approach that automatically reasons about the environment requirements.imposed by malware, then directs a unpacking tool to change the controlled environment to extract the hide code at.the new environment. The experimental results show that our approach significantly increases the resilience of the.traditional unpacking tools to environment-sensitive malware.

Non-classical Correlations and Quantum Coherence in Mixed Environments

Science.gov (United States)

Hu, Zheng-Da; Wei, Mei-Song; Wang, Jicheng; Zhang, Yixin; He, Qi-Liang

2018-05-01

We investigate non-classical correlations (entanglement and quantum discord) and quantum coherence for an open two-qubit system each independently coupled to a bosonic environment and a spin environment, respectively. The modulating effects of spin environment and bosonic environment are respectively explored. A relation among the quantum coherence, quantum discord and classical correlation is found during the sudden transition phenomenon. We also compare the case of mixed environments with that of the same environments, showing that the dynamics is dramatically changed.

International Conference on Environment Science (ICES 2012)

CERN Document Server

Advances in Computational Environment Science

2012-01-01

2012 International Conference on Environment Science and 2012 International Conference on Computer Science (ICES 2012/ICCS 2012) will be held in Australia, Melbourne, 15‐16 March, 2012.Volume 1 contains some new results in computational environment science. There are 47 papers were selected as the regular paper in this volume. It contains the latest developments and reflects the experience of many researchers working in different environments (universities, research centers or even industries), publishing new theories and solving new technological problems on computational environment science.   The purpose of volume 1 is interconnection of diverse scientific fields, the cultivation of every possible scientific collaboration, the exchange of views and the promotion of new research targets as well as the further dissemination, the dispersion, the diffusion of the environment science, including but not limited to Ecology, Physics, Chemistry, Biology, Soil Science, Geology, Atmospheric Science and Geography �...

Massivizing Networked Virtual Environments on Clouds

NARCIS (Netherlands)

Shen, S.

2015-01-01

Networked Virtual Environments (NVEs) are virtual environments where physically distributed, Internet-connected users can interact and socialize with others. The most popular NVEs are online games, which have hundreds of millions of users and a global market of tens of billions Euros per year.

Group Modeling in Social Learning Environments

Science.gov (United States)

Stankov, Slavomir; Glavinic, Vlado; Krpan, Divna

2012-01-01

Students' collaboration while learning could provide better learning environments. Collaboration assumes social interactions which occur in student groups. Social theories emphasize positive influence of such interactions on learning. In order to create an appropriate learning environment that enables social interactions, it is important to…

47 CFR 2.1503 - Test environment.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 1 2010-10-01 2010-10-01 false Test environment. 2.1503 Section 2.1503 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL FREQUENCY ALLOCATIONS AND RADIO TREATY MATTERS; GENERAL... Radiobeacons (EPIRBs) General § 2.1503 Test environment. (a) Measurement sites. Radiated emission tests for...