WorldWideScience

Sample records for pergamon pii s0028

  1. Uridylylation of the PII protein from Herbaspirillum seropedicae.

    Science.gov (United States)

    Benelli, E M; Buck, M; de Souza, E M; Yates, M G; Pedrosa, F O

    2001-04-01

    The PII protein is apparently involved in the control of NifA activity in Herbaspirillum seropedicae. To evaluate the probable role of PII in signal transduction, uridylylation assays were conducted with purified H. seropedicae PII and Escherichia coli GlnD, or a cell-free extract of H. seropedicae as sources of uridylylating activity. The results showed that alpha-ketoglutarate and ATP stimulate uridylylation whereas glutamine inhibits uridylylation. Deuridylylation of PII-UMP was dependent on glutamine and inhibited by ATP and alpha-ketoglutarate. PII uridylylation and (or) deuridylylation in response to these effectors suggests that PII is a nitrogen level signal transducer in H. seropedicae.

  2. From PII signaling to metabolite sensing: a novel 2-oxoglutarate sensor that details PII-NAGK complex formation.

    Directory of Open Access Journals (Sweden)

    Jan Lüddecke

    Full Text Available The widespread PII signal transduction proteins are known for integrating signals of nitrogen and energy supply and regulating cellular behavior by interacting with a multitude of target proteins. The PII protein of the cyanobacterium Synechococcus elongatus forms complexes with the controlling enzyme of arginine synthesis, N-acetyl-L-glutamate kinase (NAGK in a 2-oxoglutarate- and ATP/ADP-dependent manner. Fusing NAGK and PII proteins to either CFP or YFP yielded a FRET sensor that specifically responded to 2-oxoglutarate. The impact of the fluorescent tags on PII and NAGK was evaluated by enzyme assays, surface plasmon resonance spectroscopy and isothermal calorimetric experiments. The developed FRET sensor provides real-time data on PII - NAGK interaction and its modulation by the effector molecules ATP, ADP and 2-oxoglutarate in vitro. Additionally to its utility to monitor 2-oxoglutarate levels, the FRET assay provided novel insights into PII - NAGK complex formation: (i It revealed the formation of an encounter-complex between PII and NAGK, which holds the proteins in proximity even in the presence of inhibitors of complex formation; (ii It revealed that the PII T-loop residue Ser49 is neither essential for complex formation with NAGK nor for activation of the enzyme but necessary to form a stable complex and efficiently relieve NAGK from arginine inhibition; (iii It showed that arginine stabilizes the NAGK hexamer and stimulates PII - NAGK interaction.

  3. Eumenes II. als persona non grata: Pergamon, Rom und der 3. Makedonische Krieg

    Directory of Open Access Journals (Sweden)

    Christoph Kenkel

    2012-11-01

    Full Text Available Christoph Kenkel treads on difficult terrain with his Bachelor Thesis Eumenes II als persona non grata: Pergamon, Rom und der 3. Makedonische Krieg ( Eumenes II as persona non grata: Pergamon, Rome and the Third Macedonian War, but manages to develop his own convincing interpretation of a research topic subjected to strong discourse.Starting with the deprecatory demeanor of the Roman Senate towards Eumenes II Sotor (197-159 in 167 B.C., the author begins a search for this unusual rejection, facing the challenge of a confusing array of sources and the many diverging opinions of researchers. Further complications arise from the complex political situation at the eve of the Third Macedonian War that raises a variety of new issues.Nevertheless Kenkel manages to see through the machinations and rumors of Roman politics by applying logical thought, and explains plausibly why Eumenes, who unjustly got caught in the crossfire, has always been an ally of Rome, despite of many contemporary rumors and keen allegations.

  4. Properties of Roman bricks and mortars used in Serapis temple in the city of Pergamon

    International Nuclear Information System (INIS)

    Ozkaya, Ozlem Aslan; Boeke, Hasan

    2009-01-01

    Serapis temple, which was constructed in the Roman period in the city of Pergamon (Bergama/Turkey), is one of the most important monuments of the world heritage. In this study, the characteristics of bricks and mortars used in the temple have been determined in order to define the necessary characteristics of the intervention materials, which will be used in the conservation works of the temple. Several analyses were carried out to determine their basic physical properties, raw material compositions, mineralogical and microstructural properties using X-ray diffraction, Scanning Electron Microscope and a Thermo Gravimetric Analyzer. Analysis results indicated that the mortars are stiff, compact and hydraulic due to the use of natural pozzolanic aggregates. The Roman bricks are of low density, high porosity and were produced from raw materials containing calcium poor clays fired at low temperatures.

  5. Escherichia coli PII protein: purification, crystallization and oligomeric structure.

    Science.gov (United States)

    Vasudevan, S G; Gedye, C; Dixon, N E; Cheah, E; Carr, P D; Suffolk, P M; Jeffrey, P D; Ollis, D L

    1994-01-17

    The Escherichia coli signal transduction protein PII, product of the glnB gene, was overproduced and purified. The predicted molecular weight of the protein based on the correct nucleotide sequence is 12,427 and is very close to the value 12,435 obtained by matrix-assisted laser desorption mass spectrometry. Hexagonal crystals of the unuridylylated form of PII with dimensions 0.2 x 0.2 x 0.3 mm were grown and analysed by X-ray diffraction. The crystals belong to space group P6(3) with a = b = 61.6 A, c = 56.3 A and Vm of 2.5 for one subunit in the asymmetric unit. A low-resolution electron density map showed electron density concentrated around a three-fold axis, suggesting the molecule to be a trimer. A sedimentation equilibrium experiment of the meniscus depletion type was used to estimate a molecular weight of 35,000 +/- 1,000 for PII in solution. This result is consistent with the native protein being a homotrimer.

  6. The Byzantine ceramics from Pergamon excavations. Characterization of local and imported productions by elementary analysis using PIXE and INAA methods and by petrography

    International Nuclear Information System (INIS)

    Waksman, S.Y.

    1995-01-01

    An important ceramics material dated back to the 12th-14th centuries has been excavated in Pergamon (Turkey). Among these findings, wasters, tripod stilts and unfinished ware attest to local production in the Byzantine period. Elemental analysis by the methods PIXE (Particle Induced X-ray Emission) and INAA (Instrumental Neutron Activation Analysis) has been performed on a representative sampling of 160 sherds, including attested local material. Multivariate statistical techniques were used to classify the sherds into groups of similar composition and thus to distinguish ceramics made in Pergamon from imported wares. Several groups of local production have been constituted, which correspond to wares differing in date and fabric. The geochemical characterization of the pastes, complemented with petrographical and mineralogical data, shows that specific raw materials have been used to manufacture each ware. The analytical data related to ceramics made in Pergamon will serve as reference data for future provenance studies. Such reference groups of Byzantine ceramics are very rare, and therefore the ceramics imported into Pergamon cannot be attributed as to their origin. Among the ceramics widely diffused in the Byzantine world, some importations belonging to the ''fine sgraffito'' and ''Zeuxippus ware'' types have been identified. The latter type has been a source of stylistic influence for the workshops of Pergamon, since the analyses show that imitated ''Zeuxippus ware'' has been produced there. These imitations were probably themselves diffused on a regional scale. (author). 238 refs., 48 figs., 53 tabs., 22 photos., 8 appends

  7. Status report on the positive ion injector (PII) for ATLAS at Argonne National Laboratory

    International Nuclear Information System (INIS)

    Zinkann, G.P.; Added, N.; Billquist, P.; Bogaty, J.; Clifft, B.; Markovich, P.; Phillips, D.; Strickhorn, P.; Shepard, K.W.

    1991-01-01

    The Positive Ion Injector (PII) is part of the Uranuim upgrade for ATLAS accelerator at Argonne National Laboratory. This paper will include a technical discussion of the Positive Ion Injector (PII) accelerator with its superconducting, niobium, very low-velocity accelerating structures. It will also discuss the current construction schedule of PII, and review an upgrade of the fast- tuning system. 10 refs., 6 figs

  8. Status report on the positive ion injector (PII) for ATLAS at Argonne National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Zinkann, G.P.; Added, N.; Billquist, P.; Bogaty, J.; Clifft, B.; Markovich, P.; Phillips, D.; Strickhorn, P.; Shepard, K.W.

    1991-01-01

    The Positive Ion Injector (PII) is part of the Uranuim upgrade for ATLAS accelerator at Argonne National Laboratory. This paper will include a technical discussion of the Positive Ion Injector (PII) accelerator with its superconducting, niobium, very low-velocity accelerating structures. It will also discuss the current construction schedule of PII, and review an upgrade of the fast- tuning system. 10 refs., 6 figs.

  9. Herbaspirillum seropedicae signal transduction protein PII is structurally similar to the enteric GlnK.

    Science.gov (United States)

    Machado Benelli, Elaine; Buck, Martin; Polikarpov, Igor; Maltempi de Souza, Emanuel; Cruz, Leonardo M; Pedrosa, Fábio O

    2002-07-01

    PII-like proteins are signal transduction proteins found in bacteria, archaea and eukaryotes. They mediate a variety of cellular responses. A second PII-like protein, called GlnK, has been found in several organisms. In the diazotroph Herbaspirillum seropedicae, PII protein is involved in sensing nitrogen levels and controlling nitrogen fixation genes. In this work, the crystal structure of the unliganded H. seropedicae PII was solved by X-ray diffraction. H. seropedicae PII has a Gly residue, Gly108 preceding Pro109 and the main-chain forms a beta turn. The glycine at position 108 allows a bend in the C-terminal main-chain, thereby modifying the surface of the cleft between monomers and potentially changing function. The structure suggests that the C-terminal region of PII proteins may be involved in specificity of function, and nonenteric diazotrophs are found to have the C-terminal consensus XGXDAX(107-112). We are also proposing binding sites for ATP and 2-oxoglutarate based on the structural alignment of PII with PII-ATP/GlnK-ATP, 5-carboxymethyl-2-hydroxymuconate isomerase and 4-oxalocrotonate tautomerase bound to the inhibitor 2-oxo-3-pentynoate.

  10. First operation of ATLAS using the PII linac and a comparison to tandem injection

    International Nuclear Information System (INIS)

    Pardo, R.C.; Bollinger, L.M.; Billquist, P.J.; Bogaty, J.M.; Clifft, B.E.; Markovich, P.; Munson, F.H.; Shepard, K.W.; Zinkann, G.P.

    1991-01-01

    The ATLAS Positive Ion Injector (PII) is designed to replace the tandem injector for the ATLAS heavy-ion facility. When the PII project is complete, ATLAS will be able to accelerate all ions through uranium to energies above the Coulomb barrier. PII consists of an ECR ion source on a 350 kV platform and a very low-velocity superconducting linac. The PII project is nearing completion. First beam from the complete system is expected in early 1992. Beam tests and experiments using a partially completed PII linac have demonstrated that the technical design goals are being met. The results of the early beam tests and first experiments will be discussed and compared to the performance of ATLAS with tandem injection. 10 refs., 2 figs

  11. First operation of ATLAS using the PII linac and a comparison to tandem injection

    Energy Technology Data Exchange (ETDEWEB)

    Pardo, R.C.; Bollinger, L.M.; Billquist, P.J.; Bogaty, J.M.; Clifft, B.E.; Markovich, P.; Munson, F.H.; Shepard, K.W.; Zinkann, G.P.

    1991-12-31

    The ATLAS Positive Ion Injector (PII) is designed to replace the tandem injector for the ATLAS heavy-ion facility. When the PII project is complete, ATLAS will be able to accelerate all ions through uranium to energies above the Coulomb barrier. PII consists of an ECR ion source on a 350 kV platform and a very low-velocity superconducting linac. The PII project is nearing completion. First beam from the complete system is expected in early 1992. Beam tests and experiments using a partially completed PII linac have demonstrated that the technical design goals are being met. The results of the early beam tests and first experiments will be discussed and compared to the performance of ATLAS with tandem injection. 10 refs., 2 figs.

  12. First operation of ATLAS using the PII linac and a comparison to tandem injection

    Energy Technology Data Exchange (ETDEWEB)

    Pardo, R.C.; Bollinger, L.M.; Billquist, P.J.; Bogaty, J.M.; Clifft, B.E.; Markovich, P.; Munson, F.H.; Shepard, K.W.; Zinkann, G.P.

    1991-01-01

    The ATLAS Positive Ion Injector (PII) is designed to replace the tandem injector for the ATLAS heavy-ion facility. When the PII project is complete, ATLAS will be able to accelerate all ions through uranium to energies above the Coulomb barrier. PII consists of an ECR ion source on a 350 kV platform and a very low-velocity superconducting linac. The PII project is nearing completion. First beam from the complete system is expected in early 1992. Beam tests and experiments using a partially completed PII linac have demonstrated that the technical design goals are being met. The results of the early beam tests and first experiments will be discussed and compared to the performance of ATLAS with tandem injection. 10 refs., 2 figs.

  13. Sequencing and Characterization of Novel PII Signaling Protein Gene in Microalga Haematococcus pluvialis

    Directory of Open Access Journals (Sweden)

    Ruijuan Ma

    2017-10-01

    Full Text Available The PII signaling protein is a key protein for controlling nitrogen assimilatory reactions in most organisms, but little information is reported on PII proteins of green microalga Haematococcus pluvialis. Since H. pluvialis cells can produce a large amount of astaxanthin upon nitrogen starvation, its PII protein may represent an important factor on elevated production of Haematococcus astaxanthin. This study identified and isolated the coding gene (HpGLB1 from this microalga. The full-length of HpGLB1 was 1222 bp, including 621 bp coding sequence (CDS, 103 bp 5′ untranslated region (5′ UTR, and 498 bp 3′ untranslated region (3′ UTR. The CDS could encode a protein with 206 amino acids (HpPII. Its calculated molecular weight (Mw was 22.4 kDa and the theoretical isoelectric point was 9.53. When H. pluvialis cells were exposed to nitrogen starvation, the HpGLB1 expression was increased 2.46 times in 48 h, concomitant with the raise of astaxanthin content. This study also used phylogenetic analysis to prove that HpPII was homogeneous to the PII proteins of other green microalgae. The results formed a fundamental basis for the future study on HpPII, for its potential physiological function in Haematococcus astaxanthin biosysthesis.

  14. Urban Conservation Policies and Plans for a World Heritage Site Case: Antique Pergamon City and its Multi-Layered Cultural Landscape

    Science.gov (United States)

    Tunçer, Mehmet

    2017-10-01

    Izmir’s Pergamon (Bergama) Antique City and Its Multi-Layered Cultural Landscape entered the UNESCO World Heritage List with the participation of 21 countries in the 38th World Heritage Committee Meeting held in Doha, Qatar’s capital in between 15 - 25 June 2014. Bergama became the 999th WORLD HERITAGE. Bergama, which has been in operation since 2010, has entered the list as a Multi-layered Cultural Landscape Area. The main purpose of this paper will explain and summarize of urban and archaeological conservation efforts for Pergamon since 1992 to 2014. In the paper also aimed to give the conservation policies of public administrations which mainly central /Ministry of Culture and Tourism, Ministry of Environment/ and local /Bergama Municipality, Gen. Directorate of Vakiflar. Turkey is one of the 10 original member states to establish UNESCO. 9 cities in Turkey are included in the UNESCO List of World Heritage Sites. Further, 23 sites have been nominated and are included in the tentative list. The activities aimed to include the district of Bergama in the UNESCO World Heritage List are ongoing in the years 2009-2014. All the efforts have been made carry this unique antique city to the UNESCO Heritage List at 2014. As an Urban Conservation Planner, I had a change of preparing the FIRST Conservation Aimed Plans and urban designs for Urban and Archaeological Sites of Pergamon together with my team, in the years between 1992-94. We prepared conservation aimed plans for all of the areas of Acropolis, Middle City and Ottoman period urban conservation areas. Urban and archaeological sites of Pergamon the ancient city today, which is over two thousand years old, where scientists, archaeologists, architects, art historians, urban planners, sculptors and similar arts and culture, men talk about admiration, write about and write praises, face to face some deterioration and destruction. As a conservation planner working on Pergamon since 1992, I’ will concentrate the

  15. 2-Oxoglutarate levels control adenosine nucleotide binding by Herbaspirillum seropedicae PII proteins.

    Science.gov (United States)

    Oliveira, Marco A S; Gerhardt, Edileusa C M; Huergo, Luciano F; Souza, Emanuel M; Pedrosa, Fábio O; Chubatsu, Leda S

    2015-12-01

    Nitrogen metabolism in Proteobacteria is controlled by the Ntr system, in which PII proteins play a pivotal role, controlling the activity of target proteins in response to the metabolic state of the cell. Characterization of the binding of molecular effectors to these proteins can provide information about their regulation. Here, the binding of ATP, ADP and 2-oxoglutarate (2-OG) to the Herbaspirillum seropedicae PII proteins, GlnB and GlnK, was characterized using isothermal titration calorimetry. Results show that these proteins can bind three molecules of ATP, ADP and 2-OG with homotropic negative cooperativity, and 2-OG binding stabilizes the binding of ATP. Results also show that the affinity of uridylylated forms of GlnB and GlnK for nucleotides is significantly lower than that of the nonuridylylated proteins. Furthermore, fluctuations in the intracellular concentration of 2-OG in response to nitrogen availability are shown. Results suggest that under nitrogen-limiting conditions, PII proteins tend to bind ATP and 2-OG. By contrast, after an ammonium shock, a decrease in the 2-OG concentration is observed causing a decrease in the affinity of PII proteins for ATP. This phenomenon may facilitate the exchange of ATP for ADP on the ligand-binding pocket of PII proteins, thus it is likely that under low ammonium, low 2-OG levels would favor the ADP-bound state. © 2015 FEBS.

  16. Consumer involvement with products: comparison of PII and NIP scales in the Brazilian context

    Directory of Open Access Journals (Sweden)

    Victor Manoel Cunha de Almeida

    2014-05-01

    Full Text Available This study aims to evaluate the extent to which two scales of consumer involvement with products converge: PII (Personal Involvement Inventory, by Zaichkowsky (1994, and NIP (New Involvement Profile, by Jain and Srinivasan (1990. The literature review encompasses the main studies on measuring the involvement of consumers with products. Data was collected through a survey that was applied to a nonprobabilistic quota sample of undergraduate students from different institutions across the state of Rio de Janeiro. A total of 1,122 questionnaires were collected, of which 1,025 (91.4% were considered valid. In order to investigate the different levels of consumer involvement through different product categories, four products were used – sneakers, mobile phone, sports drinks and soft drinks. ANOVA and post hoc tests were used to verify the existence of significant difference on answers among product groups. This study’s substantive hypothesis, the degree of convergence between the classification results of the PII and NIP scales, was verified in two ways: through Spearman’s non-parametric correlation test and through the observation of the scales’ similar classification proportion rates. The scores’ independence was evaluated through the nonparametric Chi-Square test. Results show high classification convergence. The main contribution of this study is thus to empirically test the PII and NIP scales in the Brazilian context. Furthermore, the convergence of the scores of these scales suggests the possibility of comparing results of studies, using either scale.

  17. Structure and thermodynamics of effector molecule binding to the nitrogen signal transduction PII protein GlnZ from Azospirillum brasilense.

    Science.gov (United States)

    Truan, Daphné; Bjelić, Saša; Li, Xiao-Dan; Winkler, Fritz K

    2014-07-29

    The trimeric PII signal transduction proteins regulate the function of a variety of target proteins predominantly involved in nitrogen metabolism. ATP, ADP and 2-oxoglutarate (2-OG) are key effector molecules influencing PII binding to targets. Studies of PII proteins have established that the 20-residue T-loop plays a central role in effector sensing and target binding. However, the specific effects of effector binding on T-loop conformation have remained poorly documented. We present eight crystal structures of the Azospirillum brasilense PII protein GlnZ, six of which are cocrystallized and liganded with ADP or ATP. We find that interaction with the diphosphate moiety of bound ADP constrains the N-terminal part of the T-loop in a characteristic way that is maintained in ADP-promoted complexes with target proteins. In contrast, the interactions with the triphosphate moiety in ATP complexes are much more variable and no single predominant interaction mode is apparent except for the ternary MgATP/2-OG complex. These conclusions can be extended to most investigated PII proteins of the GlnB/GlnK subfamily. Unlike reported for other PII proteins, microcalorimetry reveals no cooperativity between the three binding sites of GlnZ trimers for any of the three effectors under carefully controlled experimental conditions. Copyright © 2014 Elsevier Ltd. All rights reserved.

  18. Are You Sure You Want to Contact Us? Quantifying the Leakage of PII via Website Contact Forms

    Directory of Open Access Journals (Sweden)

    Starov Oleksii

    2016-01-01

    Full Text Available The majority of commercial websites provide users the ability to contact them via dedicated contact pages. In these pages, users are typically requested to provide their names, email addresses, and reason for contacting the website. This effectively makes contact pages a gateway from being anonymous or pseudonymous, i.e., identified via stateful and stateless identifiers, to being eponymous. As such, the environment where users provide their personally identifiable information (PII has to be trusted and free from intentional and unintentional information leaks. In this paper, we report on the first large-scale study of PII leakage via contact pages of the 100,000 most popular sites of the web. We develop a reliable methodology for identifying and interacting with contact forms as well as techniques that allow us to discover the leakage of PII towards thirdparties, even when that information is obfuscated. Using these methods, we witness the leakage of PII towards third-parties in a wide range of ways, including the leakage through third-party form submissions, third-party scripts that collect PII information from a first-party page, and unintended leakage through a browser’s Referer header. To recover the lost control of users over their PII, we design and develop Formlock, a browser extension that warns the user when contact forms are using PII-leaking practices, and provides the ability to comprehensively lock-down a form so that a user’s details cannot be, neither accidentally, nor intentionally, leaked to third parties

  19. Role of PII proteins in nitrogen fixation control of Herbaspirillum seropedicae strain SmR1

    Directory of Open Access Journals (Sweden)

    Steffens Maria BR

    2011-01-01

    Full Text Available Abstract Background The PII protein family comprises homotrimeric proteins which act as transducers of the cellular nitrogen and carbon status in prokaryotes and plants. In Herbaspirillum seropedicae, two PII-like proteins (GlnB and GlnK, encoded by the genes glnB and glnK, were identified. The glnB gene is monocistronic and its expression is constitutive, while glnK is located in the nlmAglnKamtB operon and is expressed under nitrogen-limiting conditions. Results In order to determine the involvement of the H. seropedicae glnB and glnK gene products in nitrogen fixation, a series of mutant strains were constructed and characterized. The glnK- mutants were deficient in nitrogen fixation and they were complemented by plasmids expressing the GlnK protein or an N-truncated form of NifA. The nitrogenase post-translational control by ammonium was studied and the results showed that the glnK mutant is partially defective in nitrogenase inactivation upon addition of ammonium while the glnB mutant has a wild-type phenotype. Conclusions Our results indicate that GlnK is mainly responsible for NifA activity regulation and ammonium-dependent post-translational regulation of nitrogenase in H. seropedicae.

  20. Role of PII proteins in nitrogen fixation control of Herbaspirillum seropedicae strain SmR1.

    Science.gov (United States)

    Noindorf, Lilian; Bonatto, Ana C; Monteiro, Rose A; Souza, Emanuel M; Rigo, Liu U; Pedrosa, Fabio O; Steffens, Maria B R; Chubatsu, Leda S

    2011-01-11

    The PII protein family comprises homotrimeric proteins which act as transducers of the cellular nitrogen and carbon status in prokaryotes and plants. In Herbaspirillum seropedicae, two PII-like proteins (GlnB and GlnK), encoded by the genes glnB and glnK, were identified. The glnB gene is monocistronic and its expression is constitutive, while glnK is located in the nlmAglnKamtB operon and is expressed under nitrogen-limiting conditions. In order to determine the involvement of the H. seropedicae glnB and glnK gene products in nitrogen fixation, a series of mutant strains were constructed and characterized. The glnK- mutants were deficient in nitrogen fixation and they were complemented by plasmids expressing the GlnK protein or an N-truncated form of NifA. The nitrogenase post-translational control by ammonium was studied and the results showed that the glnK mutant is partially defective in nitrogenase inactivation upon addition of ammonium while the glnB mutant has a wild-type phenotype. Our results indicate that GlnK is mainly responsible for NifA activity regulation and ammonium-dependent post-translational regulation of nitrogenase in H. seropedicae.

  1. Atomic physics at the Argonne PII ECR [electron cyclotron resonance] Ion Source

    International Nuclear Information System (INIS)

    Dunford, R.W.; Berry, H.G.; Billquist, P.J.; Pardo, R.C.; Zabransky, B.J.; Bakke, E.; Groeneveld, K.O.; Hass, M.; Raphaelian, M.L.A.

    1987-01-01

    An atomic physics beam line has been set up at the Argonne PII ECR Ion Source. The source is on a 350-kV high-voltage platform which is a unique feature of particular interest in work on atomic collisions. We describe our planned experimental program which includes: measurement of state-selective electron-capture cross sections, studies of doubly-excited states, precision spectroscopy of few-electron ions, tests of quantum electrodynamics, and studies of polarization transfer using optically pumped polarized alkali targets. The first experiments will be measurements of cross sections for electron capture into specific nl subshells in ion-atom collisions. Our method is to observe the characteristic radiation emitted after capture using a VUV spectrometer. Initial data from these experiments are presented. 12 refs., 4 figs

  2. Mathematical model of the binding of allosteric effectors to the Escherichia coli PII signal transduction protein GlnB.

    Science.gov (United States)

    da Rocha, Ricardo Alves; Weschenfelder, Thiago André; de Castilhos, Fernanda; de Souza, Emanuel Maltempi; Huergo, Luciano Fernandes; Mitchell, David Alexander

    2013-04-16

    PII proteins are important regulators of nitrogen metabolism in a wide variety of organisms: the binding of the allosteric effectors ATP, ADP, and 2-oxoglutarate (2-OG) to PII proteins affects their ability to interact with target proteins. We modeled the simultaneous binding of ATP, ADP, and 2-OG to one PII protein, namely GlnB of Escherichia coli, using a modeling approach that allows the prediction of the proportions of individual binding states. Four models with different binding rules were compared. We selected one of these models (that assumes that the binding of the first nucleotide to GlnB makes it harder for subsequent nucleotides to bind) and used it to explore how physiological concentrations of ATP, ADP, and 2-OG would affect the proportions of those states of GlnB that interact with the target proteins ATase and NtrB. Our simulations indicate that GlnB can, as suggested by previous researchers, act as a sensor of both 2-OG and the ATP:ADP ratio. We conclude that our modeling approach will be an important tool in future studies concerning the PII binding states and their interactions with target proteins.

  3. The Byzantine ceramics from Pergamon excavations. Characterization of local and imported productions by elementary analysis using PIXE and INAA methods and by petrography; Les ceramiques byzantines des fouilles de Pergame. Caracterisation des productions locales et importees par analyse elementaire par les methodes PIXE et INAA et par petrographie

    Energy Technology Data Exchange (ETDEWEB)

    Waksman, S Y

    1995-01-12

    An important ceramics material dated back to the 12th-14th centuries has been excavated in Pergamon (Turkey). Among these findings, wasters, tripod stilts and unfinished ware attest to local production in the Byzantine period. Elemental analysis by the methods PIXE (Particle Induced X-ray Emission) and INAA (Instrumental Neutron Activation Analysis) has been performed on a representative sampling of 160 sherds, including attested local material. Multivariate statistical techniques were used to classify the sherds into groups of similar composition and thus to distinguish ceramics made in Pergamon from imported wares. Several groups of local production have been constituted, which correspond to wares differing in date and fabric. The geochemical characterization of the pastes, complemented with petrographical and mineralogical data, shows that specific raw materials have been used to manufacture each ware. The analytical data related to ceramics made in Pergamon will serve as reference data for future provenance studies. Such reference groups of Byzantine ceramics are very rare, and therefore the ceramics imported into Pergamon cannot be attributed as to their origin. Among the ceramics widely diffused in the Byzantine world, some importations belonging to the ``fine sgraffito`` and ``Zeuxippus ware`` types have been identified. The latter type has been a source of stylistic influence for the workshops of Pergamon, since the analyses show that imitated ``Zeuxippus ware`` has been produced there. These imitations were probably themselves diffused on a regional scale. (author). 238 refs., 48 figs., 53 tabs., 22 photos., 8 appends.

  4. Datasets will not be made accessible to the public due to the fact that they include household level data with PII.

    Data.gov (United States)

    U.S. Environmental Protection Agency — Datasets will not be made accessible to the public due to the fact that they include household level data with PII. This dataset is not publicly accessible because:...

  5. The characteristics of Fugi IP Cassette Type PII and application for radiation oncology quality assurance tests and portal imaging

    International Nuclear Information System (INIS)

    Soh, H.S.; Ung, N.M.; Ng, K.H.

    2008-01-01

    Full text: The advancement of digital imaging has prompted more medical institutions to go filmless. The computed radiography (CR) system is becoming an important tool not only in diagnostic imaging, but also in radiation oncology. A new CR system that was specially designed for the use in radiation oncology. Fuji IP cassette type PII has been introduced to the market in the middle of year 2006. This project aimed to study some basic physical characteristics of this new type of cassette and explore its application for performing quality assurance (QA) tests and portal imaging in radiotherapy. All the images were read by FCR 5000 Plus reader. The image was found to reach its saturation value of 1023 (due to the image was stored in 10 bits data) by depending on the sensitivity value being adjusted. The uniformity test gave the result of 0.12%. The cassette was used to perform the QA tests which were previously performed using film. All the results met the specification as stated in AAPM Task Group 40. The comparison for the portal images of Portal Vision contrast-detail phantom showed that the spatial resolution of the images obtained by CR system (Fujifilm Co.. Ltd.. Tokyo. Japan) were better than the EPID (Varian Medical Systems. Inc.. Palo Alto. USA) and film system (Eastman Kodak Co.. New York. USA). The IP cassette type PII was found to be suitable as an alternative QA test tool and portal imaging in radiotherapy.

  6. Proteomic analysis of Herbaspirillum seropedicae reveals ammonium-induced AmtB-dependent membrane sequestration of PII proteins.

    Science.gov (United States)

    Huergo, Luciano F; Noindorf, Lilian; Gimenes, Camila; Lemgruber, Renato S P; Cordellini, Daniela F; Falarz, Lucas J; Cruz, Leonardo M; Monteiro, Rose A; Pedrosa, Fábio O; Chubatsu, Leda S; Souza, Emanuel M; Steffens, Maria B R

    2010-07-01

    This study was aimed at describing the spectrum and dynamics of proteins associated with the membrane in the nitrogen-fixing bacterium Herbaspirillum seropedicae according to the availability of fixed nitrogen. Using two-dimensional electrophoresis we identified 79 protein spots representing 45 different proteins in the membrane fraction of H. seropedicae. Quantitative analysis of gel images of membrane extracts indicated two spots with increased levels when cells were grown under nitrogen limitation in comparison with nitrogen sufficiency; these spots were identified as the GlnK protein and as a conserved noncytoplasmic protein of unknown function which was encoded in an operon together with GlnK and AmtB. Comparison of gel images of membrane extracts from cells grown under nitrogen limitation or under the same regime but collected after an ammonium shock revealed two proteins, GlnB and GlnK, with increased levels after the shock. The P(II) proteins were not present in the membrane fraction of an amtB mutant. The results reported here suggest that changes in the cellular localization of P(II) might play a role in the control of nitrogen metabolism in H. seropedicae.

  7. Yeast hexokinase: substrate-induced association--dissociation reactions in the binding of glucose to hexokinase P-II.

    Science.gov (United States)

    Hoggett, J G; Kellett, G L

    1976-06-15

    A method is described for the purification of native hexokinases P-I and P-II from yeast using preparative isoelectric focussing to separate the isozymes. The binding of glucose to hexokinase P-II, and the effect of this on the monomer--dimer association--dissociation reaction have been investigated quantitatively by a combination of titrations of intrinsic protein fluorescence and equilibrium ultracentrifugation. Association constants for the monomer-dimer reaction decreased with increasing pH, ionic strength and concentration of glucose. Saturating concentrations of glucose did not bring about complete dissociation of the enzyme showing that both sites were occupired in the dimer. At pH 8.0 and high ionic strength, where the enzyme existed as monomer, the dissociation constant of the enzyme-glucose complex was 3 X 10(-4) mol 1(-1) and was independent of the concentration of enzyme. Binding to the dimeric form at low pH and ionic strength (I=0.02 mol 1(-1), pH less than 7.5) was also independent of enzyme concentration (in the range 10-1000 mug ml-1) but was much weaker. The process could be described by a single dissociation constant, showing that the two available sites on the dimer were equivalent and non-cooperative; values of the intrinsic dissociation constant varied from 2.5 X 10(-3) mol 1(-1) at pH 7.0 to 6 X 10(-3) at pH 6.5. Under intermediate conditions (pH 7.0, ionic strength=0.15 mol 1(-1)), where monomer and dimer coexisted, the binding of glucose showed weak positive cooperatively (Hill coefficient 1.2); in addition, the binding was dependent upon the concentration of enzyme in the direction of stronger binding at lower concentrations. The results show that the phenomenon of half-sites reactivity observed in the binding of glucose to crystalline hexokinase P-II does not occur in solution; the simplest explanation of our finding the two sites to be equivalent is that the dimer results from the homologous association of two identical subunits.

  8. Experimental enhancement of fuzzy fractional order PI+I controller of grid connected variable speed wind energy conversion system

    International Nuclear Information System (INIS)

    Beddar, Antar; Bouzekri, Hacene; Babes, Badreddine; Afghoul, Hamza

    2016-01-01

    Highlights: • Fuzzy fractional order PI+I for wind energy conversion system is developed. • Investigation of the control methods performances under wind and load variations. • PSO algorithm with frequency method are used for parameters tuning. • Experimental results are presented. - Abstract: In this paper, fuzzy fractional order PI+I (FFOPI+I) controller for grid connected Variable Speed Wind Energy Conversion System (VS-WECS) is proposed. The FFOPI+I controller is applied to control a Permanent Magnet Synchronous Generator (PMSG) connected to the grid and nonlinear load through a back-to-back AC-DC-AC PWM converter. The control strategy of the Machine Side Converter (MSC) aims, at first, to extract a maximum power under fluctuating wind speed. Then, the Grid Side Converter (GSC) is controlled to improve the power quality and ensure sinusoidal current in the grid side. The FFOPI+I controller implements a Fuzzy Logic Controller (FLC) in parallel with Fractional Order PI (FOPI) and conventional PI controllers by having a commune proportional gain. The FLC changes the integral gains at runtime. The initial parameters of the FFOPI+I controller were calculated using a frequency method to create a search space then the PSO algorithm is used to select the optimal parameters. To evaluate the performance of the proposed controller in steady and transient states, an experimental test bench has been built in laboratory using dSPACE1104 card. The experimental results demonstrate the effectiveness and feasibility of the FFOPI+I over FOPI and conventional PI controllers by realizing maximum power extraction and improving the grid-side power factor for a wide range of wind speed.

  9. Structure of a conserved hypothetical protein SA1388 from S. aureus reveals a capped hexameric toroid with two PII domain lids and a dinuclear metal center

    Directory of Open Access Journals (Sweden)

    Leybourne Matthew

    2006-12-01

    Full Text Available Abstract Background The protein encoded by the SA1388 gene from Staphylococcus aureus was chosen for structure determination to elucidate its domain organization and confirm our earlier remote homology based prediction that it housed a nitrogen regulatory PII protein-like domain. SA1388 was predicted to contain a central PII-like domain and two flanking regions, which together belong to the NIF3-like protein family. Proteins like SA1388 remain a poorly studied group and their structural characterization could guide future investigations aimed at understanding their function. Results The structure of SA1388 has been solved to 2.0Å resolution by single wavelength anomalous dispersion phasing method using selenium anomalous signals. It reveals a canonical NIF3-like fold containing two domains with a PII-like domain inserted in the middle of the polypeptide. The N and C terminal halves of the NIF3-like domains are involved in dimerization, while the PII domain forms trimeric contacts with symmetry related monomers. Overall, the NIF3-like domains of SA1388 are organized as a hexameric toroid similar to its homologs, E. coli ybgI and the hypothetical protein SP1609 from Streptococcus pneumoniae. The openings on either side of the toroid are partially covered by trimeric "lids" formed by the PII domains. The junction of the two NIF3 domains has two zinc ions bound at what appears to be a histidine rich active site. A well-defined electron density corresponding to an endogenously bound ligand of unknown identity is observed in close proximity to the metal site. Conclusion SA1388 is the third member of the NIF3-like family of proteins to be structurally characterized, the other two also being hypothetical proteins of unknown function. The structure of SA1388 confirms our earlier prediction that the inserted domain that separates the two NIF3 domains adopts a PII-like fold and reveals an overall capped toroidal arrangement for the protein hexamer. The

  10. Tissue localization and extracellular matrix degradation by PI, PII and PIII snake venom metalloproteinases: clues on the mechanisms of venom-induced hemorrhage.

    Directory of Open Access Journals (Sweden)

    Cristina Herrera

    2015-04-01

    Full Text Available Snake venom hemorrhagic metalloproteinases (SVMPs of the PI, PII and PIII classes were compared in terms of tissue localization and their ability to hydrolyze basement membrane components in vivo, as well as by a proteomics analysis of exudates collected in tissue injected with these enzymes. Immunohistochemical analyses of co-localization of these SVMPs with type IV collagen revealed that PII and PIII enzymes co-localized with type IV collagen in capillaries, arterioles and post-capillary venules to a higher extent than PI SVMP, which showed a more widespread distribution in the tissue. The patterns of hydrolysis by these three SVMPs of laminin, type VI collagen and nidogen in vivo greatly differ, whereas the three enzymes showed a similar pattern of degradation of type IV collagen, supporting the concept that hydrolysis of this component is critical for the destabilization of microvessel structure leading to hemorrhage. Proteomic analysis of wound exudate revealed similarities and differences between the action of the three SVMPs. Higher extent of proteolysis was observed for the PI enzyme regarding several extracellular matrix components and fibrinogen, whereas exudates from mice injected with PII and PIII SVMPs had higher amounts of some intracellular proteins. Our results provide novel clues for understanding the mechanisms by which SVMPs induce damage to the microvasculature and generate hemorrhage.

  11. Yeast hexokinase. A fluorescence temperature-jump study of the kinetics of the binding of glucose to the monomer forms of hexokinases P-I and P-II.

    Science.gov (United States)

    Hoggett, J G; Kellett, G L

    1976-09-15

    The binding of glucose to the monomeric forms of hexokinases P-I and P-II in Tris and phosphate buffers at pH 8.0 in the presence of 1 mol l-1 KCl has been studied using the fluorescence temperature-jump technique. For both isozymes only one relaxation time was observed; values of tau-1 increased linearly with increasing concentration of free reacting partners. The apparent second-order rate constant for association was about 2 X 10(6) 1 mol-1 s-1 for both isozymes; the differences in the stabilities of the complexes with P-I and P-II are entirely attributable to the fact that glucose dissociates more slowly from its complex with P-I than P-II (approximately 300 s-1 and 1100 s-1 respectively). Although the kinetic data are compatible with a single-step mechanism for glucose binding the association rate constant was much lower than that expected for a diffusion-limited rate of encounter. Other mechanisms for describing an induced-fit are discussed. It is shown that the data are incompatible with a slow 'prior-isomerization' pathway of substrate binding, but are consistent with a 'substrate-guided' pathway involving isomerization of the enzyme-substrate complex.

  12. Evaluation of mating type distribution and genetic diversity of three Magnaporthe oryzae avirulence genes, PWL-2, AVR-Pii and Avr-Piz-t, in Thailand rice blast isolates

    Directory of Open Access Journals (Sweden)

    Thanyaluk Sirisathaworn

    2017-02-01

    Full Text Available Rice blast disease, caused by the filamentous ascomycete fungus Magnaporthe oryzae (anamorph Pyricularia oryzae, has been ranked among the most important diseases of rice. The molecular mechanisms against this fungus follow the idea of “gene-for-gene interaction”, in which a plant resistance (R gene product recognizes a fungal avirulence (Avr effector and triggers the defense response. However, the Avr genes have been shown to be rapidly evolving resulting in high levels of genetic diversity. This study investigated genetic diversity that is influenced by sexual recombination and mutation for the adaptation of rice blast fungus to overcome the defense response. Mating type distribution and the nucleotide sequence variation of three avirulence genes were evaluated—PWL-2, Avr-Pii and Avr-Piz-t. In total, 77 rice blast isolates collected from infected rice plants in northern, northeastern and central Thailand in 2005, 2010 and 2012, were used in the analysis with mating type and avirulence gene-specific primers. The results revealed that all the tested blast isolates belonged to the mating type MAT1-2, suggesting a lack of sexual recombination within the population. The successful rates of PWL-2, Avr-Pii and Avr-Piz-t gene-specific primer amplification were 100%, 60% and 54%, respectively. Base substitution mutation was observed in coding regions of the Avr-Pii and Avr-Piz-t genes. Although these results showed a low level of genetic diversity in Thai rice blast isolates, non-synonymous mutations did occur which revealed common mechanisms of selective pressure that are prone to adaptation of Avr genes. The information on nucleotide sequence variation and the genetic diversity of Avr genes obtained from this study could be useful for planning novel strategies in the development of rice breeding programs in Thailand.

  13. Baecklund transformations for discrete Painleve equations: Discrete PII-PV

    International Nuclear Information System (INIS)

    Sakka, A.; Mugan, U.

    2006-01-01

    Transformation properties of discrete Painleve equations are investigated by using an algorithmic method. This method yields explicit transformations which relates the solutions of discrete Painleve equations, discrete P II -P V , with different values of parameters. The particular solutions which are expressible in terms of the discrete analogue of the classical special functions of discrete Painleve equations can also be obtained from these transformations

  14. A Responsible De-Identification Of The Real Data Corpus: Building A Framework For PII Management

    Science.gov (United States)

    2016-09-01

    driver’s license, full or partial social security, passport, etc. Memberships and donation info Marriage and family - spouse, marital status, chil- dren...Processing] can include, but is not limited to, the collection, retention , logging, generation, transformation, disclosure, transfer, and disposal of...a structured output, it makes the data controller’s de-identification job a bit easier. This provides an advantage over other information systems that

  15. PII- Potential Innovation Index: a Tool to Benchmark Innovation Capabilities in International Context

    Directory of Open Access Journals (Sweden)

    Daniel Galvez

    2013-12-01

    Full Text Available Benchmarking has become a useful tool for companies, enabling better decision-making and improvement of internal practices towards world-class performance. Nevertheless, concerning SMEs’ innovation capabilities from traditional sectors, benchmarking applications have been scarce. This article uses a predefined metric named the “Potential Innovation Index (PII”, based on internal practices of the firms to compare innovation capabilities of two groups of similar SMEs from 2 different geographical, cultural and social contexts. Results were used to analyze similarities and differences, strengths and weaknesses of the groups. Obtained results confirm the difficulties to innovate of this type firms, no matters the sector or country, as over 55% of the companies studied were evaluated as having a low innovative performance. However, regarding the index’s constitutive practices, significant differences were found. Which leads to infer that innovation support strategies to enhance innovation must be adapted to the local context and culture.

  16. 32 CFR Appendix A to Part 310 - Safeguarding Personally Identifiable Information (PII)

    Science.gov (United States)

    2010-07-01

    ... computer environments outside the data processing installation (such as, remote job entry stations... process classified material have adequate procedures and security for the purposes of this Regulation... handling the information of the need for special protection. Designating products “For Official Use Only...

  17. International dictionary of geophysics : S. K. Runcorn (editor-in-chief). Pergamon, Oxford, 1967, 2 volumes, 1,728 pp., 730 fig., £ 45.0.0

    NARCIS (Netherlands)

    Manten, A.A.

    1968-01-01

    The reader is informed about a large number of subjects in a generally brief, elucidating manner. No single source contains such a large number of short review articles. That the general framework in which the contributions are contained is weak, is no reflection on the authors, but the

  18. Application of the τ-function theory of Painleve equations to random matrices: PIV, PII and the GUE

    International Nuclear Information System (INIS)

    Forrester, P.J.; Witte, N.S.

    2000-01-01

    Tracy and Widom have evaluated the cumulative distribution of the largest eigenvalue for the finite and scaled infinite Gaussian unitary ensemble (GUE) in terms of a Painleve IV and Painleve II transcendent respectively. We generalise these results to the evaluation of E N (λ;a) :(Π n l=1 χ (l) (-∞,λ) (λ - λ l ) a ), where χ (l) (-∞) = 1 for λ l E (- ∞,λ] and χ (l) (-∞,λ) = 0 otherwise, and the average is with respect to the joint eigenvalue distribution of the GUE, as well as to the evaluation of F N (λ;a) :(Π N l=1 (λ - λ l ) a ). Of particular interest are E N (λ;2) and F N (λ;2)X and their scaled limits, which give the distribution of the largest eigenvalue and the density respectively. Our results are obtained by applying the Okamoto τ-function theory of Painleve IV and Painleve II equations, for which we give a self contained presentation based on the recent work of Noumi and Yamada. We point out that the same approach can be used to study the quantities E N (λ; a) and F N (λ; a) for the other classical matrix ensembles

  19. Editorial: especial n.1 do segundo semestre de 2006 10.5007/1518-2924.2006v11nesp2pii

    Directory of Open Access Journals (Sweden)

    Juan Carlos Fernández Molina

    2006-12-01

    Full Text Available EDITORIAL Al contrario que en la mayoría de los países europeos y americanos (tanto del norte como del sur, la formación en el área de Biblioteconomía y Documentación tiene una escasa tradición en la universidad española. De hecho, sólo hace 20 años que de las universidades de Barcelona y Granada salieron los primeros titulados universitarios en Biblioteconomía y Documentación. En 1978 se habían creado legalmente en España las Escuelas y Diplomaturas universitarias en Biblioteconomía y Documentación, pero no fue hasta el curso 1983/84 cuando empezó su andadura en estas dos universidades, que actuaron de pioneras. Dado que este primer título era de 3 años, en 1986 salieron de ambas universidades los primeros Diplomados en Biblioteconomía y Documentación. Y tuvieron que pasar otros cuantos años, para que en 1994 la formación fuera ampliada con la creación de un segundo ciclo (Licenciatura, que suponía dos años más de estudio. Finalmente, en 1996 se concedió el primer título de doctor en Documentación y se generalizaron los programas de doctorado específicos del área de Documentación. Es decir, sólo a partir de la segunda mitad de los noventa se puede considerar que la formación universitaria queda completada y se dan las condiciones mínimas para un adecuado desarrollo de la investigación en este área en España. Aunque el periodo transcurrido ha sido muy corto, la investigación en este campo ha experimentado un gran crecimiento, tanto en cantidad como calidad, siguiendo un patrón similar al del conjunto de la investigación en España, cuyo desarrollo en la década de los noventa ha sido sobresaliente, debido tanto al desarrollo económico del país como a los incentivos que se implantan a partir de finales de los años ochenta. Este número especial de Encontros Bibli tiene su origen en la amable invitación de su Comisión Editorial para dedicarlo no a un tema concreto o a recoger una selección de las contribuciones a un congreso, como ha sido lo habitual hasta ahora, sino a una institución: la Facultad de Biblioteconomía y Documentación de la Universidad de Granada, aprovechando que se cumplen 20 años de sus primeros titulados y 10 de sus primeros doctores en Documentación. El objetivo era presentar una muestra significativa de la investigación que se desarrolla en esta institución, por lo que se han elegido contribuciones que abarcan diferentes campos y con autores que pertenecen a diferentes departamentos. En este sentido, conviene señalar que esta Facultad cuenta con casi 60 profesores, de los que unos 35 pertenecen al Departamento de Biblioteconomía y Documentación. Pues bien, la mayoría de los profesores que han colaborado pertenecen a este departamento, dado su claro predominio en la Facultad, pero también los hay del Departamento de Ciencias de la Computación e Inteligencia Artificial o del de Historia de la Ciencia. En cuanto a los temas, el dominante es sin duda la Bibliometría, reflejo de la hegemonía que este tema tiene en esta Facultad, que está representado por los trabajos de E. Ruiz de Osma y del Grupo Scimago. Un buen ejemplo de la colaboración entre los departamentos de Biblioteconomía y Documentación y Ciencias de la Computación es el trabajo de Herrera-Viedma et al., centrado en la aplicación de herramientas de lógica difusa a la evaluación de bibliotecas. También se centra en la evaluación el trabajo de Torres y Muñoz, pero en este caso de las páginas web de los centros universitarios que se dedican a los Estudios de las Mujeres. De gran actualidad es el tema abordado por la contribución de López Gijón et al.: el papel que debe jugar la biblioteca universitaria en el nuevo entorno de la educación universitaria en la Unión Europea surgido por el denominado “proceso de Bolonia”. Finalmente, la aportación de G. Olagüe, del Departamento de Historia de la Ciencia, analiza la colaboración entre España y América Latina en los orígenes y desarrollo del movimiento documental europeo de principios del siglo XX. Granada, julio de 2006 Juan Carlos Fernández Molina Universidad de Granada - España

  20. Apresentação da editora deste número 10.5007/1518-2924.2006v11nesp3pii

    Directory of Open Access Journals (Sweden)

    Célia Regina Simonetti Barbalho

    2006-12-01

    Full Text Available No mundo de Babel em que vivemos não falamos uma mesma língua, mesmo quando nos expressamos através do mesmo idioma. Nesta obscura torre, onde o homem se manifesta pelas linguagens que constituiu, muitos são os modos como individualmente um sujeito compreende o que está implícito e explicito na teia de sentidos que foi cuidadosamente constituída e articulada para expressar significado. Dewey, ao constituir seu sistema de classificação, afirmou ser ele um construto para educação do individuo embora entendesse ser necessário “[...] saber como extrair sentido da página impressa”. De fato, independente do suporte onde se exibe, uma mensagem para se tornar um lance de comunicação, precisa ser assimilada, demandando que dela se extraia os sentidos que manifesta. Este desafio aproximou a Semiótica da Ciência da Informação uma vez que ambas buscam consolidar algo essencial para minimizar os impactos da obesidade de informação que se vivencia hoje, qual seja, promover acesso ao significado dos artefatos de cultura produzidos pelo homem de modo a fomentar saberes que constituam conhecimentos ou, como afirma Maria Aparecida Moura, no artigo Ciência da Informação e Semiótica: conexão de saberes, ambas procuram ampliar a compreensão das manifestações de modo a conectar conhecimento e sabedoria. Nesta perspectiva, a aproximação inicialmente ocorreu pelo foco que, aparentemente lhes é mais próximo, o das linguagens documentárias e suas semioses, como questiona Marilda Lopes Ginez de Lara, no artigo É possível falar em signo e semiose documentária? Assim exposta, tal aproximação da Semiótica com a Ciência da Informação ocorreu através das duas abordagens mais conhecidas da primeira: a corrente fenomenológica do americano Charles Sanders Peirce e a lingüística do lituano-francês Algirdas Julien Greimas, embora minimamente exista ainda a vertente russa da Escola de Tartu, representada por Iuri Lotman. Os estudos da linha americana também se manifestam na discussão de Solange Silva Moreira, no artigo O ícone e a possibilidade de informação que trata da potencialidade informacional do ícone, elemento onde se circunscreve a lógica das articulações teóricas que devem ser estabelecidas pela aproximação acima tratada. A abordagem é recorrente no texto de Silvana Drumond Monteiro que, ao expor sua Semiótica peirciana e a questão da informação e do conhecimento apresenta a diferença entre informação e conhecimento, tanto do ponto de vista da linguagem, como do sujeito cognoscente. No artigo Signos audiovisuais e ciência da informação: uma avaliação, Jalver Bethônico também se ampara nas reflexões de Charles Sanders Peirce para concluir pela compreensão do fenômeno da informação através da análise nos mais variados tipos de textos que são materializados em distintas formas simbólicas destacando que o saber é ato de conhecer sob o ponto de vista daquele que o interpreta. Na expectativa de oferecer um outro foco para a parceria da Ciência da Informação com a Semiótica, Celia Regina Simonetti Barbalho, no texto Fazer semiótico: subsídios para Enc. Bibli: R. Eletr. Bibliotecon. Ci. Inf., Florianópolis, 2 número esp., 2º sem. 2006 exame do espaço concreto, expõe os aspectos teóricos da abordagem francesa e estabelece o espaço enquanto locus de suas análises. Neste conjunto de artigos, será possível observar o quão variada é a análise semiótica e o quanto ela pode oferecer para o entendimento da informação enquanto um instrumento capaz de favorecer a percepção do homem em seu contexto e promover sua capacidade de articulação com o mundo que o cerca. A intencionalidade de se consolidar esta Edição Especial ocorreu no sentido de permitir que se instale, mais intensamente, no contexto dos estudos brasileiros que buscam tal interface, uma ampla discussão que permita disseminar os fundamentos de uma área de árdua compreensão, como é a semiótica, de modo a consentir que a tênue relação existente entre as áreas, possa contribuir para uma percepção ampla do modo de entender os artefatos de cultura postos para serem visíveis ao olhar de um outro, ator do contexto onde a informação busca sua transformação em conhecimento.

  1. Classics in physical geography revisited. Hewlett, J.D. and Hibbert, A.R. 1967: Factors affecting the response of small watersheds to precipitation in humid areas. In Sopper, W.E. and Lull, H.W., editors, Forest hydrology, New York: Pergamon Press, 275-90.

    Science.gov (United States)

    Jeffrey J. McDonnell

    2009-01-01

    Hewlett and Hibbert’s (1967) ‘Factors affecting the response of small watersheds to precipitation in humid areas’ (hereafter referred to as ‘Factors’) is one of the most important papers published in the field of catchment hydrology.

  2. Observations of wind and waves in the central Bay of Bengal during ...

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    Time-series wind and wave measurements were carried out onboard INS ... relation for gross estimation of effective depth within which the sound energy is generally trapped during its ..... and wave climate; (USA: Pergamon, Elsevier Science).

  3. Fulltext PDF

    Indian Academy of Sciences (India)

    of the self-consistent determination of the isovector effective interaction ... because they play a considerable role in the determination of the effective vector ...... [24] V G Soloviev, Theory of complex nuclei (Pergamon Press, New York, 1976).

  4. Compensating Wounded Warriors: An Analysis of Injury, Labor Market Earnings, and Disability Compensation Among Veterans of the Iraq and Afghanistan Wars

    Science.gov (United States)

    2012-01-01

    dermatological; ear, nose, and throat; eye; family problems; fatigue, malaise, multisystem complaint; audiology ; gastrointestinal; genitourinary...25, 2011: http://www.sciencedirect.com/science/ article /pii/S0927537111000686 Loughran, David S., Jacob Alex Klerman, and Craig Martin, Activation and

  5. Dicty_cDB: VFK707 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qvll ltllkn*pii*ltttvklvffskinnvk*yik***KNVVTLYIYKKK--- ---TLKTLNKYIIYNDLASIRR*qltwcwfriscsfrcc*r*clgtlswiqc...kn*pii*ltttvklvffskinnvk*yik***kn Frame C: tlktlnkyiiyndlasirr*qltwcwfriscsfrcc*r...it*nni*nnnkkml*lyiyikkk--- ---TLKTLNKYIIYNDLASIRR*qltwcwfriscsfrcc*r*clgtlswiqcr*r*gnnr tfskgwscirnwhprcw*ei

  6. Vulnerability- and Diversity-Aware Anonymization of Personally Identifiable Information for Improving User Privacy and Utility of Publishing Data

    Science.gov (United States)

    Majeed, Abdul; Ullah, Farman; Lee, Sungchang

    2017-01-01

    Personally identifiable information (PII) affects individual privacy because PII combinations may yield unique identifications in published data. User PII such as age, race, gender, and zip code contain private information that may assist an adversary in determining the user to whom such information relates. Each item of user PII reveals identity differently, and some types of PII are highly identity vulnerable. More vulnerable types of PII enable unique identification more easily, and their presence in published data increases privacy risks. Existing privacy models treat all types of PII equally from an identity revelation point of view, and they mainly focus on hiding user PII in a crowd of other users. Ignoring the identity vulnerability of each type of PII during anonymization is not an effective method of protecting user privacy in a fine-grained manner. This paper proposes a new anonymization scheme that considers the identity vulnerability of PII to effectively protect user privacy. Data generalization is performed adaptively based on the identity vulnerability of PII as well as diversity to anonymize data. This adaptive generalization effectively enables anonymous data, which protects user identity and private information disclosures while maximizing the utility of data for performing analyses and building classification models. Additionally, the proposed scheme has low computational overheads. The simulation results show the effectiveness of the scheme and verify the aforementioned claims. PMID:28481298

  7. Vulnerability- and Diversity-Aware Anonymization of Personally Identifiable Information for Improving User Privacy and Utility of Publishing Data

    Directory of Open Access Journals (Sweden)

    Abdul Majeed

    2017-05-01

    Full Text Available Personally identifiable information (PII affects individual privacy because PII combinations may yield unique identifications in published data. User PII such as age, race, gender, and zip code contain private information that may assist an adversary in determining the user to whom such information relates. Each item of user PII reveals identity differently, and some types of PII are highly identity vulnerable. More vulnerable types of PII enable unique identification more easily, and their presence in published data increases privacy risks. Existing privacy models treat all types of PII equally from an identity revelation point of view, and they mainly focus on hiding user PII in a crowd of other users. Ignoring the identity vulnerability of each type of PII during anonymization is not an effective method of protecting user privacy in a fine-grained manner. This paper proposes a new anonymization scheme that considers the identity vulnerability of PII to effectively protect user privacy. Data generalization is performed adaptively based on the identity vulnerability of PII as well as diversity to anonymize data. This adaptive generalization effectively enables anonymous data, which protects user identity and private information disclosures while maximizing the utility of data for performing analyses and building classification models. Additionally, the proposed scheme has low computational overheads. The simulation results show the effectiveness of the scheme and verify the aforementioned claims.

  8. Anal Canal Cancer: Management of Inguinal Nodes and Benefit of Prophylactic Inguinal Irradiation (CORS-03 Study)

    International Nuclear Information System (INIS)

    Ortholan, Cécile; Resbeut, Michel; Hannoun-Levi, Jean-Michel; Teissier, Eric; Gerard, Jean-Pierre; Ronchin, Philippe; Zaccariotto, Audrey; Minsat, Mathieu; Benezery, Karen; François, Eric; Salem, Naji; Ellis, Steve; Azria, David; Champetier, Cédric; Gross, Emmanuel; Cowen, Didier

    2012-01-01

    Purpose: To evaluate the benefit of prophylactic inguinal irradiation (PII) in anal canal squamous cell carcinoma (ASCC). Methods and Materials: This retrospective study analyzed the outcome of 208 patients presenting with ASCC treated between 2000 and 2004 in four cancer centers of the south of France. Results: The population study included 35 T1, 86 T2, 59 T3, 20 T4, and 8 T stage unknown patients. Twenty-seven patients presented with macroscopic inguinal node involvement. Of the 181 patients with uninvolved nodes at presentation, 75 received a PII to a total dose of 45–50 Gy (PII group) and 106 did not receive PII (no PII group). Compared with the no PII group, patients in the PII group were younger (60% vs. 41% of patients age 2 toxicity of the lower extremity was observed. Conclusion: PII with a dose of 45 Gy is safe and highly efficient to prevent inguinal recurrence and should be recommended for all T3-4 tumors. For early-stage tumors, PII should also be discussed, because the 5-year inguinal recurrence risk remains substantial when omitting PII (about 10%).

  9. Status of the uranium upgrade of ATLAS

    International Nuclear Information System (INIS)

    Bollinger, L.M.; Billquist, P.J.; Bogaty, J.M.; Clifft, B.E.; Markovich, P.; Munson, F.H.; Pardo, R.C.; Shepard, K.W.; Zinkann, G.P.

    1991-01-01

    The ATLAS Positive Ion Injector (PII) is designed to replace the tandem injector for the ATLAS heavy-ion facility. When the PII project is complete, ATLAS will be able to accelerate all ions through uranium to energies above the Coulomb barrier. PII consists of an ECR ion source on a 350 KV platform and a very low-velocity superconducting linac. The linac is composed of an independently-phased array of superconducting four-gap interdigital resonators which accelerate over a velocity range of .007c to .05c. the PII project is approximately 75% complete. Beam tests and experiments using the partially completed PII have demonstrated that the technical design goals are being met. The design, construction status, and results of recent operational experience using the PII will be discussed. 10 refs., 2 figs., 1 tab

  10. Status of the uranium upgrade of ATLAS

    Energy Technology Data Exchange (ETDEWEB)

    Bollinger, L.M.; Billquist, P.J.; Bogaty, J.M.; Clifft, B.E.; Markovich, P.; Munson, F.H.; Pardo, R.C.; Shepard, K.W.; Zinkann, G.P.

    1991-01-01

    The ATLAS Positive Ion Injector (PII) is designed to replace the tandem injector for the ATLAS heavy-ion facility. When the PII project is complete, ATLAS will be able to accelerate all ions through uranium to energies above the Coulomb barrier. PII consists of an ECR ion source on a 350 KV platform and a very low-velocity superconducting linac. The linac is composed of an independently-phased array of superconducting four-gap interdigital resonators which accelerate over a velocity range of .007c to .05c. the PII project is approximately 75% complete. Beam tests and experiments using the partially completed PII have demonstrated that the technical design goals are being met. The design, construction status, and results of recent operational experience using the PII will be discussed. 10 refs., 2 figs., 1 tab.

  11. Plan for Reducing Unnecessary use of Social Security Numbers

    Science.gov (United States)

    Recognizing that training and awareness are critical to protecting agency Personally Identifiable Information (PII), the EPA is developing online training for privacy contacts in its programs and regions.

  12. Privacy Training Program

    Science.gov (United States)

    Recognizing that training and awareness are critical to protecting agency Personally Identifiable Information (PII), the EPA is developing online training for privacy contacts in its programs and regions.

  13. Evolutionary conservation of the polyproline II conformation surrounding intrinsically disordered phosphorylation sites.

    Science.gov (United States)

    Elam, W Austin; Schrank, Travis P; Campagnolo, Andrew J; Hilser, Vincent J

    2013-04-01

    Intrinsically disordered (ID) proteins function in the absence of a unique stable structure and appear to challenge the classic structure-function paradigm. The extent to which ID proteins take advantage of subtle conformational biases to perform functions, and whether signals for such mechanism can be identified in proteome-wide studies is not well understood. Of particular interest is the polyproline II (PII) conformation, suggested to be highly populated in unfolded proteins. We experimentally determine a complete calorimetric propensity scale for the PII conformation. Projection of the scale into representative eukaryotic proteomes reveals significant PII bias in regions coding for ID proteins. Importantly, enrichment of PII in ID proteins, or protein segments, is also captured by other PII scales, indicating that this enrichment is robustly encoded and universally detectable regardless of the method of PII propensity determination. Gene ontology (GO) terms obtained using our PII scale and other scales demonstrate a consensus for molecular functions performed by high PII proteins across the proteome. Perhaps the most striking result of the GO analysis is conserved enrichment (P ontology reveals an enrichment of PII bias near disordered phosphorylation sites that is conserved throughout eukaryotes. Copyright © 2013 The Protein Society.

  14. Your solar energy home: including wind and methane applications

    National Research Council Canada - National Science Library

    Howell, Derek

    1979-01-01

    .... When a particular title is adopted or recommended for adoption for class use and the recommendation results in a sale of 12 or more copies, the inspection copy may be retained with our compliments. The Publishers will be pleased to receive suggestions for revised editions and new titles to be published in this important International Library.Other Pergamon ...

  15. ( Combretaceae ) on gastro intestinal smooth muscle

    African Journals Online (AJOL)

    USER

    plague in the Gambia locally named “Alibain”, claimed many lives but a lot of ... days and then ground into a fine powder using pestle and mortar. .... Modern. Pharmacology with Clinical Applications. Fifth edition, Pergamon press. New York, Pp.93, 109-. 113. Galvez, J., Zarzuelo, A. and Crespo, M.E. (1991):. Antidiarrhoea ...

  16. Handbook for Nuclear Weapons Effects under Arctic Conditions. Sanitized.

    Science.gov (United States)

    1980-04-30

    Atmos- phere Symposium at Oslo, July 1956, Sutcliffe, R.C., Ed., Pergamon Press, Almsford, NY, 1958, UNCLASSIFIED. Nakonechny, Basil V., The Arctic...venting prior to emision of the first S bubble pulse. If the detonation occurs close enough to the surface so that ice melt is involved in the initial

  17. Volume 7 No. 6 2007 December 2007

    African Journals Online (AJOL)

    Administrator

    13 FAO/APHCA. The use of palm-kernel cake as Animal feed. FAO/ APHCA. Publication No. 8., 1989. 14 Pannevis MC Nutrition of Ornamental Fish. In: I Burger (Ed). The Watham Book of. Companion Animal Nutrition. Pergamon Press Ltd, Oxford, England, 1993:85-96. 15 Eyo AA Fish Processing Technology in the Tropics.

  18. Toxicity of two plant powders as biopesticides in the management of ...

    African Journals Online (AJOL)

    SARAH

    2015-02-28

    Feb 28, 2015 ... The lowest LC50 value after 6 days was obtained with A. cissampeloides applied at. 2.37g/20g of V. ... Ex Hook.) Harms (Passifloraceae). Cliche: Chougourou, 2015. ..... Innovative Pest Management, Pergamon Press,. Oxford ...

  19. Health Visitor's Role in Prediction of Early Childhood Injuries and Failure to Thrive.

    Science.gov (United States)

    Dean, Janet G.; And Others

    1978-01-01

    Discusses the role of the health visitor in the prediction of early childhood injuries, abuse, and failure to thrive--based on a three-year study of the relationship between early maternal attitudes and subsequent child health. Journal availability: Pergamon Press Ltd., Headington Hill Hall, Oxford, OX3 OBW England. (DLS)

  20. Untitled

    African Journals Online (AJOL)

    Barr, J.B.; Wallon, S.B. J. Appl. Polym. Sci. 1971, 15, 1079. Chuang, I-S; Maciel, G.E. Macromolecules 1984, 17, 1087. Gandini, A. Comprehensive Polymer Science, Pergamon Press: Oxford; 1992. Choura, M. Doctoral Thesis, National Polytechnic Institute, Grenoble, France, 1991. Wewerka, E.M.; Loughran, E.D.; Walters, ...

  1. Problem Sets: Fundamentals Of Transportation And Traffic Operations

    OpenAIRE

    Daganzo, Carlos F.

    1998-01-01

    These problem sets comprise a supplement to Fundamentals of Transportation and Traffic Operations (C. Daganzo, Pergamon, 1997). Academicians can also obtain a companion set of solutions by writing to "Institute of Transportation Studies, Publications Office, 109 McLaughlin Hall, University of California, Berkeley, CA 94720" or by sending e-mail to .

  2. Tutorial Workshop on Robotics and Robot Control.

    Science.gov (United States)

    1982-10-26

    unconditional shifts can be defined as increments in the four coordinate systems described above: i8 ugT - (AJtp ia, J.u) where all components nt...Manipulators," Mechanism and Machine Theory , Pergamon Press, �, Vol. 12, pp. 515-530. D.E. Whitney, "Force Feedback Control of Manipulator Fine Motions

  3. Upper ocean stratification and circulation in the northern Bay of Bengal during southwest monsoon of 1991

    Digital Repository Service at National Institute of Oceanography (India)

    Gopalakrishna, V.V.; Murty, V.S.N.; Sengupta, D.; Shenoy, Shrikant; Araligidad, N.

    and the role of near-surface stratified layer in the Bay of Bengal. Proceedings of PORSEC 2000, Vol. I, pp. 453–457. Pond, S., Pickard, G.L., 1983. Introductory Dynamic Oceano- graphy, Pergamon Press, New York, 241pp. Sengupta,D.,Senan,R.,Goswamy,B.N.,2001...

  4. Anomalous current structure in the eastern equatorial Indian Indian Ocean during the south-west monsoon of 1994

    Digital Repository Service at National Institute of Oceanography (India)

    Unnikrishnan, A.S.; Murty, V.S.N.; Babu, M.T.; Gopinathan, C.K.; Charyulu, R.J.K.

    ., and Mcphaden M. J. (1989). Use of the geostrophic approximation to estimate time-varying zonal currents at the equator. Journal of Geophysical Research 94(C3), 3228–36. Pond, S., and Pickard, G. L. (1983). ‘Introductory Dynamic Oceanography.’ (Pergamon Press...

  5. The monsoon currents in the north Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Shankar, D.; Vinayachandran, P.N.; Unnikrishnan, A.S.

    . Journal of Geo- physical Research 97, 20169?20178. Pond, S., Pickard, G. L., 1983. Introductory dynamical oceanography, 2nd Edition. Pergamon Press, Oxford. Potemra, J. T., Luther, M. E., O'Brien, J. J., 1991. The seasonal circulation of the upper ocean...

  6. Untitled

    Indian Academy of Sciences (India)

    ... (London: Pergamon Press) 4th ed., pp. 122, 147. Dolgov O V and Maksimov E G 1978JETP Lett. 241. Ghatak A K and Thyagarajan K 1978 Contemporary optics (New York, Plenum Press) p. 10. Lee TD 1979 Coulombia University Preprint CU-TP-170. Stratton J A 1941 Electromagnetic theory (New York: McGraw-Hill) pp.

  7. Developmental regulation of silk protein P25 in the silkworm ...

    Indian Academy of Sciences (India)

    tribpo

    anti-P25 sera were raised in rabbit and mice. The relative ... of B. mori. Couble et al (1983) identified a new mRNA species in the posterior ... quantitative changes in P25 protein level during development in B. mori. 2 . ..... physiology biochemistry and pharmacology (eds) G A Kerkut and L I Gilbert (New York: Pergamon.

  8. Untitled

    Indian Academy of Sciences (India)

    4P Semiconductor in applied solid state science, (ed.) R. Wolfe 4. Molecular beam epitaxy (ed) BR Pamplin (Pergamon) pp. 49-94. Kasai 1970 PhD Thesis. California University, Los Angeles. Puskeppel A and Harsdorff M 1976 Thi Solid Films 3599. Santhanam S 1982 PhD Thesis, Dept. of PhyS., IIT, Kharagpur, India.

  9. Fermi Transport

    Indian Academy of Sciences (India)

    IAS Admin

    interests are in coding theory, error-correction in networks and wireless communication.“ ... 2 L D Landau and E M Lifshitz, Electrodynamics of Continuous Media, Pergamon Press, 1960. Box 1. Continued ... In fact the mass shell of a relativistic.

  10. Distributional characteristics of surface-layer mesozooplankton in the Bay of Bengal during the 2005 winter monsoon.

    Digital Repository Service at National Institute of Oceanography (India)

    Fernandes, V.; Ramaiah, N.

    . Z., National Institute of Oceanography, Goa. (1976) pp. 21-27. 50 Raymont, J. E. C., Plankton and productivity in the oceans 2nd edition, Volume 2- Zooplankton, Pergamon Press, (1983) 1-824 pp. 51 Lavaniegos, B. E., Jiménez-Pérez, L. C...

  11. HO€VET-WEIPOEIER (a) VERTEERBAARHEID IN ...

    African Journals Online (AJOL)

    In die praktyk word aanbeveel dat weipoeier nie teen hoer peile as 20/, in melkvervangers ingesluit moet ... varieer het. Hierdie HVW is 'n relatief lae koste produk wat teen gemiddelde groeiresultate gunstige koste bespa- ..... International encyclopedia of food and nutrition. Oxford Pergamon Pres ,17 , (2\\ 645. STOBO, lJ.

  12. Fulltext PDF

    Indian Academy of Sciences (India)

    Organic Chemistry: The Name Game -. Modem Coined Terms and their Origins. Alex NiCkon and E F Silversmith,. Pergamon Press, New York, 1987. It is perhaps time to disclose an important classified information. Many of the questions in the Chemistry quizzes conducted by me as well as by my colleagues during the last ...

  13. Fulltext PDF

    Indian Academy of Sciences (India)

    Macmillan International Edition. Pergamon Press. Oxford, 1989. Which Direction Does the Frictional Force Act? Consider a bicycle moving from the West to East. What is the frictional force acting on each wheel, when a) The cycle is being pedalled? and b) When it is moving freely (without being pedalled)?. In the August 96 ...

  14. 77 FR 57077 - Privacy Act of 1974; System of Records

    Science.gov (United States)

    2012-09-17

    ...) pursuant to paragraph 4c of Appendix I to OMB Circular No. A-130, ``Federal Agency Responsibilities for... System: Civilian employees, contractors and military assignees who are the subject of an inquiry based on... PII and who request guidance on the collection of PII. Civilian employees, contractor, military...

  15. 78 FR 73535 - Privacy Act System of Records

    Science.gov (United States)

    2013-12-06

    ... Lifeline Program system of records covers the PII that the Eligible Telecommunications Carriers (ETCs) must... PII that enables USAC to recertify the eligibility of current Lifeline Program subscribers of ETCs who... verification service not in the control of USAC or the Commission; 2. The information that ETCs that elect to...

  16. Comparison of H+ and He+ plasmapause locations based on the resurrected and reevaluated OGO-5 ion composition data base

    Czech Academy of Sciences Publication Activity Database

    Truhlík, Vladimír; Třísková, Ludmila; Benson, R. F.; Bilitza, D.; Grebowsky, J.; Richards, P. G.

    2014-01-01

    Roč. 119, NOV (2014), s. 27-34 ISSN 1364-6826 R&D Projects: GA MŠk(CZ) LH11123 Institutional support: RVO:68378289 Keywords : plasmasphere * plasmapause * FLIP * empirical model * OGO-5 Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 1.474, year: 2014 http://www.sciencedirect.com/science/ article /pii/S1364682614001321#

  17. Non-meagre subgroups of reals disjoint with meagre sets

    Czech Academy of Sciences Publication Activity Database

    Kostana, Ziemowit

    2018-01-01

    Roč. 241, June (2018), s. 11-19 ISSN 0166-8641 Institutional support: RVO:67985840 Keywords : algebraic sum * Baire property * non-meaurable subgroup Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.377, year: 2016 https://www.sciencedirect.com/science/ article /pii/S0166864118300567

  18. Noncommutative Cantor–Bendixson derivatives and scattered C⁎-algebras

    Czech Academy of Sciences Publication Activity Database

    Ghasemi, Saeed; Koszmider, P.

    2018-01-01

    Roč. 240, 15 May (2018), s. 183-209 ISSN 0166-8641 Institutional support: RVO:67985840 Keywords : C*-algebras * Cantor-Bendixson derivative * scattered locally compact spaces Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.377, year: 2016 https://www.sciencedirect.com/science/ article /pii/S0166864118301688?via%3Dihub

  19. Cognitive, personality, and social factors associated with adolescents' online personal information disclosure.

    Science.gov (United States)

    Liu, Cong; Ang, Rebecca P; Lwin, May O

    2013-08-01

    The current study aims to understand the factors that influence adolescents' disclosure of personally identifiable information (PII) on social networking sites (SNSs). A survey was conducted among 780 adolescent participants (between 13 and 18) who were Facebook users. Structural equation modeling was used for analyzing the data and obtaining an overarching model that include cognitive, personality, and social factors that influence adolescents' PII disclosure. Results showed privacy concern as the cognitive factor reduces adolescents' PII disclosure and it serves as a potential mediator for personality and social factors. Amongst personality factors, narcissism was found to directly increase PII disclosure, and social anxiety indirectly decreases PII disclosure by increasing privacy concern. Amongst social factors, active parental mediation decreases PII disclosure directly and indirectly by increasing privacy concern. Restrictive parental mediation decreases PII disclosure only indirectly by increasing privacy concern. Implications of the findings to parents, educators, and policy makers were discussed. Copyright © 2013 The Foundation for Professionals in Services for Adolescents. Published by Elsevier Ltd. All rights reserved.

  20. Ancient mythological images and their interpretation: an introduction to iconology, semiotics and image studies in classical art history

    OpenAIRE

    Lorenz, Katharina

    2016-01-01

    When we try to make sense of pictures, what do we gain when we use a particular method - and what might we be missing or even losing? Empirical experimentation on three types of mythological imagery - a Classical Greek pot, a frieze from Hellenistic Pergamon and a second-century CE Roman sarcophagus - enables Katharina Lorenz to demonstrate how theoretical approaches to images (specifically, iconology, semiotics, and image studies) impact the meanings we elicit from Greek and Roman art. A gui...

  1. On the circulation in the Bay of Bengal during northern spring inter-monsoon (March-April 1987)

    Digital Repository Service at National Institute of Oceanography (India)

    Babu, M.T.; Sarma, Y.V.B.; Murty, V.S.N.; Vethamony, P.

    ) indicated an anticyclonic circulation with a northeastward flow in the western bay duringMarch–April ( La Fond and La Fond 1968; Duing, 1970; Wyrtki, 1971). The temperature field obtained from satellite- based advanced very high resolution radiometer (AVHRR.... Pergamon. New York, pp. 451–475. Duing,W.,1970.Themonsoonregimeofcurrentsin theIndian Ocean. University Press of Hawaii, Honolulu, USA, 68pp. Eigenheer,A.,Quadfasel,D.,2000.SeasonalvariabilityoftheBay of Bengal circulation inferred from TOPEX...

  2. A Survey of Past Work on Rates of Advance in Land Combat Operations

    Science.gov (United States)

    1990-02-01

    Weather: Clear, mild, cold, snow, fog, rain, misty , fair-again objective definitions are not provided. c. Type action: Pursuit, limited objective...90-03 SIMPKIN-1984 J 1. Document: a. Title: Red Armour b. Author: Simpkin, Richard E. c. Date: 1984 d. Organiation: Pergamon Press Ltd, Oxford e...8217Mechanised advances on roads average about 35 miles,’day, advances on the best days achieving 50 miles for typical armoured division wheel/track mixes

  3. Rethinking US Security Policy for the 1980s. Proceedings of the Annual National Security Affairs Conference (7th) held 21-23 July 1980, Fort McNair, Washington, DC.

    Science.gov (United States)

    1980-01-01

    decisions of a small number of sparsely populated states that happen to possess enormous quantities of oil. Wether or not the Western nations might have...on Military R&D," The Genesis of New Weapons, edited by F. A. Long and Judith Reppy, (Elmsford, NY: Pergamon, 1980). 7. Stephen J. Lukasik, "Military...innovation is widely perceived as adequate, and a complementary tendency tu criticize many aspects of US military programs. See F. A. Long and Judith Reppy

  4. Combat Aircraft Maneuverability.

    Science.gov (United States)

    1981-12-01

    rodynamique, propulsion, rdsistance den structures, etc ... - lea m~thodes d’essaia an soufflerie, aur banca au aol, sur simulateurs. A un niveau de synthbse...Dunstan Graham, "Aircraft Dynamics and Automatic Control," Princeton University Press , Princeton, N.J., 1973. 9. Hoh, Roger H., Thomas T. Myers...discussion of the roll coupling problem" Progress in Aerospace Sciences, Vol 15, Pergamon Press , Oxford 1974 17-8 (6] R.W. KLOPPENSTEIN "Zeroes of

  5. Fuel Chemistry And Combustion Distribution Effects On Rocket Engine Combustion Stability

    Science.gov (United States)

    2015-11-19

    Press., 1953, p. 110. [64] Panchev, S., Random Fluctuations and Turbulence. Pergamon, Oxford, 1971. [65] Pedocchi, F. and Piedra -Cueva, I., Camp and...recently, Pedocchi and Piedra -Cueva [6] take into account the dilatation effect on the collision frequency function in a laminar incompressible flow. The...available in their paper. The comparisons between Smoulchowski [4], Kramer and Clark [5], Pedocchi and Piedra - Cueva [6], and current modeling for

  6. Response of benthic fauna to different pollutants: Some case studies and relevance of benthos to environmental impact assessment

    Digital Repository Service at National Institute of Oceanography (India)

    Ansari, Z.A.; Ingole, B.S.; Furtado, R.

    Franjipane (ed.) Marine pollution and waste disposal. Pergamon Press New york. pp.193-196. Christie, H. 1980. Methods for ecological monitoring: Biological interactions in a rocky sub-tidal community. Helgolande Meeresunters, 33: 367-374. Dauer, D.M. and W... be a direct consequence of the major environmental changes, including dumping of the municipal and industrial wastes. leading to extreme deterioration in the marine environment of the coastal waters of Mumbai (Anon., 1975). Shallow coastal regions...

  7. Assessing Heat-to-Heat Variations Affecting Mechanism Based Modeling of Hydrogen Environment Cracking (HEAC) in High Strength Alloys for Marine Applications: Monel K-500

    Science.gov (United States)

    2016-01-28

    allow for free rotation in compliance with K-solution boundary conditions [45]. Active crack length feedback coupled with software-controlled servo ...in press . 21. J. A. Harter: http://www.afgrow.net/downloads/pdownload.aspx, 2007. 22. W. A. Grell and P. J. Laz: Int. J. Fatigue, 2010, vol. 32, pp...Pergamon Press , Oxford Oxfordshire ; New York, 1982. 56. J. Waldman, R. P. Gangloff, and J. T. Burns: Final Report, STTR Topic No. N08-T010 (Phase

  8. FEMA Housing Assistance Renters - API

    Data.gov (United States)

    Department of Homeland Security — This dataset lists aggregated, non-PII dataset of FEMA Housing Assistance Program for House Renters The data was generated by FEMA's ECIM (Enterprise Coordination...

  9. Performance Indicators of Indoor Environmental Quality (IEQ ...

    African Journals Online (AJOL)

    Sultan

    environmental framework for the promotion of a healthy and comfortable ... (n.d.) consists of six metrics namely: Indoor air quality (IAQ) ..... Quality. Thermal quality measurement in the hospital ...... article/pii/S036013231300142X. Jensen, K.

  10. Report: Cybersecurity Act of 2015 Report - EPA’s Policies and Procedures to Protect Systems With Personally Identifiable Information

    Science.gov (United States)

    Report #16-P-0259, August 10, 2016. The EPA has 30 systems that contain sensitive PII. Safeguarding information and preventing system breaches are essential for ensuring the EPA retains the trust of the American public.

  11. Report: Cybersecurity Act of 2015 Report - CSB’s Policies and Procedures to Protect Systems With Personally Identifiable Information

    Science.gov (United States)

    Report #16-P-0254, August 1, 2016. CSB has one system that contains sensitive PII. Safeguarding such information in the possession of the government and preventing its breach is essential to ensuring CSB retains the trust of the American public.

  12. Plasma ion implantation technology for broad industrial application

    International Nuclear Information System (INIS)

    Deb, D.; Siambis, J.; Symons, R.

    1994-01-01

    The recently invented Plasma Ion Implantation (PII) process (1987) [J. R. Conrad, U.S. Patent No. 764394 (August 16, 1988)] is currently under intense industrial engineering investigation and development. A critical component of PII for broad industrial utilization is the availability of an efficient modulator system that applies the high voltage pulse to the workpiece. A modulator technology assessment and selection is carried out. The requirements of the PII process favor the selection of a hard-tube modulator. The PII process favors the application of beam switch tube technology such as the Litton L-5012 and L-5097. These Litton tubes have already been selected by LANL and utilized in their pilot engineering demonstration experiment with GM and the University of Wisconsin. The performance, physical operation, and potential enhancements of the Litton beam switch tubes L-5012 and L-5097 will be discussed in connection with the requirements of the emerging plasma ion implantation industrial modulator technology

  13. Corrigendum to “Robust error bounds for finite element approximation of reaction–diffusion problems with non-constant reaction coefficient in arbitrary space dimension” [Comput. Methods Appl. Mech. Engrg. 281 (2014) 184–199

    Czech Academy of Sciences Publication Activity Database

    Ainsworth, M.; Vejchodský, Tomáš

    2016-01-01

    Roč. 299, February (2016), s. 143 ISSN 0045-7825 Institutional support: RVO:67985921 Subject RIV: BA - General Mathematics Impact factor: 3.949, year: 2016 http://www.sciencedirect.com/science/article/pii/S0045782515003473

  14. FEMA Housing Assistance Program Data

    Data.gov (United States)

    Department of Homeland Security — This dataset contains aggregated, non-PII data generated by FEMA’s Enterprise Coordination & Information Management (ECIM) reporting team to share data on FEMA’s...

  15. FEMA Housing Assistance Owners - API

    Data.gov (United States)

    Department of Homeland Security — This dataset lists aggregated, non-PII dataset of FEMA Housing Assistance Program for House Owners The data was generated by FEMA's ECIM (Enterprise Coordination...

  16. Privacy Impact Assessment for the Integrated Grants Management System

    Science.gov (United States)

    The Integrated Management System collects contact information and other Personally Identifiable Information (PII). Learn how this data is collected, how it will be used, access to the data, the purpose of data collection, and record retention policies.

  17. Privacy Impact Assessment for the Childcare Tuition Assistance Program

    Science.gov (United States)

    This system collects contact information and other Personally Identifiable Information (PII). Learn how this data is collected, how it will be used, access to the data, the purpose of data collection, and record retention policies for this data.

  18. Privacy Impact Assessment for the Contract Payment System

    Science.gov (United States)

    The Contract Payment System collects contact information and other Personally Identifiable Information (PII). Learn how this data is collected in the system, how it will be used, access to the data, the purpose of data collection, and record retention.

  19. Privacy Impact Assessment for the Integrated Contracts Management System

    Science.gov (United States)

    The Integrated Contracts Management System collects contact information and other Personally Identifiable Information (PII). Learn how this data will be collected in the system, how it will be used, access to the data, and the purpose of data collection.

  20. Privacy Impact Assessment for the Wellness Program Medical Records

    Science.gov (United States)

    The Wellness Program Medical Records System collects contact information and other Personally Identifiable Information (PII). Learn how this data is collected, used, accessed, the purpose of data collection, and record retention policies.

  1. Miroslav Fiedler, 1926–2015

    Czech Academy of Sciences Publication Activity Database

    Rákosník, Jiří; Rozložník, Miroslav; Strakoš, Zdeněk

    2016-01-01

    Roč. 497, 15 May (2016), s. 162-166 ISSN 0024-3795 Keywords : Miroslav Fiedler * linear algebra * geometry Impact factor: 0.973, year: 2016 http://www.sciencedirect.com/science/article/pii/S0024379516001178

  2. Workers Compensation Claim Data -

    Data.gov (United States)

    Department of Transportation — This data set contains DOT employee workers compensation claim data for current and past DOT employees. Types of data include claim data consisting of PII data (SSN,...

  3. Low Temperature X-Ray Diffraction Study on CaFe2As2

    Science.gov (United States)

    Huyan, Shuyuan; Deng, Liangzi; Wu, Zheng; Zhao, Kui; Lv, Bing; Xue, Yiyu; Chu, Ching-Wu; B. Lv Collaboration; HPLT (Paul C. W. Chu) Team

    For undoped CaFe2As2 single crystals, we observed that utilizing thermal treatments could stabilize two pure tetragonal phases PI and PII. Both phases are non-superconducting, while the superconductivity with a Tc up to 25 K can be induced through proper thermal treatment. Room temperature X-ray studies suggest that the origin of superconductivity arises from the interface of the mesoscopically stacked layers of PI and PII. To further investigate, a systematic low temperature X-ray study was conducted over a series of thermal treated CaFe2As2 single crystals. From which, we observed the phase aggregation of PI and PII upon cooling, more importantly, an ordered stacking structure exists at low temperature, which closely related to superconducting volume fraction and the ratio of PI and PII. These results further support the proposal of interface-enhanced superconductivity in undoped CaFe2As2. UT Dallas

  4. Dicty_cDB: VHN529 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tltciivavyddklqpgaaaniaekladyl idnnc*isilfknk*RKIIYKIKKK--- ---FHTLKTLNKYIIYNDLASIRR*qltwcwfrisc...c*kisrlfn*qqlln*ysfqk*it*nn Translated Amino Acid sequence (All Frames) Frame A: yndlasirr*qltwcwfriscsfrcc*...lvssllsmmtnynqvllltllkn*pii* ltttvklvffskinnvk*yik*kk--- ---FHTLKTLNKYIIYNDLASIRR*qltwcwfrisc

  5. Snake Venom Metalloproteinases

    OpenAIRE

    Gâz Florea Şerban Andrei; Gâz Florea Adriana; Kelemen Hajnal; Muntean Daniela-Lucia

    2016-01-01

    As more data are generated from proteome and transcriptome analysis revealing that metalloproteinases represent most of the Viperid and Colubrid venom components authors decided to describe in a short review a classification and some of the multiple activities of snake venom metalloproteinases. SVMPs are classified in three major classes (P-I, P-II and P-III classes) based on the presence of various domain structures and according to their domain organization. Furthermore, P-II and P-III clas...

  6. Game-Theoretic Model of Incentivizing Privacy-Aware Users to Consent to Location Tracking

    OpenAIRE

    Panaousis, Emmanouil; Laszka, Aron; Pohl, Johannes; Noack, Andreas; Alpcan, Tansu

    2016-01-01

    Nowadays, mobile users have a vast number of applications and services at their disposal. Each of these might impose some privacy threats on users' "Personally Identifiable Information" (PII). Location privacy is a crucial part of PII, and as such, privacy-aware users wish to maximize it. This privacy can be, for instance, threatened by a company, which collects users' traces and shares them with third parties. To maximize their location privacy, users can decide to get offline so that the co...

  7. Link Before You Share: Managing Privacy Policies through Blockchain

    OpenAIRE

    Banerjee, Agniva; Joshi, Karuna Pande

    2017-01-01

    With the advent of numerous online content providers, utilities and applications, each with their own specific version of privacy policies and its associated overhead, it is becoming increasingly difficult for concerned users to manage and track the confidential information that they share with the providers. Users consent to providers to gather and share their Personally Identifiable Information (PII). We have developed a novel framework to automatically track details about how a users' PII ...

  8. Cybersecurity: Utilizing Fusion Centers to Protect State, Local, Tribal, and Territorial Entities Against Cyber Threats

    Science.gov (United States)

    2016-09-01

    freedom of speech to name a few. Hacktivists use several cyber-attack methods: blocking access to websites, defacing of websites, identity theft...2009), 10, https://www.whitehouse.gov/assets/documents/Cyberspace_Policy_Review_final.pdf. 7 In May 2009, during his speech on Cybersecurity...accounts and stole PII data from the organization. The #GOP leaked PII data to the public to embarrass Sony Executives in response to a film “The

  9. When is multiplication in a Banach algebra open?

    Czech Academy of Sciences Publication Activity Database

    Draga, Szymon; Kania, Tomasz

    2018-01-01

    Roč. 538, 1 February (2018), s. 149-165 ISSN 0024-3795 R&D Projects: GA ČR GF16-34860L Institutional support: RVO:67985840 Keywords : Banach algebra * open mapping * uniformly open map Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.973, year: 2016 http://www.sciencedirect.com/science/ article /pii/S0024379517305761?via%3Dihub

  10. Gradient $L^q$ theory for a class of non-diagonal nonlinear elliptic systems

    Czech Academy of Sciences Publication Activity Database

    Bulíček, M.; Kalousek, M.; Kaplický, P.; Mácha, Václav

    2018-01-01

    Roč. 171, June (2018), s. 156-169 ISSN 0362-546X R&D Projects: GA ČR GA16-03230S Institutional support: RVO:67985840 Keywords : regularity * gradient estimates * non-diagonal elliptic systems Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.192, year: 2016 https://www.sciencedirect.com/science/ article /pii/S0362546X18300385

  11. Hairy AdS black holes with a toroidal horizon in 4D Einstein-nonlinear omega-model system

    Czech Academy of Sciences Publication Activity Database

    Astorino, M.; Canfora, F.; Giacomini, A.; Ortaggio, Marcello

    2018-01-01

    Roč. 776, 10 January (2018), s. 236-241 ISSN 0370-2693 R&D Projects: GA ČR GB14-37086G Institutional support: RVO:67985840 Keywords : AdS black holes * nonlinear sigma model Subject RIV: BA - General Mathematics OBOR OECD: Applied mathematics Impact factor: 4.807, year: 2016 http://www.sciencedirect.com/science/ article /pii/S0370269317309437

  12. A remark on smooth images of Banach spaces

    Czech Academy of Sciences Publication Activity Database

    Hájek, Petr Pavel; Johanis, M.

    2018-01-01

    Roč. 458, č. 2 (2018), s. 1307-1313 ISSN 0022-247X R&D Projects: GA ČR GA16-07378S Institutional support: RVO:67985840 Keywords : smooth surjections Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.064, year: 2016 http://www.sciencedirect.com/science/ article /pii/S0022247X17309186?via%3Dihub

  13. Aerodynamic and aeroelastic characteristics of typical bridge decks equipped with wind barriers at the windward bridge-deck edge

    Czech Academy of Sciences Publication Activity Database

    Buljac, Andrija; Kozmar, H.; Pospíšil, Stanislav; Macháček, Michael

    2017-01-01

    Roč. 137, April (2017), s. 310-322 ISSN 0141-0296 R&D Projects: GA ČR(CZ) GA15-01035S; GA MŠk(CZ) LO1219 Keywords : bridge decks * roadway wind barrier * aerodynamic forces and moments * galloping * flutter * wind-tunnel experiments Subject RIV: JM - Building Engineering OBOR OECD: Construction engineering , Municipal and structural engineering Impact factor: 2.258, year: 2016 http://www.sciencedirect.com/science/ article /pii/S014102961730278X

  14. Microstructure and sliding wear properties of HVOF sprayed, laser remelted and laser clad Stellite 6 coatings

    Czech Academy of Sciences Publication Activity Database

    Houdková, Š.; Pala, Zdeněk; Smazalová, E.; Vostřák, M.; Česánek, Z.

    2017-01-01

    Roč. 318, May (2017), s. 129-141 ISSN 0257-8972. [International Meeting on Thermal Spraying (RIPT)/7./. Limoges, 09.12.2015-11.12.2015] Institutional support: RVO:61389021 Keywords : Stellite 6 * HVOF * Laser remelting * Laser clad * Wear * Phase transformation Subject RIV: JK - Corrosion ; Surface Treatment of Materials OBOR OECD: Coating and films Impact factor: 2.589, year: 2016 http://www.sciencedirect.com/science/ article /pii/S0257897216308817

  15. Experimental testing and theoretical prediction of traditional dowel-type connections in tension parallel to grain

    Czech Academy of Sciences Publication Activity Database

    Milch, J.; Tippner, J.; Brabec, M.; Sebera, V.; Kunecký, Jiří; Kloiber, Michal; Hasníková, Hana

    2017-01-01

    Roč. 152, December (2017), s. 180-187 ISSN 0141-0296 R&D Projects: GA MK(CZ) DG16P02M026 Keywords : digital image correlation * dowel-type joint * European yield model * load-carrying capacity * single-shear * stiffness Subject RIV: JN - Civil Engineering OBOR OECD: Construction engineering , Municipal and structural engineering Impact factor: 2.258, year: 2016 http://www.sciencedirect.com/science/ article /pii/S0141029616311324?via%3Dihub

  16. Coupling parallel adaptive mesh refinement with a nonoverlapping domain decomposition solver

    Czech Academy of Sciences Publication Activity Database

    Kůs, Pavel; Šístek, Jakub

    2017-01-01

    Roč. 110, August (2017), s. 34-54 ISSN 0965-9978 R&D Projects: GA ČR GA14-02067S Institutional support: RVO:67985840 Keywords : adaptive mesh refinement * parallel algorithms * domain decomposition Subject RIV: BA - General Mathematics OBOR OECD: Applied mathematics Impact factor: 3.000, year: 2016 http://www.sciencedirect.com/science/ article /pii/S0965997816305737

  17. Physics conclusions in support of ITER W divertor monoblock shaping

    Czech Academy of Sciences Publication Activity Database

    Pitts, R.A.; Bardin, S.; Bazylev, B.; van den Berg, M.A.; Bunting, P.; Carpentier-Chouchana, S.; Coenen, J.W.; Corre, Y.; Dejarnac, Renaud; Escourbiac, F.; Gaspar, J.; Gunn, J. P.; Hirai, T.; Hong, S.-H.; Horáček, Jan; Iglesias, D.; Komm, Michael; Krieger, K.; Lasnier, C.; Matthews, G.F.; Morgan, T.W.; Panayotis, S.; Pestchanyi, S.; Podolník, Aleš; Nygren, R.E.; Rudakov, D.L.; De Temmerman, G.; Vondráček, Petr; Watkins, J.G.

    2017-01-01

    Roč. 12, August (2017), s. 60-74 ISSN 2352-1791. [International Conference on Plasma Surface Interactions 2016, PSI2016 /22./. Roma, 30.05.2016-03.06.2016] Institutional support: RVO:61389021 Keywords : ITER * Tungsten * Divertor * Shaping * Melting * MEMOS Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: Fluids and plasma physics (including surface physics) http://www.sciencedirect.com/science/ article /pii/S2352179116302885

  18. Purification and characterization of the bifunctional uridylyltransferase and the signal transducing proteins GlnB and GlnK from Herbaspirillum seropedicae.

    Science.gov (United States)

    Bonatto, Ana C; Couto, Gustavo H; Souza, Emanuel M; Araújo, Luiza M; Pedrosa, Fabio O; Noindorf, Lilian; Benelli, Elaine M

    2007-10-01

    GlnD is a bifunctional uridylyltransferase/uridylyl-removing enzyme that has a central role in the general nitrogen regulatory system NTR. In enterobacteria, GlnD uridylylates the PII proteins GlnB and GlnK under low levels of fixed nitrogen or ammonium. Under high ammonium levels, GlnD removes UMP from these proteins (deuridylylation). The PII proteins are signal transduction elements that integrate the signals of nitrogen, carbon and energy, and transduce this information to proteins involved in nitrogen metabolism. In Herbaspirillum seropedicae, an endophytic diazotroph isolated from grasses, several genes coding for proteins involved in nitrogen metabolism have been identified and cloned, including glnB, glnK and glnD. In this work, the GlnB, GlnK and GlnD proteins of H. seropedicae were overexpressed in their native forms, purified and used to reconstitute the uridylylation system in vitro. The results show that H. seropedicae GlnD uridylylates GlnB and GlnK trimers producing the forms PII (UMP)(1), PII (UMP)(2) and PII (UMP)(3), in a reaction that requires 2-oxoglutarate and ATP, and is inhibited by glutamine. The quantification of these PII forms indicates that GlnB was more efficiently uridylylated than GlnK in the system used.

  19. Mechanism of photodynamic inactivation of hepatocarcinoma cells with sulfonated aluminum phthalocyanine

    Science.gov (United States)

    Yu, Hong-Yu; Dong, Rong-Chun; Chen, Ji-Yao; Cai, Huai-Xin

    1993-03-01

    The mechanism of photodynamic therapy (PDT) with sulfonated aluminum phthalocyanine (AlSPC) studied with the human hepatocellular carcinoma cell line in culture is reported herein. Photofrin II (PII) was chosen as the control photosensitizer of AlSPC. Deuterium oxide (D2O), an enhancer of singlet oxygen (1O2); 1,3-diphenylisobenzofuran (DPBF), a quencher of 1O2: glycerol, a quencher of OH radical (OH(DOT)); superoxide dismutase (SOD), a quencher of O2- radical (O2-(DOT)); diethyldithiocarbamate (DDC), an inhibitor of SOD and glutathione peroxidase; were introduced into both the processes of photodynamic inactivation of human liver cancer cells in culture with AlSPC (AlSPC-PDT) and with PII (PII-PDT). The results suggest that: 1O2 is dominantly involved in both PII-PDT and AlSPC-PDT; O2-(DOT) is involved in AlSPC-PDT in a lower degree than 1O2, while almost not involved in PII-PDT; OH(DOT) is involved in PII-PDT in a lower degree than 1O2, while almost not involved in AlSPC-PDT.

  20. Uridylylation of Herbaspirillum seropedicae GlnB and GlnK proteins is differentially affected by ATP, ADP and 2-oxoglutarate in vitro.

    Science.gov (United States)

    Bonatto, Ana C; Souza, Emanuel M; Oliveira, Marco A S; Monteiro, Rose A; Chubatsu, Leda S; Huergo, Luciano F; Pedrosa, Fábio O

    2012-08-01

    PII are signal-transducing proteins that integrate metabolic signals and transmit this information to a large number of proteins. In proteobacteria, PII are modified by GlnD (uridylyltransferase/uridylyl-removing enzyme) in response to the nitrogen status. The uridylylation/deuridylylation cycle of PII is also regulated by carbon and energy signals such as ATP, ADP and 2-oxoglutarate (2-OG). These molecules bind to PII proteins and alter their tridimensional structure/conformation and activity. In this work, we determined the effects of ATP, ADP and 2-OG levels on the in vitro uridylylation of Herbaspirillum seropedicae PII proteins, GlnB and GlnK. Both proteins were uridylylated by GlnD in the presence of ATP or ADP, although the uridylylation levels were higher in the presence of ATP and under high 2-OG levels. Under excess of 2-OG, the GlnB uridylylation level was higher in the presence of ATP than with ADP, while GlnK uridylylation was similar with ATP or ADP. Moreover, in the presence of ADP/ATP molar ratios varying from 10/1 to 1/10, GlnB uridylylation level decreased as ADP concentration increased, whereas GlnK uridylylation remained constant. The results suggest that uridylylation of both GlnB and GlnK responds to 2-OG levels, but only GlnB responds effectively to variation on ADP/ATP ratio.

  1. Late Byzantine mineral soda high alumina glasses from Asia Minor: a new primary glass production group.

    Directory of Open Access Journals (Sweden)

    Nadine Schibille

    Full Text Available The chemical characterisation of archaeological glass allows the discrimination between different glass groups and the identification of raw materials and technological traditions of their production. Several lines of evidence point towards the large-scale production of first millennium CE glass in a limited number of glass making factories from a mixture of Egyptian mineral soda and a locally available silica source. Fundamental changes in the manufacturing processes occurred from the eight/ninth century CE onwards, when Egyptian mineral soda was gradually replaced by soda-rich plant ash in Egypt as well as the Islamic Middle East. In order to elucidate the supply and consumption of glass during this transitional period, 31 glass samples from the assemblage found at Pergamon (Turkey that date to the fourth to fourteenth centuries CE were analysed by electron microprobe analysis (EPMA and by laser ablation-inductively coupled plasma-mass spectrometry (LA-ICP-MS. The statistical evaluation of the data revealed that the Byzantine glasses from Pergamon represent at least three different glass production technologies, one of which had not previously been recognised in the glass making traditions of the Mediterranean. While the chemical characteristics of the late antique and early medieval fragments confirm the current model of glass production and distribution at the time, the elemental make-up of the majority of the eighth- to fourteenth-century glasses from Pergamon indicate the existence of a late Byzantine glass type that is characterised by high alumina levels. Judging from the trace element patterns and elevated boron and lithium concentrations, these glasses were produced with a mineral soda different to the Egyptian natron from the Wadi Natrun, suggesting a possible regional Byzantine primary glass production in Asia Minor.

  2. Surface science techniques

    CERN Document Server

    Walls, JM

    2013-01-01

    This volume provides a comprehensive and up to the minute review of the techniques used to determine the nature and composition of surfaces. Originally published as a special issue of the Pergamon journal Vacuum, it comprises a carefully edited collection of chapters written by specialists in each of the techniques and includes coverage of the electron and ion spectroscopies, as well as the atom-imaging methods such as the atom probe field ion microscope and the scanning tunnelling microscope. Surface science is an important area of study since the outermost surface layers play a crucial role

  3. Prediction of the Unified Parkinson's Disease Rating Scale assessment using a genetic programming system with geometric semantic genetic operators

    OpenAIRE

    Castelli, Mauro; Vanneschi, Leonardo; Silva, Sara

    2014-01-01

    This work was supported by national funds through FCT under contract PEst-OE/EEI/LA0021/2013 and by projects MassGP (PTDC/EEI-CTP/2975/2012), EnviGP (PTDC/EIA-CCO/103363/2008) and InteleGen (PTDC/DTP-FTO/1747/2012), Portugal. Pergamon-elsevier science ltd Oxford Unified Parkinson's Disease Rating Scale (UPDRS) assessment is the most used scale for tracking Parkinson's disease symptom progression. Nowadays, the tracking process requires a patient to undergo invasive and time-consuming speci...

  4. Data analysis methods in physical oceanography. By Emery, W.J. and Thomson, R.E.

    Digital Repository Service at National Institute of Oceanography (India)

    Nayak, M.R.

    . 729-730 September 1999 Book Reviews DATA ANALYSIS METHODS IN PHYSICAL O~EAN~GRAFWY. By Wil- liam J. Emery and Richard E. Thomson. PERGAMON Else&r Sci- ence. 1998. 400 p. U.S. $112 / NLG 177.00. The book Data Analysis Methods in Physical... Oceanography pro- vides a comprehensive and practical compilation of the essential information and analysis techniques required for the advanced processing and interpretation of digital spat&temporal data in physical oceanography, as well as in other...

  5. Data analysis methods in physical oceanography. By Emery, W.J. and Thomson, R.E.

    Digital Repository Service at National Institute of Oceanography (India)

    Nayak, M.R.

    in Physical Oceanography. Page 1 of 1 file://C:\\My Documents\\articles30.htm 2/11/05 William J. Emery and Richard E. Thomson. Pergamon Elsevier Science. 1998. hardbound. 400 pp. ISBN: 0-08-031434-1. Price: US$ 112/NLG 177.00 This book provides a comprehensive... and practical compilation of the essential information and analysis techniques required for the advanced processing and interpretation of digital spatio-temporal data in physical oceanography, as well as in other branches of the geophysical sciences. The book...

  6. State of oil pollution in the northern Arabian Sea after the 1991 Gulf oil spill

    Digital Repository Service at National Institute of Oceanography (India)

    Sengupta, R.; Fondekar, S.P.; Alagarsamy, R.

    stream_size 30182 stream_content_type text/plain stream_name Mar_Pollut_Bull_27_85.pdf.txt stream_source_info Mar_Pollut_Bull_27_85.pdf.txt Content-Encoding UTF-8 Content-Type text/plain; charset=UTF-8 Marine Pollution... Bulletin, Volume 27, pp. 85-91, 1993. 0025-326X/93 $6.00+0.00 Printed in Great Britain. O 1993 Pergamon Press Ltd State of Oil Pollution in the Northern Arabian Sea after the 1991 Gulf Oil Spill R. SEN GUPTA, S. P. FONDEKAR and R. ALAGARSAMY National...

  7. Contractors Meeting on Combustion Rocket Propulsion Diagnostics of Reacting Flow Held in Monrovia, California on 13-17 June 1988

    Science.gov (United States)

    1988-06-13

    A + Sx) 2(x) BI must be negative definite for x e (0,,) (7) If these conditions are not met, i.e., homogeneous system is not stable a control action ...Pergamon Press, 19F5 10 Y. Takubo, T. Okamoto, and M. Yamamoto, -. , p1. Opt. 25, 740 (1986). I 162 F𔃺C LOW ©,,_~d DAca Op LOIe (n DS"I 0 6.1 12.2 0...to atomic free radicals. This part of the project will also be described below. The topic of modeling will be deferred to a later time. A schematic

  8. Recent Naval Postgraduate School Publications.

    Science.gov (United States)

    1984-06-01

    U.S. Army Training & Doctrine Ccmmand, Fort Monroe, Va. Naval Postgraduate School, (NPS-55-80-023), June, 1980. 42 p. Hartman, J K Grcund movement ... movement Elmsford, N.Y., Pergamon, 1980. 300 p. Amos, J W Deception and the Middle East war IN D. C. Daniel and K. L. Herbig, eds.: Strategic military...Service, (NOAA), i6 p., (1980). * Moose, P B The qradient maqnetC- telluric method at the sea floor IEE Trans. Geoscience and Remote Sensing, vol. 19, no. 1

  9. Lithogenic fluxes to the deep Arabian Sea measurEd. by sediment traps

    Digital Repository Service at National Institute of Oceanography (India)

    Ramaswamy, V.; Nair, R.R; Manganini, S.J.; Haake, B.; Ittekkot, V.

    . 38. No. 2. pp 1~g-\\[~44 It,lqt. fllC~g...4)i49tql $31~) 4- 0.till Pnnted m Great Britain. ~ lg~t Pergamon Press pie Lithogenic fluxes to the deep Arabian Sea measured by sediment traps V. RAMASWAMY,* R. R. NAIR,* S. MANGANINI,# B. HAAKE~. and V... (MIct, lrdAN et al., 1984). Most of the present suspended sediment discharge is in July and August, during the peak of the southwest monsoon period, with negligible discharge during other times (I'rrEKKO'r and ARAIN, 1986). The Narmada and Tapti...

  10. Role of eddies in the Bay of Bengal circulation and hydrography and in the distribution of nutrients and chlorophyll

    Digital Repository Service at National Institute of Oceanography (India)

    Murukesh, N.

    ’ Brien, T.P. Boyer, C. Stephens, J.I. Antonov, (2002), World Ocean Atlas 2001: Objective Analysis, Data statistics and Figures, CD-ROM documentation, National Oceanographic Data center, Silver Spring, MD, 17pp. Cushman-Roisin, B., E. P. Chassignet...-542. Pedlosky, J., (1979),Geophysical Fluid Dynamics, Springer-Verlag., 624pp. Pond, S., G.L. Pickard, (1978), Introductory dynamic oceanography, Pergamon Press, Oxford, UK., 241pp. Potemra, J.T., M.E. Luther, J.J. O'brien, (1991),The seasonal circulation...

  11. Life cycle of eddies along the western boundary of the Bay of Bengal and their implications

    Digital Repository Service at National Institute of Oceanography (India)

    Nuncio, M.; PrasannaKumar, S.

    ., Antonov, J.I., 2002. World Ocean Atlas 2001: Objective Analysis, Data statistics and Figures, CD-ROM documentation, National Oceanographic Data center, Silver Spring, MD, 17pp Gopalan, A.K.S., GopalaKrishna, V.V. , Ali, M.M., Sharma, R., 2000.... Sci. 22, 12-16. Pond, S., G.L. Pickard, 1978. Introductory dynamic oceanography, Pergamon Press, Oxford, UK., 241pp. Potemra, J.T., M.E. Luther, J.J. O'brien, 1991. The seasonal circulation of the upper ocean in the Bay of Bengal, J...

  12. Mechanical similarity as a generalization of scale symmetry

    International Nuclear Information System (INIS)

    Gozzi, E; Mauro, D

    2006-01-01

    In this paper, we study the symmetry known (Landau and Lifshits 1976 Course of Theoretical Physics vol 1: Mechanics (Oxford: Pergamon)) as mechanical similarity (LMS) and present for any monomial potential. We analyse it in the framework of the Koopman-von Neumann formulation of classical mechanics and prove that in this framework the LMS can be given a canonical implementation. We also show that the LMS is a generalization of the scale symmetry which is present only for the inverse square and a few other potentials. Finally, we study the main obstructions which one encounters in implementing the LMS at the quantum-mechanical level

  13. The chemistry of silicon

    CERN Document Server

    Rochow, E G; Emeléus, H J; Nyholm, Ronald

    1975-01-01

    Pergamon Texts in Organic Chemistry, Volume 9: The Chemistry of Silicon presents information essential in understanding the chemical properties of silicon. The book first covers the fundamental aspects of silicon, such as its nuclear, physical, and chemical properties. The text also details the history of silicon, its occurrence and distribution, and applications. Next, the selection enumerates the compounds and complexes of silicon, along with organosilicon compounds. The text will be of great interest to chemists and chemical engineers. Other researchers working on research study involving s

  14. Radiation and Your Patient: A Guide for Medical Practitioners

    International Nuclear Information System (INIS)

    Cosset, J.M.; Liniecki, J.; Ortiz-Lopez, P.; Ringertz, H.; Sharp, C.; Mettler, F.A. Jr.; Harding, L.K.; Nakamura, H.; Rehani, M.M.; Sasaki, Y.; Ussov, W.Y.; Guiberteau, M.J.; Hiraoka, M.; Vafio, E.; Gusev, L.A.; Pinillos-Ashton, L.V.; Rosenstein, M.; Yin, W.; Mattsson, S.; Cousins, C.

    2004-01-01

    The medical exposures are the first cause of irradiation of populations. The benefit/risk ratio must be taken into consideration. Progress margin exists to reduce the radiation doses delivered to patients. The British people have noticed a reduction of 30% in the doses received by the patients during the last years. A better radiation protection needs a better dialogue between physicians and patients. This is the object of this ICRP guide which is a French translation of the original title 'Supporting guidance 2. Radiation and Your Patient: A Guide for Medical Practitioners', published by Pergamon (2002)

  15. Proceedings of the International Congress (12th), Corrosion Control for Low-Cost Reliability, Held in Houston, Texas on September 19-24, 1993. Volume 5B. Corrosion: General Issues

    Science.gov (United States)

    1993-09-24

    1992, (in press). I I. M . Pourbaix. L. Klimzack-Mathieu, C. Martens, J. Meunier, C. Vanlengenhaghe, L.D. Munch, J. Laureys , L. Nellmans. and M ...hydrogen assisted plasticity9 . For the 60 wppm H material, the KISLC threshold in air is measured to be about 58 MPa’/ m , as indicated in Fig. 5b. Thus...Manager. References 1. M.O. Speidel, Corrosion Fatigue of Steam Turbine Blade M .,aerials, (New York, NY: Pergamon, 1983), p. 1. 2. T.W. Crooker, J.A

  16. The ATLAS positive ion injector

    International Nuclear Information System (INIS)

    Shepard, K.W.; Bollinger, L.M.; Pardo, R.C.

    1990-01-01

    This paper reviews the design, construction status, and beam tests to date of the positive ion injector (PII) which is replacing the tandem injector for the ATLAS heavy-ion facility. PII consists of an ECR ion source on a 350 KV platform injecting a very low velocity superconducting linac. The linac is composed of an independently-phased array of superconducting four-gap interdigital resonators which accelerate over a velocity range of .006 to .05c. In finished form, PII will be able to inject ions as heavy as uranium into the existing ATLAS linac. Although at the present time little more than 50% of the linac is operational, the indenpently-phased array is sufficiently flexible that ions in the lower half of the periodic table can be accelerated and injected into ATLAS. Results of recent operational experience will be discussed. 5 refs

  17. Mechanisms driving variability in the ocean forcing of Pine Island Glacier.

    Science.gov (United States)

    Webber, Benjamin G M; Heywood, Karen J; Stevens, David P; Dutrieux, Pierre; Abrahamsen, E Povl; Jenkins, Adrian; Jacobs, Stanley S; Ha, Ho Kyung; Lee, Sang Hoon; Kim, Tae Wan

    2017-02-17

    Pine Island Glacier (PIG) terminates in a rapidly melting ice shelf, and ocean circulation and temperature are implicated in the retreat and growing contribution to sea level rise of PIG and nearby glaciers. However, the variability of the ocean forcing of PIG has been poorly constrained due to a lack of multi-year observations. Here we show, using a unique record close to the Pine Island Ice Shelf (PIIS), that there is considerable oceanic variability at seasonal and interannual timescales, including a pronounced cold period from October 2011 to May 2013. This variability can be largely explained by two processes: cumulative ocean surface heat fluxes and sea ice formation close to PIIS; and interannual reversals in ocean currents and associated heat transport within Pine Island Bay, driven by a combination of local and remote forcing. Local atmospheric forcing therefore plays an important role in driving oceanic variability close to PIIS.

  18. The ATLAS positive ion injector

    Energy Technology Data Exchange (ETDEWEB)

    Shepard, K.W.; Bollinger, L.M.; Pardo, R.C.

    1990-01-01

    This paper reviews the design, construction status, and beam tests to date of the positive ion injector (PII) which is replacing the tandem injector for the ATLAS heavy-ion facility. PII consists of an ECR ion source on a 350 KV platform injecting a very low velocity superconducting linac. The linac is composed of an independently-phased array of superconducting four-gap interdigital resonators which accelerate over a velocity range of .006 to .05c. In finished form, PII will be able to inject ions as heavy as uranium into the existing ATLAS linac. Although at the present time little more than 50% of the linac is operational, the indenpently-phased array is sufficiently flexible that ions in the lower half of the periodic table can be accelerated and injected into ATLAS. Results of recent operational experience will be discussed. 5 refs.

  19. Mapping of residues of fibrinogen cleaved by protease II of Bacillus thuringiensis var. israelensis IMV B-7465

    Directory of Open Access Journals (Sweden)

    E. M. Stohniy

    2016-04-01

    Full Text Available The limited proteolysis of macromolecules allows obtaining the fragments that preserve the structure and functional properties of the whole molecule and could be used in the study of proteins structure and function. Proteases targeted to fibrinogen and fibrin are of interest as the tool for obtaining of functionally active fragments of fibrin(ogen and for the direct defibrination in vivo. That is why the aim of the present work was to study the proteolytic action of Protease II (PII purified from Bacillus thuringiensis var. israelensis IMV B-7465 on fibrinogen. Hydrolysis products of fibrinogen by PII were analysed by SDS-PAGE under reducing conditions with further immunoprobing using the mouse monoclonal 1-5A (anti-Aα509-610 and ІІ-5С (anti-Aα20-78 antibodies. It was shown that PII cleaved preferentially the Aα-chain of fibrinogen splitting off the peptide with apparent molecular weight of 10 kDa that corresponded the C-terminal part of Aα-chain of fibrinogen molecule. MALDI-TOF analysis of hydrolysis of fibrinogen was performed using a Voyager-DE. Results analyzed by Data Explorer 4.0.0.0 allowed to detect the main peak occurring at mass/charge (M/Z ratio of 11 441 Da. According to “Peptide Mass Calculator” this peptide corresponded to fragment Аα505-610 of fibrinogen molecule. The result showed that PII cleaves the peptide bond AαAsp-Thr-Ala504-Ser505. Thus, PII can be used for the obtaining of unique fragments of fibrinogen molecule. As far as αC-domain contains numerous sites of fibrin intermolecular interactions we can consider PII as a prospective agent for their study and for the defibrination.

  20. Have a little faith: measuring the impact of illness on positive and negative aspects of faith.

    Science.gov (United States)

    Salsman, John M; Garcia, Sofia F; Lai, Jin-Shei; Cella, David

    2012-12-01

    The importance of faith and its associations with health are well documented. As part of the Patient Reported Outcomes Measurement Information System, items tapping positive and negative impact of illness (PII and NII) were developed across four content domains: Coping/Stress Response, Self-Concept, Social Connection/Isolation, and Meaning and Spirituality. Faith items were included within the concept of meaning and spirituality. This measurement model was tested on a heterogeneous group of 509 cancer survivors. To evaluate dimensionality, we applied two bi-factor models, specifying a general factor (PII or NII) and four local factors: Coping/Stress Response, Self-Concept, Social Connection/Isolation, and Meaning and Spirituality. Bi-factor analysis supported sufficient unidimensionality within PII and NII item sets. The unidimensionality of both PII and NII item sets was enhanced by extraction of the faith items from the rest of the questions. Of the 10 faith items, nine demonstrated higher local than general factor loadings (range for local factor loadings = 0.402 to 0.876), suggesting utility as a separate but related 'faith' factor. The same was true for only two of the remaining 63 items across the PII and NII item sets. Although conceptually and to a degree empirically related to Meaning and Spirituality, Faith appears to be a distinct subdomain of PII and NII, better handled by distinct assessment. A 10-item measure of the impact of illness upon faith (II-Faith) was therefore assembled. Copyright © 2011 John Wiley & Sons, Ltd.

  1. Suppression of charged particle production at large transverse momentum in central Pb--Pb collisions at root s(NN) = 2.76 TeV

    Czech Academy of Sciences Publication Activity Database

    Aamodt, K.; Quintana, A.A.; Adamová, Dagmar; Bielčík, J.; Bielčíková, Jana; Kushpil, Svetlana; Kushpil, Vasilij; Mareš, Jiří A.; Polák, Karel; Šumbera, Michal; Tlustý, D.; Wagner, V.; Závada, Petr

    2011-01-01

    Roč. 696, 1-2 (2011), s. 30-39 ISSN 0370-2693 R&D Projects: GA MŠk LA08015 Institutional research plan: CEZ:AV0Z10100502; CEZ:AV0Z10480505 Keywords : quark-gluon plasma * saturation * LHC Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 3.955, year: 2011 http://www. science direct.com/ science ?_ob=MImg&_imagekey=B6TVN-51PH19C-1-F&_cdi=5539&_user=625012&_pii=S0370269310013973&_origin= search &_coverDate=01%2

  2. Reduction of stimulated Brillouin backscattering with plasma beam smoothing

    Energy Technology Data Exchange (ETDEWEB)

    Yahia, V.; Loisel, G.; Baccou, C.; Labaune, C. [Laboratoire pour l' Utilisation des Lasers Intenses, Ecole Polytechnique, Palaiseau (France); Masson-Laborde, P.-E.; Depierreux, S.; Goyon, C.; Teychenné, D. [CEA, DAM, DIF, F-91297 Arpajon (France); Borisenko, N. G.; Orekhov, A. [P.N. Lebedev Physical Institute, Russian Academy of Science, Moscow (Russian Federation); Rienecker, T.; Rosmej, O. [GSI Helmhotzzentrum fur Schwerionenforschung, 64291 Darmstadt (Germany)

    2015-04-15

    Plasma induced incoherence (PII) can strongly modify the growth rates of stimulated scattering instabilities. A special double-target design was used to quantify the effect of PII on stimulated Brillouin scattering (SBS). Successive shots using all or part of these targets led to the characterization of temporal and spatial incoherence of a laser pulse after propagation through a foam plasma and to the quantification of the reduction of SBS from the second target. Numerical simulations were used to identify the main physical mechanisms in play.

  3. Simulation of the turbine discharge transient with the code Trace; Simulacion del transitorio disparo de turbina con el codigo TRACE

    Energy Technology Data Exchange (ETDEWEB)

    Mejia S, D. M.; Filio L, C., E-mail: dulcemaria.mejia@cnsns.gob.mx [Comision Nacional de Seguridad Nuclear y Salvaguardias, Dr. Jose Ma. Barragan No. 779, Col. Narvarte, 03020 Mexico D. F. (Mexico)

    2014-10-15

    In this paper the results of the simulation of the turbine discharge transient are shown, occurred in Unit 1 of nuclear power plant of Laguna Verde (NPP-L V), carried out with the model of this unit for the best estimate code Trace. The results obtained by the code Trace are compared with those obtained from the Process Information Integral System (PIIS) of the NPP-L V. The reactor pressure, level behavior in the down-comer, steam flow and flow rate through the recirculation circuits are compared. The results of the simulation for the operation power of 2027 MWt, show concordance with the system PIIS. (Author)

  4. Revitalization of Nuclear Powered Flight

    Science.gov (United States)

    2016-05-01

    science/ article /pii/S0376042110000497. Hedges, John, host. “Nuclear Airplane (Season 1, Episode 4).” In Planes That Never Flew. Discovery Channel...sensors and weapons the mission requires. Machines for the USAF come in the form of airplanes , which cannot get to the fight without tanker support or...Information Retrieval System. “Cost and Funding for KC-46 A from SAR Dec 2014.” 6 Hedges, John, host. “Nuclear Airplane (Season 1, Episode 4).” 7

  5. Flutter and galloping of cable-supported bridges with porous wind barriers

    Czech Academy of Sciences Publication Activity Database

    Buljac, A.; Kozmar, H.; Pospíšil, S.; Macháček, Michael

    2017-01-01

    Roč. 171, December (2017), s. 304-318 ISSN 0167-6105 R&D Projects: GA ČR(CZ) GA15-01035S; GA MŠk(CZ) LO1219 Keywords : cable-supported bridges * porous wind barriers * aerodynamic forces and moments * flutter * galloping * wind-tunnel experiments Subject RIV: JM - Building Engineering OBOR OECD: Construction engineering , Municipal and structural engineering Impact factor: 2.049, year: 2016 http://www.sciencedirect.com/science/ article /pii/S016761051730435X

  6. Theoretical background and implementation of the finite element method for multi-dimensional Fokker-Planck equation analysis

    Czech Academy of Sciences Publication Activity Database

    Král, Radomil; Náprstek, Jiří

    2017-01-01

    Roč. 113, November (2017), s. 54-75 ISSN 0965-9978 R&D Projects: GA ČR(CZ) GP14-34467P; GA ČR(CZ) GA15-01035S Institutional support: RVO:68378297 Keywords : Fokker-Planck equation * finite element method * simplex element * multi-dimensional problem * non-symmetric operator Subject RIV: JM - Building Engineering OBOR OECD: Mechanical engineering Impact factor: 3.000, year: 2016 https://www.sciencedirect.com/science/ article /pii/S0965997817301904

  7. Simulation of the turbine discharge transient with the code Trace

    International Nuclear Information System (INIS)

    Mejia S, D. M.; Filio L, C.

    2014-10-01

    In this paper the results of the simulation of the turbine discharge transient are shown, occurred in Unit 1 of nuclear power plant of Laguna Verde (NPP-L V), carried out with the model of this unit for the best estimate code Trace. The results obtained by the code Trace are compared with those obtained from the Process Information Integral System (PIIS) of the NPP-L V. The reactor pressure, level behavior in the down-comer, steam flow and flow rate through the recirculation circuits are compared. The results of the simulation for the operation power of 2027 MWt, show concordance with the system PIIS. (Author)

  8. The role of biotic interactions in plant community assembly: What is the community species pool?

    Czech Academy of Sciences Publication Activity Database

    Švamberková, E.; Vítová, A.; Lepš, Jan

    2017-01-01

    Roč. 85, NOV 01 (2017), s. 150-156 ISSN 1146-609X Institutional support: RVO:60077344 Keywords : abiotic filter * biotic filter * competitive exclusion Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.652, year: 2016 http://www.sciencedirect.com/science/article/pii/S1146609X16303757

  9. Polarity of wurtzite crystals by photoelectron diffraction

    Czech Academy of Sciences Publication Activity Database

    Bartoš, Igor; Romanyuk, Olexandr

    2014-01-01

    Roč. 315, OCT (2014), s. 506-509 ISSN 0169-4332 Grant - others:AVČR(CZ) M100101201 Institutional support: RVO:68378271 Keywords : wurtzite semiconductors * surface polarity * X-ray photoelectron diffraction * XPD Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.711, year: 2014 http://www.sciencedirect.com/science/article/pii/S016943321400066X

  10. Thermoelectric properties of Ni – doped CuInTe2

    Czech Academy of Sciences Publication Activity Database

    Kucek, V.; Drašar, Č.; Navrátil, Jiří; Plecháček, T.; Beneš, L.

    2015-01-01

    Roč. 83, August (2015), s. 18-23 ISSN 0022-3697 Institutional support: RVO:61389013 Keywords : semiconductors * chalcogenides * X-ray diffraction Subject RIV: CA - Inorganic Chemistry Impact factor: 2.048, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022369715000670

  11. Why is the number of days required for induction of adult diapause in the linden bug Pyrrhocoris apterus fewer in the larval than in the adult stage?

    Czech Academy of Sciences Publication Activity Database

    Hodková, Magdalena

    2015-01-01

    Roč. 77, JUN 01 (2015), s. 39-44 ISSN 0022-1910 R&D Projects: GA ČR GAP502/10/1612 Institutional support: RVO:60077344 Keywords : diapause * reproduction * diapuase information Subject RIV: ED - Physiology Impact factor: 2.267, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022191015000797

  12. Application of compact finite-difference schemes to simulations of stably stratified fluid flows

    Czech Academy of Sciences Publication Activity Database

    Bodnár, Tomáš; Beneš, L.; Fraunie, P.; Kozel, Karel

    2012-01-01

    Roč. 219, č. 7 (2012), s. 3336-3353 ISSN 0096-3003 Institutional support: RVO:61388998 Keywords : stratification * finite- difference * finite-volume * Runge-Kutta Subject RIV: BA - General Mathematics Impact factor: 1.349, year: 2012 http://www.sciencedirect.com/science/article/pii/S0096300311010988

  13. Mitochondrial DNA provides evidence of a double origin for the stone crayfish Austropotamobius torrentium in the Elbe basin

    Czech Academy of Sciences Publication Activity Database

    Petrusek, A.; Pešek, P.; Leština, Dan; Martin, P.; Fischer, D.; Kozák, P.; Vlach, P.

    2017-01-01

    Roč. 62, JAN 01 (2017), s. 77-83 ISSN 0075-9511 Institutional support: RVO:60077344 Keywords : stone crayfish * Austropotamobius torrentium * Elbe basin Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Genetics and heredity (medical genetics to be 3) Impact factor: 1.427, year: 2016 https://www.sciencedirect.com/science/article/pii/S0075951116300901

  14. Relative importance of pasture size and grazing continuity for the long-term conservation of Europena dung beetles

    Czech Academy of Sciences Publication Activity Database

    Buse, J.; Šlachta, M.; Sládeček, František Xaver Jiří; Pung, M.; Wagner, T.; Entling, M. H.

    2015-01-01

    Roč. 187, JUL 01 (2015), s. 112-119 ISSN 0006-3207 Grant - others:GA MZe(CZ) QI111C034 Program:QI Institutional support: RVO:60077344 Keywords : habitat area * habitat continuity * geotrupidae Subject RIV: EH - Ecology, Behaviour Impact factor: 3.985, year: 2015 http://www.sciencedirect.com/science/article/pii/S0006320715001561

  15. Carnap on unified science

    Czech Academy of Sciences Publication Activity Database

    Klev, Ansten

    -, č. 59 (2016), s. 53-67 ISSN 0039-3681 Institutional support: RVO:67985955 Keywords : Rudolf Carnap * Unity of Science * Logical Empiricism Subject RIV: AA - Philosophy ; Religion Impact factor: 0.723, year: 2016 http://www.sciencedirect.com/science/article/pii/S0039368116300206

  16. Haar meager sets revisited

    Czech Academy of Sciences Publication Activity Database

    Doležal, Martin; Rmoutil, M.; Vejnar, B.; Vlasák, V.

    2016-01-01

    Roč. 440, č. 2 (2016), s. 922-939 ISSN 0022-247X Institutional support: RVO:67985840 Keywords : Haar meager set * Haar null set * Polish group Subject RIV: BA - General Mathematics Impact factor: 1.064, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022247X1600305X

  17. Poikilothermic traits in Mashona mole-rat (Fukomys darlingi). Reality or myth?

    Czech Academy of Sciences Publication Activity Database

    Zemanová, Milada; Šumbera, R.; Okrouhlík, J.

    2012-01-01

    Roč. 37, č. 7 (2012), s. 485-489 ISSN 0306-4565 Institutional support: RVO:60077344 Keywords : subterranean rodent * Bathyergidae * poikilothermy Subject RIV: ED - Physiology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 1.376, year: 2012 http://www.sciencedirect.com/science/article/pii/S0306456512000824

  18. Eigenvalues and bifurcation for problems with positively homogeneous operators and reaction-diffusion systems with unilateral terms

    Czech Academy of Sciences Publication Activity Database

    Kučera, Milan; Navrátil, J.

    2018-01-01

    Roč. 166, January (2018), s. 154-180 ISSN 0362-546X Institutional support: RVO:67985840 Keywords : global bifurcation * maximal eigenvalue * positively homogeneous operators Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.192, year: 2016 http://www. science direct.com/ science /article/pii/S0362546X17302559?via%3Dihub

  19. 75 FR 79065 - Privacy Act of 1974, as Amended; Proposed System of Records and Routine Use Disclosures

    Science.gov (United States)

    2010-12-17

    ... includes management and profile information, such as blocked accounts, failed access data, effective date... to which criminal penalties attach; and (b) Representing the Commissioner; or (c) Investigating... the criminal penalties that apply to an unauthorized access to, or disclosure of, PII. Employees and...

  20. Dragonflies of freshwater pools in lignite spoil heaps: Restoration management, habitat structure and conservation value

    Czech Academy of Sciences Publication Activity Database

    Harabiš, F.; Tichánek, F.; Tropek, Robert

    2013-01-01

    Roč. 55, JUN 10 (2013), s. 51-61 ISSN 0925-8574 Grant - others:GA Czech University of Life Sciences Pragae(CZ) 42110/1312/3118 Institutional support: RVO:60077344 Keywords : aquatic insect * biodiversity conservation * Odonata Subject RIV: EH - Ecology, Behaviour Impact factor: 3.041, year: 2013 http://www.sciencedirect.com/science/article/pii/S0925857413000761

  1. An improved injector bunching geometry for ATLAS

    Indian Academy of Sciences (India)

    This geometry improves the handling of space charge for high-current beams, significantly increases the capture fraction into the primary rf bucket and reduces the capture fraction of the unwanted parasitic rf bucket. Total capture and transport through the PII has been demonstrated as high as 80% of the injected dc beam ...

  2. Regional differences in political trust: Comparing the Vysocina and Usti Regions

    Czech Academy of Sciences Publication Activity Database

    Čermák, Daniel; Mikešová, Renáta; Stachová, Jana

    2016-01-01

    Roč. 49, č. 2 (2016), s. 137-146 ISSN 0967-067X R&D Projects: GA ČR GAP404/12/0714 Institutional support: RVO:68378025 Keywords : Political trust * Regional differences * Czech Republic Subject RIV: AO - Sociology, Demography Impact factor: 0.607, year: 2016 http://www.sciencedirect.com/science/article/pii/S0967067X16300058

  3. Maximal multiplier operators in Lp(·)(Rn) spaces

    Czech Academy of Sciences Publication Activity Database

    Gogatishvili, Amiran; Kopaliani, T.

    2016-01-01

    Roč. 140, č. 4 (2016), s. 86-97 ISSN 0007-4497 R&D Projects: GA ČR GA13-14743S Institutional support: RVO:67985840 Keywords : spherical maximal function * variable Lebesque spaces * boundedness result Subject RIV: BA - General Mathematics Impact factor: 0.750, year: 2016 http://www.sciencedirect.com/science/article/pii/S0007449715000329

  4. Organizational Analysis of the United States Army Evaluation Center

    Science.gov (United States)

    2014-12-01

    customer at Redstone Arsenal, Alabama. Figure 14 shows the placement of the AEC APG directorates and was derived from Google Maps. Figure 14...Information (PII)  Portable Electronic Devices & Removable Storage Media  Phishing Awareness  Army G3 Computer Security Training In addition to the

  5. From Quantitative to Qualitative Differences: Testing MMI and EMI in the Czech Secondary School System in the First Decade of the 21st Century

    Czech Academy of Sciences Publication Activity Database

    Katrňák, T.; Simonová, Natalie; Fónadová, L.

    2016-01-01

    Roč. 46, Part B (2016), s. 157-171 ISSN 0276-5624 Institutional support: RVO:68378025 Keywords : education * inequality * social stratification Subject RIV: AO - Sociology, Demography Impact factor: 1.033, year: 2016 http://www.sciencedirect.com/science/article/pii/S027656241630141X

  6. Microstructure of lime and lime-pozzolana pastes with nanosilica

    Czech Academy of Sciences Publication Activity Database

    Nunes, Cristiana Lara; Slížková, Zuzana; Stefanidou, M.; Němeček, J.

    2016-01-01

    Roč. 83, May (2016), s. 152-163 ISSN 0008-8846 R&D Projects: GA ČR(CZ) GBP105/12/G059 Institutional support: RVO:68378297 Keywords : nanosilica * pozzolana * surface area * elastic moduli * microstructure Subject RIV: JN - Civil Engineering Impact factor: 4.762, year: 2016 http://www.sciencedirect.com/science/article/pii/S0008884616301223

  7. Functional genomics studies of Rhipicephalus (Boophilus) annulatus ticks in response to infection with the cattle protozoan parasite, Babesia bigemina

    Czech Academy of Sciences Publication Activity Database

    Antunes, S.; Galindo, R. C.; Almazán, C.; Rudenko, Natalia; Golovchenko, Maryna; Grubhoffer, Libor; Shkap, V.; do Rosário, A.; de la Fuente, J.; Domingos, A.

    2012-01-01

    Roč. 42, č. 2 (2012), s. 187-195 ISSN 0020-7519 Institutional research plan: CEZ:AV0Z60220518 Keywords : Tick * Genomics * Babesia * Rhipicephalus * Boophilus * RNA interference * Vaccine Subject RIV: EC - Immunology Impact factor: 3.637, year: 2012 http://www.sciencedirect.com/science/article/pii/S0020751912000033

  8. Comparison of four NDT methods for indication of reactor steel degradation by high fluences of neutron irradiation

    Czech Academy of Sciences Publication Activity Database

    Tomáš, Ivan; Vértesy, G.; Pirfo Barroso, S.; Kobayashi, S.

    2013-01-01

    Roč. 265, DEC (2013), s. 201-209 ISSN 0029-5493 Institutional support: RVO:68378271 Keywords : neutron irradiation * steel degradation * nuclear reactor pressure vessel * magnetic NDT * magnetic minor hysteresis loops * Magnetic Barkhausen Emission Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.972, year: 2013 http://www.sciencedirect.com/science/article/pii/S0029549313004664

  9. Determination of the stochastic layer properties induced by magnetic perturbations via heat pulse experiments at ASDEX upgrade

    Czech Academy of Sciences Publication Activity Database

    Brida, D.; Lunt, T.; Wischmeier, M.; Birkenmeier, G.; Cahyna, Pavel; Carralero, D.; Faitsch, M.; Feng, Y.; Kurzan, B.; Schubert, M.; Sieglin, B.; Suttrop, W.; Wolfrum, E.

    2017-01-01

    Roč. 12, August (2017), s. 831-837 ISSN 2352-1791 EU Projects: European Commission(XE) 633053 - EUROfusion Institutional support: RVO:61389021 Keywords : ASDEX upgrade * Magnetic perturbations * Divertor heat flux Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: Fluids and plasma physics (including surface physics) http://www.sciencedirect.com/science/article/pii/S2352179116302150

  10. Mechanism of negative ion emission from surfaces of ferroelectrics

    Czech Academy of Sciences Publication Activity Database

    Šroubek, Zdeněk

    2012-01-01

    Roč. 606, 15-16 (2012), s. 1327-1330 ISSN 0039-6028 Institutional support: RVO:67985882 Keywords : Surface of ferroelectrics * Ion emission Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.838, year: 2012 http://www.sciencedirect.com/science/article/pii/S0039602812001525#gts0005

  11. Heat coma temperature, relative contents of saturated/unsaturated fatty acids and reproductive maturation in the oceanic sea skaters Halobates micans

    Czech Academy of Sciences Publication Activity Database

    Takenaka, S.; Katagiri, C.; Košťál, Vladimír; Harada, T.

    2014-01-01

    Roč. 17, č. 3 (2014), s. 633-637 ISSN 1226-8615 Institutional support: RVO:60077344 Keywords : oceanic sea skaters * saturated/unsaturated lipids * reproductive maturation Subject RIV: ED - Physiology Impact factor: 0.946, year: 2014 http://www.sciencedirect.com/science/article/pii/S1226861514000752

  12. Some constructive bounds on Ramsey numbers

    Czech Academy of Sciences Publication Activity Database

    Kostochka, A.; Pudlák, Pavel; Rodl, V.

    2010-01-01

    Roč. 100, č. 5 (2010), s. 439-445 ISSN 0095-8956 Institutional research plan: CEZ:AV0Z10190503 Keywords : Norm-graphs Subject RIV: BA - General Mathematics Impact factor: 1.043, year: 2010 http://www.sciencedirect.com/science/article/pii/S0095895610000043

  13. Phylogenetic relationships of the algae scraping cyprinid genus Capoeta (Teleostei: Cyprinidae)

    Czech Academy of Sciences Publication Activity Database

    Levin, B. A.; Freyhof, J.; Lajbner, Zdeněk; Perea, S.; Abdoli, A.; Gaffaroglu, M.; Özulog, M.; Rubeyan, H.R.; Salnikov, V.B.; Doadrio, I.

    2012-01-01

    Roč. 62, č. 1 (2012), s. 542-549 ISSN 1055-7903 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z50450515 Keywords : Cyprinidae * Phylogeny * Polyploid barbini Subject RIV: EH - Ecology, Behaviour Impact factor: 4.066, year: 2012 http://www.sciencedirect.com/science/article/pii/S1055790311003940

  14. An algorithmic metatheorem for directed treewidth

    Czech Academy of Sciences Publication Activity Database

    de Oliveira Oliveira, Mateus

    2016-01-01

    Roč. 204, May (2016), s. 49-76 ISSN 0166-218X EU Projects: European Commission(XE) 339691 - FEALORA Institutional support: RVO:67985840 Keywords : combinatorial slice theory * directed treewidth * tree-zig-zag number Subject RIV: BA - General Mathematics Impact factor: 0.956, year: 2016 http://www.sciencedirect.com/science/article/pii/S0166218X15005077

  15. Brain norepinephrine identified by mass spectrometry is associated with reproductive status of females of the linden bug Pyrrhocoris apterus

    Czech Academy of Sciences Publication Activity Database

    Chvalová, D.; Zdechovanová, Lenka; Vaněčková, Hana; Hodková, Magdalena

    2014-01-01

    Roč. 168, č. 1 (2014), s. 70-75 ISSN 1096-4959 R&D Projects: GA ČR GAP502/10/1612 Institutional support: RVO:60077344 Keywords : adult diapause * brain complex * dopamine Subject RIV: ED - Physiology Impact factor: 1.551, year: 2014 http://www.sciencedirect.com/science/article/pii/S1096495913001796

  16. Improving dielectric properties of plasma sprayed calcium titanate (CaTiO3) coatings by thermal annealing

    Czech Academy of Sciences Publication Activity Database

    Kotlan, Jiří; Ctibor, Pavel; Pala, Zdeněk; Homola, P.; Nehasil, V.

    2014-01-01

    Roč. 40, č. 8 (2014), s. 13049-13055 ISSN 0272-8842 Institutional support: RVO:61389021 Keywords : X-raymethods * Dielectricproperties * Perovskites * Plasma spraying Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 2.605, year: 2014 http://www.sciencedirect.com/science/article/pii/S027288421400724X

  17. Dielectric and electrochemical properties through-thickness mapping on extremely thick plasma sprayed TiO2

    Czech Academy of Sciences Publication Activity Database

    Ctibor, Pavel; Sedláček, J.; Pala, Zdeněk

    2016-01-01

    Roč. 42, č. 6 (2016), s. 7183-7191 ISSN 0272-8842 Institutional support: RVO:61389021 Keywords : Electrical properties * TiO2 * Plasma spraying * Annealing * Microstructure Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 2.986, year: 2016 http://www.sciencedirect.com/science/article/pii/S0272884216001395

  18. Respiratory metabolism of salivary glands during the late larval and prepupal development of Drosophila melanogaster

    Czech Academy of Sciences Publication Activity Database

    Farkaš, R.; Sláma, Karel

    2015-01-01

    Roč. 81, October 01 (2015), s. 109-117 ISSN 0022-1910 Institutional support: RVO:60077344 Keywords : salivary glands * in vitro culture * metamorphosis Subject RIV: ED - Physiology Impact factor: 2.267, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022191015001328

  19. Solutions to muscle fiber equations and their long time behaviour

    Czech Academy of Sciences Publication Activity Database

    Krejčí, Pavel; Sainte-Marie, J.; Sorine, M.; Urquiza, J.M.

    2006-01-01

    Roč. 7, č. 4 (2006), s. 535-558 ISSN 1468-1218 Institutional research plan: CEZ:AV0Z10190503 Keywords : existence * uniqueness * muscle and cardiac mechanics Subject RIV: BA - General Mathematics Impact factor: 1.194, year: 2006 http://www.sciencedirect.com/science/article/pii/S1468121805000507

  20. Evapotranspiration of a high-density poplar stand in comparison with a reference grass cover in the Czech–Moravian Highlands

    Czech Academy of Sciences Publication Activity Database

    Fischer, M.; Trnka, M.; Kučera, J.; Deckmyn, G.; Orság, M.; Sedlák, Pavel; Žalud, Z.; Ceulemans, R.

    2013-01-01

    Roč. 181, NOV 2013 (2013), s. 43-60 ISSN 0168-1923 Institutional support: RVO:68378289 Keywords : Evapotranspiration * Short-rotation poplar coppice * Grassland * Bowen ratio/energy balance method Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 3.894, year: 2013 http://www.sciencedirect.com/science/article/pii/S0168192313001846

  1. Dissipative weak solutions to compressible Navier–Stokes–Fokker–Planck systems with variable viscosity coefficients

    Czech Academy of Sciences Publication Activity Database

    Feireisl, Eduard; Lu, Y.; Süli, E.

    2016-01-01

    Roč. 443, č. 1 (2016), s. 322-351 ISSN 0022-247X Keywords : weak solutions * kinetic polymer models * FENE chain Subject RIV: BA - General Mathematics Impact factor: 1.064, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022247X1630172X

  2. Role of adipokinetic hormone and adenosine in the anti-stress response in Drosophila melanogaster

    Czech Academy of Sciences Publication Activity Database

    Zemanová, Milada; Stašková, Tereza; Kodrík, Dalibor

    91-92, AUG 01 (2016), s. 39-47 ISSN 0022-1910 R&D Projects: GA ČR GA14-07172S Institutional support: RVO:60077344 Keywords : stress * AKH * adenosine Subject RIV: ED - Physiology Impact factor: 2.227, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022191016301937

  3. An E∞-extension of the associahedra and the Tamarkin cell mystery

    Czech Academy of Sciences Publication Activity Database

    Markl, Martin

    2015-01-01

    Roč. 98, December (2015), s. 446-471 ISSN 0393-0440 Institutional support: RVO:67985840 Keywords : associahedra * Fox -Neuwirth cell * Tamarkin cell Subject RIV: BA - General Mathematics Impact factor: 0.752, year: 2015 http://www.sciencedirect.com/science/article/pii/S0393044015002089

  4. Existence of weak solutions for compressible Navier-Stokes equations with entropy transport

    Czech Academy of Sciences Publication Activity Database

    Maltese, D.; Michálek, Martin; Mucha, P.; Novotný, A.; Pokorný, M.; Zatorska, E.

    2016-01-01

    Roč. 261, č. 8 (2016), s. 4448-4485 ISSN 0022-0396 R&D Projects: GA ČR GA13-00522S Institutional support: RVO:67985840 Keywords : Navier-Stokes equations Subject RIV: BA - General Mathematics Impact factor: 1.988, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022039616301656

  5. pI-Control in comparative fluorescence gel electrophoresis (CoFGE) using amphoteric azo dyes

    Czech Academy of Sciences Publication Activity Database

    Hanneken, M.; Šlais, Karel; König, S.

    2015-01-01

    Roč. 3, JUN (2015), s. 221-228 ISSN 2352-3409 Institutional support: RVO:68081715 Keywords : 2D-PAGE * CoFGE * Gel electrophoresis Subject RIV: CB - Analytical Chemistry, Separation http://www.sciencedirect.com/science/article/pii/S2352340915000414

  6. Quasistatic normal-compliance contact problem of visco-elastic bodies with Coulomb friction implemented by QP and SGBEM

    Czech Academy of Sciences Publication Activity Database

    Vodička, R.; Mantič, V.; Roubíček, Tomáš

    2017-01-01

    Roč. 315, May (2017), s. 249-272 ISSN 0377-0427 Institutional support: RVO:61388998 Keywords : contact mechanics * evolution variational inequalities * numerical approximation Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.357, year: 2016 http://www.sciencedirect.com/science/article/pii/S037704271630499X

  7. Analysis of Äspö Pillar Stability Experiment: Continuous thermo-mechanical model development and calibration

    Czech Academy of Sciences Publication Activity Database

    Blaheta, Radim; Byczanski, Petr; Čermák, M.; Hrtus, Rostislav; Kohut, Roman; Kolcun, Alexej; Malík, Josef; Sysala, Stanislav

    2013-01-01

    Roč. 5, č. 2 (2013), s. 124-135 ISSN 1674-7755 Institutional support: RVO:68145535 Keywords : in situ pillar stability experiment * model calibration by back analysis * continuous mechanics * damage of granite rocks * Finite element method (FEM) Subject RIV: BA - General Mathematics http://www.sciencedirect.com/science/article/pii/S1674775513000103

  8. 41 CFR 105-64.107 - What standards of conduct apply to employees with privacy-related responsibilities?

    Science.gov (United States)

    2010-07-01

    ... systems will protect system security, avoid unauthorized disclosure of information, both verbal and... Personally Identifiable Information (PII), CIO P 2100.1E CIO P GSA Information Technology (IT) Security Policy, and CIO 2104.1 GSA Information Technology (IT) General Rules of Behavior. ...

  9. Why has nature invented three stop codons of DNA and only one start codon?

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal; Křížek, P.

    2012-01-01

    Roč. 304, Jul 7 (2012), s. 183-187 ISSN 0022-5193 R&D Projects: GA AV ČR(CZ) IAA100190803 Institutional support: RVO:67985840 Keywords : DNA * RNA * stop codon * synchronization shift * drosophila genome Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.351, year: 2012 http://www.sciencedirect.com/science/article/pii/S0022519312001580

  10. Dead wood dependent organisms in one of the oldest protected forests of Europe: Investigating the contrasting effects of within-stand variation in a highly diversified environment

    Czech Academy of Sciences Publication Activity Database

    Horák, J.; Kout, J.; Vodka, Štěpán; Donato, D. C.

    2016-01-01

    Roč. 363, MAR 1 (2016), s. 229-236 ISSN 0378-1127 Institutional support: RVO:60077344 Keywords : biodiversity * gaps * microenvironment variation Subject RIV: EH - Ecology, Behaviour Impact factor: 3.064, year: 2016 http://www.sciencedirect.com/science/article/pii/S0378112715007744

  11. Comprehensive study on mechanical properties of lime-based pastes with additions of metakaolin and brick dust

    Czech Academy of Sciences Publication Activity Database

    Nežerka, V.; Slížková, Zuzana; Tesárek, P.; Plachý, T.; Frankeová, Dita; Petráňová, Veronika

    2014-01-01

    Roč. 64, October (2014), s. 17-29 ISSN 0008-8846 R&D Projects: GA MK(CZ) DF11P01OVV008 Keywords : microstructure * mechanical properties * CaO * metakaolin * brick dust Subject RIV: AL - Art, Architecture, Cultural Heritage Impact factor: 2.864, year: 2014 http://www.sciencedirect.com/science/article/pii/S0008884614001239

  12. Geometric Arveson–Douglas conjecture

    Czech Academy of Sciences Publication Activity Database

    Engliš, Miroslav; Eschmeier, J.

    2015-01-01

    Roč. 274, April (2015), s. 606-630 ISSN 0001-8708 Institutional support: RVO:67985840 Keywords : Arveson- Douglas conjecture * generalized Toeplitz operator Subject RIV: BA - General Mathematics Impact factor: 1.405, year: 2015 http://www.sciencedirect.com/science/article/pii/S0001870815000328

  13. Corrigendum to “Geometric Arveson–Douglas conjecture” [Adv. Math. 274 (2015) 606–630

    Czech Academy of Sciences Publication Activity Database

    Engliš, Miroslav; Eschmeier, J.

    2015-01-01

    Roč. 278, June (2015), s. 254 ISSN 0001-8708 Institutional support: RVO:67985840 Keywords : Arveson- Douglas conjecture * generalized Toeplitz operator Subject RIV: BA - General Mathematics Impact factor: 1.405, year: 2015 http://www.sciencedirect.com/science/article/pii/S000187081500119X

  14. Left-forbidding cooperating distributed grammar systems

    Czech Academy of Sciences Publication Activity Database

    Goldefus, F.; Masopust, Tomáš; Meduna, A.

    2010-01-01

    Roč. 411, 40-42 (2010), s. 3661-3667 ISSN 0304-3975 Institutional research plan: CEZ:AV0Z10190503 Keywords : cooperating distributed grammar system * cooperating derivation mode * left-forbidding grammar * generative power * descriptional complexity Subject RIV: BA - General Mathematics Impact factor: 0.838, year: 2010 http://www.sciencedirect.com/science/article/pii/S0304397510003440

  15. One problem of the Navier type for the Stokes system in planar domains

    Czech Academy of Sciences Publication Activity Database

    Medková, Dagmar

    2016-01-01

    Roč. 261, č. 10 (2016), s. 5670-5689 ISSN 0022-0396 R&D Projects: GA ČR GA16-03230S Institutional support: RVO:67985840 Keywords : Stokes system * Navier type problem * regularity of a solution Subject RIV: BA - General Mathematics Impact factor: 1.988, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022039616302121

  16. Centers and homotopy centers in enriched monoidal categories

    Czech Academy of Sciences Publication Activity Database

    Batanin, M.; Markl, Martin

    2012-01-01

    Roč. 230, 4-6 (2012), s. 1811-1858 ISSN 0001-8708 R&D Projects: GA ČR GA201/08/0397 Institutional support: RVO:67985840 Keywords : monoidal categories * center * Hochschild complex Subject RIV: BA - General Mathematics Impact factor: 1.373, year: 2012 http://www.sciencedirect.com/science/article/pii/S0001870812001508

  17. Distributional chaos for linear operators

    Czech Academy of Sciences Publication Activity Database

    Bernardes Jr., N.C.; Bonilla, A.; Müller, Vladimír; Peris, A.

    2013-01-01

    Roč. 265, č. 9 (2013), s. 2143-2163 ISSN 0022-1236 R&D Projects: GA ČR GA201/09/0473 Institutional support: RVO:67985840 Keywords : distributional chaos * hypercyclic operators * irregular vectors Subject RIV: BA - General Mathematics Impact factor: 1.152, year: 2013 http://www.sciencedirect.com/science/article/pii/S0022123613002450

  18. Reissner-Mindlin plate model with uncertain input data

    Czech Academy of Sciences Publication Activity Database

    Hlaváček, Ivan; Chleboun, J.

    2014-01-01

    Roč. 17, Jun (2014), s. 71-88 ISSN 1468-1218 Institutional support: RVO:67985840 Keywords : Reissner-Mindlin model * orthotropic plate Subject RIV: BA - General Mathematics Impact factor: 2.519, year: 2014 http://www.sciencedirect.com/science/article/pii/S1468121813001077

  19. Localized quantification of anhydrous calcium carbonate polymorphs using micro-Raman spectroscopy

    Czech Academy of Sciences Publication Activity Database

    Ševčík, Radek; Mácová, Petra

    2018-01-01

    Roč. 95, March (2018), s. 1-6 ISSN 0924-2031 R&D Projects: GA MŠk(CZ) LO1219 Keywords : micro-Raman * quantification * calcite * vaterite * aragonite * nanolime Subject RIV: CA - Inorganic Chemistry Impact factor: 1.740, year: 2016 http://www.sciencedirect.com/science/article/pii/S0924203117302886

  20. 77 FR 32089 - Information Collections Being Submitted for Review and Approval to the Office of Management and...

    Science.gov (United States)

    2012-05-31

    .... Title: Implementation of the Twenty-first Century Communications and Video Accessibility Act of 2010, Section 105, Relay Services for Deaf-Blind Individuals, CG Docket No. 10-210. Form Number: N/A. [[Page... (PII), which is covered under the FCC's system of records notice (SORN), FCC/CGB-3, ``National Deaf...

  1. A Ratiometric Sensor for Imaging Insulin Secretion in Single beta Cells

    Czech Academy of Sciences Publication Activity Database

    Schifferer, M.; Yushchenko, Dmytro A.; Stein, F.; Bolbat, A.; Schultz, C.

    2017-01-01

    Roč. 24, č. 4 (2017), s. 525-531 ISSN 2451-9448 Institutional support: RVO:61388963 Keywords : zinc transporter ZnT8 * line MIN6 * glucose homeostasis Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology http://www.sciencedirect.com/science/article/pii/S2451945617300624

  2. On restricted context-free grammars

    Czech Academy of Sciences Publication Activity Database

    Dassow, J.; Masopust, Tomáš

    2012-01-01

    Roč. 78, č. 1 (2012), s. 293-304 ISSN 0022-0000 Institutional research plan: CEZ:AV0Z10190503 Keywords : context-free grammars * derivation restriction * normal forms Subject RIV: BA - General Mathematics Impact factor: 1.000, year: 2012 http://www.sciencedirect.com/science/article/pii/S0022000011000572

  3. Degree, instability and bifurcation of reaction-diffusion systems with obstacles near certain hyperbolas

    Czech Academy of Sciences Publication Activity Database

    Eisner, J.; Väth, Martin

    2016-01-01

    Roč. 135, April (2016), s. 158-193 ISSN 0362-546X Institutional support: RVO:67985840 Keywords : reaction-diffusion system * turing instability * global bifurcation Subject RIV: BA - General Mathematics Impact factor: 1.192, year: 2016 http://www.sciencedirect.com/science/article/pii/S0362546X16000146

  4. Some Crandall–Rabinowitz type results and applications toreaction–diffusion systems

    Czech Academy of Sciences Publication Activity Database

    Väth, Martin

    2018-01-01

    Roč. 458, č. 2 (2018), s. 1324-1343 ISSN 0022-247X Institutional support: RVO:67985840 Keywords : Crandall–Rabinowitz theorem * jumping nonlinearity * splitting of critical point Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.064, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022247X17309319?via%3Dihub

  5. Comparison of Prandtl–Ishlinskii and Preisach modeling for smart devices applications

    Czech Academy of Sciences Publication Activity Database

    Al Janaideh, M.; Davino, D.; Krejčí, Pavel; Visone, C.

    2016-01-01

    Roč. 486, 1 April (2016), s. 155-159 ISSN 0921-4526 R&D Projects: GA ČR(CZ) GA15-12227S Institutional support: RVO:67985840 Keywords : hysteresis modeling * smart materials Subject RIV: BA - General Mathematics Impact factor: 1.386, year: 2016 http://www.sciencedirect.com/science/article/pii/S0921452616300084

  6. Degradation of Verapamil hydrochloride in water by gliding arc discharge

    Czech Academy of Sciences Publication Activity Database

    Krishna, S.; Mašláni, Alan; Izdebski, T.; Horáková, M.; Klementová, Š.; Špatenka, P.

    2016-01-01

    Roč. 152, June (2016), s. 47-54 ISSN 0045-6535 Institutional support: RVO:61389021 Keywords : Gliding arc discharge * Emission spectroscopy * Pharmaceuticals * Half-life * Degradation mechanism Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 4.208, year: 2016 http://www.sciencedirect.com/science/article/pii/S0045653516302442

  7. Generation mechanism of the whistler-mode waves in the plasma sheet prior to magnetic reconnection

    Czech Academy of Sciences Publication Activity Database

    Wei, X. H.; Cao, J. B.; Zhou, G. C.; Fu, H. S.; Santolík, Ondřej; Reme, H.; Dandouras, I.; Cornilleau, N.; Fazakerley, A.

    2013-01-01

    Roč. 52, č. 1 (2013), s. 205-210 ISSN 0273-1177 Institutional support: RVO:68378289 Keywords : whistler-mode waves * electron temperature anisotropy * Reconnection * the plasma sheet Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.238, year: 2013 http://www.sciencedirect.com/science/article/pii/S0273117713001221

  8. Recent progress in research on tungsten materials for nuclear fusion applications in Europe

    Czech Academy of Sciences Publication Activity Database

    Rieth, M.; Dudarev, S.L.; Gonzalez de Vicente, S.M.; Aktaa, J.; Ahlgren, T.; Antusch, S.; Armstrong, D.E.J.; Balden, M.; Baluc, N.; Barthe, M.-F.; Basuki, W.W.; Battabyal, M.; Becquart, C.S.; Blagoeva, N.; Boldyryeva, Hanna; Brinkmann, J.; Celino, M.; Ciupinski, L.; Correia, J.B.; De Backer, A.; Domain, C.; Gaganidze, E.; García-Rosales, C.; Gibson, J.; Gilbert, M.R.; Giusepponi, S.; Gludovatz, B.; Greuner, H.; Heinola, K.; Höschen, T.; Hoffmann, A.; Holstein, A.; Koch, F.; Krauss, W.; Li, H.; Lindig, S.; Linke, J.; Linsmeier, Ch.; López-Ruiz, P.; Maier, H.; Matějíček, Jiří; Mishra, T.P.; Muhammed, M.; Muñoz, A.; Muzyk, M.; Nordlund, K.; Nguyen-Manh, D.; Opschoor, J.; Ordás, N.; Palacios, Y.; Pintsuk, G.; Pippan, R.; Reiser, J.; Riesch, J.; Roberts, S. G.; Romaner, L.; Rosiński, M.; Sanchez, M.; Schulmeyer, W.; Traxler, H.; Ureña, G.; van der Laan, J.G.; Veleva, L.; Wahlberg, S.; Walter, M.; Weber, T.; Weitkamp, T.; Wurster, S.; Yar, M.A.; You, J.H.; Zivelonghi, A.

    2013-01-01

    Roč. 432, 1-3 (2013), s. 482-500 ISSN 0022-3115 Institutional support: RVO:61389021 Keywords : tungsten * joining * composites * graded materials * fusion materials Subject RIV: JF - Nuclear Energetics Impact factor: 2.016, year: 2013 http://www.sciencedirect.com/science/article/pii/S0022311512004278

  9. Long-hole destress blasting for rockburst control during deep underground coal mining

    Czech Academy of Sciences Publication Activity Database

    Koníček, Petr; Souček, Kamil; Staš, Lubomír; Singh, R.

    -, č. 61 (2013), s. 141-153 ISSN 1365-1609 R&D Projects: GA MŠk ED2.1.00/03.0082 Institutional support: RVO:68145535 Keywords : Ostrava - Karvina Coal basin * longwall mining * rockbursts * destress blasting Subject RIV: DH - Mining, incl. Coal Mining Impact factor: 1.424, year: 2013 http://www.sciencedirect.com/science/article/pii/S1365160913000348

  10. Method of the viscosity measurement by means of the vibrating micro-/nano-mechanical resonators

    Czech Academy of Sciences Publication Activity Database

    Fedorchenko, Alexander I.; Stachiv, Ivo; Wang, W.; Ch.

    2013-01-01

    Roč. 32, August 2013 (2013), s. 84-89 ISSN 0955-5986 R&D Projects: GA MŠk LH12042 Institutional support: RVO:61388998 Keywords : dimensionless analysis * microcantilever * nanowire Subject RIV: BJ - Thermodynamics Impact factor: 1.030, year: 2013 http://www.sciencedirect.com/science/article/pii/S0955598613000332

  11. Seasonal changes in minor membrane phospholipid classes, sterols and tocopherols in overwintering insect, Pyrrhocoris apterus

    Czech Academy of Sciences Publication Activity Database

    Košťál, Vladimír; Urban, T.; Řimnáčová, Lucie; Berková, Petra; Šimek, Petr

    2013-01-01

    Roč. 59, č. 9 (2013), s. 934-941 ISSN 0022-1910 R&D Projects: GA MŠk LH12103; GA MZd(CZ) NT11513 Institutional support: RVO:60077344 Keywords : seasonal membrane restructuring * phospholipids * lysophospholipids Subject RIV: ED - Physiology Impact factor: 2.500, year: 2013 http://www.sciencedirect.com/science/article/pii/S0022191013001406#

  12. Impingement heat/mass transfer to hybrid synthetic jets and other reversible pulsating jets

    Czech Academy of Sciences Publication Activity Database

    Trávníček, Zdeněk; Vít, T.

    2015-01-01

    Roč. 85, June (2015), s. 473-487 ISSN 0017-9310 R&D Projects: GA ČR GA14-08888S Institutional support: RVO:61388998 Keywords : impinging jet * reversible pulsating jet * synthetic jet Subject RIV: JU - Aeronautics, Aerodynamics, Aircrafts Impact factor: 2.857, year: 2015 http://www.sciencedirect.com/science/article/pii/S001793101500143X

  13. Ecosystems emerging. 5: Constraints

    Czech Academy of Sciences Publication Activity Database

    Patten, B. C.; Straškraba, Milan; Jorgensen, S. E.

    2011-01-01

    Roč. 222, č. 16 (2011), s. 2945-2972 ISSN 0304-3800 Institutional research plan: CEZ:AV0Z50070508 Keywords : constraint * epistemic * ontic Subject RIV: EH - Ecology, Behaviour Impact factor: 2.326, year: 2011 http://www.sciencedirect.com/science/article/pii/S0304380011002274

  14. Development of a no-moving-part blower for difficult operating conditions

    Czech Academy of Sciences Publication Activity Database

    Tesař, Václav

    2013-01-01

    Roč. 91, č. 12 (2013), s. 2401-2411 ISSN 0263-8762 R&D Projects: GA ČR GA13-23046S Institutional research plan: CEZ:AV0Z20760514 Keywords : blower * fluidics * hazardous fluids Subject RIV: BK - Fluid Dynamics Impact factor: 2.281, year: 2013 http://www.sciencedirect.com/science/article/pii/S0263876213001081

  15. Use of STIM for morphological studies of microstructured polymer foils

    Czech Academy of Sciences Publication Activity Database

    Stori, E. M.; de Souza, C.T.; Amaral, L.; Fink, Dietmar; Papaleo, R. M.; Dias, J.F.

    2013-01-01

    Roč. 306, č. 7 (2013), s. 99-103 ISSN 0168-583X Institutional support: RVO:61389005 Keywords : scanning transmission ion microscopy * proton beam writing * ion beam imagign techniques Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.186, year: 2013 http://www.sciencedirect.com/science/article/pii/S0168583X12006611

  16. Decrease in Methoprene tolerant and Taiman expression reduces juvenile hormone effects and enhances the levels of juvenile hormone circulating in males of the linden Pyrrhoceris apterus

    Czech Academy of Sciences Publication Activity Database

    Hejníková, M.; Paroulek, Michal; Hodková, Magdalena

    93-94, OCT 01 (2016), s. 72-80 ISSN 0022-1910 R&D Projects: GA ČR GAP502/10/1612 Institutional support: RVO:60077344 Keywords : Corpus allatum * Methoprene tolerant * Taiman Subject RIV: ED - Physiology Impact factor: 2.227, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022191016300798

  17. Oncomiracidial development, survival and swimming behaviour of the monogenean Sparicotyle chrysophrii (Van Beneden and Hesse, 1863)

    Czech Academy of Sciences Publication Activity Database

    Repulles-Albelda, A.; Holzer, Astrid S.; Raga, J. A.; Montero, F. E.

    338-341, MAR 29 (2012), s. 47-55 ISSN 0044-8486 Institutional research plan: CEZ:AV0Z60220518 Keywords : Sparicotyle chrysophrii * Sparus aurata * Polyopisthocotylea * Oncomiracidial development * Hatching * Survival time Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.009, year: 2012 http://www.sciencedirect.com/science/article/pii/S0044848612000646

  18. West Nile virus lineage 2 isolated from Culex modestus mosquitoes in the Czech Republic, 2013: expansion of the European WNV endemic area to the North?

    Czech Academy of Sciences Publication Activity Database

    Rudolf, Ivo; Bakonyi, T.; Šebesta, Oldřich; Mendel, Jan; Peško, Juraj; Betášová, Lenka; Blažejová, Hana; Venclíková, Kristýna; Straková, Petra; Nowotny, N.; Hubálek, Zdeněk

    2014-01-01

    Roč. 19, č. 31 (2014), pii=20867 ISSN 1560-7917 EU Projects: European Commission(XE) 261504 - EDENEXT Institutional support: RVO:68081766 Keywords : West Nile virus * mosquitoes * Czech Republic Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 5.722, year: 2014 http://www.eurosurveillance.org/ViewArticle.aspx?ArticleId=20867

  19. A multilocus phylogeny of Podoctidae (Arachnida, Opiliones, Laniatores) and parametric shape analysis reveal the disutility of subfamilial nomenclature in armored harvestman systematics

    Czech Academy of Sciences Publication Activity Database

    Sharma, P. P.; Santiago, M. A.; Kriebel, R.; Lipps, S. M.; Buenavente, P. A. C.; Diesmos, A. C.; Janda, Milan; Boyer, S. L.; Clouse, R. M.; Wheeler, W. C.

    2017-01-01

    Roč. 106, JAN 01 (2017), s. 164-173 ISSN 1055-7903 Institutional support: RVO:60077344 Keywords : grassatores * morphology * comparative methods Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 4.419, year: 2016 http://www.sciencedirect.com/science/article/pii/S1055790316302445

  20. Eigenvalues and bifurcation for problems with positively homogeneous operators and reaction-diffusion systems with unilateral terms

    Czech Academy of Sciences Publication Activity Database

    Kučera, Milan; Navrátil, J.

    2018-01-01

    Roč. 166, January (2018), s. 154-180 ISSN 0362-546X Institutional support: RVO:67985840 Keywords : global bifurcation * maximal eigenvalue * positively homogeneous operators Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.192, year: 2016 http://www.sciencedirect.com/science/article/pii/S0362546X17302559?via%3Dihub

  1. Persistent discharges in dentate gyrus perisoma-inhibiting interneurons require hyperpolarization-activated cyclic nucleotide-gated channel activation.

    Science.gov (United States)

    Elgueta, Claudio; Köhler, Johannes; Bartos, Marlene

    2015-03-11

    Parvalbumin (PV)-expressing perisoma-inhibiting interneurons (PIIs) of the dentate gyrus integrate rapidly correlated synaptic inputs and generate short-duration action potentials that propagate along the axon to their output synapses, supporting fast inhibitory signaling onto their target cells. Here we show that PV-PIIs in rat and mouse dentate gyrus (DG) integrate their intrinsic activity over time and can turn into a persistent firing mode characterized by the ability to generate long-lasting trains of action potentials at ∼50 Hz in the absence of additional inputs. Persistent firing emerges in the axons remote from the axon initial segment and markedly depends on hyperpolarization-activated cyclic nucleotide-gated channel (HCNC) activation. Persistent firing properties are modulated by intracellular Ca(2+) levels and somatic membrane potential. Detailed computational single-cell PIIs models reveal that HCNC-mediated conductances can contribute to persistent firing during conditions of a shift in their voltage activation curve to more depolarized potentials. Paired recordings from PIIs and their target granule cells show that persistent firing supports strong inhibitory output signaling. Thus, persistent firing may emerge during conditions of intense activation of the network, thereby providing silencing to the circuitry and the maintenance of sparse activity in the dentate gyrus. Copyright © 2015 the authors 0270-6474/15/354131-09$15.00/0.

  2. Discretization error estimates in maximum norm for convergent splittings of matrices with a monotone preconditioning part

    Czech Academy of Sciences Publication Activity Database

    Axelsson, Owe; Karátson, J.

    2017-01-01

    Roč. 210, January 2017 (2017), s. 155-164 ISSN 0377-0427 Institutional support: RVO:68145535 Keywords : finite difference method * error estimates * matrix splitting * preconditioning Subject RIV: BA - General Mathematics OBOR OECD: Applied mathematics Impact factor: 1.357, year: 2016 http://www. science direct.com/ science /article/pii/S0377042716301492?via%3Dihub

  3. Note to the problem of asymptotic behavior of viscous incompressible flow around a rotating body

    Czech Academy of Sciences Publication Activity Database

    Deuring, P.; Kračmar, S.; Nečasová, Šárka

    2016-01-01

    Roč. 354, č. 8 (2016), s. 794-798 ISSN 1631-073X R&D Projects: GA ČR GA13-00522S Institutional support: RVO:67985840 Keywords : Navier-Stokes system * Oseen system Subject RIV: BA - General Mathematics Impact factor: 0.396, year: 2016 http://www.sciencedirect.com/science/article/pii/S1631073X16300863

  4. Formation mechanism and microstructure characterization of nickel-aluminum intertwining interface in cold spray

    Czech Academy of Sciences Publication Activity Database

    Xie, Y.; Yin, S.; Čížek, Jan; Cupera, J.; Guo, E.; Lupoi, R.

    2018-01-01

    Roč. 337, March (2018), s. 447-452 ISSN 0257-8972 Institutional support: RVO:61389021 Keywords : Kinetic spray * Materials mixing * Grain refinement * Dynamic recrystallization * Nanostructure Subject RIV: JK - Corrosion ; Surface Treatment of Materials OBOR OECD: Coating and films Impact factor: 2.589, year: 2016 https://www.sciencedirect.com/science/article/pii/S0257897218300574

  5. Poisson-Lie T-duality of string effective actions: A new approach to the dilaton puzzle

    Czech Academy of Sciences Publication Activity Database

    Jurčo, B.; Vysoký, Jan

    2018-01-01

    Roč. 130, August (2018), s. 1-26 ISSN 0393-0440 Institutional support: RVO:67985840 Keywords : Poisson-Lie T-duality * string effective actions * dilaton field Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.819, year: 2016 https://www.sciencedirect.com/science/article/pii/S0393044018301748?via%3Dihub

  6. Jacobi bundles and the BFV-complex

    Czech Academy of Sciences Publication Activity Database

    Le, Hong-Van; Tortorella, A. G.; Vitagliano, L.

    2017-01-01

    Roč. 121, November (2017), s. 347-377 ISSN 0393-0440 Institutional support: RVO:67985840 Keywords : Jacobi manifold * Jacobi bundle * coisotropic submanifolds Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.819, year: 2016 http://www.sciencedirect.com/science/article/pii/S0393044017301948

  7. McLean’s second variation formula revisited

    Czech Academy of Sciences Publication Activity Database

    Le, Hong-Van; Vanžura, Jiří

    2017-01-01

    Roč. 113, March (2017), s. 188-196 ISSN 0393-0440 Institutional support: RVO:67985840 Keywords : calibrated submanifold * second variation * Harvey–Lawson’s identity Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.819, year: 2016 http://www.sciencedirect.com/science/article/pii/S0393044016302376

  8. Pilot Program Evaluating Personal Tablet Device Use Across Campus

    Science.gov (United States)

    2012-01-01

    Protocol ISM – Information Systems Management ISP – Internet Service Provider LAN – Local Area Network Mbps – Mega Bits Per Second MDM – Mobile Device...Management NIPRNET – Nonsecure Internet Protocol Router Network OCSP – Online Certificate Status Protocol OSI – Open Systems Interconnection PII

  9. Design of an airlift loop bioreactor and pilot scales studies with fluidic oscillator induced microbubbles for growth of a microalgae Dunaliella salina

    Czech Academy of Sciences Publication Activity Database

    Zimmerman, W. B.; Zandi, M.; Bandulasena, H.C.H.; Tesař, Václav; Gilmour, D.J.; Ying, K.

    2011-01-01

    Roč. 88, č. 10 (2011), s. 3357-3369 ISSN 0306-2619 Institutional research plan: CEZ:AV0Z20760514 Keywords : microbbles * microfluidics * algae Subject RIV: BK - Fluid Dynamics Impact factor: 5.106, year: 2011 http://www.sciencedirect.com/science/article/pii/S0306261911001127

  10. The occurrence and origin of selenium minerals in Se-rich stone coals, spoils and their adjacent soils in Yutangba, China

    Czech Academy of Sciences Publication Activity Database

    Zhu, J.M.; Johnson, T.M.; Finkelman, R.B.; Zheng, B.S.; Sýkorová, Ivana; Pešek, J.

    2012-01-01

    Roč. 330, November (2012), s. 27-38 ISSN 0009-2541 Institutional support: RVO:67985891 Keywords : native Se * Cu-selenides * mandarinoite Subject RIV: DD - Geochemistry Impact factor: 3.154, year: 2012 http://www.sciencedirect.com/science/article/pii/S0009254112003828

  11. Classification of the spaces Cp*(X) within the Borel-Wadge hierarchy for a projective space X

    Czech Academy of Sciences Publication Activity Database

    Doležal, Martin; Vejnar, B.

    2015-01-01

    Roč. 183, March (2015), s. 11-17 ISSN 0166-8641 Institutional support: RVO:67985840 Keywords : function spaces * pointwise convergence * projective determinacy Subject RIV: BA - General Mathematics Impact factor: 0.493, year: 2015 http://www.sciencedirect.com/science/article/pii/S0166864114004854

  12. La lucha europea contra la presencia epidémica de la poliomielitis : una reflexión histórica

    OpenAIRE

    Ballester Añón, Rosa

    2012-01-01

    Artículo realizado en el marco de los proyectos de investigación PII1I09-0114-0843 (financiado por la Consejería de Educación y Ciencia de la JCCM) y HAR2009-14068-C03-01/HIST (financiado por el MICINN).

  13. Profiling of urinary amino-carboxylic metabolites by in-situ heptafluorobutyl chloroformate mediated sample preparation and gas chromatography-mass spectrometry

    Czech Academy of Sciences Publication Activity Database

    Hušek, Petr; Švagera, Z.; Hanzlíková, D.; Řimnáčová, Lucie; Zahradníčková, Helena; Opekarová, Iva; Šimek, Petr

    2016-01-01

    Roč. 1443, April 22 (2016), s. 211-232 ISSN 0021-9673 R&D Projects: GA ČR GA13-18509S Institutional support: RVO:60077344 Keywords : metabolite profiling * metabolomics * urine Subject RIV: CE - Biochemistry Impact factor: 3.981, year: 2016 http://www.sciencedirect.com/science/article/pii/S0021967316302692

  14. Why have parasites promoting mating success been observed so rarely?

    Czech Academy of Sciences Publication Activity Database

    Berec, Luděk; Maxin, D.

    2014-01-01

    Roč. 342, FEB 7 (2014), s. 47-61 ISSN 0022-5193 Grant - others:National Science Foundation(US) EF-0832858 Institutional support: RVO:60077344 Keywords : population dynamics * two-sex population model * sexually transmitted disease Subject RIV: ED - Physiology Impact factor: 2.116, year: 2014 http://www.sciencedirect.com/science/article/pii/S0022519313005109#

  15. No-moving-part electro/fluidic transducer based on plasma discharge effect

    Czech Academy of Sciences Publication Activity Database

    Tesař, Václav; Šonský, Jiří

    2015-01-01

    Roč. 232, August (2015), s. 20-29 ISSN 0924-4247 R&D Projects: GA ČR GA13-23046S Institutional support: RVO:61388998 Keywords : transducer * fluidic * plasma discharge Subject RIV: BK - Fluid Dynamics Impact factor: 2.201, year: 2015 http://www.sciencedirect.com/science/article/pii/S092442471500206X

  16. Proof complexity of intuitionistic implicational formulas

    Czech Academy of Sciences Publication Activity Database

    Jeřábek, Emil

    2017-01-01

    Roč. 168, č. 1 (2017), s. 150-190 ISSN 0168-0072 EU Projects: European Commission(XE) 339691 - FEALORA Institutional support: RVO:67985840 Keywords : proof complexity * intuitionistic logic * implicational fragment Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.647, year: 2016 http://www.sciencedirect.com/science/article/pii/S0168007216301154

  17. Cobham recursive set functions

    Czech Academy of Sciences Publication Activity Database

    Beckmann, A.; Buss, S.; Friedman, S.-D.; Müller, M.; Thapen, Neil

    2016-01-01

    Roč. 167, č. 3 (2016), s. 335-369 ISSN 0168-0072 R&D Projects: GA ČR GBP202/12/G061 Institutional support: RVO:67985840 Keywords : set function * polynomial time * Cobham recursion Subject RIV: BA - General Mathematics Impact factor: 0.647, year: 2016 http://www.sciencedirect.com/science/article/pii/S0168007215001293

  18. Characterization of eight Bacillus thuringiensis isolates originated from fecal samples of Fuzhou Zoo and Fuzhou Panda Center

    Czech Academy of Sciences Publication Activity Database

    Wu, Ch.; Wu, L.; Zhang, L.; Gelbič, Ivan; Xu, L.; Guan, X.

    2014-01-01

    Roč. 17, č. 3 (2014), s. 395-397 ISSN 1226-8615 Institutional support: RVO:60077344 Keywords : Bacillus thuringiensis * faeces * microscophy Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 0.946, year: 2014 http://www.sciencedirect.com/science/article/pii/S122686151400034X

  19. BDDC by a frontal solver and the stress computation in a hip joint replacement

    Czech Academy of Sciences Publication Activity Database

    Šístek, Jakub; Novotný, Jaroslav; Mandel, J.; Čertíková, M.; Burda, P.

    2010-01-01

    Roč. 80, č. 6 (2010), s. 1310-1323 ISSN 0378-4754 Institutional research plan: CEZ:AV0Z10190503; CEZ:AV0Z20760514 Keywords : domain decomposition * iterative substructuring * finite elements * linear elasticity * parallel algorithms Subject RIV: BA - General Mathematics Impact factor: 0.812, year: 2010 http://www.sciencedirect.com/science/article/pii/S0378475409000044

  20. Clinal variation in fitness related traits in tropical drosophilids of the Indian subcontinent

    Czech Academy of Sciences Publication Activity Database

    Rajpurohit, S.; Nedvěd, Oldřich

    2013-01-01

    Roč. 38, č. 6 (2013), s. 345-354 ISSN 0306-4565 Institutional support: RVO:60077344 Keywords : climatic adaption * Drosophila * geographic cline Subject RIV: ED - Physiology Impact factor: 1.544, year: 2013 http://www.sciencedirect.com/science/article/pii/S0306456513000569#

  1. Spark plasma versus conventional sintering in the electrical properties of Nasicon-type materials

    Czech Academy of Sciences Publication Activity Database

    Pérez-Estébanez, Marta; Isasi-Marín, J.; Rivera-Calzada, A.; León, C.; Nygren, M.

    2015-01-01

    Roč. 651, December (2015), s. 636-642 ISSN 0925-8388 R&D Projects: GA MŠk(CZ) LO1219 Keywords : electrode materials * ionic conduction * sintering Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 3.014, year: 2015 http://www.sciencedirect.com/science/article/pii/S0925838815308227

  2. RETRACTED: Treatment of postoperative emetic symptoms with granisetron in women undergoing abdominal hysterectomy: a randomized, double-blind, placebo-controlled, dose-ranging study

    Directory of Open Access Journals (Sweden)

    MD Yoshitaka Fujii

    2004-07-01

    Fujii Y, Tanaka H, Somekawa Y. Treatment of postoperative emetic symptoms with granisetron in women undergoing abdominal hysterectomy: a randomised, double-blind, placebo-controlled, dose-ranging study. Current Therapeutic Research 2004;65:321–9. https://www.sciencedirect.com/science/article/pii/S0011393X04800018

  3. Structure and mechanical properties of Al-Si-Fe alloys prepared by short-term mechanical alloying and Spark Plasma Sintering

    Czech Academy of Sciences Publication Activity Database

    Průša, J.; Vojtěch, D.; Bláhová, M.; Michalcová, A.; Kubatík, Tomáš František; Čížek, J.

    2015-01-01

    Roč. 75, June (2015), s. 65-75 ISSN 0261-3069 Institutional support: RVO:61389021 Keywords : Aluminium alloy s * Mechanical Properties * Microstructure * Mechanical alloy ing * Spark-Plasma Sintering Subject RIV: JG - Metallurgy Impact factor: 3.997, year: 2015 http://www.sciencedirect.com/science/article/pii/S0261306915000990#

  4. Unraveling the intraguild competition between Oscheius spp. nematodes and entomopathogenic nematodes: Implications for their natural distribution in Swiss agricultural soils

    Czech Academy of Sciences Publication Activity Database

    Campos-Herrera, R.; Půža, Vladimír; Jaffuel, G.; Blanco-Pérez, R.; Čepulyté-Rakauskiené, R.; Turlings, T. C. J.

    2015-01-01

    Roč. 132, NOV 01 (2015), s. 216-227 ISSN 0022-2011 Institutional support: RVO:60077344 Keywords : Oscheius * quantitative real-time PCR * intraguild competition Subject RIV: EH - Ecology, Behaviour Impact factor: 2.198, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022201115300276

  5. Numerical study of nozzle design for the hybrid synthetic jet actuator

    Czech Academy of Sciences Publication Activity Database

    Hsu, S.-S.; Chou, Y.-J.; Trávníček, Zdeněk; Lin, C.-F.; Wang, A. B.; Yen, R.H.

    2015-01-01

    Roč. 232, August (2015), s. 172-182 ISSN 0924-4247 R&D Projects: GA ČR GA14-08888S Institutional support: RVO:61388998 Keywords : synthetic jet * hybrid synthetic jet * numerical simulation Subject RIV: JU - Aeronautics, Aerodynamics, Aircrafts Impact factor: 2.201, year: 2015 http://www.sciencedirect.com/science/article/pii/S0924424715300091

  6. 75 FR 51468 - Published Privacy Impact Assessments on the Web

    Science.gov (United States)

    2010-08-20

    ... Initiative: Customer Relationship Management. Component: DHS Wide. Date of approval: December 10, 2009. The... Intergovernmental Affairs, are developing the Customer Relationship Management (CRM), a data management tool being... PIA because TEAL retrieves PII from USCIS and DHS systems. System: Bond Management Information System...

  7. Lack of evidence for integration of Trypanosoma cruzi minicircle DNA in South American human genomes

    Czech Academy of Sciences Publication Activity Database

    Flegontova, Olga; Lukeš, Julius; Flegontov, Pavel

    2012-01-01

    Roč. 42, č. 5 (2012), s. 437-441 ISSN 0020-7519 Grant - others:GA MŠk(CZ) LM2010005 Institutional support: RVO:60077344 Keywords : Trypanosoma cruzi * Kinetoplast minicircle * Chagas disease * Horizontal gene transfer * Human genome Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.637, year: 2012 http://www.sciencedirect.com/science/article/pii/S0020751912000781

  8. A new approach to model mixed hydrates

    Czech Academy of Sciences Publication Activity Database

    Hielscher, S.; Vinš, Václav; Jäger, A.; Hrubý, Jan; Breitkopf, C.; Span, R.

    2018-01-01

    Roč. 459, March (2018), s. 170-185 ISSN 0378-3812 R&D Projects: GA ČR(CZ) GA17-08218S Institutional support: RVO:61388998 Keywords : gas hydrate * mixture * modeling Subject RIV: BJ - Thermodynamics Impact factor: 2.473, year: 2016 https://www.sciencedirect.com/science/article/pii/S0378381217304983

  9. Effects of cold acclimation on rectal macromorphology, ultrastructure, and cytoskeletal stability in Gryllus pennsylvanicus crickets

    Czech Academy of Sciences Publication Activity Database

    Des Marteaux, Lauren E.; Stinziano, J. R.; Sinclair, B. J.

    2018-01-01

    Roč. 104, JAN 10 (2018), s. 15-24 ISSN 0022-1910 Institutional support: RVO:60077344 Keywords : insect * phenotypic plasticity * actin Subject RIV: ED - Physiology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 2.227, year: 2016 https://www.sciencedirect.com/science/article/pii/S0022191017302925?via%3Dihub

  10. Hydrate failure in ITZ governs concrete strength: A micro-to-macro validated engineering mechanics model

    Czech Academy of Sciences Publication Activity Database

    Königsberger, M.; Hlobil, Michal; Delsaute, B.; Staquet, S.; Hellmich, C.; Pichler, B.

    2018-01-01

    Roč. 103, č. 1 (2018), s. 77-94 ISSN 0008-8846 Institutional support: RVO:68378297 Keywords : compressive strength * micromechanics * cement paste * concrete * modeling Subject RIV: JM - Building Engineering OBOR OECD: Construction engineering, Municipal and structural engineering Impact factor: 4.762, year: 2016 http://www.sciencedirect.com/science/article/pii/S0008884617302934?via%3Dihub

  11. The effect of cold acclimation on active ion transport in cricket ionoregulatory tissues

    Czech Academy of Sciences Publication Activity Database

    Des Marteaux, Lauren E.; Khazraeenia, S.; Yerushalmi, G. Y.; Donini, A.; Li, N. G.; Sinclair, B. J.

    2018-01-01

    Roč. 216, FEB 01 (2018), s. 28-33 ISSN 1095-6433 Institutional support: RVO:60077344 Keywords : insect * Gryllus * malpighian tubules Subject RIV: ED - Physiology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 1.812, year: 2016 https://www.sciencedirect.com/science/article/pii/S1095643317302519?via%3Dihub

  12. Management of semi-natural grasslands benefiting both planbt and insect diversity: The importance of heterogeneity and tradition

    Czech Academy of Sciences Publication Activity Database

    Bonari, G.; Fajmon, K.; Malenovský, I.; Zelený, D.; Holuša, J.; Jongepierová, I.; Kočárek, P.; Konvička, Ondřej; Uřičář, J.; Chytrý, M.

    2017-01-01

    Roč. 246, AUG 01 (2017), s. 243-252 ISSN 0167-8809 Institutional support: RVO:60077344 Keywords : Carabidae * conservation management * Lepidoptera Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 4.099, year: 2016 http://www.sciencedirect.com/science/article/pii/S0167880917302530

  13. Synthesis and characterization of Bi.sub.1-x./sub.Nd.sub.x./sub.FeO.sub.3./sub. thin films deposited using a high throughput physical vapour deposition technique

    Czech Academy of Sciences Publication Activity Database

    Darby, M.S.B.; Karpinsky, D.V.; Pokorný, Jan; Guerin, D.; Kholkin, A. L.; Miao, S.; Haydn, B.E.; Reaney, I. M.

    2013-01-01

    Roč. 531, MAR (2013), s. 56-60 ISSN 0040-6090 Institutional support: RVO:68378271 Keywords : bismuth ferrite * piezoelectric * neodymium doped * high throughput * combinatorial * physical vapour deposition Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.867, year: 2013 http://www.sciencedirect.com/science/article/pii/S004060901201646X

  14. Global existence and uniqueness result for the diffusive Peterlin viscoelastic model

    Czech Academy of Sciences Publication Activity Database

    Medviďová-Lukáčová, M.; Mizerová, H.; Nečasová, Šárka

    2015-01-01

    Roč. 120, June (2015), s. 154-170 ISSN 0362-546X R&D Projects: GA ČR GA13-00522S Institutional support: RVO:67985840 Keywords : Peterlin viscoelastic model * existence * uniqueness Subject RIV: BA - General Mathematics Impact factor: 1.125, year: 2015 http://www.sciencedirect.com/science/article/pii/S0362546X1500070X

  15. Standard reference data for the air-liquid and vapor-liquid surface tension of benzene

    Czech Academy of Sciences Publication Activity Database

    Součková, Monika; Klomfar, Jaroslav; Pátek, Jaroslav

    2013-01-01

    Roč. 356, October (2013), s. 329-337 ISSN 0378-3812 R&D Projects: GA ČR GA101/09/0010 Institutional support: RVO:61388998 Keywords : benzene * surface tension * experimental data * standard reference data Subject RIV: BJ - Thermodynamics Impact factor: 2.241, year: 2013 http://www.sciencedirect.com/science/article/pii/S0378381213004196

  16. Restricting uniformly open surjections

    Czech Academy of Sciences Publication Activity Database

    Kania, Tomasz; Rmoutil, M.

    2017-01-01

    Roč. 355, č. 9 (2017), s. 925-928 ISSN 1631-073X Institutional support: RVO:67985840 Keywords : Banach space * uniform spaces Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.396, year: 2016 http://www.sciencedirect.com/science/article/pii/S1631073X17302261?via%3Dihub

  17. Fluid mechanics of needle valves with rounded components Part III: Pressure distributions on walls

    Czech Academy of Sciences Publication Activity Database

    Tesař, Václav

    2016-01-01

    Roč. 248, September (2016), s. 138-147 ISSN 0924-4247 R&D Projects: GA ČR GA13-23046S Institutional support: RVO:61388998 Keywords : needle valves * pressure measurements * valves Subject RIV: BK - Fluid Dynamics Impact factor: 2.499, year: 2016 http://www.sciencedirect.com/science/article/pii/S0924424716303417

  18. Asymptotic formulae for solutions of half-linear differential equations

    Czech Academy of Sciences Publication Activity Database

    Řehák, Pavel

    2017-01-01

    Roč. 292, January (2017), s. 165-177 ISSN 0096-3003 Institutional support: RVO:67985840 Keywords : half-linear differential equation * nonoscillatory solution * regular variation Subject RIV: BA - General Mathematics OBOR OECD: Applied mathematics Impact factor: 1.738, year: 2016 http://www.sciencedirect.com/science/article/pii/S0096300316304581

  19. On a kind of symmetric weakly non-linear ordinary differential systems

    Czech Academy of Sciences Publication Activity Database

    Fečkan, M.; Rontó, András; Dilna, N.

    2016-01-01

    Roč. 140, č. 2 (2016), s. 188-230 ISSN 0007-4497 Institutional support: RVO:67985840 Keywords : symmetric solution * symmetry * periodic solution Subject RIV: BA - General Mathematics Impact factor: 0.750, year: 2016 http://www.sciencedirect.com/science/article/pii/S0007449715000895

  20. Imaging of human tooth using ultrasound based chirp-coded nonlinear time reversal acoustics

    Czech Academy of Sciences Publication Activity Database

    Dos Santos, S.; Převorovský, Zdeněk

    2011-01-01

    Roč. 51, č. 6 (2011), s. 667-674 ISSN 0041-624X Institutional research plan: CEZ:AV0Z20760514 Keywords : TR-NEWS * chirp-coded excitation * echodentography * ultrasonic imaging Subject RIV: BI - Acoustics Impact factor: 1.838, year: 2011 http://www.sciencedirect.com/science/article/pii/S0041624X11000229

  1. Robustness of one-dimensional viscous fluid motion under multidimensional perturbations

    Czech Academy of Sciences Publication Activity Database

    Feireisl, Eduard; Sun, Y.

    2015-01-01

    Roč. 259, č. 12 (2015), s. 7529-7539 ISSN 0022-0396 EU Projects: European Commission(XE) 320078 - MATHEF Institutional support: RVO:67985840 Keywords : compressible Navier-Stokes equations * 1-D compressible fluid flow * relative energy Subject RIV: BA - General Mathematics Impact factor: 1.821, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022039615004325

  2. Disconnected rational homotopy theory

    Czech Academy of Sciences Publication Activity Database

    Lazarev, A.; Markl, Martin

    2015-01-01

    Roč. 283, 1 October (2015), s. 303-361 ISSN 0001-8708 Institutional support: RVO:67985840 Keywords : closed model category * differential graded Lie algebra * Maurer-Cartan simplicial set Subject RIV: BA - General Mathematics Impact factor: 1.405, year: 2015 http://www.sciencedirect.com/science/article/pii/S0001870815002479

  3. Influence of stress on the permeability of coal and sedimentary rocks of the Upper Silesian Basin

    Czech Academy of Sciences Publication Activity Database

    Konečný, Pavel; Kožušníková, Alena

    2011-01-01

    Roč. 48, č. 2 (2011), s. 347-352 ISSN 1365-1609 Institutional research plan: CEZ:AV0Z30860518 Keywords : permeability * triaxial test * coal and sedimentary rocks Subject RIV: DH - Mining, incl. Coal Mining Impact factor: 1.272, year: 2011 http://www.sciencedirect.com/science/article/pii/S1365160910002194

  4. How differential management strategies affect Ips typographus L. dispersal

    Czech Academy of Sciences Publication Activity Database

    Montano, V.; Bertheau, C.; Doležal, Petr; Krumböck, S.; Okrouhlík, Jan; Stauffer, CH.; Moodley, Y.

    2016-01-01

    Roč. 360, 15 JAN (2016), s. 195-204 ISSN 0378-1127 R&D Projects: GA ČR GAP504/10/0843 Institutional support: RVO:60077344 Keywords : bark beetle outbreaks * management strategies * dispersal Subject RIV: EH - Ecology, Behaviour Impact factor: 3.064, year: 2016 http://www.sciencedirect.com/science/article/pii/S0378112715005940

  5. Analysis of biodiversity experiments: A comparison of traditional and linear-model-based methods

    Czech Academy of Sciences Publication Activity Database

    Fibich, P.; Rychtecká, T.; Lepš, Jan

    2015-01-01

    Roč. 63, Feb 12 (2015), s. 47-55 ISSN 1146-609X Institutional support: RVO:60077344 Keywords : biodiversity effects * diversity-interactions models * species identity Subject RIV: EH - Ecology, Behaviour Impact factor: 1.420, year: 2015 http://www.sciencedirect.com/science/article/pii/S1146609X15000181

  6. Recent advances in the vertical coupling in the Atmosphere–Ionosphere System

    Czech Academy of Sciences Publication Activity Database

    Koucká Knížová, Petra; Georgieva, K.; Ward, W.; Yiğit, E.

    136 B, Special Issue (2015), s. 125-125 ISSN 1364-6826 Institutional support: RVO:68378289 Keywords : ionosphere * neutral atmosphere * atmospheric waves Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 1.463, year: 2015 http://www.sciencedirect.com/science/article/pii/S1364682615001765

  7. The effects of adhesive forces on the collision behavior of polyolefin particles

    Czech Academy of Sciences Publication Activity Database

    Ledvinková, Blanka; Kosek, J.

    2013-01-01

    Roč. 243, July (2013), s. 27-39 ISSN 0032-5910 R&D Projects: GA ČR GA103/09/2066 Institutional support: RVO:67985874 Keywords : adhersive forces * agglomeration * chain entanglement * discrete element method * gas polymerization Subject RIV: BK - Fluid Dynamics Impact factor: 2.269, year: 2013 http://www.sciencedirect.com/science/article/pii/S0032591013002362

  8. Special Issue: Recent Progress in the Vertical Coupling in the Atmosphere-Ionosphere System\

    Czech Academy of Sciences Publication Activity Database

    Pancheva, D.; Shiokawa, K.; Knížová, Petra; Wan, W.

    90-91, Special Issue (2012), s. 5-6 ISSN 1364-6826 Institutional support: RVO:68378289 Keywords : ionosphere * neutral atmosphere * atmospheric waves Subject RIV: DG - Athmosphere Sciences, Meteorology OBOR OECD: Meteorology and atmospheric sciences Impact factor: 1.417, year: 2012 http://www.sciencedirect.com/science/article/pii/S1364682612002581?via%3Dihub

  9. Modeling receptor-mediated endocytosis of polymer-functionalized iron oxide nanoparticles by human macrophages

    Czech Academy of Sciences Publication Activity Database

    Lunov, O.; Zablotskyy, Vitaliy A.; Syrovets, T.; Röcker, C.; Tron, K.; Nienhaus, G.U.; Simmet, T.

    2011-01-01

    Roč. 32, č. 2 (2011), s. 547-555 ISSN 0142-9612 Institutional research plan: CEZ:AV0Z10100522 Keywords : macrophage * nanoparticle * bioabsorption * modeling * antisense * MRI (magnetic resonance imaging) Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 7.404, year: 2011 http://www.sciencedirect.com/science/article/pii/S014296121001149X

  10. 78 FR 43182 - Proposed Collection; Comment Request

    Science.gov (United States)

    2013-07-19

    ... Provisioning System (AMPS); OMB Control Number: 0730-TBD. Needs and Uses: The information collection... system to obtain PII information for users. All users are required to set-up a user account to use AMPS... user account. Any user that is not issued a CAC will enter their information into AMPS to create a user...

  11. Basophil Sensitivity Decreases During the Updosing of SCIT in Subjects Allergic to Grass Pollen

    DEFF Research Database (Denmark)

    Schmid, Johannes Martin; Dahl, Ronald; Hoffmann, Hans Jürgen

    ).This corresponds to an approximately 14-fold reduction in basophil sensitivity. No significant changes were observed in the baseline, washed cells or control group. CONCLUSIONS: We show that the main mechanism leading to a reduction of basophil sensitivity is humoral. PII: S0091-6749(10)02749-1 doi:10.1016...

  12. Acoustic emission for interlaminar toughness testing of CFRP: Evaluation of the crack growth due to burst analysis

    Czech Academy of Sciences Publication Activity Database

    Lissek, F.; Haegerb, A.; Knoblauch, V.; Hloch, Sergej; Pude, F.; Kaufeld, M.

    2018-01-01

    Roč. 136, č. 1 (2018), s. 55-62 ISSN 1359-8368 Institutional support: RVO:68145535 Keywords : DCB * interlaminar toughness testing * acoustic emission * CFRP * burst analysis Subject RIV: JQ - Machines ; Tools Impact factor: 4.727, year: 2016 http://www.sciencedirect.com/science/article/pii/S1359836817313720

  13. A note on SAT algorithms and proof complexity

    Czech Academy of Sciences Publication Activity Database

    Krajíček, Jan

    2012-01-01

    Roč. 112, č. 12 (2012), s. 490-493 ISSN 0020-0190 R&D Projects: GA AV ČR IAA100190902 Institutional research plan: CEZ:AV0Z10190503 Keywords : computational complexity Subject RIV: BA - General Mathematics Impact factor: 0.488, year: 2012 http://www.sciencedirect.com/science/article/pii/S0020019012000774

  14. Circuit lower bounds in bounded arithmetics

    Czech Academy of Sciences Publication Activity Database

    Pich, Ján

    2015-01-01

    Roč. 166, č. 1 (2015), s. 29-45 ISSN 0168-0072 R&D Projects: GA AV ČR IAA100190902 Keywords : bounded arithmetic * circuit lower bounds Subject RIV: BA - General Mathematics Impact factor: 0.582, year: 2015 http://www.sciencedirect.com/science/article/pii/S0168007214000888

  15. Effective computing algorithm for maintenance optimization of highly reliable systems

    Czech Academy of Sciences Publication Activity Database

    Briš, R.; Byczanski, Petr

    2013-01-01

    Roč. 109, č. 1 (2013), s. 77-85 ISSN 0951-8320 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0070 Institutional support: RVO:68145535 Keywords : exact computing * maintenance * optimization * unavailability Subject RIV: BA - General Mathematics Impact factor: 2.048, year: 2013 http://www.sciencedirect.com/science/article/pii/S0951832012001639

  16. Computable majorants of the limit load in Hencky's plasticity problems

    Czech Academy of Sciences Publication Activity Database

    Repin, S.; Sysala, Stanislav; Haslinger, Jaroslav

    2018-01-01

    Roč. 75, č. 1 (2018), s. 199-217 ISSN 0898-1221 R&D Projects: GA MŠk LQ1602 Institutional support: RVO:68145535 Keywords : computable bounds * divergence free fields * Hencky's plasticity * limit load * penalization Subject RIV: BA - General Mathematics Impact factor: 1.531, year: 2016 http://www.sciencedirect.com/science/article/pii/S0898122117305552

  17. Critical frequency and maximum electron density of F2 region over four stations in the North American sector

    Czech Academy of Sciences Publication Activity Database

    Ezquer, R. G.; Cabrera, M. A.; López, J. L.; Albornoz, M. R.; Mosert, M.; Marcó, P.; Burešová, Dalia

    2011-01-01

    Roč. 73, č. 4 (2011), s. 420-429 ISSN 1364-6826 Institutional research plan: CEZ:AV0Z30420517 Keywords : Ionosphere * F2 region * Critical frequency * Electron density * Model Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 1.596, year: 2011 http://www.sciencedirect.com/science/article/pii/S1364682610002786

  18. Accuracy of tracer stimulus response experiments in laminar flows

    Czech Academy of Sciences Publication Activity Database

    Chlup, Hynek; Novotný, Pavel; Žitný, R.

    2012-01-01

    Roč. 55, 23-24 (2012), s. 6458-6462 ISSN 0017-9310 Institutional research plan: CEZ:AV0Z20760514 Keywords : residence time distribution * tracer injection * laminar convective dominated flow Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 2.315, year: 2012 http://www.sciencedirect.com/science/article/pii/S001793101200470X

  19. Oscillatory properties of solutions to certain two-dimensional systems of non-linear ordinary differential equations

    Czech Academy of Sciences Publication Activity Database

    Dosoudilová, M.; Lomtatidze, Alexander; Šremr, Jiří

    2015-01-01

    Roč. 120, June (2015), s. 57-75 ISSN 0362-546X Institutional support: RVO:67985840 Keywords : half-linear system * Hartman -Wintner theorem * Kamenev theorem Subject RIV: BA - General Mathematics Impact factor: 1.125, year: 2015 http://www.sciencedirect.com/science/article/pii/S0362546X15000620

  20. Analysis of an operator-differential model for magnetostrictive energy harvesting

    Czech Academy of Sciences Publication Activity Database

    Davino, D.; Krejčí, Pavel; Pimenov, A.; Rachinskii, D.; Visone, C.

    2016-01-01

    Roč. 39, October (2016), s. 504-519 ISSN 1007-5704 R&D Projects: GA ČR(CZ) GA15-12227S Institutional support: RVO:67985840 Keywords : magnetostrictive materials * hysteresis * energy harvesting Subject RIV: BA - General Mathematics Impact factor: 2.784, year: 2016 http://www.sciencedirect.com/science/article/pii/S100757041630106X

  1. Victims of agricultural intensification: Mowing date affects Rhinanthus spp. regeneration and fruit ripening

    Czech Academy of Sciences Publication Activity Database

    Blažek, P.; Lepš, Jan

    2015-01-01

    Roč. 211, Dec 15 (2015), s. 10-16 ISSN 0167-8809 Institutional support: RVO:60077344 Keywords : yellow rattle * hemiparasite * agri-environmental schemes Subject RIV: EH - Ecology, Behaviour Impact factor: 3.564, year: 2015 http://www.sciencedirect.com/science/article/pii/S0167880915001553

  2. Enterocytozoon bieneusi and Encephalitozoon cuniculi in horses kept under different management systems in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Wagnerová, Pavla; Sak, Bohumil; Květoňová, Dana; Buňatová, Z.; Civišová, H.; Maršálek, M.; Kváč, Martin

    2012-01-01

    Roč. 190, 3-4 (2012), s. 573-577 ISSN 0304-4017 Institutional support: RVO:60077344 Keywords : Horse * Enterocytozoon bieneusi * Encephalitozoon cuniculi * PCR * ITS * Natural infection Subject RIV: EA - Cell Biology Impact factor: 2.381, year: 2012 http://www.sciencedirect.com/science/article/pii/S0304401712003676

  3. U.S. EPA, Pesticide Product Label, DIURON MUP, 06/20/2007

    Science.gov (United States)

    2011-04-21

    ... tl:J.~''' L'B )'\\:iri'.-:.I.lnE~!o"i~·'·· I'~'n',;,:t.!,~. uec 'i,;joc~lclru.Ao:., I co!. :;.y,.,..J':"Q ..... j L~:' tl'-~ pop,i:c~ J'o':.,istc?((: ~1!..c-+ ... l..h~~~".p.~-I'I2. I ...

  4. Ablation of (GeS2)0.3(Sb2S3)0.7 glass with an ultra – violet nano-second laser

    Czech Academy of Sciences Publication Activity Database

    Knotek, P.; Návesník, J.; Černohorský, T.; Kincl, Miloslav; Vlček, Milan; Tichý, Ladislav

    2015-01-01

    Roč. 64, April (2015), s. 42-50 ISSN 0025-5408 Institutional support: RVO:61389013 Keywords : chalcogenides * glass * atomic force microscopy Subject RIV: CA - Inorganic Chemistry Impact factor: 2.435, year: 2015 http://www.sciencedirect.com/science/article/pii/S0025540814007843

  5. Comparison of precipitation nowcasting by extrapolation and statistical-advection methods

    Czech Academy of Sciences Publication Activity Database

    Sokol, Zbyněk; Kitzmiller, D.; Pešice, Petr; Mejsnar, Jan

    2013-01-01

    Roč. 123, 1 April (2013), s. 17-30 ISSN 0169-8095 R&D Projects: GA MŠk ME09033 Institutional support: RVO:68378289 Keywords : Precipitation forecast * Statistical models * Regression * Quantitative precipitation forecast * Extrapolation forecast Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 2.421, year: 2013 http://www.sciencedirect.com/science/article/pii/S0169809512003390

  6. First experience with the application of the METRo model in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Sokol, Zbyněk; Zacharov, Petr, jr.; Sedlák, Pavel; Hošek, Jiří; Bližňák, Vojtěch; Chládová, Zuzana; Pešice, Petr; Škuthan, M.

    2014-01-01

    Roč. 143, 15 June 2014 (2014), s. 1-16 ISSN 0169-8095 R&D Projects: GA TA ČR(CZ) TA01031509 Institutional support: RVO:68378289 Keywords : road meteorology * road surface conditions * forecasting model Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 2.844, year: 2014 http://www.sciencedirect.com/science/article/pii/S0169809514000192

  7. Photoperiodic time measurement in insects

    Czech Academy of Sciences Publication Activity Database

    Doležel, David

    2015-01-01

    Roč. 7, Feb 02 (2015), s. 98-103 ISSN 2214-5745 R&D Projects: GA ČR GC14-32654J; GA MŠk LH14029 Institutional support: RVO:60077344 Keywords : photoperiodic time Subject RIV: ED - Physiology Impact factor: 2.719, year: 2015 http://www.sciencedirect.com/science/article/pii/S2214574514001576

  8. Fraisse sequences: category-theoretic approach to universal homogeneous structures

    Czech Academy of Sciences Publication Activity Database

    Kubiś, Wieslaw

    2014-01-01

    Roč. 165, č. 11 (2014), s. 1755-1811 ISSN 0168-0072 R&D Projects: GA ČR(CZ) GAP201/12/0290 Institutional support: RVO:67985840 Keywords : universal homogeneous object * Fraissé sequence * amalgamation Subject RIV: BA - General Mathematics Impact factor: 0.548, year: 2014 http://www.sciencedirect.com/science/article/pii/S0168007214000773

  9. The structure of Valdivia compact lines

    Czech Academy of Sciences Publication Activity Database

    Kalenda, O.F.K.; Kubiś, Wieslaw

    2010-01-01

    Roč. 157, č. 7 (2010), s. 1142-1151 ISSN 0166-8641 R&D Projects: GA AV ČR IAA100190901 Institutional research plan: CEZ:AV0Z10190503 Keywords : valdivia compact line * increasing map * retraction Subject RIV: BA - General Mathematics Impact factor: 0.447, year: 2010 http://www.sciencedirect.com/science/article/pii/S0166864110000374

  10. Assessing the Impact of Security Behavior on the Awareness of Open-Source Intelligence: A Quantitative Study of IT Knowledge Workers

    Science.gov (United States)

    Daniels, Daniel B., III

    2014-01-01

    There is a lack of literature linking end-user behavior to the availability of open-source intelligence (OSINT). Most OSINT literature has been focused on the use and assessment of open-source intelligence, not the proliferation of personally or organizationally identifiable information (PII/OII). Additionally, information security studies have…

  11. Molecular evidence of shared hookworm Ancylostoma tubaeforme haplotypes between the critically endangered Iberian lynx and sympatric domestic cats

    Czech Academy of Sciences Publication Activity Database

    Millán, J.; Blasco-Costa, Maria Isabel

    2012-01-01

    Roč. 186, 3-4 (2012), s. 518-522 ISSN 0304-4017 Institutional support: RVO:60077344 Keywords : Ancylostomiasis * Hookworm * Reservoir * Spain Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.381, year: 2012 http://www.sciencedirect.com/science/article/pii/S030440171100759X#

  12. 76 FR 35052 - Privacy Act of 1974: New System of Records

    Science.gov (United States)

    2011-06-15

    ...; or (4) The United States, when OPM determines that litigation is likely to affect OPM or any of its... dependents: a. Personally identifiable Information (PII) (Name, Social Security Number, Date of Birth, Gender, and FEHBP Member ID number). b. Home Address. c. Covered dependent information (Spouse, Dependents...

  13. Oscillation and nonoscillation results for solutions of half-linear equations with deviated argument

    Czech Academy of Sciences Publication Activity Database

    Drábek, P.; Kufner, Alois; Kuliev, K.

    2017-01-01

    Roč. 447, č. 1 (2017), s. 371-382 ISSN 0022-247X Institutional support: RVO:67985840 Keywords : half-linear equation * oscillatory solution * nonoscillatory solution Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.064, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022247X16306059

  14. Discussion of "On the interpretation of the logarithmic strain tensor in an arbitrary system of representation" by M. Latorre and FJ Montans

    Czech Academy of Sciences Publication Activity Database

    Fiala, Zdeněk

    56/57, March (2015), s. 290-291 ISSN 0020-7683 Institutional support: RVO:68378297 Keywords : logarithmic strain tensor * evolution equations of Lie type * finite deformations * solid mechanics Subject RIV: JN - Civil Engineering Impact factor: 2.081, year: 2015 http://www.sciencedirect.com/science/article/pii/S002076831400448X

  15. Solvability conditions for non-local boundary value problems for two-dimensional half-linear differential systems

    Czech Academy of Sciences Publication Activity Database

    Kiguradze, I.; Šremr, Jiří

    2011-01-01

    Roč. 74, č. 17 (2011), s. 6537-6552 ISSN 0362-546X Institutional research plan: CEZ:AV0Z10190503 Keywords : half-linear differential system * non-local boundary value problem * solvability Subject RIV: BA - General Mathematics Impact factor: 1.536, year: 2011 http://www.sciencedirect.com/science/article/pii/S0362546X11004573

  16. Dual energy CT inspection of a carbon fibre reinforced plastic composite combined with metal components

    Czech Academy of Sciences Publication Activity Database

    Vavřík, Daniel; Jakůbek, J.; Kumpová, Ivana; Pichotka, M.

    6, Part B, November (2016), s. 47-55 ISSN 2214-6571 R&D Projects: GA MŠk(CZ) LO1219; GA ČR(CZ) GA15-07210S Keywords : dual energy computed tomography * carbon fibre reinforced plastic composite * metal artefact suppression Subject RIV: JI - Composite Material s http://www.sciencedirect.com/science/article/pii/S2214657116300107

  17. The exponentiated Hencky-logarithmic strain energy. Improvement of planar polyconvexity

    Czech Academy of Sciences Publication Activity Database

    Ghiba, I.-D.; Neff, P.; Šilhavý, Miroslav

    2015-01-01

    Roč. 71, May (2015), s. 48-51 ISSN 0020-7462 Institutional support: RVO:67985840 Keywords : finite isotropis elasticity * polyconvexity * logarithmic strain Subject RIV: BA - General Mathematics Impact factor: 1.920, year: 2015 http://www.sciencedirect.com/science/article/pii/S0020746215000190

  18. Poisson-Lie T-duality of string effective actions: A new approach to the dilaton puzzle

    Czech Academy of Sciences Publication Activity Database

    Jurčo, B.; Vysoký, Jan

    2018-01-01

    Roč. 130, August (2018), s. 1-26 ISSN 0393-0440 Institutional support: RVO:67985840 Keywords : Poisson-Lie T- dual ity * string effective actions * dilaton field Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.819, year: 2016 https://www.sciencedirect.com/science/article/pii/S0393044018301748?via%3Dihub

  19. Transmission problem for the Laplace equation and the integral equation method

    Czech Academy of Sciences Publication Activity Database

    Medková, Dagmar

    2012-01-01

    Roč. 387, č. 2 (2012), s. 837-843 ISSN 0022-247X Institutional research plan: CEZ:AV0Z10190503 Keywords : transmission problem * Laplace equation * boundary integral equation Subject RIV: BA - General Mathematics Impact factor: 1.050, year: 2012 http://www.sciencedirect.com/science/article/pii/S0022247X11008985

  20. Dimension theory and forcing

    Czech Academy of Sciences Publication Activity Database

    Zapletal, Jindřich

    2014-01-01

    Roč. 167, April 15 (2014), s. 31-35 ISSN 0166-8641 R&D Projects: GA AV ČR IAA100190902 Institutional support: RVO:67985840 Keywords : Cohen real * infinite dimension * calibrated ideal Subject RIV: BA - General Mathematics Impact factor: 0.551, year: 2014 http://www.sciencedirect.com/science/article/pii/S0166864114001151

  1. Sensitivity analysis of 1−d steady forced scalar conservation laws

    Czech Academy of Sciences Publication Activity Database

    Ersoy, M.; Feireisl, Eduard; Zuazua, E.

    2013-01-01

    Roč. 254, č. 9 (2013), s. 3817-3834 ISSN 0022-0396 R&D Projects: GA ČR GA201/09/0917 Institutional support: RVO:67985840 Keywords : sensitivity * scalar conservation law * control Subject RIV: BA - General Mathematics Impact factor: 1.570, year: 2013 http://www.sciencedirect.com/science/article/pii/S0022039613000892#

  2. Effects of torpedo blasting on rockburst prevention during deep coal seam mining in the Upper Silesian Coal Basin

    Czech Academy of Sciences Publication Activity Database

    Wojtecki, Ł.; Koníček, Petr; Schreiber, J.

    2017-01-01

    Roč. 9, č. 4 (2017), s. 694-701 ISSN 1674-7755 Institutional support: RVO:68145535 Keywords : rockburst prevention * torpedo blasting * seismic effect * Upper Silesian Coal Basin (USCB) Subject RIV: DH - Mining, incl. Coal Mining OBOR OECD: Mining and mineral processing http://www.sciencedirect.com/science/article/pii/S1674775517300896

  3. Electrical Discharge Machining (EDM) Gun Barrel Bore and Rifling Feasibility Study

    Science.gov (United States)

    1974-09-01

    11 I + | , + + in cri es sss asa f^piis aisa -^ nro^ HH^ S I I + VD 1X> ^3 Wfl ^mvo ^00...and high erosion rates encountered in high performance gun designs such as the GAU-7/A DD , :°N RM73 1473 EDITION OF 1 NOV 65 IS OBSOLETE

  4. Direction and stability of bifurcating solutions for a Signorini problem

    Czech Academy of Sciences Publication Activity Database

    Eisner, J.; Kučera, Milan; Recke, L.

    2015-01-01

    Roč. 113, January (2015), s. 357-371 ISSN 0362-546X Institutional support: RVO:67985840 Keywords : Signorini problem * variational inequality * bifurcation direction Subject RIV: BA - General Mathematics Impact factor: 1.125, year: 2015 http://www.sciencedirect.com/science/article/pii/S0362546X14003228

  5. Hydrophobic lime based mortars with linseed oil: Characterization and durability assessment

    Czech Academy of Sciences Publication Activity Database

    Nunes, Cristiana Lara; Slížková, Zuzana

    61-62, July-August (2014), s. 28-39 ISSN 0008-8846 R&D Projects: GA MK(CZ) DF11P01OVV008 Keywords : durability * transport properties * metakaolin * mortar Subject RIV: AL - Art, Architecture, Cultural Heritage Impact factor: 2.864, year: 2014 http://www.sciencedirect.com/science/article/pii/S0008884614000738

  6. Investigation of crushed brick-matrix interface in lime-based ancient mortar by microscopy and nanoindentation

    Czech Academy of Sciences Publication Activity Database

    Nežerka, V.; Němeček, J.; Slížková, Zuzana; Tesárek, P.

    2015-01-01

    Roč. 55, January (2015), s. 122-128 ISSN 0958-9465 R&D Projects: GA MK(CZ) DF11P01OVV008 Keywords : nanoindentation * historic mortars * cocciopesto * reaction rim * ITZ Subject RIV: AL - Art, Architecture, Cultural Heritage Impact factor: 3.399, year: 2015 http://www.sciencedirect.com/science/article/pii/S0958946514001619

  7. Understanding the source of multifractality in financial markets

    Czech Academy of Sciences Publication Activity Database

    Baruník, Jozef; Aste, T.; Di Matteo, T.; Liu, R.

    2012-01-01

    Roč. 391, č. 17 (2012), s. 4234-4251 ISSN 0378-4371 R&D Projects: GA ČR GA402/09/0965 Institutional research plan: CEZ:AV0Z10750506 Keywords : Multifractality * Financial markets * Hurst exponent Subject RIV: AH - Economics Impact factor: 1.676, year: 2012 http://www.sciencedirect.com/science/article/pii/S0378437112002890

  8. On the weak solutions to the equations of a compressible heat conducting gas

    Czech Academy of Sciences Publication Activity Database

    Chiodaroli, E.; Feireisl, Eduard; Kreml, O.

    2015-01-01

    Roč. 32, č. 1 (2015), s. 225-243 ISSN 0294-1449 EU Projects: European Commission(XE) 320078 - MATHEF Institutional support: RVO:67985840 Keywords : Euler-Fourier system * convex integration * weak solution Subject RIV: BA - General Mathematics Impact factor: 2.066, year: 2015 http://www.sciencedirect.com/science/article/pii/S0294144913001339

  9. Transitions in the heartbeat pattern during pupal diapause and adult development in the flesh fly, Sarcophaga crassipalpis

    Czech Academy of Sciences Publication Activity Database

    Sláma, Karel; Denlinger, D. L.

    2013-01-01

    Roč. 59, č. 8 (2013), s. 767-780 ISSN 0022-1910 Grant - others:National Science Foundation(US) IOS-0840772 Institutional support: RVO:60077344 Keywords : overwintering * heartbeat reversal * discontinuous cycles Subject RIV: ED - Physiology Impact factor: 2.500, year: 2013 http://www.sciencedirect.com/science/article/pii/S0022191013001169#

  10. Combining the VAS 3D interpolation method and Wind Atlas methodology to produce a high-resolution wind resource map for the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Hanslian, David; Hošek, Jiří

    2015-01-01

    Roč. 77, May (2015), s. 291-299 ISSN 0960-1481 Institutional support: RVO:68378289 Keywords : wind resource map * wind field modelling * wind measurements * wind climatology * Czech Republic * WAsP Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 3.404, year: 2015 http://www.sciencedirect.com/science/article/pii/S0960148114008398#

  11. Marine renewable energy: The ecological implications of altering the hydrodynamics of the marine environment

    Czech Academy of Sciences Publication Activity Database

    Shields, M. A.; Wolf, D. K.; Grist, Erik P. M.; Kerr, S. A.; Jackson, A. C.; Harris, R. E.; Bell, M. C.; Beharie, R.; Want, A.; Osalusi, E.; Gibb, S. W.; Side, J.

    2011-01-01

    Roč. 54, č. 1 (2011), s. 2-9 ISSN 0964-5691 Institutional research plan: CEZ:AV0Z50070508 Keywords : tidal current energy * suspension feeders * sediment dynamics Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.333, year: 2011 http://www.sciencedirect.com/science/article/pii/S0964569110001924

  12. Where AD plants wildly grow: The spatio-temporal diffusion of agricultural biogas production in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Martinát, Stanislav; Navrátil, J.; Dvořák, Petr; Van der Horst, D.; Klusáček, Petr; Kunc, Josef; Frantál, Bohumil

    2016-01-01

    Roč. 95, September 2016 (2016), s. 85-97 ISSN 0960-1481 Institutional support: RVO:68145535 Keywords : agricultural anaerobic digestion plants * Czech Republic * spatial determinants * Spatial analysis Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 4.357, year: 2016 http://www.sciencedirect.com/science/article/pii/S0960148116302610

  13. Finding the energy source for self-propagating high-temperature synthesis production of NiTi shape memory alloy

    Czech Academy of Sciences Publication Activity Database

    Novák, P.; Školáková, A.; Pignol, D.; Průša, F.; Salvetr, P.; Kubatík, Tomáš František; Perriere, L.; Karlík, M.

    2016-01-01

    Roč. 181, September (2016), s. 295-300 ISSN 0254-0584 Institutional support: RVO:61389021 Keywords : NiTi * Shape memory alloys * Powder metallurgy * Microstructure Subject RIV: JG - Metallurgy Impact factor: 2.084, year: 2016 http://www.sciencedirect.com/science/article/pii/S025405841630476X

  14. Uncovering the benefits of fluctuating thermal regimes on cold tolerance of drosophila flies by combined metabolomic and lipidomic approach

    Czech Academy of Sciences Publication Activity Database

    Colinet, H.; Renault, D.; Javal, M.; Berková, Petra; Šimek, Petr; Košťál, Vladimír

    2016-01-01

    Roč. 1861, č. 11 (2016), s. 1736-1745 ISSN 1388-1981 R&D Projects: GA ČR GA13-18509S Institutional support: RVO:60077344 Keywords : cold stress * fluctuating thermal regimes * recovery Subject RIV: ED - Physiology Impact factor: 5.547, year: 2016 http://www.sciencedirect.com/science/article/pii/S1388198116302281

  15. 76 FR 19110 - Published Privacy Impact Assessments on the Web

    Science.gov (United States)

    2011-04-06

    ... Citizenship and Immigration Services (USCIS). Date of approval: May 4, 2010. The Verification Division of... LAN collect PII. System: Digital Mail Pilot Program. Component: DHS Wide. Date of approval: June 18, 2010. The DHS Office of the Chief Administrative Officer (OCAO) has implemented a Digital Mail Pilot...

  16. The Katowice problem and autohomeomorphisms of $omega_0^*$

    Czech Academy of Sciences Publication Activity Database

    Chodounský, David; Dow, A.; Hart, K.P.; de Vries, H.

    2016-01-01

    Roč. 213, November 1 (2016), s. 230-237 ISSN 0166-8641 R&D Projects: GA ČR(CZ) GF15-34700L Institutional support: RVO:67985840 Keywords : Katowice problem * homeomorphism * non-trivial autohomeomorphism Subject RIV: BA - General Mathematics Impact factor: 0.377, year: 2016 http://www.sciencedirect.com/science/article/pii/S0166864116301808

  17. Molecular characterization, tissue distribution, and ultrastructural localization of adipokinetic hormones in the CNS of the firebug Pyrrhocoris apterus (Heteroptera, Insecta)

    Czech Academy of Sciences Publication Activity Database

    Kodrík, Dalibor; Stašková, Tereza; Jedličková, V.; Weyda, F.; Závodská, Radka; Pflegerová, Jitka

    2015-01-01

    Roč. 210, Jan 1 (2015), s. 1-11 ISSN 0016-6480 R&D Projects: GA ČR GA14-07172S Institutional support: RVO:60077344 Keywords : AKH * pre-pro-hormone * insect brain Subject RIV: ED - Physiology Impact factor: 2.667, year: 2015 http://www.sciencedirect.com/science/article/pii/S0016648014004158

  18. Hormonal enhancement of insecticide efficacy in Tribolium castaneum: Oxidative stress and metabolic aspects

    Czech Academy of Sciences Publication Activity Database

    Plavšin, Ivana; Stašková, Tereza; Šerý, Michal; Smýkal, Vlastimil; Hackenberger, B. K.; Kodrík, Dalibor

    2015-01-01

    Roč. 170, APR 07 (2015), s. 19-27 ISSN 1532-0456 R&D Projects: GA ČR GA14-07172S Institutional support: RVO:60077344 Keywords : adipokinetic hormone * insecticide * RNA interference Subject RIV: ED - Physiology Impact factor: 2.546, year: 2015 http://www.sciencedirect.com/science/article/pii/S153204561500006X

  19. Structural and magnetic properties of (NdBa)MnO.sub.3./sub. films on lattice-matched substrates

    Czech Academy of Sciences Publication Activity Database

    Khoryushin, A.V.; Mozhaeva, J.E.; Mozhaev, P.B.; Yurchenko, V. V.; Stupakov, Oleksandr; Pan, A.V.; Jacobsen, C.S.; Hansen, J.B.

    2013-01-01

    Roč. 333, MAY (2013), s. 53-62 ISSN 0304-8853 Institutional support: RVO:68378271 Keywords : CMR manganite * NdBa)MnO 3 * substrate-induced strain * oxygen deficiency Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.002, year: 2013 http://www.sciencedirect.com/science/article/pii/S0304885312010049

  20. Accumulation of free amino acids during exposure to drought in three springtail species

    Czech Academy of Sciences Publication Activity Database

    Holmstrup, M.; Slotsbo, S.; Rozsypal, Jan; Henriksen, P. G.; Bayley, M.

    2015-01-01

    Roč. 82, NOV 01 (2015), s. 114-121 ISSN 0022-1910 EU Projects: European Commission(XE) 316304 - MODBIOLIN Institutional support: RVO:60077344 Keywords : collembola * desiccation * osmoregulation Subject RIV: ED - Physiology Impact factor: 2.267, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022191015001912

  1. The response of Phasmarhabditis hermaphrodita (Nematoda: Rhabditidae) and Steinernema feltiae (Nematoda: Steinernematidae) to different host-associated cues

    Czech Academy of Sciences Publication Activity Database

    Nermuť, Jiří; Půža, Vladimír; Mráček, Zdeněk

    2012-01-01

    Roč. 61, č. 3 (2012), s. 201-206 ISSN 1049-9644 R&D Projects: GA MŠk(CZ) ME10078 Institutional research plan: CEZ:AV0Z50070508 Keywords : chemoattraciton * entomopathogenic nematode * gastropod parasitic nematode Subject RIV: EH - Ecology, Behaviour Impact factor: 1.917, year: 2012 http://www.sciencedirect.com/science/article/pii/S1049964412000436

  2. Precise genome editing in the silkworm Bombyx mori using TALENs and ds- and ssDNA donors – A practical approach

    Czech Academy of Sciences Publication Activity Database

    Takasu, Y.; Kobayashi, I.; Tamura, T.; Uchino, K.; Sezutsu, H.; Žurovec, Michal

    2016-01-01

    Roč. 78, NOV 01 (2016), s. 29-38 ISSN 0965-1748 R&D Projects: GA ČR GA14-27816S Institutional support: RVO:60077344 Keywords : engineered nucleases * HDR * DSB Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.756, year: 2016 http://www.sciencedirect.com/science/article/pii/S0965174816301242

  3. Behavior of the equivalent slab thickness over three European stations

    Czech Academy of Sciences Publication Activity Database

    Mosert, M.; Magdaleno, S.; Burešová, Dalia; Altadill, D.; Gende, M.; Gularte, E.; Scida, L.

    2013-01-01

    Roč. 51, č. 4 (2013), s. 677-682 ISSN 0273-1177 Institutional support: RVO:68378289 Keywords : Ionospheric slab thickness * F2-layer peak * TEC * European stations Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 1.238, year: 2013 http://www.sciencedirect.com/science/article/pii/S0273117712003754

  4. Generalized elementary functions

    Czech Academy of Sciences Publication Activity Database

    Monteiro, Giselle Antunes; Slavík, A.

    2014-01-01

    Roč. 411, č. 2 (2014), s. 838-852 ISSN 0022-247X Institutional support: RVO:67985840 Keywords : elementary functions * Kurzweil-Stieltjes integral * generalized linear ordinary differential equations * time scale calculus Subject RIV: BA - General Mathematics Impact factor: 1.120, year: 2014 http://www.sciencedirect.com/science/article/pii/S0022247X13009141

  5. Boundary singularity of Poisson and harmonic Bergman kernels

    Czech Academy of Sciences Publication Activity Database

    Engliš, Miroslav

    2015-01-01

    Roč. 429, č. 1 (2015), s. 233-272 ISSN 0022-247X R&D Projects: GA AV ČR IAA100190802 Institutional support: RVO:67985840 Keywords : harmonic Bergman kernel * Poisson kernel * pseudodifferential boundary operators Subject RIV: BA - General Mathematics Impact factor: 1.014, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022247X15003170

  6. Novel iron oxide-silica coreshell powders compacted by using pulsed electric current sintering: optical and magnetic properties

    Czech Academy of Sciences Publication Activity Database

    Mahmed, N.; Heczko, Oleg; Maki, R.; Söderberg, O.; Haimi, E.; Hannula, S.-P.

    2012-01-01

    Roč. 32, č. 11 (2012), s. 2981-2988 ISSN 0955-2219 Institutional research plan: CEZ:AV0Z10100520 Keywords : sintering * SiO 2 * ferrites * grain growth * transparent Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.360, year: 2012 http://www.sciencedirect.com/science/article/pii/S0955221912001240

  7. A novel adipokinetic peptide from the corpus cardiacum of the primitive caeliferan pygmy grasshopper Tetrix subulata (Caelifera, Tetrigidae)

    Czech Academy of Sciences Publication Activity Database

    Gäde, G.; Šimek, Petr; Marco, H. G.

    2015-01-01

    Roč. 68, JUN 01 (2015), s. 43-49 ISSN 0196-9781 R&D Projects: GA ČR GA13-18509S Institutional support: RVO:60077344 Keywords : insects * pygmy grasshoppers * Tetrigidae Subject RIV: EH - Ecology, Behaviour Impact factor: 2.535, year: 2015 http://www.sciencedirect.com/science/article/pii/S0196978115000339

  8. Shock capturing techniques for hphp-adaptive finite elements

    Czech Academy of Sciences Publication Activity Database

    Hierro, A.; Kůs, Pavel; Badia, S.

    2016-01-01

    Roč. 309, 1 September (2016), s. 532-553 ISSN 0045-7825 Institutional support: RVO:67985840 Keywords : hphp-adaptivity * discontinuous Galerkin * shock capturing Subject RIV: BA - General Mathematics Impact factor: 3.949, year: 2016 http://www.sciencedirect.com/science/article/pii/S0045782516305862

  9. Multiaxial ratcheting with advanced kinematic and directional distortional hardening rules

    Czech Academy of Sciences Publication Activity Database

    Feigenbaum, H. P.; Dugdale, J.; Dafalias, Y.F.; Kourousis, K. I.; Plešek, Jiří

    2012-01-01

    Roč. 49, č. 22 (2012), s. 3063-3076 ISSN 0020-7683 R&D Projects: GA MŠk(CZ) ME10024 Institutional research plan: CEZ:AV0Z20760514 Keywords : plasticity * directional distortional hardening * thermodynamics Subject RIV: JJ - Other Materials Impact factor: 1.871, year: 2012 http://www.sciencedirect.com/science/article/pii/S0020768312002612

  10. Numerical responses in resource-based mutualisms: A time scale approach

    Czech Academy of Sciences Publication Activity Database

    Revilla, Tomás A.

    2015-01-01

    Roč. 378, AUG 07 (2015), s. 39-46 ISSN 0022-5193 R&D Projects: GA MŠk(CZ) EE2.3.30.0032 Institutional support: RVO:60077344 Keywords : mutualism * resources * services Subject RIV: EH - Ecology, Behaviour Impact factor: 2.049, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022519315001745

  11. Tithonian-early Berriasian perisphinctoid ammonites from the Stramberk Limestone at Kotouc Quarry near Stramberk, Outer Western Carpathians (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Vašíček, Zdeněk; Skupien, P.

    2016-01-01

    Roč. 64, č. 64 (2016), s. 12-29 ISSN 0195-6671 Institutional support: RVO:68145535 Keywords : Upper Jurassic * Lower Cretaceous * Perisphinctoidea * biostratigraphy * Central Europe Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.015, year: 2016 http://www.sciencedirect.com/science/article/pii/S0195667116300350

  12. Sister broods in the spruce bark beetle, Ips typographus (L.)

    Czech Academy of Sciences Publication Activity Database

    Davídková, Markéta; Doležal, Petr

    2017-01-01

    Roč. 405, DEC 01 (2017), s. 13-21 ISSN 0378-1127 Grant - others:Lesy ČR(CZ) 08/2009-2015 Institutional support: RVO:60077344 Keywords : re-emergence * sister broods * Ips typographus Subject RIV: EH - Ecology, Behaviour OBOR OECD: Zoology Impact factor: 3.064, year: 2016 http://www.sciencedirect.com/science/article/pii/S0378112717309507

  13. Projections of temperature-related excess mortality under climate change scenarios

    Czech Academy of Sciences Publication Activity Database

    Gasparrini, A.; Guo, Y.; Sera, F.; Vicedo-Cabrera, A.M.; Huber, V.; Tong, S.; Coelho, M. S. Z. S.; Saldiva, P. H. N.; Lavigne, E.; Correa, P.M.; Ortega, N. V.; Kan, H.; Osorio, S.; Kyselý, Jan; Urban, Aleš; Jaakkola, J.J.K.; Ryti, N.R.I.; Pascal, M.; Goodman, P.G.; Zeka, A.; Michelozzi, P.; Scortichini, M.; Hashizume, M.; Honda, Y.; Hurtado-Diaz, M.; Cruz, J.C.; Seposo, X.; Kim, H.; Tobias, A.; Iñiguez, C.; Forsberg, B.; Åström, D.O.; Ragettli, M.S.; Guo, Y.L.; Wu, Ch.; Zanobetti, A.; Schwartz, J.; Bell, M.L.; Dang, T.N.; Van, D.D.; Heaviside, C.; Vardoulakis, S.; Hajat, S.; Haines, A.; Armstrong, B.

    2017-01-01

    Roč. 1, č. 9 (2017), e360-e367 ISSN 2542-5196 R&D Projects: GA ČR(CZ) GA16-22000S Institutional support: RVO:68378289 Keywords : climate change scenarios * mortality Subject RIV: DG - Athmosphere Sciences, Meteorology OBOR OECD: Climatic research https://www.sciencedirect.com/science/article/pii/S2542519617301560#!

  14. Sexually transmitted infections and mate-finding Allee effects

    Czech Academy of Sciences Publication Activity Database

    Berec, Luděk; Janoušková, E.; Theuer, M.

    2017-01-01

    Roč. 114, APR 01 (2017), s. 59-69 ISSN 0040-5809 Institutional support: RVO:60077344 Keywords : Allee effect * mating * sexually transmitted disease Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.613, year: 2016 http://www.sciencedirect.com/science/article/pii/S0040580916301186

  15. On the Eulerian formulation of a stress induced platelet activation function

    Czech Academy of Sciences Publication Activity Database

    Bodnár, Tomáš

    2014-01-01

    Roč. 257, November (2014), s. 91-95 ISSN 0025-5564 Institutional support: RVO:61388998 Keywords : blood flow * platelet * stress * activation Subject RIV: BK - Fluid Dynamics Impact factor: 1.303, year: 2014 http://www.sciencedirect.com/science/article/pii/S0025556414001163

  16. Standardization of reflectance measurements in dispersed organic matter: Results of an exercise to improve interlaboratory agreement

    Czech Academy of Sciences Publication Activity Database

    Hackley, P.C.; Araujo, C.V.; Borrego, A.G.; Bouzinos, A.; Cardott, B.J.; Cook, A.C.; Eble, C.; Flores, D.; Gentzis, T.; Goncalves, P.A.; Mendonca Filho, J.G.; Hámor-Vidó, M.; Jelonek, I.; Kommeren, K.; Knowles, W.; Kus, J.; Mastalerz, M.; Menezes, T.R.; Newman, J.; Oikonomopoulos, I.K.; Pawlewicz, M.; Pickel, W.; Potter, J.; Ranasinghe, P.; Read, H.; Reyes, J.; De La Rosa Rodriguez, G.; de Souza, I.V.A.F.; Suárez-Ruiz, I.; Sýkorová, Ivana; Valentine, B.J.

    2015-01-01

    Roč. 59, JAN (2015), s. 22-34 ISSN 0264-8172 Institutional support: RVO:67985891 Keywords : vitrinite reflectance * thermal maturity * shale petroleum systems * microscopy * hydrocarbon exploration Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.788, year: 2015 http://www.sciencedirect.com/science/article/pii/S0264817214002402

  17. Meta-analysis of geographical clines in desiccation tolerance of Indian drosophilids

    Czech Academy of Sciences Publication Activity Database

    Rajpurohit, S.; Nedvěd, Oldřich; Gibbs, A. G.

    2013-01-01

    Roč. 164, č. 2 (2013), s. 391-398 ISSN 1095-6433 Grant - others: National Science Foundation(US) 0723930 Institutional support: RVO:60077344 Keywords : Drosophila * climatic adaptation * geographic variability Subject RIV: EH - Ecology, Behaviour Impact factor: 2.371, year: 2013 http://www.sciencedirect.com/science/article/pii/S109564331200520X

  18. The metric approximation property and Lipschitz-free spaces over subsets of R-N

    Czech Academy of Sciences Publication Activity Database

    Pernecká, Eva; Smith, R.J.

    2015-01-01

    Roč. 199, November (2015), s. 29-44 ISSN 0021-9045 R&D Projects: GA ČR(CZ) GAP201/11/0345 Institutional support: RVO:67985840 Keywords : Lipschitz-free space * approximation property Subject RIV: BA - General Mathematics Impact factor: 0.921, year: 2015 http://www.sciencedirect.com/science/article/pii/S0021904515000970

  19. A hybrid model for the play hysteresis operator

    Czech Academy of Sciences Publication Activity Database

    Al Janaideh, M.; Naldi, R.; Marconi, L.; Krejčí, Pavel

    2013-01-01

    Roč. 430, 1 December (2013), s. 95-98 ISSN 0921-4526 R&D Projects: GA ČR GAP201/10/2315 Institutional support: RVO:67985840 Keywords : hysteresis * hybrid * play Subject RIV: BA - General Mathematics Impact factor: 1.276, year: 2013 http://www.sciencedirect.com/science/article/pii/S0921452613004146

  20. Fatigue properties of magnesium alloy AZ91 processed by severe plastic deformation

    Czech Academy of Sciences Publication Activity Database

    Fintová, Stanislava; Kunz, Ludvík

    2015-01-01

    Roč. 42, FEB (2015), s. 219-228 ISSN 1751-6161 R&D Projects: GA ČR GAP108/10/2001 Institutional support: RVO:68081723 Keywords : AZ91 magnesium alloy * ECAP * Fatigue * Crack initiation Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 2.876, year: 2015 http://www.sciencedirect.com/science/article/pii/S1751616114003713

  1. Spatio-temporal patterns of recurrent slope instabilities affecting undercut slopes in flysch: A dendrogeomorphic approach using broad-leaved trees

    Czech Academy of Sciences Publication Activity Database

    Šilhán, K.; Pánek, T.; Turský, O.; Brázdil, R.; Klimeš, Jan; Kašičková, L.

    2014-01-01

    Roč. 213, MAY 15 (2014), s. 240-254 ISSN 0169-555X Institutional support: RVO:67985891 Keywords : dendrogeomorphology * tree-ring eccentricity * bedrock landslides * hydrometeorological triggers Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 2.577, year: 2013 http://www.sciencedirect.com/science/article/pii/S0169555X14000506

  2. 75 FR 17207 - Electronic On-Board Recorders for Hours-of-Service Compliance

    Science.gov (United States)

    2010-04-05

    ... Carrier Safety Regulations FMI Food Marketing Institute FOIA Freedom of Information Act FONSI Finding of...; Petroleum Marketers Association of America (PMAA); and, the Food Marketing Institute (FMI). State... Association, Inc. PDA Personal Digital Assistant PII Personally Identifiable Information PIA Privacy Impact...

  3. Fabrication of free-standing pure carbon-based composite material with the combination of sp.sup.2./sup.-sp.sup.3./sup. hybridizations

    Czech Academy of Sciences Publication Activity Database

    Varga, Marián; Vretenár, V.; Kotlár, M.; Skakalová, V.; Kromka, Alexander

    2014-01-01

    Roč. 308, JUL (2014), s. 211-215 ISSN 0169-4332 R&D Projects: GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:68378271 Keywords : SWNT buckypaper * diamond * composite structures * MWCVD Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.711, year: 2014 http://www.sciencedirect.com/science/article/pii/S0169433214009118

  4. Microstructure and mechanical properties of Ni1,5Co1,5CrFeTi0,5 high entropy alloy fabricated by mechanical alloying and spark plasma sintering

    Czech Academy of Sciences Publication Activity Database

    Moravčík, I.; Čížek, J.; Zapletal, J.; Kováčová, Z.; Veselý, J.; Minařík, P.; Kitzmantel, E.; Neubauer, E.; Dlouhý, Ivo

    2017-01-01

    Roč. 119, APR (2017), s. 141-150 ISSN 0264-1275 Institutional support: RVO:68081723 Keywords : Multi principal element alloy * Tensile strength * Fracture * Ductility Subject RIV: JL - Materials Fatigue, Friction Mechanics OBOR OECD: Audio engineering, reliability analysis Impact factor: 4.364, year: 2016 http://www.sciencedirect.com/science/article/pii/S0264127517300461

  5. Corrigendum to “Cross-sections of solution funnels” [J. Math. Anal. Appl. 433 (2) (2016) 957–973

    Czech Academy of Sciences Publication Activity Database

    Hájek, Petr Pavel; Vivi, P.

    2016-01-01

    Roč. 435, č. 1 (2016), s. 1017 ISSN 0022-247X Institutional support: RVO:67985840 Keywords : polynomial algebra Subject RIV: BA - General Math ematics Impact factor: 1.064, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022247X15010264

  6. Testing of degradation of alloy 800 H in impure helium at 760 °C

    Czech Academy of Sciences Publication Activity Database

    Berka, J.; Vilémová, Monika; Sajdl, P.

    2015-01-01

    Roč. 464, September (2015), s. 221-229 ISSN 0022-3115 Institutional support: RVO:61389021 Keywords : High temperature corrosion * impure helium * 800 H * Generation IV nuclear reactors Subject RIV: JF - Nuclear Energetics OBOR OECD: Nuclear related engineering Impact factor: 2.199, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022311515002019#

  7. Middle Moscovian climate of eastern equatorial Pangea recorded in paleosols and fluvial architecture

    Czech Academy of Sciences Publication Activity Database

    Opluštil, S.; Lojka, R.; Rosenau, N.A.; Strnad, L.; Sýkorová, Ivana

    2015-01-01

    Roč. 440, DEC (2015), s. 328-352 ISSN 0031-0182 Institutional support: RVO:67985891 Keywords : Carboniferous paleoclimate * fluvial architectures * paleosols * geochemistry Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.525, year: 2015 http://www.sciencedirect.com/science/article/pii/S0031018215004939

  8. Bright Light Therapy for Treatment of Sleep Problems Following Mild TBI https://www.dacspr.documentservices.dla.mil/dtic/livelink func=formwf.formedit and workid=4132484 and subworkid=4132484 and taskid=8 and formID=1 and viewname=jhg and editable=1176347093 and nexturl=%2Fdtic%2Flivelink%3Ffunc%3Dwork%2Etaskdone%26workid%3D4132484%26subworkid%3D4132484%26taskid%3D8%26xAction%3Dsave%26paneindex%3D1%26nexturl%3D%252Fdtic%252Flivelink%253Ffunc%253Dllworkspace and noredisplay=1#

    Science.gov (United States)

    2016-10-01

    00) and at night (between 00:00 and 04:00), and found that participants reported lower levels of sleepiness and fatigue, pii: sp-00684-15 ht tp...Chief Psychologist, GovSource, Inc., U.S. Department of Defense (DoD) Contractor 8/08 Consulting Psychologist, The Brain Institute, University of

  9. An E∞-extension of the associahedra and the Tamarkin cell mystery

    Czech Academy of Sciences Publication Activity Database

    Markl, Martin

    2015-01-01

    Roč. 98, December (2015), s. 446-471 ISSN 0393-0440 Institutional support: RVO:67985840 Keywords : associahedra * Fox-Neuwirth cell * Tamarkin cell Subject RIV: BA - General Mathematics Impact factor: 0.752, year: 2015 http://www.sciencedirect.com/science/article/pii/S0393044015002089

  10. Analytic continuation of weighted Bergman kernels

    Czech Academy of Sciences Publication Activity Database

    Engliš, Miroslav

    2010-01-01

    Roč. 94, č. 6 (2010), s. 622-650 ISSN 0021-7824 R&D Projects: GA AV ČR IAA100190802 Keywords : Bergman kernel * analytic continuation * Toeplitz operator Subject RIV: BA - General Mathematics Impact factor: 1.450, year: 2010 http://www.sciencedirect.com/science/article/pii/S0021782410000942

  11. A new look at the comparative physiology of insect and human hearts

    Czech Academy of Sciences Publication Activity Database

    Sláma, Karel

    2012-01-01

    Roč. 58, č. 8 (2012), s. 1072-1081 ISSN 0022-1910 Institutional support: RVO:60077344 Keywords : heartbeat reversal * anterograde heartbeat * retrograde heartbeat Subject RIV: ED - Physiology Impact factor: 2.379, year: 2012 http://www. science direct.com/ science /article/pii/S0022191012001035#

  12. Understanding the 16th century coastal watchtowers: Material characterisation of Torre Gregoriana (Italy)

    Czech Academy of Sciences Publication Activity Database

    Cacciotti, Riccardo; Petráňová, Veronika; Frankeová, Dita

    2015-01-01

    Roč. 93, September (2015), s. 608-619 ISSN 0950-0618 Institutional support: RVO:68378297 Keywords : coastal watchtower * military engineering * historic mortar * material analysis * glass powder Subject RIV: AL - Art, Architecture, Cultural Heritage Impact factor: 2.421, year: 2015 http://www.sciencedirect.com/science/article/pii/S0950061815006947

  13. Geometry of the Poincaré compactification of a four-dimensional food-web system

    Czech Academy of Sciences Publication Activity Database

    Priyadarshi, Anupam; Banerjee, S.; Gakkhar, S.

    2014-01-01

    Roč. 226, JAN 1 (2014), s. 229-237 ISSN 0096-3003 R&D Projects: GA MŠk(CZ) EE2.3.30.0032 Institutional support: RVO:60077344 Keywords : Poincaré compactification * global dynamics * boundedness Subject RIV: EH - Ecology, Behaviour Impact factor: 1.551, year: 2014 http://www.sciencedirect.com/science/article/pii/S0096300313011247

  14. Operadic categories and duoidal Deligne's conjecture

    Czech Academy of Sciences Publication Activity Database

    Batanin, M.; Markl, Martin

    2015-01-01

    Roč. 285, 5 November (2015), s. 1630-1687 ISSN 0001-8708 Institutional support: RVO:67985840 Keywords : operadic category * duoidal category * Deligne's conjecture Subject RIV: BA - General Mathematics Impact factor: 1.405, year: 2015 http://www.sciencedirect.com/science/article/pii/S0001870815002467

  15. Adsorption of peptides produced by cyanobacterium Microcystis aeruginosa onto granular activated carbon

    Czech Academy of Sciences Publication Activity Database

    Kopecká, Ivana; Pivokonský, Martin; Pivokonská, Lenka; Hnaťuková, Petra; Šafaříková, Jana

    2014-01-01

    Roč. 69, April (2014), s. 595-608 ISSN 0008-6223 R&D Projects: GA ČR GAP105/11/0247 Institutional support: RVO:67985874 Keywords : Microcystis aeruginosa * granular activated carbon * celllular organic matter (COM) Subject RIV: BK - Fluid Dynamics Impact factor: 6.196, year: 2014 http://www.sciencedirect.com/science/article/pii/S000862231301227X

  16. A phi-competitive algorithm for collecting items with increasing weights from a dynamic queue

    Czech Academy of Sciences Publication Activity Database

    Bienkowski, M.; Chrobak, M.; Dürr, Ch.; Hurand, M.; Jeż, A.; Jeż, Łukasz; Stachowiak, G.

    2013-01-01

    Roč. 475, 4 March (2013), s. 92-102 ISSN 0304-3975 Institutional support: RVO:67985840 Keywords : online algorithms * competitive analysis * buffer management Subject RIV: BA - General Mathematics Impact factor: 0.516, year: 2013 http://www.sciencedirect.com/science/article/pii/S0304397513000121

  17. Non-meagre subgroups of reals disjoint with meagre sets

    Czech Academy of Sciences Publication Activity Database

    Kostana, Ziemowit

    2018-01-01

    Roč. 241, June (2018), s. 11-19 ISSN 0166-8641 Institutional support: RVO:67985840 Keywords : algebraic sum * Baire property * non-meaurable subgroup Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.377, year: 2016 https://www. science direct.com/ science /article/pii/S0166864118300567

  18. Acoustic emission for interlaminar toughness testing of CFRP: Evaluation of the crack growth due to burst analysis

    Czech Academy of Sciences Publication Activity Database

    Lissek, F.; Haegerb, A.; Knoblauch, V.; Hloch, Sergej; Pude, F.; Kaufeld, M.

    2018-01-01

    Roč. 136, č. 1 (2018), s. 55-62 ISSN 1359-8368 Institutional support: RVO:68145535 Keywords : DCB * interlaminar toughness testing * acoustic emission * CFRP * burst analysis Subject RIV: JQ - Machines ; Tools Impact factor: 4.727, year: 2016 http://www. science direct.com/ science /article/pii/S1359836817313720

  19. On periodic solutions to second-order Duffing type equations

    Czech Academy of Sciences Publication Activity Database

    Lomtatidze, Alexander; Šremr, Jiří

    2018-01-01

    Roč. 40, April (2018), s. 215-242 ISSN 1468-1218 Institutional support: RVO:67985840 Keywords : periodic solution * Duffing type equation * positive solution Subject RIV: BA - General Mathematics OBOR OECD: Applied mathematics Impact factor: 1.659, year: 2016 http://www. science direct.com/ science /article/pii/S1468121817301335?via%3Dihub

  20. The investigation of strangeness photoproduction in the threshold region at ELPH-Tohoku

    Czech Academy of Sciences Publication Activity Database

    Kaneta, M.; Beckford, B.; Bydžovský, Petr; Fujibayashi, T.; Fujii, T.; Fujii, Y.; Futatsukawa, K.; Gogami, T.; Han, Y. C.; Hashimoto, O.; Hirose, K.; Hosomi, K.; Honda, R.; Iguchi, A.; Ishikawa, T.; Kanda, H.; Kaneko, Y.; Kasai, Y.; Kawasaki, T.; Kimura, C.; Kiyokawa, S.; Koike, T.; Maeda, K.; Maruyama, N.; Matsubara, M.; Miwa, K.; Miyagi, Y.; Nagao, S.; Nakamura, S. N.; Okuyama, A.; Sotona, Miloslav; Tamae, T.; Tamura, H.; Tsukada, K.; Terada, N.; Wang, T. S.; Yamamoto, F.; Yamamoto, T.; Yamazaki, H.

    2013-01-01

    Roč. 914, SEP (2013), s. 69-73 ISSN 0375-9474 Institutional support: RVO:61389005 Keywords : strangeness * photoproduction * tagged photon beam * lambda detection Subject RIV: BE - Theoretical Physics Impact factor: 2.499, year: 2013 http://www.sciencedirect.com/science/article/pii/S0375947413005344

  1. New COSPAR space life sciences journal

    Czech Academy of Sciences Publication Activity Database

    Laštovička, Jan; Hei, T.; Stoop, J.

    2013-01-01

    Roč. 52, č. 11 (2013), s. 1859 ISSN 0273-1177 Institutional support: RVO:68378289 Keywords : COSPAR journal Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 1.238, year: 2013 http://www.sciencedirect.com/science/article/pii/S0273117713006753

  2. Supercooling points and heat coma temperatures in four species of oceanic sea skaters of the genus Halobates (Heteroptera: Gerridae: Halobatinae)

    Czech Academy of Sciences Publication Activity Database

    Harada, T.; Takenaka, S.; Iyota, K.; Shiraki, T.; Moku, M.; Katagiri, C.; Košťál, Vladimír

    2013-01-01

    Roč. 16, č. 3 (2013), s. 219-222 ISSN 1226-8615 Institutional support: RVO:60077344 Keywords : temperature dynamics * distribution * heat tolerance Subject RIV: ED - Physiology Impact factor: 0.875, year: 2013 http://www.sciencedirect.com/science/article/pii/S1226861513000150#

  3. Assessment of the potential hazard represented by natural raw materials containing mineral fibres -The case of the feldspar from Orani, Sardinia (Italy)

    Czech Academy of Sciences Publication Activity Database

    Gualtieri, A. F.; Gandolfi, N. B.; Pollastri, S.; Rinaldi, R.; Sala, O.; Martinelli, G.; Bacci, T.; Paoli, F.; Viani, Alberto; Vigliaturo, R.

    2018-01-01

    Roč. 350, May (2018), s. 76-87 ISSN 0304-3894 R&D Projects: GA MŠk(CZ) LO1219 Keywords : feldspar * tremolite * Rietveld * SEM * EMPA Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Mineralogy Impact factor: 6.065, year: 2016 https://www.sciencedirect.com/science/article/pii/S0304389418300888

  4. A constructive approach to boundary value problems with state-dependent impulses

    Czech Academy of Sciences Publication Activity Database

    Rachůnková, I.; Rachůnek, L.; Rontó, András; Rontó, M.

    2016-01-01

    Roč. 274, February (2016), s. 726-744 ISSN 0096-3003 Institutional support: RVO:67985840 Keywords : non-linear system of differential equation * impulse effect * parameterization * successive approximations Subject RIV: BA - General Mathematics Impact factor: 1.738, year: 2016 http://www.sciencedirect.com/science/article/pii/S0096300315015234

  5. 48 CFR 204.7001 - Policy.

    Science.gov (United States)

    2010-10-01

    ... the basic PII number unchanged for the life of the instrument unless the conditions in paragraph (c... not in the Government's best interest solely for administrative reasons (e.g., when the supplementary... predecessor contract once issued; and (iv) Shall not evade competition, expand the scope of work, or extend...

  6. Extremal solutions of measure differential equations

    Czech Academy of Sciences Publication Activity Database

    Monteiro, Giselle Antunes; Slavík, A.

    2016-01-01

    Roč. 444, č. 1 (2016), s. 568-597 ISSN 0022-247X Institutional support: RVO:67985840 Keywords : measure differential equations * extremal solution * lower solution Subject RIV: BA - General Mathematics Impact factor: 1.064, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022247X16302724

  7. High resolution hypernuclear spectroscopy at Jefferson Lab Hall A

    Czech Academy of Sciences Publication Activity Database

    Garibaldi, F.; Bydžovský, Petr; Cisbani, E.; Cusanno, F.; De Leo, R.; Frullani, S.; Iodice, M.; LeRose, J. J.; Markowitz, P.; Millener, D.J.; Urciuoli, G. M.

    2013-01-01

    Roč. 914, SEP (2013), s. 34-40 ISSN 0375-9474 R&D Projects: GA ČR(CZ) GAP203/12/2126 Institutional support: RVO:61389005 Keywords : hypernuclei * electroproduction reactions Subject RIV: BE - Theoretical Physics Impact factor: 2.499, year: 2013 http://www.sciencedirect.com/science/article/pii/S037594741300170X

  8. 76 FR 20003 - Privacy Act of 1974: Notice of New System of Records, Integrated Disbursement & Information...

    Science.gov (United States)

    2011-04-11

    ... property interests, identity theft or fraud, or harm to the security or integrity of this system, then the... System (IDIS). System Location: Online at http://www.hud.gov/offices/cpd/systems/idis/idis.cfm... Information (PII) is not being released. If the Department suspects or has confirmed that the security or...

  9. Interaction times change evolutionary outcomes: Two-player matrix games

    Czech Academy of Sciences Publication Activity Database

    Křivan, Vlastimil; Cressman, R.

    2017-01-01

    Roč. 416, MAR 07 (2017), s. 199-207 ISSN 0022-5193 EU Projects: European Commission(XE) 690817 - FourCmodelling Institutional support: RVO:60077344 Keywords : evolutionary game theory * Hawk-Dove game * pair formation Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 2.113, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022519317300103

  10. Parallel iterative solution of the incompressible Navier-Stokes equations with application to rotating wings

    Czech Academy of Sciences Publication Activity Database

    Šístek, Jakub; Cirak, F.

    2015-01-01

    Roč. 122, 20 November (2015), s. 165-183 ISSN 0045-7930 R&D Projects: GA ČR GA14-02067S Institutional support: RVO:67985840 Keywords : Navier-Stokes * incompressible flow * Krylov subspace methods Subject RIV: BA - General Mathematics Impact factor: 1.891, year: 2015 http://www.sciencedirect.com/science/article/pii/S0045793015003023

  11. Analytical solution of transient in-plane vibration of a thin viscoelastic disc and its multi-precision evaluation

    Czech Academy of Sciences Publication Activity Database

    Adámek, V.; Valeš, František

    2012-01-01

    Roč. 85, NOV 2012 (2012), s. 34-44 ISSN 0378-4754 R&D Projects: GA ČR(CZ) GAP101/11/0288 Institutional support: RVO:61388998 Keywords : transient vibration * viscoelastic disc * analytical solution Subject RIV: BI - Acoustics Impact factor: 0.836, year: 2012 http://www.sciencedirect.com/science/article/pii/S037847541200225X

  12. Complementary error bounds for elliptic systems and applications

    Czech Academy of Sciences Publication Activity Database

    Vejchodský, Tomáš

    2013-01-01

    Roč. 219, č. 3 (2013), s. 7194-7205 ISSN 0096-3003 R&D Projects: GA AV ČR IAA100760702 Institutional support: RVO:67985840 Keywords : a posteriori error estimates * guaranteed * dual finite element methods Subject RIV: BA - General Mathematics Impact factor: 1.600, year: 2013 http://www.sciencedirect.com/science/article/pii/S0096300311007910

  13. Periodic solutions of singular second order differential equations : upper and lower functions

    Czech Academy of Sciences Publication Activity Database

    Hakl, Robert; Torres, P.J.; Zamora, M.

    2011-01-01

    Roč. 74, č. 18 (2011), s. 7078-7093 ISSN 0362-546X Institutional research plan: CEZ:AV0Z10190503 Keywords : second-order differential equation * singularity at the phase variable * Rayleigh-Plesset equation Subject RIV: BA - General Mathematics Impact factor: 1.536, year: 2011 http://www.sciencedirect.com/science/article/pii/S0362546X11005049

  14. A new approach to non-local boundary value problems for ordinary differential systems

    Czech Academy of Sciences Publication Activity Database

    Rontó, András; Rontó, M.; Shchobak, N.

    2015-01-01

    Roč. 250, č. 1 (2015), s. 689-700 ISSN 0096-3003 Institutional support: RVO:67985840 Keywords : non-local problem * parametrisation * successive approximations Subject RIV: BA - General Mathematics Impact factor: 1.345, year: 2015 http://www.sciencedirect.com/science/article/pii/S0096300314015434

  15. An improvement of dimension-free Sobolev imbeddings in r spaces

    Czech Academy of Sciences Publication Activity Database

    Fiorenza, A.; Krbec, Miroslav; Schmeisser, H.-J.

    2014-01-01

    Roč. 267, č. 1 (2014), s. 243-261 ISSN 0022-1236 R&D Projects: GA ČR GAP201/10/1920 Institutional support: RVO:67985840 Keywords : imbedding theorem * small Lebesgue space * rearrangement-invariant Banach Subject RIV: BA - General Mathematics Impact factor: 1.322, year: 2014 http://www.sciencedirect.com/science/article/pii/S0022123614001724

  16. Heterozygous Loss-of-Function SEC61A1 Mutations Cause Autosomal-Dominant Tubulo-Interstitial and Glomerulocystic Kidney Disease with Anemia

    Czech Academy of Sciences Publication Activity Database

    Bolar, N. A.; Golzio, C.; Živná, M.; Hayot, G.; Van Hemelrijk, C.; Schepers, D.; Vandeweyer, G.; Hoischen, A.; Huyghe, J. R.; Raes, A.; Matthys, E.; Sys, E.; Azou, M.; Gubler, M. C.; Praet, M.; Van Camp, G.; McFadden, K.; Pediaditakis, I.; Přistoupilová, A.; Hodaňová, K.; Vyleťal, P.; Hartmannová, H.; Stránecký, V.; Hůlková, H.; Barešová, V.; Jedličková, I.; Sovová, J.; Hnízda, Aleš; Kidd, K.; Bleyer, A. J.; Spong, R. S.; Vande Walle, J.; Mortier, G.; Brunner, H.; Van Laer, L.; Kmoch, S.; Katsanis, N.; Loeys, B. L.

    2016-01-01

    Roč. 99, č. 1 (2016), s. 174-187 ISSN 0002-9297 R&D Projects: GA MŠk(CZ) LO1304 Institutional support: RVO:61388963 Keywords : Sec61 * tubulo-interstitial kidney disease * rare disease Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 9.025, year: 2016 http://www.sciencedirect.com/science/article/pii/S0002929716301999

  17. Some duality relations in the theory of tensor products

    Czech Academy of Sciences Publication Activity Database

    Hájek, Petr Pavel; Smith, R. J.

    2012-01-01

    Roč. 30, č. 3 (2012), s. 239-249 ISSN 0723-0869 R&D Projects: GA ČR(CZ) GAP201/11/0345 Institutional support: RVO:67985840 Keywords : tensor * projective * injective Subject RIV: BA - General Mathematics Impact factor: 0.780, year: 2012 http://www.sciencedirect.com/science/article/pii/S072308691200045X

  18. Migration and development policies: The state of affairs before the 2015 European migration crises in the Czech Republic and its current implications

    Czech Academy of Sciences Publication Activity Database

    Stojanov, R.; Bureš, O.; Duží, Barbora

    2017-01-01

    Roč. 50, č. 3 (2017), s. 169-181 ISSN 0967-067X Institutional support: RVO:68145535 Keywords : development policy * migration policy * coherence * international migration * European Union Subject RIV: DE - Earth Magnetism, Geodesy, Geography OBOR OECD: Cultural and economic geography Impact factor: 0.607, year: 2016 http://www.sciencedirect.com/science/article/pii/S0967067X17300272

  19. Reaching the superlinear convergence phase of the CG method

    Czech Academy of Sciences Publication Activity Database

    Axelsson, Owe; Karátson, J.

    2014-01-01

    Roč. 260, č. 260 (2014), s. 244-257 ISSN 0377-0427 R&D Projects: GA MŠk ED1.1.00/02.0070 Institutional support: RVO:68145535 Keywords : superlinear convergence * conjugate gradient method * eigenvalues Subject RIV: BA - General Mathematics Impact factor: 1.266, year: 2014 http://www.sciencedirect.com/science/article/pii/S0377042713005451

  20. Kirjanduslik pommirünnak lõppenud / Udo Uibo

    Index Scriptorium Estoniae

    Uibo, Udo, 1956-

    2011-01-01

    Kanada kirjanik Yann Martel, kes 2002. a. sai oma romaani "Pii elu" (Life of Pi; e.k. 2005) eest Bookeri auhinna, otsustas hakata 2007 a. Kanada peaministri Stephan Harperi kirjanduslikuks mentoriks ja on otsustanud nüüd sellest loobuda

  1. Three results on frequency assignment in linear cellular networks

    Czech Academy of Sciences Publication Activity Database

    Chrobak, M.; Sgall, Jiří

    2010-01-01

    Roč. 411, č. 1 (2010), s. 131-137 ISSN 0304-3975 R&D Projects: GA MŠk(CZ) 1M0545; GA AV ČR IAA100190902 Keywords : frequency assignment * approximation algorithms * online algorithms Subject RIV: BA - General Mathematics Impact factor: 0.838, year: 2010 http://www.sciencedirect.com/science/article/pii/S0304397509006574

  2. Pressure on the conical surface of needle valves

    Czech Academy of Sciences Publication Activity Database

    Tesař, Václav

    2014-01-01

    Roč. 220, č. 1 (2014), s. 1-12 ISSN 0924-4247 R&D Projects: GA ČR GA13-23046S Institutional support: RVO:61388998 Keywords : nozzle * needle nozzle * flow separation Subject RIV: BK - Fluid Dynamics Impact factor: 1.903, year: 2014 http://www.sciencedirect.com/science/article/pii/S0924424714004087

  3. Statistical and regression analyses of detected extrasolar systems

    Czech Academy of Sciences Publication Activity Database

    Pintr, Pavel; Peřinová, V.; Lukš, A.; Pathak, A.

    2013-01-01

    Roč. 75, č. 1 (2013), s. 37-45 ISSN 0032-0633 Institutional support: RVO:61389021 Keywords : Exoplanets * Kepler candidates * Regression analysis Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.630, year: 2013 http://www.sciencedirect.com/science/article/pii/S0032063312003066

  4. Exploring Information Security Awareness Training to Reduce Unauthorized Disclosure of Information in Public Schools

    Science.gov (United States)

    Fleming, Antoine

    2017-01-01

    Advances in technological uses within public schools provide increased methods to collect and store non-public personal information (NPI) or personally identifiable information (PII) from both students and employees. Consequently, the sensitive information collected is susceptible to unauthorized disclosure, as various public school employees are…

  5. A computational investigation on the reducing lateral vibration of rotors with rolling-element bearings passing through critical speeds by means of tuning the stiffness of the system supports

    Czech Academy of Sciences Publication Activity Database

    Zapoměl, Jaroslav; Ferfecki, Petr

    2011-01-01

    Roč. 46, č. 5 (2011), s. 707-724 ISSN 0094-114X Institutional research plan: CEZ:AV0Z20760514 Keywords : accelerating rotors * critical speeds * tuning of the stiffness of the rotor supports Subject RIV: JR - Other Machinery Impact factor: 1.366, year: 2011 http://www.sciencedirect.com/science/article/pii/S0094114X10002314

  6. A dynamical model for bark beetle outbreaks

    Czech Academy of Sciences Publication Activity Database

    Křivan, Vlastimil; Lewis, M.; Bentz, B. J.; Bewick, S.; Lenhart, S. M.; Liebhold, A.

    2016-01-01

    Roč. 407, OCT 21 (2016), s. 25-37 ISSN 0022-5193 Institutional support: RVO:60077344 Keywords : bistability * bark beetle * Dendroctonus ponderosae Subject RIV: EH - Ecology, Behaviour Impact factor: 2.113, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022519316301928

  7. On the solutions of a dynamic contact problem for a thermoelastic von Kármán plate

    Czech Academy of Sciences Publication Activity Database

    Bock, I.; Jarušek, Jiří; Šilhavý, Miroslav

    2016-01-01

    Roč. 32, December (2016), s. 111-135 ISSN 1468-1218 R&D Projects: GA ČR(CZ) GAP201/12/0671 Institutional support: RVO:67985840 Keywords : thermoelastic plate * unilateral dynamic contact * rigid obstacle Subject RIV: BA - General Mathematics Impact factor: 1.659, year: 2016 http://www.sciencedirect.com/science/article/pii/S146812181630013X

  8. Asymptotic stability of tri-trophic food chains sharing a common resource

    Czech Academy of Sciences Publication Activity Database

    Vrkoč, Ivo; Křivan, Vlastimil

    2015-01-01

    Roč. 270, Part A (2015), s. 90-94 ISSN 0025-5564 Institutional support: RVO:67985840 ; RVO:60077344 Keywords : competition * food webs * Lyapunov function Subject RIV: BA - General Mathematics; EH - Ecology, Behaviour (BC-A) Impact factor: 1.256, year: 2015 http://www.sciencedirect.com/science/article/pii/S0025556415002114

  9. The new airfoil model NACA0015, modal analysis and flutter properties

    Czech Academy of Sciences Publication Activity Database

    Kozánek, Jan; Vlček, Václav; Zolotarev, Igor

    2017-01-01

    Roč. 46, June (2017), s. 698-706 ISSN 0307-904X Institutional support: RVO:61388998 Keywords : aeroelasticity * subsonic flow * self-excited vibration * modal analysis * kinematics Subject RIV: BI - Acoustics OBOR OECD: Applied mechanics Impact factor: 2.350, year: 2016 http://www.sciencedirect.com/science/article/pii/S0307904X1730135X

  10. Heterotic reduction of Courant algebroid connections and Einstein-Hilbert actions

    Czech Academy of Sciences Publication Activity Database

    Jurčo, B.; Vysoký, Jan

    2016-01-01

    Roč. 909, August (2016), s. 86-121 ISSN 0550-3213 Institutional support: RVO:67985840 Keywords : geometry * duality Subject RIV: BA - General Mathematics Impact factor: 3.678, year: 2016 http://www.sciencedirect.com/science/article/pii/S0550321316300761

  11. EPA's Public Access Website Children’s Privacy and Copyright Issues

    Science.gov (United States)

    This document establishes the policy for protecting the privacy of children on EPA’s Public Access Web site. It concerns the collection, both online and off, of information from ages 13 and under, and the display of Personally Identifying Information (PII)

  12. In situ synchrotron powder diffraction study of the setting reaction kinetics of magnesium-potassium phosphate cements

    Czech Academy of Sciences Publication Activity Database

    Viani, Alberto; Pérez-Estébanez, Marta; Pollastri, S.; Gualtieri, A. F.

    2016-01-01

    Roč. 79, January (2016), s. 344-352 ISSN 0008-8846 R&D Projects: GA MŠk(CZ) LO1219 Keywords : kinetics * reaction * X-ray diffraction * MgO * chemically bonded ceramics Subject RIV: JN - Civil Engineering Impact factor: 4.762, year: 2016 http://www.sciencedirect.com/science/article/pii/S0008884615002690

  13. Fatigue and phase transition in an oscillating plate

    Czech Academy of Sciences Publication Activity Database

    Bosia, S.; Eleuteri, M.; Kopfová, J.; Krejčí, Pavel

    2014-01-01

    Roč. 435, February (2014), s. 1-3 ISSN 0921-4526 R&D Projects: GA ČR GAP201/10/2315 Institutional support: RVO:67985840 Keywords : fatigue * hysteresis * phase transitions Subject RIV: BA - General Mathematics Impact factor: 1.319, year: 2014 http://www.sciencedirect.com/science/article/pii/S0921452613006042

  14. Effect of mixed vs single brine composition on salt weathering in porous carbonate building stones for different environmental conditions

    Czech Academy of Sciences Publication Activity Database

    Menéndez, B.; Petráňová, Veronika

    2016-01-01

    Roč. 210, August (2016), s. 124-139 ISSN 0013-7952 R&D Projects: GA MŠk(CZ) LO1219 Keywords : salt weathering * limestone * environmental conditions * sodium chloride * sodium sulphate * calcium sulphate * salt mixture Subject RIV: AL - Art, Architecture, Cultural Heritage Impact factor: 2.569, year: 2016 http://www.sciencedirect.com/science/article/pii/S0013795216301879

  15. Affine Toda equations and solutions in the homogeneous grading

    Czech Academy of Sciences Publication Activity Database

    Zuevsky, Alexander

    2018-01-01

    Roč. 542, April 1 (2018), s. 149-161 ISSN 0024-3795 Institutional support: RVO:67985840 Keywords : affine Lie gebras * affine Toda modes * solitons Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.973, year: 2016 https://www.sciencedirect.com/science/article/pii/S0024379517302100

  16. On the spectrum in max algebra

    Czech Academy of Sciences Publication Activity Database

    Müller, Vladimír; Peperko, A.

    2015-01-01

    Roč. 485, November (2015), s. 250-266 ISSN 0024-3795 R&D Projects: GA ČR(CZ) GA14-07880S Institutional support: RVO:67985840 Keywords : non-negativ matrices * max algebra * eigenvalues Subject RIV: BA - General Mathematics Impact factor: 0.965, year: 2015 http://www.sciencedirect.com/science/article/pii/S0024379515004139

  17. Ranks of dense alternating sign matrices and their sign patterns

    Czech Academy of Sciences Publication Activity Database

    Fiedler, Miroslav; Gao, W.; Hall, F.J.; Jing, G.; Li, Z.; Stroev, M.

    2015-01-01

    Roč. 471, April (2015), s. 109-121 ISSN 0024-3795 R&D Projects: GA ČR(CZ) GA14-07880S Institutional support: RVO:67985840 Keywords : alternating sign matrix * dense matrix * sign pattern matrix Subject RIV: BA - General Mathematics Impact factor: 0.965, year: 2015 http://www.sciencedirect.com/science/article/pii/S0024379515000257

  18. On families of anticommuting matrices

    Czech Academy of Sciences Publication Activity Database

    Hrubeš, Pavel

    2016-01-01

    Roč. 493, March 15 (2016), s. 494-507 ISSN 0024-3795 EU Projects: European Commission(XE) 339691 - FEALORA Institutional support: RVO:67985840 Keywords : anticommuting matrices * sum-of-squares formulas Subject RIV: BA - General Mathematics Impact factor: 0.973, year: 2016 http://www.sciencedirect.com/science/article/pii/S0024379515007296

  19. Powder metallurgy preparation of Al-Cu-Fe quasicrystals using mechanical alloying and Spark Plasma Sintering

    Czech Academy of Sciences Publication Activity Database

    Novák, P.; Kubatík, Tomáš František; Vystrčil, J.; Hendrych, R.; Kříž, J.; Mlynár, J.; Vojtěch, D.

    2014-01-01

    Roč. 52, September (2014), s. 131-137 ISSN 0966-9795 Institutional support: RVO:61389021 Keywords : Nanostructure intermetallics * Ternary alloys systems * Mechanical alloying and milling * Sintering * Diffraction Subject RIV: JG - Metallurgy Impact factor: 2.131, year: 2014 http://www.sciencedirect.com/science/article/pii/S0966979514001198#

  20. Rational sphere valued supercocycles in M-theory and type IIA string theory

    Czech Academy of Sciences Publication Activity Database

    Fiorenza, D.; Schreiber, Urs; Sati, H.

    2017-01-01

    Roč. 114, April (2017), s. 91-108 ISSN 0393-0440 Institutional support: RVO:67985840 Keywords : homotopy Lie algebras * supersymmetry * branes Subject RIV: BA - General Mathematics OBOR OECD: Applied mathematics Impact factor: 0.819, year: 2016 http://www.sciencedirect.com/science/article/pii/S0393044016303047

  1. Rotating compressible fluids under strong stratification

    Czech Academy of Sciences Publication Activity Database

    Feireisl, Eduard; Lu, Y.; Novotný, A.

    2014-01-01

    Roč. 19, October (2014), s. 11-18 ISSN 1468-1218 Keywords : rotating fluid * compressible Navier-Stokes * strong stratification Subject RIV: BA - General Mathematics Impact factor: 2.519, year: 2014 http://www.sciencedirect.com/science/article/pii/S1468121814000212#

  2. Almost periodic evolution systems with impulse action at state-dependent moments

    Czech Academy of Sciences Publication Activity Database

    Hakl, Robert; Pinto, M.; Tkachenko, V.; Trofimchuk, S.

    2017-01-01

    Roč. 446, č. 1 (2017), s. 1030-1045 ISSN 0022-247X Institutional support: RVO:67985840 Keywords : Wexler's almost periodic solution * evolution system * impulse action at variable times Subject RIV: BA - General Mathematics OBOR OECD: Applied mathematics Impact factor: 1.064, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022247X16305273

  3. Metric Scott analysis

    Czech Academy of Sciences Publication Activity Database

    Ben Yaacov, I.; Doucha, Michal; Nies, A.; Tsankov, T.

    2017-01-01

    Roč. 318, October (2017), s. 46-87 ISSN 0001-8708 Institutional support: RVO:67985840 Keywords : continuous logic * infinitary logic * Scott sentence Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.373, year: 2016 http://www.sciencedirect.com/science/article/pii/S0001870816309896?via%3Dihub

  4. Chromatic roots and limits of dense graphs

    Czech Academy of Sciences Publication Activity Database

    Csikvári, P.; Frenkel, P. E.; Hladký, Jan; Hubai, T.

    2017-01-01

    Roč. 340, č. 5 (2017), s. 1129-1135 ISSN 0012-365X EU Projects: European Commission(XE) 628974 - PAECIDM Institutional support: RVO:67985840 Keywords : chromatic root * graph limit * holomorphic moment Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.639, year: 2016 http://www.sciencedirect.com/science/article/pii/S0012365X16303661

  5. Tick-borne zoonotic pathogens in ticks feeding on the common nightingale including a novel strain of Rickettsia sp

    Czech Academy of Sciences Publication Activity Database

    Dubská, L.; Literák, I.; Kverek, P.; Roubalová, Eva; Kocianova, E.; Taragelova, V.

    2012-01-01

    Roč. 3, č. 4 (2012), s. 265-268 ISSN 1877-959X Institutional support: RVO:60077344 Keywords : tick * Ixodes ricinus * Borrelia garinii * Anaplasma phagocytophilum * Rickettsia helvetica * Babesia sp. EU1 * Common nightingale Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.353, year: 2012 http://www.sciencedirect.com/science/article/pii/S1877959X12000556

  6. Properties of solutions to a class of differential models incorporating Preisach hysteresis operator

    Czech Academy of Sciences Publication Activity Database

    Krejčí, Pavel; O'Kane, J.P.; Pokrovskii, A.; Rachinskii, D.

    2012-01-01

    Roč. 241, č. 22 (2012), s. 2010-2028 ISSN 0167-2789 R&D Projects: GA ČR GAP201/10/2315 Institutional support: RVO:67985840 Keywords : Preisach operator * differential equation * periodic solution Subject RIV: BA - General Mathematics Impact factor: 1.669, year: 2012 http://www.sciencedirect.com/science/article/pii/S0167278911001126

  7. Sustainable urban development in a city affected by heavy industry and mining? Case study of brownfields in Karvina, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Martinát, S.; Dvořák, Petr; Frantál, B.; Klusáček, P.; Kunc, J.; Navrátil, J.; Osman, R.; Turečková, K.; Reed, M.

    2016-01-01

    Roč. 118, April 2016 (2016), s. 78-87 ISSN 0959-6526 R&D Projects: GA TA ČR(CZ) TD020259 Institutional support: RVO:68145535 Keywords : brownfields * human geography * spatial analysis Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 5.715, year: 2016 http://www.sciencedirect.com/science/article/pii/S095965261600055X

  8. Noncommutative Cantor–Bendixson derivatives and scattered C⁎-algebras

    Czech Academy of Sciences Publication Activity Database

    Ghasemi, Saeed; Koszmider, P.

    2018-01-01

    Roč. 240, 15 May (2018), s. 183-209 ISSN 0166-8641 Institutional support: RVO:67985840 Keywords : C*-algebras * Cantor-Bendixson derivative * scattered locally compact spaces Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.377, year: 2016 https://www.sciencedirect.com/science/article/pii/S0166864118301688?via%3Dihub

  9. The Economics of Managed Print and Imaging Services

    Science.gov (United States)

    2011-06-01

    process are called poka - yokes , which are methods to prevent mistakes. This combination of controls is designed to make a system foolproof because it...must be reformatted prior to turn-in.” This sticker serves as a poka - yoke , as mentioned in Chapter IV. A breach of PII can also result from

  10. "Stump Horizon" in the Bílina Mine (Most Basin, Czech Republic) – GC-MS, optical and electron microscopy in identification of wood biological origin

    Czech Academy of Sciences Publication Activity Database

    Havelcová, Martina; Sýkorová, Ivana; Bechtel, A.; Mach, K.; Trejtnarová, Hana; Žaloudková, Margit; Matysová, Petra; Blažek, Jaroslav; Boudová, J.; Sakala, J.

    2013-01-01

    Roč. 107, MAR (2013), s. 62-77 ISSN 0166-5162 R&D Projects: GA ČR GA205/09/1162 Institutional support: RVO:67985891 Keywords : xylite * gelification * biomarkers Subject RIV: DD - Geochemistry Impact factor: 3.313, year: 2013 http://www.sciencedirect.com/science/article/pii/S0166516212002200

  11. Comprehensive physiology and toxicology of ecdysogens – The metabolically activated porphyrin-ecdysteroid complexes in insects

    Czech Academy of Sciences Publication Activity Database

    Sláma, Karel; Zhylitskaya, H.

    181-182, March 31 (2016), s. 55-67 ISSN 1532-0456 Institutional support: RVO:60077344 Keywords : ecdysone * 20-hydroxyecdysone (E20) * ecdysteroids (Ecds) Subject RIV: ED - Physiology Impact factor: 2.416, year: 2016 http://www.sciencedirect.com/science/article/pii/S1532045616300011

  12. Spear phishing in organisations explained

    NARCIS (Netherlands)

    Bullee, Jan-Willem; Montoya, Lorena; Junger, Marianne; Hartel, Pieter

    Purpose - The purpose of this study is to explore how the opening phrase of a phishing email influences the action taken by the recipient. Design/methodology/approach - Two types of phishing emails were sent to 593 employees, who were asked to provide personally identifiable information (PII). A

  13. Molecular phylogeny of species of Ligophorus (Monogenea: Dactylogyridae) and their affinities within the Dactylogyridae

    Czech Academy of Sciences Publication Activity Database

    Blasco-Costa, Maria Isabel; Míguez-Lozano, R.; Sarabeev, V.; Balbuena, J. A.

    2012-01-01

    Roč. 61, č. 4 (2012), s. 619-627 ISSN 1383-5769 Institutional support: RVO:60077344 Keywords : 28S ribosomal DNA region * Internal transcribed spacer 1 * Morphology * Molecular systematics * Diversification processes * Mediterranean basin * Ergenstrema * Mugilidae Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.302, year: 2012 http://www.sciencedirect.com/science/article/pii/S138357691200089X

  14. Evidence for climate change relevant to building design in the UK, 1976-2000

    OpenAIRE

    Wright, A. J.

    2002-01-01

    This work led to the author writing a successful Partners in Innovation (PII) bid, with Prof G Levermore, to analyse building design weather statistics under future climates. This was published as CIBSE Technical Memorandum TM34, ‘Weather Data with Climate Change Scenarios (2004)’, Wright AJ & Parkinson JB, available to CIBSE members on the CIBSE website.

  15. Molecular basis of juvenile hormone signaling

    Czech Academy of Sciences Publication Activity Database

    Jindra, Marek; Bellés, X.; Shinoda, T.

    2015-01-01

    Roč. 11, Oct 09 (2015), s. 39-46 ISSN 2214-5745 R&D Projects: GA ČR GA15-23681S Institutional support: RVO:60077344 Keywords : juvenile hormone * JH receptor * Drosophila melanogaster Subject RIV: ED - Physiology Impact factor: 2.719, year: 2015 http://www.sciencedirect.com/science/article/pii/S2214574515001297

  16. The science case for an orbital mission to Uranus: Exploring the origins and evolution of ice giant planets

    Czech Academy of Sciences Publication Activity Database

    Arridge, C. S.; Achilleos, N.; Agarwal, J.; Agnor, C. B.; Ambrosi, R.; André, N.; Badman, S. V.; Baines, K.; Banfield, D.; Barthélémy, M.; Bisi, M. M.; Blum, J.; Bocanegra-Bahamon, T.; Bonfond, B.; Bracken, C.; Brandt, P.; Briand, C.; Briois, C.; Brooks, S.; Castillo-Rogez, J.; Cavalié, T.; Christophe, B.; Coates, A. J.; Collinson, G.; Cooper, J. F.; Costa-Sitja, M.; Courtin, R.; Daglis, I. A.; de Pater, I.; Desai, M.; Dirkx, D.; Dougherty, M. K.; Ebert, R. W.; Filacchione, G.; Fletcher, L. N.; Fortney, J.; Gerth, I.; Grassi, D.; Grodent, D.; Grün, E.; Gustin, J.; Hedman, M.; Helled, R.; Henri, P.; Hess, S.; Hillier, J. K.; Hofstadter, M. H.; Holme, R.; Horanyi, M.; Hospodarsky, G.; Hsu, S.; Irwin, P.; Jackman, C. M.; Karatekin, O.; Kempf, S.; Khalisi, E.; Konstantinidis, K.; Krüger, H.; Kurth, W. S.; Labrianidis, C.; Lainey, V.; Lamy, L. L.; Laneuville, M.; Lucchesi, D.; Luntzer, A.; MacArthur, B.; Maier, A.; Masters, A.; McKenna-Lawlor, S.; Melin, H.; Milillo, A.; Moragas-Klostermeyer, G.; Morschhauser, A.; Moses, J. I.; Mousis, O.; Nettelmann, N.; Neubauer, F. M.; Nordheim, T.; Noyelles, B.; Orton, G. S.; Owens, M.; Peron, M.; Plainaki, C.; Postberg, F.; Rambaux, N.; Retherford, K.; Reynaud, S.; Roussos, E.; Russell, C. T.; Rymer, A. M.; Sallantin, R.; Sánchez-Lavega, A.; Santolík, Ondřej; Saur, J.; Sayanagi, K. M.; Schenk, P.; Schubert, J.; Sergis, N.; Sittler, E. C.; Smith, A.; Spahn, F.; Srama, R.; Stallard, B.; Sterken, V.; Sternovsky, Z.; Tiscareno, M.; Tobie, G.; Tosi, F.; Trielof, M.; Turrini, D.; Turtle, E. P.; Vinatier, S.; Wilson, R.; Zarka, P.

    2014-01-01

    Roč. 104, SI (2014), s. 122-140 ISSN 0032-0633 Institutional support: RVO:68378289 Keywords : Uranus * magnetosphere * atmosphere * natural satellites * rings * planetary interior Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.875, year: 2014 http://www.sciencedirect.com/science/article/pii/S0032063314002335#

  17. 76 FR 19726 - Family Educational Rights and Privacy

    Science.gov (United States)

    2011-04-08

    ... DEPARTMENT OF EDUCATION 34 CFR Part 99 RIN 1880-AA86 [Docket ID ED-2011-OM-0002] Family... the General Education Provisions Act, which is also known as the Family Educational Rights and Privacy... receiving non-consensual disclosures of PII to link education, workforce, health, family services, and other...

  18. Taxonomic review of the superfamily Pyraloidea in Bhutan (Lepidoptera)

    Czech Academy of Sciences Publication Activity Database

    Irungbam, Jatishwor; Chib, M. S.; Wangdi, K.

    2016-01-01

    Roč. 9, č. 3 (2016), s. 355-382 ISSN 2287-884X R&D Projects: GA ČR GB14-36098G Institutional support: RVO:60077344 Keywords : Crambidae * investigation * light trapping Subject RIV: EG - Zoology http://www.sciencedirect.com/science/article/pii/S2287884X16300541

  19. Biodiversity of most dead wood-dependent organisms in thermophilic temperate oak woodlands thrives on diversity of open landscape structures

    Czech Academy of Sciences Publication Activity Database

    Horák, J.; Vodka, Štěpán; Kout, J.; Halda, J. P.; Bogusch, P.; Pech, P.

    2014-01-01

    Roč. 315, MAR 1 (2014), s. 80-85 ISSN 0378-1127 Institutional support: RVO:60077344 Keywords : lichens * fungi * beetles Subject RIV: EH - Ecology, Behaviour Impact factor: 2.660, year: 2014 http://www.sciencedirect.com/science/article/pii/S0378112713008207

  20. A diagnostic ontological model for damages to historical constructions

    Czech Academy of Sciences Publication Activity Database

    Cacciotti, Riccardo; Blaško, M.; Valach, Jaroslav

    2015-01-01

    Roč. 16, č. 1 (2015), s. 40-48 ISSN 1296-2074 R&D Projects: GA MK(CZ) DF11P01OVV002 Keywords : historical constructions * conservation * ontologies * damage Subject RIV: AL - Art, Architecture, Cultural Heritage Impact factor: 1.533, year: 2015 http://www.sciencedirect.com/science/article/pii/S1296207414000259

  1. Geometry of finite deformations and time-incremental analysis

    Czech Academy of Sciences Publication Activity Database

    Fiala, Zdeněk

    2016-01-01

    Roč. 81, May (2016), s. 230-244 ISSN 0020-7462 Institutional support: RVO:68378297 Keywords : solid mechanics * finite deformations * time-incremental analysis * Lagrangian system * evolution equation of Lie type Subject RIV: BE - Theoretical Physics Impact factor: 2.074, year: 2016 http://www.sciencedirect.com/science/article/pii/S0020746216000330

  2. Probabilistic precipitation nowcasting based on an extrapolation of radar reflectivity and an ensemble approach

    Czech Academy of Sciences Publication Activity Database

    Sokol, Zbyněk; Mejsnar, Jan; Pop, Lukáš; Bližňák, Vojtěch

    2017-01-01

    Roč. 194, 15 September (2017), s. 245-257 ISSN 0169-8095 Institutional support: RVO:68378289 Keywords : scale-dependence * forecast * predictability * images * model * rainfall * weather * analogs * motion Subject RIV: DG - Athmosphere Sciences, Meteorology OBOR OECD: Meteorology and atmospheric sciences Impact factor: 3.778, year: 2016 http://www.sciencedirect.com/science/article/pii/S0169809516305142

  3. On families of anticommuting matrices

    Czech Academy of Sciences Publication Activity Database

    Hrubeš, Pavel

    2016-01-01

    Roč. 493, March 15 (2016), s. 494-507 ISSN 0024-3795 EU Projects: European Commission(XE) 339691 - FEALORA Institutional support: RVO:67985840 Keywords : anticommuting matrices * sum -of-squares formulas Subject RIV: BA - General Mathematics Impact factor: 0.973, year: 2016 http://www.sciencedirect.com/science/article/pii/S0024379515007296

  4. Tight bounds on angle sums of nonobtuse simplices

    Czech Academy of Sciences Publication Activity Database

    Brandts, J.; Cihangir, A.; Křížek, Michal

    2015-01-01

    Roč. 267, 15 September (2015), s. 397-408 ISSN 0096-3003 R&D Projects: GA ČR GA14-02067S Institutional support: RVO:67985840 Keywords : nonobtuse simplex * angle sum s * spherical geometry * polar simplex Subject RIV: BA - General Mathematics Impact factor: 1.345, year: 2015 http://www.sciencedirect.com/science/article/pii/S0096300315002155

  5. The process of ghost-rock karstification and its role in the formation of cave systems

    Czech Academy of Sciences Publication Activity Database

    Dubois, C.; Quinif, Y.; Baele, J.-M.; Barriquand, L.; Bini, A.; Bruxelles, L.; Dandurand, G.; Havron, C.; Kaufmann, O.; Lans, B.; Maire, R.; Martin, J.; Rodet, J.; Rowberry, Matthew David; Tognini, P.; Vergari, A.

    2014-01-01

    Roč. 131, APR (2014), s. 116-148 ISSN 0012-8252 Institutional support: RVO:67985891 Keywords : chemical weathering * ghost-rock * karstification * limestone dissolution * speleogenesis Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 7.885, year: 2014 http://www.sciencedirect.com/science/article/pii/S0012825214000154

  6. Dicty_cDB: VHH513 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KIKKK--- ---HFHTLKTLNKYIIYNDLASIRR*qltwcwfriscsfrcc*r*clgtlswiqcr*r*g nnrtfskgwscirnwhprcw*eiyghqk*hqiclr*ir...lltvn*vlvvlfalkp*lvssllsmmtn ynqvllltllkn*pii*ltttvklvffskinnvk*y Frame C: hfhtlktlnkyiiyndlasirr*qltwcwfrisc...**qittr ccc*hc*kisrlfn*qqlln*ysfqk*it*nni*nkkk--- ---HFHTLKTLNKYIIYNDLASIRR*qltwcwfriscsfrcc*r*clgtlswiqcr*r

  7. Targeting Phosphatidylserine for Radioimmunotherapy of Breast Cancer Brain Metastasis

    Science.gov (United States)

    2013-10-01

    antibodies to the endothelial marker, CD31 (Serotec, Raleigh, NC) followed by Cy3-conjugated secondary antibody ( Jackson Immunoresearch Laboratories...in the brain. Cancer Res 67, 4190-4198, doi:67/9/4190 [pii] 10.1158/0008-5472.CAN-06- 3316 (2007). 7 Percy , D. B. et al. In vivo characterization of

  8. Periodic solutions to second-order indefinite singular equations

    Czech Academy of Sciences Publication Activity Database

    Hakl, Robert; Zamora, M.

    2017-01-01

    Roč. 263, č. 1 (2017), s. 451-469 ISSN 0022-0396 Institutional support: RVO:67985840 Keywords : degree theory * indefinite singularity * periodic solution * singular differential equation Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.988, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022039617301134

  9. Elasto-plastic contact problems with heat exchange

    Czech Academy of Sciences Publication Activity Database

    Krejčí, Pavel; Petrov, A.

    2015-01-01

    Roč. 22, April (2015), s. 551-567 ISSN 1468-1218 R&D Projects: GA ČR GAP201/10/2315 Institutional support: RVO:67985840 Keywords : elasto-plasticity * heat equation * hysteresis operators Subject RIV: BA - General Mathematics Impact factor: 2.238, year: 2015 http://www.sciencedirect.com/science/article/pii/S1468121814001278

  10. U.S. EPA, Pesticide Product Label, PROKIL PARATHION 4 LB, 01/06/1988

    Science.gov (United States)

    2011-04-21

    ... m:AIl [lmRE l.ARD .. II,.> "Ilirtly III acca,· .Irlll':a with dUllyers. ... f .• ,ricI'!'lIHII r.xlen~inn ;'l'rvIU~ ·(I.,ePII""I. ~:' . lhL· I.Sl::le. BEANS: "'I,hid~i. r;.!oi'f1·lli'.;. ...

  11. Geometric structures associated with a simple Cartan 3-form

    Czech Academy of Sciences Publication Activity Database

    Le, Hong-Van

    2013-01-01

    Roč. 70, August (2013), s. 205-223 ISSN 0393-0440 Institutional support: RVO:67985840 Keywords : Cartan 3-form * multi-symplectic form * G-structure Subject RIV: BA - General Mathematics Impact factor: 0.797, year: 2013 http://www.sciencedirect.com/science/article/pii/S0393044013000740

  12. Red refinements of simplices into congruent subsimplices

    Czech Academy of Sciences Publication Activity Database

    Korotov, S.; Křížek, Michal

    2014-01-01

    Roč. 67, č. 12 (2014), s. 2199-2204 ISSN 0898-1221 R&D Projects: GA ČR GA14-02067S Institutional support: RVO:67985840 Keywords : sommerville tetrahedron * red refinement * higher-dimensional simplex Subject RIV: BA - General Mathematics Impact factor: 1.697, year: 2014 http://www.sciencedirect.com/science/article/pii/S0898122114000662

  13. Face-based selection of corners in 3D substructuring

    Czech Academy of Sciences Publication Activity Database

    Šístek, Jakub; Čertíková, M.; Burda, P.; Novotný, J.

    2012-01-01

    Roč. 82, č. 10 (2012), s. 1799-1811 ISSN 0378-4754 R&D Projects: GA AV ČR IAA100760702 Institutional research plan: CEZ:AV0Z10190503 Keywords : domain decomposition * iterative substructuring * BDDC Subject RIV: BA - General Mathematics Impact factor: 0.836, year: 2012 http://www.sciencedirect.com/science/article/pii/S0378475411001820

  14. Analysis of unburned carbon in industrial ashes from biomass combustion by thermogravimetric method using Boudouard reaction

    Czech Academy of Sciences Publication Activity Database

    Straka, Pavel; Náhunková, Jana; Žaloudková, Margit

    2014-01-01

    Roč. 575, JAN (2014), s. 188-194 ISSN 0040-6031 R&D Projects: GA MZe QI102A207 Institutional support: RVO:67985891 Keywords : unburned carbon * biomass * ash * thermogravimetry Subject RIV: GD - Fertilization, Irrigation, Soil Processing Impact factor: 2.184, year: 2014 http://www.sciencedirect.com/science/article/pii/S0040603113005455

  15. Discretization error estimates in maximum norm for convergent splittings of matrices with a monotone preconditioning part

    Czech Academy of Sciences Publication Activity Database

    Axelsson, Owe; Karátson, J.

    2017-01-01

    Roč. 210, January 2017 (2017), s. 155-164 ISSN 0377-0427 Institutional support: RVO:68145535 Keywords : finite difference method * error estimates * matrix splitting * preconditioning Subject RIV: BA - General Mathematics OBOR OECD: Applied mathematics Impact factor: 1.357, year: 2016 http://www.sciencedirect.com/science/article/pii/S0377042716301492?via%3Dihub

  16. The influence of tree species, stratum and forest management on beetle assemblages responding to deadwood enrichment

    Czech Academy of Sciences Publication Activity Database

    Floren, A.; Müller, T.; Dittrich, M.; Weiss, Matthias; Linsenmair, K. E.

    2014-01-01

    Roč. 323, Jul 1 (2014), s. 57-64 ISSN 0378-1127 Institutional support: RVO:60077344 Keywords : deadwood enrichment * species association * vertical stratification Subject RIV: EH - Ecology, Behaviour Impact factor: 2.660, year: 2014 http://www.sciencedirect.com/science/article/pii/S0378112714001820

  17. Estimating statistical uncertainty of Monte Carlo efficiency-gain in the context of a correlated sampling Monte Carlo code for brachytherapy treatment planning with non-normal dose distribution

    Czech Academy of Sciences Publication Activity Database

    Mukhopadhyay, N. D.; Sampson, A. J.; Deniz, D.; Carlsson, G. A.; Williamson, J.; Malušek, Alexandr

    2012-01-01

    Roč. 70, č. 1 (2012), s. 315-323 ISSN 0969-8043 Institutional research plan: CEZ:AV0Z10480505 Keywords : Monte Carlo * correlated sampling * efficiency * uncertainty * bootstrap Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.179, year: 2012 http://www.sciencedirect.com/science/article/pii/S0969804311004775

  18. Selective elimination/RNAi silencing of FMRF-related peptides and their receptors decreases the locomotor activity in Drosophila melanogaster

    Czech Academy of Sciences Publication Activity Database

    Kiss, B.; Szlanka, T.; Zvara, Á.; Žurovec, Michal; Šerý, Michal; Kakaš, Štefan; Ramasz, B.; Hegedűs, Z.; Lukacsovich, T.; Puskás, L.; Fónagy, A.; Kiss, I.

    2013-01-01

    Roč. 191, SEP 15 (2013), s. 137-145 ISSN 0016-6480 Institutional support: RVO:60077344 Keywords : Drosophila melanogaster * FMRF-related peptides * G protein-coupled receptors Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.674, year: 2013 http://www.sciencedirect.com/science/article/pii/S0016648013002621

  19. The binding of glucose and nucleotides to hexokinase from Saccharomyces cerevisiae.

    Science.gov (United States)

    Woolfitt, A R; Kellett, G L; Hoggett, J G

    1988-01-29

    The binding of glucose, ADP and AdoPP[NH]P, to the native PII dimer and PII monomer and the proteolytically-modified SII monomer of hexokinase (ATP:D-hexose 6-phosphotransferase, EC 2.7.1.1) from Saccharomyces cerevisiae was monitored at pH 6.7 by the concomitant quenching of protein fluorescence. The data were analysed in terms of Qmax, the maximal quenching of fluorescence at saturating concentrations of ligand, and [L]0.5, the concentration of ligand at half-maximal quenching. No changes in fluorescence were observed with free enzyme and nucleotide alone. In the presence of saturating levels of glucose, Qmax induced by nucleotide was between 2 and 7%, and [L]0.5 was between 0.12 and 0.56 mM, depending on the nucleotide and enzyme species. Qmax induced by glucose alone was between 22 and 25%, while [L]0.5 was approx. 0.4 mM for either of the monomeric hexokinase forms and 3.4 for PII dimer. In the presence of 6 mM ADP or 2 mM AdoPP[NH]P, Qmax for glucose was increased by up to 4% and [L]0.5 was diminished 3-fold for hexokinase PII monomer, 6-fold for SII monomer, and 15-fold for PII dimer. The results are interpreted in terms of nucleotide-induced conformational change of hexokinase in the presence of glucose and synergistic binding interactions between glucose and nucleotide.

  20. Beam-phase monitoring with non-destructive pickup

    International Nuclear Information System (INIS)

    Bogaty, J.; Clifft, B.E.

    1995-01-01

    An intensity and phase-sensitive capacitive pickup was installed at the entrance to the PII linac. This device is based on an extension of the design of the Beam Current Monitor developed as part of the ATLAS radiation safety system. The purpose of the pickup is to allow the arrival phase of the beam from the ECR source at the entrance to the PII linac to be set to a standard which reproduces previous tune conditions and establishes a standard. The new pickups and associated electronics demonstrated sensitivity well below 1 electrical nanoamp but can handle beam currents of many electrical microamps as well. In addition to phase information, beam current is also measured by the units thus providing a continuous, non-intercepting current readout as well. From the very first use of PII, we established a few open-quotes reference tunesclose quotes for the linac and scaled those tunes for any other beam desired. For such scaling to work properly, the velocity and phase of the beam from the ion source must be fixed and reproducible. In last year's FWP the new ATLAS Master Oscillator System was described. The new system has the ability of easily adjusting the beam arrival phase at the entrance to each of the major sections of the facility - PII, Booster, ATLAS. Our present techniques for establishing the beam arrival phase at the entrance of each of the linac sections are cumbersome and, sometimes, intellectually challenging. The installation of these capacitative pickups at the entrance to each of the linac sections will make the determination and setting of the beam arrival phase direct, simple, and dynamic. This should dramatically shorten our setup time for open-quotes old-tuneclose quotes configurations and increase useful operating hours. Permanent electronics for the PII entrance pickup is under construction

  1. Comparison of the Photovoltaic Characteristics and Nanostructure of Fullerenes Blended with Conjugated Polymers with Siloxane-Terminated and Branched Aliphatic Side Chains

    KAUST Repository

    Kim, Do Hwan

    2013-02-12

    All-organic bulk heterojunction solar cells based on blends of conjugated polymers with fullerenes have recently surpassed the 8% efficiency mark and are well on their way to the industrially relevant ∼15% threshold. Using a low band-gap conjugated polymer, we have recently shown that polymer side chain engineering can lead to dramatic improvement in the in-plane charge carrier mobility. In this article, we investigate the effectiveness of siloxy side chain derivatization in controlling the photovoltaic performance of polymer:[6,6]-phenyl-C[71]-butyric acid methyl ester (PC71BM) blends and hence its influence on charge transport in the out-of-plane direction relevant for organic solar cells. We find that, in neat blends, the photocurrent of the polymer with siloxy side chains (PII2T-Si) is 4 times greater than that in blends using the polymer with branched aliphatic side chains (PII2T-ref). This difference is due to a larger out-of-plane hole mobility for PII2T-Si brought about by a largely face-on crystallite orientation as well as more optimal nanoscale polymer:PC71BM mixing. However, upon incorporating a common processing additive, 1,8-diiodooctane (DIO), into the spin-casting blend solution and following optimization, the PII2T-ref:PC71BM OPV device performance undergoes a large improvement and becomes the better-performing device, almost independent of DIO concentration (>1%). We find that the precise amount of DIO plays a larger role in determining the efficiency of PII2T-Si:PC71BM, and even at its maximum, the device performance lags behind optimized PII2T-ref:PC71BM blends. Using a combination of atomic force microscopy and small- and wide-angle X-ray scattering, we are able to elucidate the morphological modifications associated with the DIO-induced changes in both the nanoscale morphology and the molecular packing in blend films. © 2012 American Chemical Society.

  2. Alexander Conze, “Greek Relief Sculpture”. Originally published as ‘Über das Relief bei den Griechen’, Sitzungsberichte der Königlich Preussischen Akademie der Wissenschaften zu Berlin. Gesammtsitzung vom 25. Mai, 1882, no. 26, pp. 1-15 (pp. 563-577.

    Directory of Open Access Journals (Sweden)

    Karl Johns (trans & ed.

    2012-12-01

    Full Text Available On the basis of a corpus edition of Attic grave stelae, it becomes possible to make certain broad observations about the nature and development of Greek relief sculpture, a branch of the arts in which the Greeks are admitted to have excelled. Archaeology has added so much to our knowledge in the course of the 19th century that we can dismiss the earlier assumption that these sculptures did not have colour. In fact they were painted, and the evidence shows that in spite of its severe technical limitations, Greek relief sculpture developed in an increasingly painterly direction, in tandem with the development of Greek wall and panel painting as we know it – more so than vase painting. St. Remy and Pergamon provide examples of the prodigious Greek application of the genre, where ‘there were no innovations left for Roman art to make’.

  3. Corrections to the Walker-Thompson estimate of the cascade volume

    International Nuclear Information System (INIS)

    Swaminarayan, S.; Nastasi, M.

    2009-01-01

    Sigmund [P. Sigmund, Appl. Phys. Lett. 25 (1974) 169] analytically predicted that the ratio of cascade volume to energy distribution volume should follow a universal curve that is sigmoidal in shape. Subsequent Monte Carlo simulations by Walker and Thompson [R.S. Walker, D.A. Thompson, Radiat. Eff. 37 (1978) 113] showed that although this curve is sigmoidal in shape, the curve is different for different materials with large deviations from Sigmund's prediction at high M 2 /M 1 . Our analysis of the Walker and Thompson approach has revealed an error in the analytical equations used. A correct analysis of volume ratios using a different set of equations is presented. Analysis of data produced by SRIM [J.F. Ziegler, J.P. Biersack, U. Littmark, in: The Stopping and Range of Ions in solids, Pergamon, New York, 1985] (Monte Carlo) simulations gives results that are in good agreement with Sigmund's predictions.

  4. Late Pleistocene sedimentation: A case study of the central Indian Ocean Basin

    Digital Repository Service at National Institute of Oceanography (India)

    Borole, D

    -Sea Research 1, Vol 40, No 4, pp 761-775, 1993 0967-0637/93 $6 00 + 0 00 Printed m Great Britain © 1993 Pergamon Press Lid Late Pleistocene sedimentation: a case study of the central Indian Ocean Basin D. V. BOROLE* (Recetved 26 August 1988, in revised... 26 + 0 11 4 10 + 0.20 1 30 + 0 10 5 03 20-25 1 10 + 0.07 3 60 + 0.14 1 08 ___ 0 09 5 3 30-35 1 51 + 0.10 3.28 + 0 34 1.10 + 0.15 5 3 65-70 1.08 + 0 05 3 20 + 0.23 0 97 + 0.09 4 38 80-85 0 81 + 0 05 1 80 + 0.12 0 63 + 0 06 4 37 Conanued 766 D V...

  5. Sediments and fossiliferous rocks from the eastern side of the Tongue of the Ocean, Bahamas

    Science.gov (United States)

    Gibson, T.G.; Schlee, J.

    1967-01-01

    In August 1966, two dives were made with the deep-diving submersible Alvin along the eastern side of the Tongue of the Ocean to sample the rock and sediment. Physiographically, the area is marked by steep slopes of silty carbonate sediment and precipitous rock cliffs dusted by carbonate debris. Three rocks, obtained from the lower and middle side of the canyon (914-1676 m depth), are late Miocene-early Pliocene to late Pleistocene-Recent in age; all are deep-water pelagic limestones. They show (i) that the Tongue of the Ocean has been a deep-water area at least back into the Miocene, and (ii) that much shallow-water detritus has been swept off neighbouring banks to be incorporated with the deep-water fauna in the sediment. ?? 1967 Pergamon Press Ltd.

  6. The changing features of the body-mind problem.

    Science.gov (United States)

    Agassi, Joseph

    2007-01-01

    The body-mind problem invites scientific study, since mental events are repeated and repeatable and invite testable explanations. They seemed troublesome because of the classical theory of substance that failed to solve its own central problems. These are soluble with the aid of the theory of the laws of nature, particularly in its emergentist version [Bunge, M., 1980. The Body-mind Problem, Pergamon, Oxford] that invites refutable explanations [Popper, K.R., 1959. The Logic of Scientific Discovery, Hutchinson, London]. The view of mental properties as emergent is a modification of the two chief classical views, materialism and dualism. As this view invites testable explanations of events of the inner world, it is better than the quasi-behaviorist view of self-awareness as computer-style self-monitoring [Minsky, M., Laske, O., 1992. A conversation with Marvin Minsky. AI Magazine 13 (3), 31-45].

  7. The Ionian Renaissance and the Hellenistic Architecture of Kos

    DEFF Research Database (Denmark)

    Pedersen, Poul

    2015-01-01

    I artiklen påvises det, at både det gamle og det nye tempel i helligdommen for lægeguden Asklepios på den græske ø Kos har tekniske særegenheder (det karisk-ioniske løftehul), som viser at de to templer blev bygget af håndværkere fra det vestlige Lilleasien, som arbejdede i den ioniske renaissances...... også i anden arkitektur på Kos, hvilket taler for at øen arkitektonisk og kulturelt i højere grad end hidtil erkendt, skal ses som hørende til den sydvestlilleasiatiske kultursfære. Endvidere trækkes en parallel til Asklepiostemplet i Pergamon, der iflg en knap 100 år gammel opmålingstegning havde...

  8. On the solution of nonlinear differential equations over the field of Mikusinski operators

    International Nuclear Information System (INIS)

    Sharkawi, I.E.; El-Sabagh, M.A.

    1983-08-01

    The nonlinear differential equation X'(lambda)+a(lambda)X(lambda)=sb(lambda)Xsup(n+1)(lambda) with the initial condition X(0)=I, over the field of Mikusinski operators [Mikusinski, J. Operational Calculus, Pergamon Press (1957)] is discussed, where a(lambda) and b(lambda) are continuous numerical functions, s is the operator of differentiation, and I is the unit operator. A solution is constructed of the following form: X(lambda)=F(lambda) ([tsup((1/n)-1)]/[GAMMA(1/n)(ng(lambda))sup(1/n)])exp(t/(ng(lambda))), where F(lambda)=exp(-integ 0 sup(lambda)a(lambda)d(lambda) and g(lambda)=integ 0 sup(lambda)[b(lambda)exp(n integ 0 sup(lambda)a(lambda))]dlambda are numerical functions

  9. First operation of the ATLAS positive-ion injector

    International Nuclear Information System (INIS)

    Pardo, R.C.; Bollinger, L.M.; Shephard, K.W.; Billquist, P.J.; Bogaty, J.M.; Clifft, B.E.; Harkewicz, R.; Munson, F.H.; Nolen, J.A.; Zinkann, G.P.

    1992-01-01

    The construction of the ATLAS Positive-Ion Injector (PII) is complete and beam acceleration tests are underway. The PII consists of an ECR ion source, on a high-voltage platform, providing beam to a low-velocity-acceptance, independently-phased, superconducting linac. This injector enables the ATLAS facility to accelerate any heavy ion, including uranium, to energies in excess of the Coulomb barrier. The design accelerating field performance has been exceeded, with an average accelerating field of approximately 3.2 MV/m achieved in early tests. Initial beam tests of the entire injector indicate that all important performance goals have been met. This paper describes the results of these early tests and discusses our initial operating experience with the whole ATLAS system. (Author) 5 refs., tab., fig

  10. Control system design for nano-positioning using piezoelectric actuators

    International Nuclear Information System (INIS)

    Shan, Jinjun; Liu, Yanfang; Cui, Naigang; Gabbert, Ulrich

    2016-01-01

    This paper presents a systematic control system design for nano-positioning of a piezoelectric actuator (PEA). PEAs exhibit hysteresis nonlinearity, which can dramatically limit the application and performance of linear feedback control theory. Thus the hysteresis is compensated for based on the Maxwell resistive capacitor (MRC) model first. Then a proportional plus integral (PI) controller and a proportional double integral plus lead compensation (PII and L) controller are designed for the hysteresis-compensated PEA to account for model uncertainty, disturbance, and noise. The robust stability of both controllers is proved. The effectiveness of the proposed control scheme is demonstrated experimentally. Both controllers achieve fast precise positioning. The 2% settling times for the PI controller and the PII and L controller are 1.5 ms and 4.7 ms, respectively. The positioning resolution is upto 1 nm for both controllers. (paper)

  11. Wind Turbines in Tourism Landscaspes: Czech Experience

    Czech Academy of Sciences Publication Activity Database

    Frantál, Bohumil; Kunc, Josef

    2011-01-01

    Roč. 38, č. 2 (2011), s. 499-519 ISSN 0160-7383 R&D Projects: GA AV ČR(CZ) KJB700860801 Institutional research plan: CEZ:AV0Z30860518 Keywords : wind energy * lanscape * perception * Czech Republic Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 3.259, year: 2011 http://www.sciencedirect.com/science?_ob=MiamiImageURL&_cid=271796&_user=4955814&_pii=S0160738310001271&_check=y&_origin=&_coverDate=30-Apr-2011&view=c&wchp=dGLbVlS-zSkWz&md5=2777f7fff0ea7807aadfe0014ace0683/1-s2.0-S0160738310001271-main.pdf

  12. Snake Venom Metalloproteinases

    Directory of Open Access Journals (Sweden)

    Gâz Florea Şerban Andrei

    2016-03-01

    Full Text Available As more data are generated from proteome and transcriptome analysis revealing that metalloproteinases represent most of the Viperid and Colubrid venom components authors decided to describe in a short review a classification and some of the multiple activities of snake venom metalloproteinases. SVMPs are classified in three major classes (P-I, P-II and P-III classes based on the presence of various domain structures and according to their domain organization. Furthermore, P-II and P-III classes were separated in subclasses based on distinctive post-translational modifications. SVMPs are synthesized in a latent form, being activated through a Cys-switch mechanism similar to matrix metalloproteinases. Most of the metalloproteinases of the snake venom are responsible for the hemorrhagic events but also have fibrinogenolytic activity, poses apoptotic activity, activate blood coagulation factor II and X, inhibit platelet aggregation, demonstrating that SVMPs have multiple functions in addition to well-known hemorrhagic function.

  13. A Letter to the Editor: Using C-reactive protein to suggest an alternative explanation of the findings of Simanek et al

    DEFF Research Database (Denmark)

    Mortensen, Laust Hvas

    2011-01-01

    , Zacho J, Friberg J, Jensen GB, Tybjaerg-Hansen A, Benn M (2010) Does elevated C-reactive protein increase atrial fibrillation risk? A Mendelian randomization of 47,000 individuals from the general population. J Am Coll Cardiol 56: 789-795. S0735-1097(10)02305-3 [pii];10.1016/j.jacc.2010.02.066 [doi]. 9....... Timpson NJ, Lawlor DA, Harbord RM, Gaunt TR, Day IN, Palmer LJ, Hattersley AT, Ebrahim S, Lowe GD, Rumley A, Davey SG (2005) C-reactive protein and its role in metabolic syndrome: mendelian randomisation study. Lancet 366: 1954-1959. S0140-6736(05)67786-0 [pii];10.1016/S0140-6736(05)67786-0 [doi]. 10...

  14. First operation of the ATLAS Positive-Ion Injector

    International Nuclear Information System (INIS)

    Pardo, R.C.; Bollinger, L.M.; Shepard, K.W.; Billquist, P.J.; Bogaty, J.M.; Clifft, B.E.; Harkewicz, R.; Munson, F.H.; Nolen, J.A.; Zinkann, G.P.

    1992-01-01

    The construction of the ATLAS Positive-Ion Injector (PII) is complete and beam acceleration tests are underway. The PII consists of an ECR ion source, on a high-voltage platform, providing beam to a low-velocity-acceptance, independently-phased, superconducting linac. This injector enables the ATLAS facility to accelerate any heavy ion, including uranium, to energies in excess of the Coulomb barrier. The design accelerating field performance has been exceeded, with an average accelerating field of approximately 3.2 MV/m achieved in early tests. Initial beam tests of the entire injector indicate tat all important performance goals have been met. This paper describes the results of these early tests and discusses our initial operating experience with the whole ATLAS system

  15. Numerical Modeling of Unsteady Flow in Steam Turbine Stage

    Czech Academy of Sciences Publication Activity Database

    Halama, Jan; Dobeš, J.; Fořt, Jaroslav; Fürst, J.; Kozel, Karel

    2010-01-01

    Roč. 234, č. 7 (2010), s. 2336-2341 ISSN 0377-0427 Grant - others:GA ČR(CZ) GA201/08/0012 Program:GA Institutional research plan: CEZ:AV0Z20760514 Keywords : stator-rotor interaction * unsteady flow * two - phase flow Subject RIV: BK - Fluid Dynamics Impact factor: 1.029, year: 2010 http://www.sciencedirect.com/science?_ob=MImg&_imagekey=B6TYH-4X1J73B-M-W&_cdi=5619&_user=640952&_pii=S0377042709005718&_origin=search&_coverDate=08%2F01%2F2010&_sk=997659992&view=c&wchp=dGLzVlz-zSkzS&md5=36ee785371868aebdcc6bd0d17263fc4&ie=/sdarticle.pdf

  16. Numerical modeling of two-phase transonic flow

    Czech Academy of Sciences Publication Activity Database

    Halama, Jan; Benkhaldoun, F.; Fořt, Jaroslav

    2010-01-01

    Roč. 80, č. 88 (2010), s. 1624-1635 ISSN 0378-4754 Grant - others:GA ČR(CZ) GA201/08/0012 Program:GA Institutional research plan: CEZ:AV0Z20760514 Keywords : two - phase flow * condensation * fractional step method Subject RIV: BK - Fluid Dynamics Impact factor: 0.812, year: 2010 http://www.sciencedirect.com/science?_ob=MImg&_imagekey=B6V0T-4VNK68X-2-R&_cdi=5655&_user=640952&_pii=S0378475409000421&_origin=search&_coverDate=04%2F30%2F2010&_sk=999199991&view=c&wchp=dGLzVlb-zSkWb&md5=5ba607428fac339a3e5f67035d3996d0&ie=/sdarticle.pdf

  17. Numerical simulation of gas-contaminated refrigerant two-phase flow through

    Czech Academy of Sciences Publication Activity Database

    Vinš, Václav; Hrubý, Jan; Vacek, V.

    2010-01-01

    Roč. 53, 23-24 (2010), s. 5430-5439 ISSN 0017-9310 R&D Projects: GA ČR GA101/09/1633 Institutional research plan: CEZ:AV0Z20760514 Keywords : capillary tube * henry’s law * non-condensing gases Subject RIV: BJ - Thermodynamics Impact factor: 1.898, year: 2010 http://www.sciencedirect.com/science?_ob=MImg&_imagekey=B6V3H-50N9C3K-8-2X&_cdi=5731&_user=640952&_pii=S0017931010003819&_origin=search&_coverDate=11%2F30%2F2010&_sk=999469976&view=c&wchp=dGLzVtz-zSkWA&md5=3b8d5c97caaa70e52da990c8ffac4421&ie=/sdarticle.pdf

  18. Interaction of candidate plasma facing materials with tokamak plasma in COMPASS

    Czech Academy of Sciences Publication Activity Database

    Matějíček, Jiří; Weinzettl, Vladimír; Macková, Anna; Malinský, Petr; Havránek, Vladimír; Naydenkova, Diana; Klevarová, Veronika; Petersson, P.; Gasior, P.; Hakola, A.; Rubel, M.; Fortuna, E.; Kolehmainen, J.; Tervakangas, S.

    2017-01-01

    Roč. 493, September (2017), s. 102-119 ISSN 0022-3115. [International Conference on Plasma-Facing Materials and Components for Fusion Applications/15./. Aix-en-Provence, 18.05.2015-22.05.2015] R&D Projects: GA ČR(CZ) GA14-12837S; GA ČR(CZ) GA15-10723S; GA MŠk(CZ) LM2015045; GA MŠk LM2015056 Institutional support: RVO:61389021 ; RVO:61389005 Keywords : erosion * COMPASS tokamak * plasma-material interaction * ion beam analysis Subject RIV: JF - Nuclear Energetics; JF - Nuclear Energetics (UJF-V) OBOR OECD: Nuclear related engineering ; Nuclear related engineering (UJF-V) Impact factor: 2.048, year: 2016 http://www.sciencedirect.com/science/ article /pii/S0022311517301708

  19. Mechanical and magnetic properties of semi-Heusler/light-metal composites consolidated by spark plasma sintering

    Czech Academy of Sciences Publication Activity Database

    Koller, M.; Chráska, Tomáš; Cinert, Jakub; Heczko, Oleg; Kopeček, Jaromír; Landa, Michal; Mušálek, Radek; Rameš, Michal; Seiner, Hanuš; Stráský, J.; Janeček, M.

    2017-01-01

    Roč. 126, July (2017), s. 351-357 ISSN 0264-1275 R&D Projects: GA ČR GB14-36566G Institutional support: RVO:61389021 ; RVO:68378271 ; RVO:61388998 Keywords : Metal–metal composites * Spark plasma sintering * Light metals * Ferromagnetic alloys * Mechanical properties Subject RIV: JI - Composite Materials; JI - Composite Materials (FZU-D); JI - Composite Materials (UT-L) OBOR OECD: Composites (including laminates, reinforced plastics, cermets, combined natural and synthetic fibre fabrics; Composites (including laminates, reinforced plastics, cermets, combined natural and synthetic fibre fabrics (FZU-D); Composites (including laminates, reinforced plastics, cermets, combined natural and synthetic fibre fabrics (UT-L) Impact factor: 4.364, year: 2016 https://www.sciencedirect.com/science/ article /pii/S0264127517303842?via%3Dih

  20. ELM-induced arcing on tungsten fuzz in the COMPASS divertor region

    Czech Academy of Sciences Publication Activity Database

    Matějíček, Jiří; Weinzettl, Vladimír; Vilémová, Monika; Morgan, T.W.; De Temmerman, G.; Dimitrova, Miglena; Cavalier, Jordan; Adámek, Jiří; Seidl, Jakub; Jäger, Aleš

    2017-01-01

    Roč. 492, August (2017), s. 204-212 ISSN 0022-3115. [PSI 2016 - 22nd International Conference on Plasma Surface Interactions in Controlled Fusion Devices/22./. Roma, 30.05.2016-03.06.2016] R&D Projects: GA ČR(CZ) GA14-12837S; GA ČR(CZ) GA15-10723S; GA MŠk(CZ) LM2015045; GA MŠk(CZ) LM2011026 Institutional support: RVO:61389021 ; RVO:68378271 Keywords : tungsten fuzz * arcing * COMPASS tokamak * plasma-material interaction Subject RIV: JF - Nuclear Energetics; JF - Nuclear Energetics (FZU-D) OBOR OECD: Nuclear related engineering ; Nuclear related engineering (FZU-D) Impact factor: 2.048, year: 2016 http://www.sciencedirect.com/science/ article /pii/S0022311517301824

  1. The influence of substrate temperature and spraying distance on the properties of plasma sprayed tungsten and steel coatings deposited in a shrouding chamber

    Czech Academy of Sciences Publication Activity Database

    Matějíček, Jiří; Vilémová, Monika; Nevrlá, Barbara; Kocmanová, Lenka; Veverka, Jakub; Halasová, Martina; Hadraba, Hynek

    2017-01-01

    Roč. 318, May (2017), s. 217-223 ISSN 0257-8972. [International Meeting on Thermal Spraying (RIPT)/7./. Limoges, 09.12.2015-11.12.2015] R&D Projects: GA ČR GB14-36566G EU Projects: European Commission(XE) 633053 - EUROfusion Institutional support: RVO:61389021 ; RVO:68081723 Keywords : Tungsten * Steel * Atmospheric plasma spraying * Shrouding * Substrate temperature * Fusion reactor materials * Plasma facing components Subject RIV: JK - Corrosion ; Surface Treatment of Materials; JK - Corrosion ; Surface Treatment of Materials (UFM-A) OBOR OECD: Coating and films; Coating and films (UFM-A) Impact factor: 2.589, year: 2016 http://www.sciencedirect.com/science/ article /pii/S0257897216310520

  2. Case and Administrative Support Tools

    Science.gov (United States)

    Case and Administrative Support Tools (CAST) is the secure portion of the Office of General Counsel (OGC) Dashboard business process automation tool used to help reduce office administrative labor costs while increasing employee effectiveness. CAST supports business functions which rely on and store Privacy Act sensitive data (PII). Specific business processes included in CAST (and respective PII) are: -Civil Rights Cast Tracking (name, partial medical history, summary of case, and case correspondance). -Employment Law Case Tracking (name, summary of case). -Federal Tort Claims Act Incident Tracking (name, summary of incidents). -Ethics Program Support Tools and Tracking (name, partial financial history). -Summer Honors Application Tracking (name, home address, telephone number, employment history). -Workforce Flexibility Initiative Support Tools (name, alternative workplace phone number). -Resource and Personnel Management Support Tools (name, partial employment and financial history).

  3. Numerical solutions of unsteady flows with low inlet Mach numbers

    Czech Academy of Sciences Publication Activity Database

    Punčochářová, Petra; Furst, Jiří; Horáček, Jaromír; Kozel, Karel

    2010-01-01

    Roč. 80, č. 8 (2010), s. 1795-1805 ISSN 0378-4754 R&D Projects: GA AV ČR IAA200760613 Institutional research plan: CEZ:AV0Z20760514 Keywords : finite volume method * unsteady flow * low Mach number * viscous compressible fluid Subject RIV: BI - Acoustics Impact factor: 0.812, year: 2010 http://www.sciencedirect.com/science?_ob=MImg&_imagekey=B6V0T-4Y0D67D-1-R&_cdi=5655&_user=640952&_pii=S0378475409003607&_origin=search&_coverDate=04%2F30%2F2010&_sk=999199991&view=c&wchp=dGLbVlb-zSkzk&md5=ed6eaf0a050968ee978714fd54e7f131&ie=/sdarticle.pdf

  4. Remodelling of living bone induced by dynamic loading and drug delivery—Numerical modelling and clinical treatment

    Czech Academy of Sciences Publication Activity Database

    Maršík, František; Klika, Václav; Chlup, Hynek

    2010-01-01

    Roč. 80, č. 6 (2010), s. 1278-1288 ISSN 0378-4754 R&D Projects: GA ČR GA106/03/1073; GA ČR(CZ) GA106/08/0557 Grant - others:GA ČR(CZ) GA201/06/0352 Institutional research plan: CEZ:AV0Z20760514 Keywords : bone remodelling * chemical kinetics * biochemical model Subject RIV: BJ - Thermodynamics Impact factor: 0.812, year: 2010 http://www.sciencedirect.com/science?_ob=MImg&_imagekey=B6V0T-4VT1FYX-1-1&_cdi=5655&_user=640952&_pii=S0378475409000664&_origin=search&_coverDate=02%2F28%2F2010&_sk=999199993&view=c&wchp=dGLzVlz-zSkzV&md5=efaf801defe31154a1c6c44a9c5edef0&ie=/sdarticle.pdf

  5. X-ray beam splitting design for concurrent imaging at hard X-ray FELs and synchrotron facilities

    Czech Academy of Sciences Publication Activity Database

    Oberta, Peter; Mokso, R.

    2013-01-01

    Roč. 729, NOV (2013), s. 85-89 ISSN 0168-9002 R&D Projects: GA MPO FR-TI1/412 Institutional research plan: CEZ:AV0Z10100522 Keywords : diffractive-refractive optics * hard X-ray FEL * X-ray imaging Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.316, year: 2013 http://www.sciencedirect.com/science/article/pii/S0168900213009613

  6. The role of amorphous phase content on the electrical properties of atmospheric plasma sprayed (Ba,Sr)TiO3 coatings

    Czech Academy of Sciences Publication Activity Database

    Kotlan, Jiří; Seshadri, R.C.; Sampath, S.; Ctibor, Pavel

    2016-01-01

    Roč. 42, č. 9 (2016), s. 11010-11014 ISSN 0272-8842 R&D Projects: GA ČR GB14-36566G Institutional support: RVO:61389021 Keywords : X-ray methods * Electrical properties * Perovskites * Atmospheric Plasma Spray Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 2.986, year: 2016 http://www.sciencedirect.com/science/article/pii/S0272884216303856

  7. HELCZA-High heat flux test facility for testing ITER EU first wall components.

    Czech Academy of Sciences Publication Activity Database

    Prokůpek, J.; Samec, K.; Jílek, R.; Gavila, P.; Neufuss, S.; Entler, Slavomír

    2017-01-01

    Roč. 124, November (2017), s. 187-190 ISSN 0920-3796. [SOFT 2016: Symposium on Fusion Technology /29./. Prague, 05.09.2016-09.09.2016] Institutional support: RVO:61389021 Keywords : HELCZA * High heat flux * Electron beam testing * Test facility * Plasma facing components * First wall * Divertora Subject RIV: JF - Nuclear Energetics OBOR OECD: Nuclear related engineering Impact factor: 1.319, year: 2016 www.sciencedirect.com/science/article/pii/S0920379617302818

  8. Detection and analysis of anomalies in the brightness temperature difference field using MSG rapid scan data

    Czech Academy of Sciences Publication Activity Database

    Šťástka, J.; Radová, Michaela

    2013-01-01

    Roč. 123, SI (2013), s. 354-359 ISSN 0169-8095 R&D Projects: GA ČR GA205/07/0905 Institutional support: RVO:68378289 Keywords : brightness temperature difference (BTD) * BTD anomaly * cloud-top brightness temperature (BT) * convective storm * MSG Subject RIV: DG - Athmosphere Sciences, Meteorology OBOR OECD: Meteorology and atmospheric sciences Impact factor: 2.421, year: 2013 https://www.sciencedirect.com/science/article/pii/S0169809512001548

  9. On numerical regularity of the face-to-face longest-edge bisection algorithm for tetrahedral partitions

    Czech Academy of Sciences Publication Activity Database

    Hannukainen, A.; Korotov, S.; Křížek, Michal

    2014-01-01

    Roč. 90, Part A (2014), s. 34-41 ISSN 0167-6423 R&D Projects: GA ČR GA14-02067S Institutional support: RVO:67985840 Keywords : bisection algorithm * conforming finite element method * regular family of partitions Subject RIV: BA - General Mathematics Impact factor: 0.715, year: 2014 http://www.sciencedirect.com/science/article/pii/S0167642313001226

  10. Endocrine regulation of non-circadian behavior of circadian genes in insect gut

    Czech Academy of Sciences Publication Activity Database

    Bajgar, Adam; Doležel, David; Hodková, Magdalena

    2013-01-01

    Roč. 59, č. 9 (2013), s. 881-886 ISSN 0022-1910 R&D Projects: GA ČR GAP502/10/1612 Grant - others:EU Seventh Framework Programme(CZ) FP7/2007-2013, No. 316304 Institutional support: RVO:60077344 Keywords : cryptochrome * par domain protein 1 * photoperiod Subject RIV: ED - Physiology Impact factor: 2.500, year: 2013 http://www.sciencedirect.com/science/article/pii/S0022191013001364

  11. Extensions of vector-valued functions with preservation of derivatives

    Czech Academy of Sciences Publication Activity Database

    Koc, M.; Kolář, Jan

    2017-01-01

    Roč. 449, č. 1 (2017), s. 343-367 ISSN 0022-247X R&D Projects: GA ČR(CZ) GA14-07880S Institutional support: RVO:67985840 Keywords : vector-valued differentiable functions * extensions * strict differentiability * partitions of unity Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.064, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022247X16307703

  12. 9-Norbornyl-6-chloropurine (NCP) induces cell death through GSH depletion-associated ER stress and mitochondrial dysfunction

    Czech Academy of Sciences Publication Activity Database

    Plačková, Pavla; Šála, Michal; Šmídková, Markéta; Dejmek, Milan; Hřebabecký, Hubert; Nencka, Radim; Thibaut, H. J.; Neyts, J.; Mertlíková-Kaiserová, Helena

    2016-01-01

    Roč. 97, Aug (2016), s. 223-235 ISSN 0891-5849 R&D Projects: GA MŠk LO1302; GA ČR GAP303/11/1297 Institutional support: RVO:61388963 Keywords : glutathione-S-transferase * oxidative stress * leukemia Subject RIV: CE - Biochemistry Impact factor: 5.606, year: 2016 http://www.sciencedirect.com/science/article/pii/S0891584916302921

  13. Functional characterization of the adipokinetic hormone in the pea aphid, Acyrthosiphon pisum

    Czech Academy of Sciences Publication Activity Database

    Jedlička, Pavel; Steinbauerová, V.; Šimek, Petr; Zahradníčková, Helena

    2012-01-01

    Roč. 162, č. 1 (2012), s. 51-58 ISSN 1095-6433 R&D Projects: GA ČR GP522/09/P382 Grant - others:European Union FP7(CZ) MOBITAG, GA 229518 Institutional research plan: CEZ:AV0Z50070508 Keywords : adipokinetic hormone * Acyrthosiphon pisum * neuropeptide Subject RIV: ED - Physiology Impact factor: 2.167, year: 2012 http://www.sciencedirect.com/science/article/pii/S1095643312000256

  14. Dispersion of carbon nanotubes for application in cement composites

    Czech Academy of Sciences Publication Activity Database

    Foldyna, Josef; Foldyna, Vladimír; Zeleňák, Michal

    2016-01-01

    Roč. 149, č. 149 (2016), s. 94-99 E-ISSN 1877-7058 R&D Projects: GA MŠk(CZ) LO1406; GA MŠk ED2.1.00/03.0082; GA ČR GA15-23219S Institutional support: RVO:68145535 Keywords : carbon nanotubes * dispersion * sonication * pulsating water jet * impact pressure Subject RIV: JQ - Machines ; Tools http://www. science direct.com/ science /article/pii/S1877705816311511

  15. Computable majorants of the limit load in Hencky's plasticity problems

    Czech Academy of Sciences Publication Activity Database

    Repin, S.; Sysala, Stanislav; Haslinger, Jaroslav

    2018-01-01

    Roč. 75, č. 1 (2018), s. 199-217 ISSN 0898-1221 R&D Projects: GA MŠk LQ1602 Institutional support: RVO:68145535 Keywords : computable bounds * divergence free fields * Hencky's plasticity * limit load * penalization Subject RIV: BA - General Mathematics Impact factor: 1.531, year: 2016 http://www. science direct.com/ science /article/pii/S0898122117305552

  16. Parallel iterative solution of the incompressible Navier-Stokes equations with application to rotating wings

    Czech Academy of Sciences Publication Activity Database

    Šístek, Jakub; Cirak, F.

    2015-01-01

    Roč. 122, 20 November (2015), s. 165-183 ISSN 0045-7930 R&D Projects: GA ČR GA14-02067S Institutional support: RVO:67985840 Keywords : Navier-Stokes * incompressible flow * Krylov subspace method s Subject RIV: BA - General Mathematics Impact factor: 1.891, year: 2015 http://www. science direct.com/ science /article/pii/S0045793015003023

  17. Electromagnetic fields with vanishing quantum corrections

    Czech Academy of Sciences Publication Activity Database

    Ortaggio, Marcello; Pravda, Vojtěch

    2018-01-01

    Roč. 779, 10 April (2018), s. 393-395 ISSN 0370-2693 R&D Projects: GA ČR GA13-10042S Institutional support: RVO:67985840 Keywords : nonlinear electrodynamics * quantum corrections Subject RIV: BA - General Mathematics OBOR OECD: Applied mathematics Impact factor: 4.807, year: 2016 https://www. science direct.com/ science /article/pii/S0370269318300327?via%3Dihub

  18. The interior regularity of pressure associated with a weak solution to the Navier-Stokes equations with the Navier-type boundary conditions

    Czech Academy of Sciences Publication Activity Database

    Neustupa, Jiří; Al Baba, Hind

    2018-01-01

    Roč. 463, č. 1 (2018), s. 222-234 ISSN 0022-247X R&D Projects: GA ČR(CZ) GA17-01747S Institutional support: RVO:67985840 Keywords : Navier-Stokes equation * Navier-type boundary conditions * interior regularity Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.064, year: 2016 https://www. science direct.com/ science /article/pii/S0022247X18302233?via%3Dihub

  19. Spared cognitive processing of visual oddballs despite delayed visual evoked potentials in patient with partial recovery of vision after 53 years of blindness

    Czech Academy of Sciences Publication Activity Database

    Kremláček, J.; Šikl, Radovan; Kuba, M.; Szanyi, J.; Kubová, Z.; Langrová, J.; Vít, F.; Šimeček, Michal; Stodůlka, P.

    2013-01-01

    Roč. 81, April (2013), s. 1-5 ISSN 0042-6989 R&D Projects: GA ČR(CZ) GAP407/12/2528 Institutional support: RVO:68081740 Keywords : visual deprivation * recovery from blindness * motion-onset VEPs * pattern-reversal VEPs * oddball ERPs * P3b Subject RIV: FH - Neurology Impact factor: 2.381, year: 2013 http://www.sciencedirect.com/science/article/pii/S0042698913000151

  20. Influence of peptides and proteins produced by cyanobacterium Microcystis aeruginosa on the coagulation of turbid waters

    Czech Academy of Sciences Publication Activity Database

    Šafaříková, Jana; Barešová, Magdalena; Pivokonský, Martin; Kopecká, Ivana

    2013-01-01

    Roč. 18, October (2013), s. 49-57 ISSN 1383-5866 R&D Projects: GA ČR GAP105/11/0247 Institutional research plan: CEZ:AV0Z20600510 Institutional support: RVO:67985874 Keywords : Cellular organic matter (COM) * Coagulation * Microcystis aeruginosa * Peptides/proteins * Turbidity removal Subject RIV: BK - Fluid Dynamics Impact factor: 3.065, year: 2013 http://www.sciencedirect.com/science/article/pii/S1383586613004152

  1. On convex complexity measures

    Czech Academy of Sciences Publication Activity Database

    Hrubeš, P.; Jukna, S.; Kulikov, A.; Pudlák, Pavel

    2010-01-01

    Roč. 411, 16-18 (2010), s. 1842-1854 ISSN 0304-3975 R&D Projects: GA AV ČR IAA1019401 Institutional research plan: CEZ:AV0Z10190503 Keywords : boolean formula * complexity measure * combinatorial rectangle * convexity Subject RIV: BA - General Mathematics Impact factor: 0.838, year: 2010 http://www.sciencedirect.com/science/article/pii/S0304397510000885

  2. The Parliamentary Election in the Czech Republic, October 2013

    Czech Academy of Sciences Publication Activity Database

    Stegmaier, M.; Linek, Lukáš

    2014-01-01

    Roč. 35, č. 1 (2014), s. 385-388 ISSN 0261-3794 R&D Projects: GA ČR(CZ) GAP408/12/1474 Institutional support: RVO:68378025 Keywords : elections * Czech republic * new parties Subject RIV: AD - Politology ; Political Science s Impact factor: 1.182, year: 2014 http://www. science direct.com/ science /article/pii/S0261379414000298

  3. Search for squarks and gluinos using final states with jets and missing transverse momentum with the ATLAS detector in sqrt{s} = 7 TeV proton-proton collisions

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abbott, B.; Abdallah, J.; Chudoba, Jiří; Gallus, Petr; Gunther, Jaroslav; Hruška, I.; Juránek, Vojtěch; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lipinský, L.; Lokajíček, Miloš; Marčišovský, Michal; Mikeštíková, Marcela; Myška, Miroslav; Němeček, Stanislav; Panušková, M.; Růžička, Pavel; Schovancová, Jaroslava; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Tic, Tomáš; Valenta, J.; Vrba, Václav; Zeman, Martin

    2012-01-01

    Roč. 710, č. 1 (2012), s. 67-85 ISSN 0370-2693 R&D Projects: GA MŠk LA08032 Institutional research plan: CEZ:AV0Z10100502 Keywords : squark * supersymmetry * space parametermassless neutralino * gluino * ATLAS * CERN LHC Coll * p p interaction Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.569, year: 2012 http://www. science direct.com/ science /article/pii/S037026931200192X

  4. Search for displaced vertices arising from decays of new heavy particles in 7 TeV pp collisions at ATLAS

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abbott, B.; Abdallah, J.; Chudoba, Jiří; Gallus, Petr; Gunther, Jaroslav; Hruška, I.; Juránek, Vojtěch; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lipinský, L.; Lokajíček, Miloš; Marčišovský, Michal; Mikeštíková, Marcela; Myška, Miroslav; Němeček, Stanislav; Panušková, M.; Růžička, Pavel; Schovancová, Jaroslava; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Tic, Tomáš; Valenta, J.; Vrba, Václav; Zeman, Martin

    2012-01-01

    Roč. 707, č. 5 (2012), s. 478-496 ISSN 0370-2693 R&D Projects: GA MŠk LA08032 Institutional research plan: CEZ:AV0Z10100502 Keywords : massive postulated particle * neutralino * ATLAS * CERN LHC Coll * squark pair production * squark: decay * p p interacion Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.569, year: 2012 http://www. science direct.com/ science /article/pii/S0370269311015255

  5. Search for a heavy Standard Model Higgs boson in the channel H->ZZ->llqq using the ATLAS detector

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abbott, B.; Abdallah, J.; Chudoba, Jiří; Gallus, Petr; Gunther, Jaroslav; Hruška, I.; Juránek, Vojtěch; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lipinský, L.; Lokajíček, Miloš; Marčišovský, Michal; Mikeštíková, Marcela; Myška, Miroslav; Němeček, Stanislav; Panušková, M.; Růžička, Pavel; Schovancová, Jaroslava; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Tic, Tomáš; Valenta, J.; Vrba, Václav; Zeman, Martin

    2012-01-01

    Roč. 707, č. 1 (2012), s. 27-45 ISSN 0370-2693 R&D Projects: GA MŠk LA08032 Institutional research plan: CEZ:AV0Z10100502 Keywords : pp interaction * Higgs particle * Higgs particle decay * Z0 pair production * final state (dijet dilepton) * Higgs particle mass Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.569, year: 2012 http://www. science direct.com/ science /article/pii/S0370269311014353

  6. pK(+)Lambda final state: Towards the extraction of the ppK(-) contribution

    Czech Academy of Sciences Publication Activity Database

    Fabbietti, L.; Agakishiev, G.; Behnke, C.; Belver, D.; Belyaev, A.; Berger-Chen, J. C.; Blanco, A.; Blume, C.; Böhmer, M.; Cabanelas, P.; Chernenko, S.; Dritsa, C.; Dybczak, A.; Epple, E.; Krása, Antonín; Křížek, Filip; Kugler, Andrej; Sobolev, Yuri, G.; Tlustý, Pavel; Wagner, Vladimír

    2013-01-01

    Roč. 914, SEP (2013), s. 60-68 ISSN 0375-9474 R&D Projects: GA MŠk LC07050; GA AV ČR IAA100480803 Institutional support: RVO:61389005 Keywords : Lambda(1405) * kaonic bound state * meson-baryon interaction * partial wave analysis Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 2.499, year: 2013 http://www. science direct.com/ science /article/pii/S0375947413004971

  7. Search for new physics in the dijet mass distribution using 1 fb.sup.-1./sup. of pp collision data at sqrt{s} = 7 TeV collected by the ATLAS detector

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abbott, B.; Abdallah, J.; Chudoba, Jiří; Gallus, Petr; Gunther, Jaroslav; Hruška, I.; Juránek, Vojtěch; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lipinský, L.; Lokajíček, Miloš; Marčišovský, Michal; Mikeštíková, Marcela; Myška, Miroslav; Němeček, Stanislav; Panušková, M.; Růžička, Pavel; Schovancová, Jaroslava; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Tic, Tomáš; Valenta, J.; Vrba, Václav; Zeman, Martin

    2012-01-01

    Roč. 708, 1-2 (2012), s. 37-54 ISSN 0370-2693 R&D Projects: GA MŠk LA08032 Institutional research plan: CEZ:AV0Z10100502 Keywords : resonance * dijet: mass spectrum * scalar resonance * color octet * new physics * ATLAS * CERN LHC Coll * axigluon * pp interaction Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.569, year: 2012 http://www. science direct.com/ science /article/pii/S0370269312000482

  8. Search for contact interactions in dilepton events from pp collisions at sqrt{s} =7 TeV with the ATLAS detector

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abbott, B.; Abdallah, J.; Chudoba, Jiří; Gallus, Petr; Gunther, Jaroslav; Hruška, I.; Juránek, Vojtěch; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lipinský, L.; Lokajíček, Miloš; Marčišovský, Michal; Mikeštíková, Marcela; Myška, Miroslav; Němeček, Stanislav; Panušková, M.; Růžička, Pavel; Schovancová, Jaroslava; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Tic, Tomáš; Valenta, J.; Vrba, Václav; Zeman, Martin

    2012-01-01

    Roč. 712, 1-2 (2012), s. 40-58 ISSN 0370-2693 R&D Projects: GA MŠk LA08032 Institutional research plan: CEZ:AV0Z10100502 Keywords : pp inclusive reaction * electron positron mass spectrum * dimuon mass spectrum * ATLAS * CERN LHC Coll Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.569, year: 2012 http://www. science direct.com/ science /article/pii/S0370269312004297

  9. Search for the standard model Higgs boson in the ZH→ννˉbbˉ channel in 9.5 fb.sup.−1./sup. of ppˉ collisions at √s=1.96 TeV

    Czech Academy of Sciences Publication Activity Database

    Abazov, V. M.; Abbott, B.; Acharya, B.S.; Kupčo, Alexander; Lokajíček, Miloš

    2012-01-01

    Roč. 716, č. 2 (2012), s. 285-293 ISSN 0370-2693 R&D Projects: GA MŠk LA08047; GA MŠk(CZ) LG12006 Institutional research plan: CEZ:AV0Z10100502 Keywords : D0 * Tevatron * standard model * Higgs boson * channel * lepton Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.569, year: 2012 http://www. science direct.com/ science /article/pii/S0370269312008842

  10. Search for heavy vector-like quarks coupling to light quarks in proton-proton collisions at sqrt{s} =7 TeV with the ATLAS detector

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abbott, B.; Abdallah, J.; Böhm, Jan; Chudoba, Jiří; Gallus, Petr; Gunther, Jaroslav; Hruška, I.; Jakoubek, Tomáš; Juránek, Vojtěch; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lipinský, L.; Lokajíček, Miloš; Marčišovský, Michal; Mikeštíková, Marcela; Myška, Miroslav; Němeček, Stanislav; Panušková, M.; Růžička, Pavel; Schovancová, Jaroslava; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Tic, Tomáš; Valenta, J.; Vrba, Václav; Zeman, Martin

    2012-01-01

    Roč. 712, 1-2 (2012), s. 22-39 ISSN 0370-2693 R&D Projects: GA MŠk LA08032 Institutional research plan: CEZ:AV0Z10100502 Keywords : heavy quark * pp scattering * ATLAS * intermedia Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.569, year: 2012 http://www. science direct.com/ science /article/pii/S0370269312003802

  11. Searches for supersymmetry with the ATLAS detector using final states with two leptons and missing transverse momentum in sqrt{s} = 7 TeV proton-proton collisions

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abbott, B.; Abdallah, J.; Chudoba, Jiří; Gallus, Petr; Gunther, Jaroslav; Hruška, I.; Juránek, Vojtěch; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lipinský, L.; Lokajíček, Miloš; Marčišovský, Michal; Mikeštíková, Marcela; Myška, Miroslav; Němeček, Stanislav; Panušková, M.; Růžička, Pavel; Schovancová, Jaroslava; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Tic, Tomáš; Valenta, J.; Vrba, Václav; Zeman, Martin

    2012-01-01

    Roč. 709, č. 3 (2012), s. 137-157 ISSN 0370-2693 R&D Projects: GA MŠk LA08032 Institutional research plan: CEZ:AV0Z10100502 Keywords : transverse momentum * missing-energy, pp scattering * sparticle production * gaugino production * chargino mass Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.569, year: 2012 http://www. science direct.com/ science /article/pii/S0370269312001177

  12. Search for Higgs bosons of the minimal supersymmetric standard model in ppˉ collisions at √s=1.96 TeV

    Czech Academy of Sciences Publication Activity Database

    Abazov, V. M.; Abbott, B.; Acharya, B.S.; Kupčo, Alexander; Lokajíček, Miloš

    2012-01-01

    Roč. 710, 4-5 (2012), s. 569-577 ISSN 0370-2693 R&D Projects: GA MŠk LA08047 Institutional research plan: CEZ:AV0Z10100502 Keywords : D0 * Higgs particle * lower limit * tau * pair production * minimal supersymmetric standard model * parameter space Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.569, year: 2012 http://www. science direct.com/ science /article/pii/S0370269312002857

  13. Search for pair production of the scalar top quark in muon+tau final states

    Czech Academy of Sciences Publication Activity Database

    Abazov, V. M.; Abbott, B.; Acharya, B.S.; Kupčo, Alexander; Lokajíček, Miloš

    2012-01-01

    Roč. 710, 4-5 (2012), s. 578-586 ISSN 0370-2693 R&D Projects: GA MŠk LA08047 Institutional research plan: CEZ:AV0Z10100502 Keywords : D0 * anti-p p interaction * muon tau final state * stop pair production Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.569, year: 2012 http://www. science direct.com/ science /article/pii/S0370269312003024

  14. Injection of 40 kHz-modulated electron beam from the satellite: I. Beam-plasma interaction near the linear stability boundary

    Czech Academy of Sciences Publication Activity Database

    Baranets, N.; Ruzhin, Yu.; Dokukin, V.; Ciobanu, M.; Rothkaehl, H.; Kiraga, A.; Vojta, Jaroslav; Šmilauer, Jan; Kudela, K.

    2017-01-01

    Roč. 59, č. 12 (2017), s. 2951-2968 ISSN 0273-1177 Institutional support: RVO:68378289 Keywords : energy waves * instability * system * beam- plasma interaction * space charge beam waves * pump wave * weak-coupling prediction Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: Fluids and plasma physics (including surface physics) Impact factor: 1.401, year: 2016 http://www.sciencedirect.com/science/article/pii/S0273117717302181

  15. Implications of high density operation on SOL transport: A multimachine investigation

    Czech Academy of Sciences Publication Activity Database

    Carralero, D.; Müller, H.W.; Groth, M.; Komm, Michael; Adámek, Jiří; Birkenmeier, G.; Brix, M.; Janky, Filip; Háček, Pavel; Marsen, S.; Reimold, F.; Silva, C.; Stroth, U.; Wischmeier, M.; Wolfrum, E.

    2015-01-01

    Roč. 463, August (2015), s. 123-127 ISSN 0022-3115. [PLASMA-SURFACE INTERACTIONS 21: International Conference on Plasma-Surface Interactions in Controlled Fusion Devices. Kanazawa, 26.05.2014-30.05.2014] Institutional support: RVO:61389021 Keywords : SOL transport * tokamak * COMPASS Subject RIV: JF - Nuclear Energetics OBOR OECD: Nuclear related engineering Impact factor: 2.199, year: 2015 http://www.sciencedirect.com/science/article/pii/S002231151400703X

  16. Study of nitrate contaminated samples from a historic building with the hygroscopic moisture content method: Contribution of laboratory data to interpret results practical significance

    Czech Academy of Sciences Publication Activity Database

    Nunes, Cristiana Lara; Skružná, Olga; Válek, Jan

    2018-01-01

    Roč. 30, March-April (2018), s. 57-69 ISSN 1296-2074 R&D Projects: GA MK(CZ) DG16P02H012 Keywords : soluble salts * hygroscopicity * moisture content * nitrate salts * deliquescence * porous building materials Subject RIV: AL - Art, Architecture, Cultural Heritage OBOR OECD: Materials engineering Impact factor: 1.838, year: 2016 https://www.sciencedirect.com/science/article/pii/S1296207417302649

  17. Why Y-c.c

    Czech Academy of Sciences Publication Activity Database

    Chodounský, David; Zapletal, Jindřich

    2015-01-01

    Roč. 166, č. 11 (2015), s. 1123-1149 ISSN 0168-0072 R&D Projects: GA ČR(CZ) GF15-34700L Institutional support: RVO:67985840 Keywords : c.c.c. partitions * proper forcing * forcing axiom Subject RIV: BA - General Mathematics Impact factor: 0.582, year: 2015 http://www.sciencedirect.com/science/article/pii/S0168007215000664

  18. On the effects of hydrogenation of thin film polycrystalline silicon: A key factor to improve heterojunction solar cells

    Czech Academy of Sciences Publication Activity Database

    Qiu, Y.; Kunz, O.; Fejfar, Antonín; Ledinský, Martin; Teik Chan, B.; Gordon, I.; Van Gestel, D.; Venkatachalm, S.; Egan, R.

    2014-01-01

    Roč. 122, MAR (2014), s. 31-39 ISSN 0927-0248 R&D Projects: GA MŠk 7E10061; GA MŠk(CZ) LM2011026 EU Projects: European Commission(XE) 240826 - PolySiMode Institutional support: RVO:68378271 Keywords : silicon * thin films * polycrystalline * hydrogenation * Raman spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 5.337, year: 2014 http://www.sciencedirect.com/science/article/pii/S0927024813006016

  19. Smooth dependence on data of solutions and contact regions for a Signorini problem

    Czech Academy of Sciences Publication Activity Database

    Eisner, Jan; Kučera, Milan; Recke, L.

    2010-01-01

    Roč. 72, 3-4 (2010), s. 1358-1378 ISSN 0362-546X R&D Projects: GA AV ČR IAA100190506 Institutional research plan: CEZ:AV0Z10190503 Keywords : smooth dependence on date * Signorini problem * variational inequality Subject RIV: BA - General Mathematics Impact factor: 1.279, year: 2010 http://www.sciencedirect.com/science/article/pii/S0362546X09009808

  20. Nonoscillation of half-linear dynamic equations

    Czech Academy of Sciences Publication Activity Database

    Matucci, S.; Řehák, Pavel

    2010-01-01

    Roč. 60, č. 5 (2010), s. 1421-1429 ISSN 0898-1221 R&D Projects: GA AV ČR KJB100190701 Grant - others:GA ČR(CZ) GA201/07/0145 Institutional research plan: CEZ:AV0Z10190503 Keywords : half-linear dynamic equation * time scale * (non)oscillation * Riccati technique Subject RIV: BA - General Mathematics Impact factor: 1.472, year: 2010 http://www.sciencedirect.com/science/article/pii/S0898122110004384