Helminth parasites of the levantine frog (Pelophylax bedriagae Camerano, 1882 from the western part of Turkey

Directory of Open Access Journals (Sweden)

Demır S.

2015-02-01

Full Text Available Fifty-four Pelophylax bedriagae (Levantine Frog from Turkey (İzmir and Manisa Provinces were examined for helminth parasites. The frogs were collected between 2012 and 2014 years. Eight species of helminth parasites were recorded: 3 species of Nematoda (Rhabdias bufonis, Cosmocerca ornata, Oswaldocruzia filiformis, 3 species of Digenea (Diplodiscus subclavatus, Haematoloechus bre-viansa, Gorgoderina vitelliloba, 1 species of Acanthocephala (Acanthocephalus ranae and 1 species of Hirudinea (Hirudo medicinalis. Pelophylax bedriagae is a new host record for these parasite species.

First bioacoustic and morphological data for the presence of Pelophylax bedriagae in Bulgaria

Directory of Open Access Journals (Sweden)

Lukanov Simeon

2018-03-01

Full Text Available Water frog mating calls from two localities were studied and analyzed. Recordings were made in the summer of 2010 at the Arkutino swamp near the town of Primorsko and at the Vurbitza River near the town of Momchilgrad. A total of 154 calls were analyzed and the results suggested the presence of both the Marsh frog (Pelophylax ridibundus and the Levant frog (Pelophylax bedriagae in both sites, with the former being more frequent in Vurbitza River, and the latter – in Arkutino. At Vurbitza, we also captured and measured 2 specimens, which morphological characteristics differed from P. ridibundus and matched those of P. bedriagae. These are the first localities for P. bedriagae in Bulgaria.

Use of the crop maize to reduce yellow nutsedge (Cyperus esculentus L. pressure in highly infested fields in Switzerland

Directory of Open Access Journals (Sweden)

Keller, Martina

2014-02-01

Full Text Available Cyperus esculentus L. causes high yield losses in many crops worldwide. In Switzerland it was observed for the first time about 30 years ago. Since then it has become a serious weed in several regions - especially where vegetables are produced. Growing vegetables in heavily infested fields should be abandoned due to their low competitiveness and the lack of available, effective herbicides. Contrarily, in maize several herbicides with a partial effect on C. esculentus are registered. Thus, continuous cultivation of maize including the use of the most effective herbicides against C. esculentus could help reducing infestation levels in heavily infested fields. Field trials were carried out at two sites in maize during 2011 and 2012. Different herbicide combinations, hoeing and herbicide applications combined with hoeing were the applied treatments. Split application was compared with one single application of the same amount of product. The effect of an additional, late under leaf herbicide application was determined as well. Cyperus esculentus coverage was estimated in the fields in 2011. Plots were sampled in spring 2011, autumn 2011 and autumn 2012. The Number of C. esculentus sprouts germinated from the soil samples was determined under greenhouse conditions. The most effective herbicide combination of registered active ingredients was rimsulfuron and mesotrione. Smetolachlor was effective as well, especially if combined with mechanical weed control. Halosulfuron-methyl applied twice provided the best C. esculentus control. Split application tended to be more effective than a single application. Control of C. esculentus could be improved considerably with an additional herbicide application in late June (under leaf. The treatments with highest C. esculentus control determined in the field trials and combinations thereof are effective treatment options for C. esculentus control in maize. These findings indicate and confirm that maize cropped for

Purification and characterization of a novel plantaricin, KL-1Y, from Lactobacillus plantarum KL-1.

Science.gov (United States)

Rumjuankiat, Kittaporn; Perez, Rodney Horanda; Pilasombut, Komkhae; Keawsompong, Suttipun; Zendo, Takeshi; Sonomoto, Kenji; Nitisinprasert, Sunee

2015-06-01

Three bacteriocins from Lactobacillus plantarum KL-1 were successfully purified using ammonium sulfate precipitation, cation-exchange chromatography and reverse-phase HPLC. The bacteriocin peptides KL-1X, -1Y and -1Z had molecular masses of 3053.82, 3498.16 and 3533.16 Da, respectively. All three peptides were stable at pH 2-12 and 25 °C and at high temperatures of 80 and 100 °C for 30 min and 121 °C for 15 min. However, they differed in their susceptibility to proteolytic enzymes and their inhibition spectra. KL-1Y showed broad inhibitory activities against Gram-positive and Gram-negative bacteria, including Salmonella enterica serovar Enteritidis DMST 17368, Pseudomonas aeruginosa ATCC 15442, P. aeruginosa ATCC 9027, Escherichia coli O157:H7 and E. coli ATCC 8739. KL-1X and -1Z inhibited only Gram-positive bacteria. KL-1X, KL-1Y and KL-1Z exhibited synergistic activity. The successful amino acid sequencing of KL-1Y had a hydrophobicity of approximately 30 % and no cysteine residues suggested its novelty, and it was designated "plantaricin KL-1Y". Plantaricin KL-1Y exhibited bactericidal activity against Bacillus cereus JCM 2152(T). Compared to nisin, KL-1Y displayed broad inhibitory activities of 200, 800, 1600, 800, 400 and 400 AU/mL against the growth of Bacillus coagulans JCM 2257(T), B. cereus JCM 2152(T), Listeria innocua ATCC 33090(T), Staphylococcus aureus TISTR 118, E. coli O157:H7 and E. coli ATCC 8739, respectively, whereas nisin had similar activities against only B. coagulans JCM 2257(T) and B. cereus JCM 2152(T). Therefore, the novel plantaricin KL-1Y is a promising antimicrobial substance for food safety uses in the future.

Competição inicial entre Cyperus esculentus e arroz irrigado em condições de casa-de-vegetação Competition between Cyperus esculentus and irrigated rice under green house conditions

Directory of Open Access Journals (Sweden)

E. A. L. Erasmo

2000-08-01

Full Text Available Com o objetivo de avaliar o efeito competitivo de Cyperus esculentus sobre o crescimento inicial da cultura do arroz irrigado, foi instalado um experimento em casa-devegetação, na Estação Experimental da Faculdade de Agronomia - UNITINS, no munícipio de Gurupi-TO. O delineamento estatístico utilizado foi um fatorial 5x4 com três repetições completamente casualizado. Os tratamentos constaram de cinco períodos de convivência do arroz com C. esculentus (15, 25, 35, 45 e 60 dias após a emergência da cultura e quatro densidades de C. esculentus (0, 2, 4 e 8 tubérculos/vaso, correspondentes a 0; 71; 142 e 286 plantas de C. esculentus por m2, respectivamente. No final de cada período foram avaliados na cultura do arroz os seguintes parâmetros: matéria seca de plantas/vaso; área foliar/planta; matéria seca de perfilhos/vaso; n.º de perfilhos/vaso e altura média de plantas. Os resultados mostraram que o efeito da presença de C. esculentus foi mais marcante nas densidades de quatro e oito tubérculos/vaso a partir dos 35 dias de convivência. O parâmetro mais afetado foi a matéria seca de plantas/vaso, como resultado do decréscimo do número de perfilhos/vaso. A altura das plantas de arroz irrigado não foi afetada pela presença da planta daninha em nenhum período de convivência.With the objective of evaluating the competitive effect of Cyperus esculentus on the growth and production of the culture of irrigated rice, experiments were installed in green house, in the Experimental Station of the School of Agronomy - UNITINS, in Gurupi, State of Tocantins, Brazil. The statistical design used in the experiments was a factorial plot 5x4 with three replications, completely randomized. The treatments consisted of five periods of coexistence of the rice with Cyperus esculentus (15, 25, 35, 45 and 60 days after the emergency - D.A.E, of the rice and four densities of C. esculentus (0, 2, 4 and 8 tuber/pots corresponding to 0; 71; 142 e

Related structures of neutral capsular polysaccharides of Acinetobacter baumannii isolates that carry related capsule gene clusters KL43, KL47, and KL88.

Science.gov (United States)

Shashkov, Alexander S; Kenyon, Johanna J; Arbatsky, Nikolay P; Shneider, Mikhail M; Popova, Anastasiya V; Miroshnikov, Konstantin A; Hall, Ruth M; Knirel, Yuriy A

2016-11-29

Capsular polysaccharides were recovered from four Acinetobacter baumannii isolates, and the following related structures of oligosaccharide repeating units were established by sugar analyses along with 1D and 2D 1 H and 13 C NMR spectroscopy: NIPH 60 and LUH5544 (K43) NIPH 601 (K47) The K locus for capsule biosynthesis in the genome sequences available for NIPH 60 and LUH5544, designated KL43, was found to be related to gene clusters KL47 in NIPH 601 and KL88 in LUH5548. The three clusters share most gene content differing in only a small portion that includes an additional glycosyltransferase genes in KL47 and KL88, as well as genes encoding distinct Wzy polymerases that were found to form the same α-d-GlcpNAc-(1 → 6)-α-d-GlcpNAc linkage in K43 and K47. Copyright © 2016 Elsevier Ltd. All rights reserved.

Regeneration of okra (Abelmoschus esculentus L.) via apical shoot ...

African Journals Online (AJOL)

USER

2012-10-25

Oct 25, 2012 ... esculentus L. Monech) N-550 line evolved at R&D, Nirmal Seeds Pvt. Ltd., was used as basic material ... Therefore, development of tissue culture protocols to induce .... Department of Botany, Rajshahi University, Bangladesh.

Tien jaar Knolcyperus (Cyperus esculentus L.) in Nederland

NARCIS (Netherlands)

Rotteveel, A.J.W.

1993-01-01

Yellow nutsedge ( Cyperus esculentus L.) was first recorded in 1981 as an agricultural pest. A considerable number of fields was found to be infested. Because the species is very damaging to agriculture legal measures were taken to restrict the dispersion and promote the control of the weed. During

Study of the hibiscus esculentus mucilage coagulation–flocculation ...

African Journals Online (AJOL)

The flocculent activity of Hibiscus esculentus (gombo) mucilage traditionally used for a local beer (Tchapalo) clarification in Côte d\\'Ivoire was studied using the method of the experimental designs. Of the three factors selected that are the volume of mucilage (X1), the temperature (X2) and the pH (X3), sole X1 and X3 ...

Kinetics of modulatory role of Cyperus esculentus L. on the specific ...

African Journals Online (AJOL)

Background: The continuous search for new lead compounds as viable inhibitors of specific enzymes linked to carbohydrate metabolism has intensified. Cyperus esculentus L. is one of the therapeutically implicated botanicals against several degenerative diseases including diabetes mellitus. Materials and Methods: This ...

the effect of aqueous extract of cyperus esculentus on some liver ...

African Journals Online (AJOL)

honey

2014-03-31

Mar 31, 2014 ... Cyperus esculentus is valued for the highly nutritional starch content, dietary fibre and digestible carbohydrate of monosaccharides, disaccharides and polysaccharides ..... Comparative physicochemical evaluation of tigernut, soyabean and coconut milk sources. Int. J. Agric. Biol. 5: 785-787. Burn, M.K. ...

A baseline survey of tiger nut ( Cyperus esculentus ) production in ...

African Journals Online (AJOL)

Tiger nut (Cyperus esculentus) is a minor but important crop in Ghana. In a survey conducted on the production and marketing of the crop at Aduamoa in the Kwahu South District of Ghana, it was observed that tiger nut production was predominantly the work of women, with 70 per cent of farmers being women and 30 per ...

On the feeding ecology of Pelophylax saharicus (Boulenger 1913) from Morocco

OpenAIRE

Zaida Ortega; Valentín Pérez-Mellado; Pilar Navarro; Javier Lluch

2016-01-01

The Sahara frog is the most common amphibian found in North Africa. However, the knowledge of its natural history is rather fragmentary. In the present work we studied the trophic ecology of Pelophylax saharicus at some areas of Morocco through the analysis of 130 gastric contents. We did not find any significant sexual dimorphism in body size of adult individuals. Consumed prey show similar sizes in both sexes, while bigger frogs normally eat larger prey. As in other Palearctic frogs, the di...

Phytochemical analysis, antioxidant, antistress, and nootropic activities of aqueous and methanolic seed extracts of ladies finger (Abelmoschus esculentus L.) in mice.

Science.gov (United States)

Doreddula, Sathish Kumar; Bonam, Srinivasa Reddy; Gaddam, Durga Prasad; Desu, Brahma Srinivasa Rao; Ramarao, Nadendla; Pandy, Vijayapandi

2014-01-01

Abelmoschus esculentus L. (ladies finger, okra) is a well-known tropical vegetable, widely planted from Africa to Asia and from South Europe to America. In the present study, we investigated the in vitro antioxidant capacity and in vivo protective effect of the aqueous and methanolic seed extracts of Abelmoschus esculentus against scopolamine-induced cognitive impairment using passive avoidance task and acute restraining stress-induced behavioural and biochemical changes using elevated plus maze (EPM) and forced swimming test (FST) in mice. Our results demonstrated that the pretreatment of mice with aqueous and methanolic seed extracts of Abelmoschus esculentus (200 mg/kg, p.o.) for seven days significantly (P nootropic activities which promisingly support the medicinal values of ladies finger as a vegetable.

NMR study of Albemoschus esculentus characterization

International Nuclear Information System (INIS)

Bathista, A.L.B.S; Silva, E.O.; Nogueira, Jose de S.; Tavares, M.I.B.

2001-01-01

The investigation of the main compounds presented in the Albemoschus esculentus has been carried out employing nuclear magnetic resonance spectroscopy (NMR), using solution and solid state NMR when it one was necessary. The evaluation of NMR data allowed us to characterize the main type of components presented in this kind of sample. It was necessary to use a total information from solid state NMR and also the solution response. From these information we could get that four main components were presented in this sample. One in the shell, that is cellulose, another one between the shell and seeds that is a polysaccharide and in the seed two components were found one is a starch and the second one is an oil, a triacylglycerol. These components are responsible by its physical chemistry properties. (author)

KL-6, a human MUC1 mucin, promotes proliferation and survival of lung fibroblasts

International Nuclear Information System (INIS)

Ohshimo, Shinichiro; Yokoyama, Akihito; Hattori, Noboru; Ishikawa, Nobuhisa; Hirasawa, Yutaka; Kohno, Nobuoki

2005-01-01

The serum level of KL-6, a MUC1 mucin, is a clinically useful marker for various interstitial lung diseases. Previous studies demonstrated that KL-6 promotes chemotaxis of human fibroblasts. However, the pathophysiological role of KL-6 remains poorly understood. Here, we further investigate the functional aspects of KL-6 in proliferation and apoptosis of lung fibroblasts. KL-6 accelerated the proliferation and inhibited the apoptosis of all human lung fibroblasts examined. An anti-KL-6 monoclonal antibody counteracted both of these effects induced by KL-6 on human lung fibroblasts. The pro-fibroproliferative and anti-apoptotic effects of KL-6 are greater than and additive to those of the maximum effective concentrations of platelet-derived growth factor, basic fibroblast growth factor, and transforming growth factor-β. These findings indicate that increased levels of KL-6 in the epithelial lining fluid may stimulate fibrotic processes in interstitial lung diseases and raise the possibility of applying an anti-KL-6 antibody to treat interstitial lung diseases

Karkaisulaitos KL12 karkaisupuhaltimien Online- kunnonvalvonnan suunnitelma

OpenAIRE

Sällinen, Tuomas

2016-01-01

Tämän opinnäytetyön tavoitteena oli tutkia Cosmos-värähtelyjärjestelmän sopivuutta karkaisulaitos KL12:n karkaisupuhaltimille. Työ suoritettiin toimeksiantona Pilkington yritykselle, mutta itse työ suoritettiin itsenäisesti. Työni tarkoituksena oli perehtyä lasin valmistukseen, lasin karkaisuprosessiin ja siihen, kuinka karkaisupuhaltimien kunnonvalvonta tulevaisuudessa hoidetaan. Karkaisupuhaltimet ovat hyvin kriittisiä linjan toiminnan kannalta. Karkaisulaitos KL12:n karkaisupuhaltimille ei...

The well-known unknown photographer Jaan Klõšeiko / Ellu Maar

Index Scriptorium Estoniae

Maar, Ellu, 1982-

2010-01-01

Graafik ja fotograaf Jaan Klõšeikost, kes on 45 aastat jäädvustanud kunsti- ja kultuurisündmusi. Galerii Vaal kodulehel ilmunud J. Klõšeiko fotoseeriatest (12), fotod valis ja saatesõnad kirjutas J. Klõšeiko

Penalty-rewards contrast analysis (PRCA) on the KL monorail services

Science.gov (United States)

Muda, Nora; Suradi, Nur Riza; Mat Roji, Noor Sulawati

2013-04-01

Changes in living standards, tastes, views and education has changed the lifestyles where people are more emphasizing on quality and satisfaction with public amenities provided. One of the services provided is the KL Monorail; a public transport service which is based on a single beam track in the city that connects the north and center of Kuala Lumpur. Therefore, this study measures the customer satisfaction on the KL Monorail services and to identify the factors that should be given priority in improving their service levels. There were seven attributes being studied, namely the informations, the situation at the station, the situation in the KL Monorail, customer service, safety, efficiency and other aspects. The analysis found that the overall customer satisfactionis mean is 4.86. Based on the measurement of Penalty-Reward Contrast Analysis (PRCA), most of the KL Monorail service attribute are at moderate level of satisfaction except for the attributes at the station that have lower level of satisfaction. Therefore, a remedial actions or planning is needed to improve the customer satisfaction on the KL Monorail services.

The Preotective effects of Okra Powder (Abelmoschus esculentus on Histological and Histochemical Changes of Pancreatic Beta Cells and Liver Tissue of Diabetic Rat

Directory of Open Access Journals (Sweden)

Naeim Erfani Majd

2017-04-01

Full Text Available Background and Objective: Since Abelmoschus esculentus plant has many medical benefits, the present study aimed to investigate the therapeutic effects of Okra Powder (Abelmoschus esculentus against high-fat diet fed-streptozotocin (HFD/STZ-induced diabetic rats. Methods: In this experimental study, 25 Wistar Albino female rats were randomly divided into 5 groups: I: control group; II: healthy rats receiving A. esculentus (200 mg/kg; III (HFD/STZ group: Rats fed with high-fat diet (HFD (60% fat for 4 weeks and then injected low-dose STZ (35 mg/kg; IV: diabetic rats receiving A. esculentus (200mg/kg and V: diabetic rats receiving metformin (200 mg/kg. At the end of experiment, biochemical parameters, including Fasting Blood Glucose (FBG, insulin levels, Homa-IR index, ALT, AST and lipid profile were measured. Pancreas and Liver samples were removed, and 5-6 µ sections were prepared and stained by H&E and aldehyde fuchsin staining. Results: All the biochemical parameters, except HDL-C and insulin, were increased in diabetic rats, while these parameters were decreased in Okra supplementation group compared to diabetic rats (p<0.05. Furthermore, Okra improved the histological impairments of pancreas and liver, including vacuolization, and decrease of β-cells as well as hypertrophy and vacuolization of hepatocytes in diabetic rats. Conclusion: Okra powder improved biochemical parameters, liver structure and restoration of beta cells of pancreas in diabetic rats. Thus, it can be considered a complementary therapy to improve diabetic patients.

Afyon-Sandıklı

Indian Academy of Sciences (India)

δ18O and δD isotope ratios of the Sandıklı waters plot along the continental meteoric water line ... and district heating. Several studies on geology, hydrogeology along ..... precipitation; In: Handbook of Environmental Isotope. Geochemistry ...

On the feeding ecology of Pelophylax saharicus (Boulenger 1913 from Morocco

Directory of Open Access Journals (Sweden)

Zaida Ortega

2016-12-01

Full Text Available The Sahara frog is the most common amphibian found in North Africa. However, the knowledge of its natural history is rather fragmentary. In the present work we studied the trophic ecology of Pelophylax saharicus at some areas of Morocco through the analysis of 130 gastric contents. We did not find any significant sexual dimorphism in body size of adult individuals. Consumed prey show similar sizes in both sexes, while bigger frogs normally eat larger prey. As in other Palearctic frogs, the diet is basically insectivorous, including terrestrial and aquatic prey. We found some differences in the diet of juveniles, with a higher proportion of flying prey, probably indicating a foraging strategy closer to ambush hunting. In the Atlas region, the high consumption of slow-moving terrestrial prey, as Gastropoda, stands out. Only in the Atlas region, the diet was similar to that described from other areas of North Africa, as Tunisia.

Segmentectomy for giant pulmonary sclerosing haemangiomas with high serum KL-6 levels

Science.gov (United States)

Kuroda, Hiroaki; Mun, Mingyon; Okumura, Sakae; Nakagawa, Ken

2012-01-01

We describe a 61-year old female patient with a giant pulmonary sclerosing haemangioma (PSH) and an extremely high preoperative serum KL-6 level. During an annual health screening, the patient showed a posterior mediastinal mass on chest radiography. Chest computed tomography and magnetic resonance imaging revealed a well-circumscribed 60 mm diameter nodule with a marked contrast enhancement in the left lower lobe. The preoperative serum KL-6 level was elevated to 8204 U/ml. We performed a four-port thoracoscopic basal segmentectomy and lymph node sampling for diagnosis and therapy. The postoperative diagnosis showed PSH. The serum KL-6 level decreased dramatically with tumour resection. To the best of our knowledge, this is the first report of a patient with PSH showing a high serum KL-6 level. PMID:22454483

Role of square root threshold singularity in current algebra and chiral symmetry breaking calculations of Kl3, Kl4 and tau → πKν decays

International Nuclear Information System (INIS)

Truong, T.N.

1981-01-01

It is shown that discrepancies between soft pion current algebra (or chiral symmetry) calculations in Kl 4 and experiments are mostly due to the square root threshold singularity of the pion-pion interaction. For the same reason, chiral symmetry breaking calculations of the scalar Kl 3 form factor cannot be extended to the threshold of tau → Kπν decay. (orig.)

Usefulness of serum KL-6 and SP-D in the diagnosis of radiation pneumonitis

International Nuclear Information System (INIS)

Saika, Yoshinori; Doi, Kenji; Misaki, Toshimasa; Tatsumi, Tomoaki; Komori, Tsuyoshi; Narabayashi, Isamu

2004-01-01

The objective of this study was to investigate the usefulness of serum KL-6 and SP-D in the diagnosis of radiation pneumonitis. We measured serum KL-6 and SP-D in patients undergoing radiation therapy of the chest, primarily for lung cancer, in the Department of Radiology, Osaka Medical College and compared the results with the findings on plain chest X-ray films and thoracic computed tomography conducted at the same time. The sensitivity of serum KL-6 and SP-D for diagnosing radiation pneumonitis were 68.2% and 70.0%, respectively, the specificity were 86.6% and 80.0%, and the accuracy were 82.0% and 77.8%. Examination of the relationship between lesion extent and activity and serum KL-6 showed that serum KL-6 values were higher when the lesion extended beyond the irradiation field than when the lesion was confined to within the irradiation field and that the value tended to be lower for old lesions than for active lesions. In patients with radiation pneumonitis in whom serum KL-6 and SP-D could be measured over time, KL-6 tended to increase after the lesion was discovered by imaging, whereas SP-D increased prior to this in many cases. Examination of the comparison between before radiotherapy and just after radiotherapy in the patients with radiation pneumonitis showed that SP-D had a consistent tendency to increase. Both serum KL-6 and SP-D had a satisfactory degree of sensitivity and specificity for diagnosing radiation pneumonitis. Serum KL-6 correlated with the extent and activity of the lesions. The results suggested that serum SP-D may be helpful for the early detection of radiation pneumonitis. (author)

Transcription factor organic cation transporter 1 (OCT-1 affects the expression of porcine Klotho (KL gene

Directory of Open Access Journals (Sweden)

Yan Li

2016-07-01

Full Text Available Klotho (KL, originally discovered as an aging suppressor, is a membrane protein that shares sequence similarity with the β-glucosidase enzymes. Recent reports showed Klotho might play a role in adipocyte maturation and systemic glucose metabolism. However, little is known about the transcription factors involved in regulating the expression of porcine KL gene. Deletion fragment analysis identified KL-D2 (−418 bp to −3 bp as the porcine KL core promoter. MARC0022311SNP (A or G in KL intron 1 was detected in Landrace × DIV pigs using the Porcine SNP60 BeadChip. The pGL-D2-A and pGL-D2-G were constructed with KL-D2 and the intron fragment of different alleles and relative luciferase activity of pGL3-D2-G was significantly higher than that of pGL3-D2-A in the PK cells and ST cells. This was possibly the result of a change in KL binding ability with transcription factor organic cation transporter 1 (OCT-1, which was confirmed using electrophoretic mobility shift assays (EMSA and chromatin immune-precipitation (ChIP. Moreover, OCT-1 regulated endogenous KL expression by RNA interference experiments. Our study indicates SNP MARC0022311 affects porcine KL expression by regulating its promoter activity via OCT-1.

Observations of far-infrared line profiles in the Orion-KL region

International Nuclear Information System (INIS)

Crawford, M.K.; Lugten, J.B.; Fitelson, W.; Genzel, R.; Melnick, G.; Harvard-Smithsonian Center for Astrophysics, Cambridge, MA)

1986-01-01

Measurements of several far-infrared emission line profiles in the Orion-KL region are reported. The emission from the CO, OH, and forbidden O I emission lines toward the BN-KL and H2 peak 1 positions probably comes from dense, hot molecular gas in the Orion-KL shock. The CO and forbidden O I lines have similar profiles, suggesting that the high-velocity forbidden O I emission also arises in magnetohydrodynamic cloud shocks. The velocity centroids of the lines are somewhat blueshifted. The far-infrared data thus support the interpretation that the blue asymmetry of the H2 2 micron lines is not mainly due to differential dust extinction, but rather to the kinematics and geometry of the shocked gas in the Orion-KL outflow. The forbidden O I and CO lines, however, have significantly less extreme blueshifted emission than the H2 lines. Both the forbidden O I 63 micron and forbidden C II 158 micron lines have features strongly supporting a common origin near the surface of the Orion molecular cloud. 28 references

Fossil DCN in Orion-KL

International Nuclear Information System (INIS)

Mangum, J.G.; Plambeck, R.L.; Wootten, A.

1991-01-01

The J = 1 - 0 transition of DCN was mapped toward Orion-KL with the BIMA array. With a synthesized beam width of 7.6 arcsec, emission from the hot core, compact ridge, and northern cloud regions was identified. Over half of the integrated DCN emission detected originates from the hot core component, with progressively smaller contributions from the compact ridge and northern cloud. The DCN fractional abundance is 10 to the -9th in the hot core, 4 x 10 to the -10th in the compact ridge, and 2 x 10 to the -10th in the northern cloud; it is estimated that the corresponding DCN/HCN ratios are about 0.005, 0.02, and 0.02. Chemical models suggest that such high DCN/HCN abundance ratios are produced only in clouds colder than about 20 K. Since the present temperatures near Orion-KL are 50-275 K, it is evident that most of the DCN formed before this region was heated by massive star formation. Much of the fossil DCN which is now observed may have sublimated from icy grain mantles. 32 refs

Optimization of batch alcoholic fermentation of Cyperus esculentus

Energy Technology Data Exchange (ETDEWEB)

Esuoso, K O [Dept. of Chemistry, Federal Univ. of Technology, Akure (Nigeria); Oderinde, R A [Dept. of Chemistry, Ibadan Univ. (Nigeria); Vega-Catalan, F J [Dept. of Computer Science, Ibadan Univ. (Nigeria); Bamiro, F O [Dept. of Chemical Sciences, Univ. of Agriculture, Abeokuta (Nigeria)

1993-01-01

In our earlier work carried out on alcoholic fermentation of molasses the optimum sugar concentration was between 14.0 and 17.0% w/v sugars, beyond which ethanol content decreased drastically. However in the present work, ethanol concentration was still high at 20% w/v sugars. This suggested that the strain had enhanced tolerance to the adverse effects of C. esculentus medium than molasses. Substituting the calculated parameter values (a[sub 1]-a[sub 10]) and optimal conditions of pH, S and T into equation, the calculated yield equals 92.7%. We again tried to verify experimentally the reliability of the theoretical optimal values obtained. The concentration of ethanol obtained was 9.2 [+-] 0.2% v/v. This was higher than the maximum concentration recorded before simulation (8.9% v/v). The experimental yield obtained was 90.3 [+-] 1.6% which is in close agreement with the simulated value of 92.7%. (orig.)

Okra (Hibiscus esculentus) seed oil for biodiesel production

Energy Technology Data Exchange (ETDEWEB)

Anwar, Farooq; Nadeem, Muhammad [Department of Chemistry and Biochemistry, University of Agriculture, Faisalabad 38040 (Pakistan); Rashid, Umer [Department of Chemistry and Biochemistry, University of Agriculture, Faisalabad 38040 (Pakistan); Department of Industrial Chemistry, Government College University, Faisalabad 38000 (Pakistan); Ashraf, Muhammad [Department of Botany, University of Agriculture, Faisalabad 38040 (Pakistan)

2010-03-15

Biodiesel was derived from okra (Hibiscus esculentus) seed oil by methanol-induced transesterification using an alkali catalyst. Transesterification of the tested okra seed oil under optimum conditions: 7:1 methanol to oil molar ratio, 1.00% (w/w) NaOCH{sub 3} catalyst, temperature 65 C and 600 rpm agitation intensity exhibited 96.8% of okra oil methyl esters (OOMEs) yield. The OOMEs/biodiesel produced was analyzed by GC/MS, which showed that it mainly consisted of four fatty acids: linoleic (30.31%), palmitic (30.23%), oleic (29.09%) and stearic (4.93%). A small amount of 2-octyl cyclopropaneoctanoic acid with contribution 1.92% was also established. Fuel properties of OOMEs such as density, kinematic viscosity, cetane number, oxidative stability, lubricity, flash point, cold flow properties, sulfur contents and acid value were comparable with those of ASTM D 6751 and EN 14214, where applicable. It was concluded that okra seed oil is an acceptable feedstock for biodiesel production. (author)

Er Trump som kejseren i "Kejserens nye klæder"?

DEFF Research Database (Denmark)

Ritter, Thomas; Lund Pedersen, Carsten

2017-01-01

Den tilbagevendende sag om Trumps dekret vedrørende indrejseforbud har givet os et indblik i dette klassiske ledelsesdilemma, der trækker tråde tilbage til eventyret om Kejserens nye Klæder. H. C. Andersens berømte fortælling om Kejserens nye klæder indeholder tre vigtige ledelsesmæssige pointer......, der netop har bevist dets relevans i sagen om Trumps indrejseforbud. Ligesom kejseren i fortællingen, så udviser Trump generelt en alternativ virkelighedsopfattelse....

A Novel Natural Product, KL-21, Inhibits Proliferation and Induces Apoptosis in Chronic Lymphocytic Leukemia Cells

Directory of Open Access Journals (Sweden)

Aysun Adan Gökbulut

2015-06-01

Full Text Available INTRODUCTION: The aims of this study were to examine the cytotoxic and apoptotic effects of KL-21, a novel plant product (produced by Naturin Natural Products, İzmir, Turkey, on 232B4 chronic lymphocytic leukemia (CLL cells and to determine the cytotoxic effects on healthy BEAS-2B human bronchial epithelial cells. METHODS: The cytotoxic effect of KL-21 was determined by MTT cell proliferation assay. Changes in caspase-3 enzyme activity were measured using the caspase-3 colorimetric assay. Changes in mitochondrial membrane potential were determined using the JC-1 dye-based method. Annexin V-FITC/PI double staining was performed to measure the apoptotic cell population. Effects of KL-21 on cell cycle profiles of CLL cells were investigated by flow cytometry. RESULTS: We detected time- and concentration-dependent increases in the cytotoxic effect of KL-21 on 232B4 CLL cells. However, we also showed that, especially at higher concentrations, KL-21 was less cytotoxic towards BEAS-2B healthy cells than towards CLL cells. Annexin-V/PI double staining results showed that the apoptotic cell population increased in 232B4 cells. Increasing concentrations of KL-21 increased caspase-3 enzyme activity and induced loss of mitochondrial membrane potential. KL-21 administration resulted in small increases in the percentage of the cells in the G0/G1 phase while it decreased the S phase cell population up to 1 mg/mL. At the highest concentration, most of the cells accumulated in the G0/G1 phase. DISCUSSION AND CONCLUSION: KL-21 has a growth-inhibitory effect on 232B4 CLL cells. KL-21 causes apoptosis and cell cycle arrest at G0/G1.

Klõsheiko, Mare Vint, effid / Harry Liivrand

Index Scriptorium Estoniae

Liivrand, Harry, 1961-

2005-01-01

Tallinna Kinomajas esilinastusid 28. okt. kolm uut dokumentaalfilmi eesti kunstnikest : "F.F.F.F. läheb laiali" (Kuukulgur Film 2005, rezh. Marko Raat, "Mare Vint" (Exitfilm 2005, rezh. Anri Rulkov) ja "Jaan Klõsheiko" (Estonia Film 2005, rezh.-d Eve Ester, Igor Ruus)

Potential of Soil Amendments (Biochar and Gypsum in increasing Water Use Efficiency of Abelmoschus esculentus L. Moench

Directory of Open Access Journals (Sweden)

Aniqa eBatool

2015-09-01

Full Text Available Water being an essential component for plant growth and development, its scarcity poses serious threat to crops around the world. Climate changes and global warming are increasing the temperature of earth hence becoming an ultimate cause of water scarcity. It is need of the day to use potential soil amendments that could increase the plants’ resistance under such situations. Biochar and gypsum were used in the present study to improve the water use efficiency and growth of Abelmoschus esculentus L. Moench (Lady’s Finger. A six weeks experiment was conducted under greenhouse conditions. Stress treatments were applied after thirty days of sowing. Plant height, leaf area, photosynthesis, transpiration rate, stomatal conductance and water use efficiency were determined weekly under stressed (60% field capacity and non-stressed (100% field capacity conditions. Stomatal conductance and transpiration rate decreased and reached near to zero in stressed plants. Stressed plants also showed resistance to water stress upto five weeks and gradually perished at sixth week. On the other hand, water use efficiency improved in stressed plants containing biochar and gypsum as compared to untreated plants. Biochar alone is a better strategy to promote plant growth and WUE specifically of Abelmoschus esculentus, compared to its application in combination with gypsum.

Aperture synthesis observations of NH3 in OMC-1 - Filamentary structures around Orion-KL

International Nuclear Information System (INIS)

Murata, Yasuhiro; Kawabe, Ryohei; Ishiguro, Masato; Morita, Kohichiro; Kasuga, Takashi

1990-01-01

Aperture synthesis observations of the Orion molecular cloud 1 (OMC-1) have been made in NH 3 (1, 1) and (2, 2) emission at 23.7 GHz, using the Nobeyama Millimeter Array (NMA), and obtained 16 arcsec resolution maps for OMC-1 and 8 arcsec resolution maps for the Orion-KL region. Filamentary structures extending over 0.5 pc from the Orion-KL region to the north and northwest directions were found. These structures are associated with the H2 finger structures and Herbig-Haro objects which are located at the blue-shifted side of the bipolar molecular outflow. The results suggest that these filaments are ambient molecular cloudlets with shocked surfaces caused by the strong stellar wind from the Orion-KL region. The 8 arcsec resolution NH 3 (2, 2) maps show the extended features around the hot core of Orion-KL. These extended features correspond to the rotating disk and shocked shell associated with the bipolar molecular outflow. 37 refs

Modified k-l model and its ability to simulate supersonic axisymmetric turbulent flows

International Nuclear Information System (INIS)

Ahmadikia, H.; Shirani, E.

2001-05-01

The k-l turbulence model is a promising two-equation model. In this paper, the k and l model equations were derived from k-kl incompressible and one-equation turbulent models. Then the model was modified for compressible and transitional flows, and was applied to simulate supersonic axisymmetric flows over Hollow cylinder flare an hyperboloid flare bodies. The results were compared with the results obtained for the same flows experimentally as well as k-ε, k-ω and Baldwin-Lomax models. It was shown that the k-l model produces good results compared with experimental data and numerical data obtained when other turbulence models were used. It gives better results than k-ω and k-ε models in some cases. (author)

Adaptation to osmotic stress provides protection against ammonium nitrate in Pelophylax perezi embryos

International Nuclear Information System (INIS)

Ortiz-Santaliestra, Manuel E.; Fernandez-Beneitez, Maria Jose; Lizana, Miguel; Marco, Adolfo

2010-01-01

The negative effects of pollution on amphibians are especially high when animals are additionally stressed by other environmental factors such as water salinity. However, the stress provoked by salinity may vary among populations because of adaptation processes. We tested the combined effect of a common fertilizer, ammonium nitrate (0-90.3 mg N-NO 3 NH 4 /L), and water salinity (0-2 per mille ) on embryos of two Pelophylax perezi populations from ponds with different salinity concentrations. Embryos exposed to the fertilizer were up to 17% smaller than controls. Survival rates of embryos exposed to a single stressor were always below 10%. The exposure to both stressors concurrently increased mortality rate (>95%) of embryos from freshwater. Since the fertilizer was lethal only when individuals were stressed by the salinity, it did not cause lethal effects on embryos naturally adapted to saline environments. Our results underscore the importance of testing multiple stressors when analyzing amphibian sensitivity to environmental pollution. - Natural resistance to salinity minimizes the impact of chemical fertilizers on amphibian embryos.

ANALISA FLAVONOID DARI EKSTRAK ETANOL 96% KULIT BUAH OKRA MERAH (Abelmoschus esculentus L. Moench SECARA KROMATOGRAFI LAPIS TIPIS DAN SPEKTROFOTOMETRI UV-VIS

Directory of Open Access Journals (Sweden)

Nia Lisnawati

2016-03-01

Full Text Available Has done research on flavonoids Analysis of Ethanol Extract 96% Fruit Leather Red Okra In Thin Layer Chromatography and Spectrophotometer UV-Vis. The purpose of this study was to analyze the content of the fruit skin red okra (Abelmoschus esculentus L. Moench by using the method of thin layer chromatography (TLC under UV light and spectrophotometry UV-Vis. Reference standards used in this study is the Standard Solution Routine Quercetin. The results of the research that has been done by the method of thin layer chromatography obtained Rf values of 0.81 and produces the color orange. And the results of research conducted by spectrophotometry UV-Vis method obtained 333,117 mg.L-1 or 421,629 mg.kg-1 or 0,84339 %. The conclusion from this study is that the 96% ethanol extract of the fruit leather red okra (Abelmoschus esculentus L. Moench positive (+ contains flavonoids with levels of 0,84339 %.

Melatonin ve Bağışıklık Sistemi

OpenAIRE

ÇETİN, E.

2005-01-01

Melatonin, pineal bezin beta adrenerjik reseptörlerinin aktivasyonu ile triptofandan sentezlenen bir hormondur.Üretim ve salınımı karanlık ile başlar ve aydınlıkla sona erer. Melatonin, birçok biyolojik fonksiyonun düzenlenmesinderol oynar. Bu derlemede melatonin hakkında genel bilgiler verilerek, melatoninin lenfoid dokular, humoral bağışıklık,hücresel bağışıklık ve kanser üzerine etkileri tartışılmıştır

Effect of gamma rays on fruit weight and number of seeds in Abelmoschus esculentus (L.) Moench and Momordica charantia L

International Nuclear Information System (INIS)

Jha, B.K.

1994-01-01

Among 5,15,30,60,90 and 120 kR doses of gamma rays, lower doses showed stimulatory effects on fresh and dry weight of fruit, while higher doses proved inhibitory in Abelmoschus esculentus and Momordica charantia. Abortion of mature seeds was also higher at 30 kR and above doses. (author). 12 refs., 2 tabs

Segmentectomy for giant pulmonary sclerosing haemangiomas with high serum KL-6 levels

OpenAIRE

Kuroda, Hiroaki; Mun, Mingyon; Okumura, Sakae; Nakagawa, Ken

2012-01-01

We describe a 61-year old female patient with a giant pulmonary sclerosing haemangioma (PSH) and an extremely high preoperative serum KL-6 level. During an annual health screening, the patient showed a posterior mediastinal mass on chest radiography. Chest computed tomography and magnetic resonance imaging revealed a well-circumscribed 60 mm diameter nodule with a marked contrast enhancement in the left lower lobe. The preoperative serum KL-6 level was elevated to 8204 U/ml. We performed a fo...

Association of serum KL-6 levels with interstitial lung disease in patients with connective tissue disease: a cross-sectional study.

Science.gov (United States)

Oguz, Ekin Oktay; Kucuksahin, Orhan; Turgay, Murat; Yildizgoren, Mustafa Turgut; Ates, Askin; Demir, Nalan; Kumbasar, Ozlem Ozdemir; Kinikli, Gulay; Duzgun, Nursen

2016-03-01

It was aimed to evaluate KL-6 glycoprotein levels to determine if it may be a diagnostic marker for the connective tissue diseases (CTDs) predicting CTD-related interstitial lung diseases (ILDs) (CTD-ILD) development and to examine if there was a difference between patients and healthy controls. The study included 113 patients with CTD (45 CTD without lung involvement, 68 CTD-ILD) and 45 healthy control subjects. KL-6 glycoprotein levels were analyzed with ELISA in patients and the control group. The relationship between KL-6 glycoprotein levels and CTD-ILD was assessed. In the comparison of all the groups in the study, significantly higher levels of KL-6 were determined in the CTD-ILD group than in either the CTD without pulmonary involvement group or the healthy control group (p connective tissue diseases in the diagnostic groups (systemic lupus erythematosus, Sjögren's syndrome, rheumatoid arthritis, mixed connective tissue disease, scleroderma, polymyositis/ dermatomyositis). In the healthy control group, there was a statistically significant difference between KL-6 levels in smokers and non-smokers. Smokers had significantly higher serum KL-6 levels compared with non-smokers (p < 0.05). There was no statistically significant difference between smoking status (pack-year) and serum KL-6 levels. There was no statistically significant correlation between serum KL-6 levels and time since diagnosis of CTD and CTD-ILD. The level of KL-6 as a predictive factor could be used to identify the clinical development of ILD before it is detected on imaging modality. Further prospective clinical studies are needed to define whether levels of KL-6 might have prognostic value or might predict progressive ILD.

Patogeneze klíšťové encefalitidy a možnosti antivirové terapie

Czech Academy of Sciences Publication Activity Database

Růžek, Daniel

2015-01-01

Roč. 64, č. 4 (2015), s. 204-209 ISSN 1210-7913 Institutional support: RVO:60077344 Keywords : virus klíšťové encefalitidy * klíšťová encefalitida * antivirová terapie * patogeneze Subject RIV: EC - Immunology Impact factor: 0.268, year: 2015

KINETICS OF MODULATORY ROLE OF Cyperus esculentus L. ON THE SPECIFIC ACTIVITY OF KEY CARBOHYDRATE METABOLIZING ENZYMES.

Science.gov (United States)

Sabiu, Saheed; Ajani, Emmanuel Oladipo; Sunmonu, Taofik Olatunde; Ashafa, Anofi Omotayo Tom

2017-01-01

The continuous search for new lead compounds as viable inhibitors of specific enzymes linked to carbohydrate metabolism has intensified. Cyperus esculentus L. is one of the therapeutically implicated botanicals against several degenerative diseases including diabetes mellitus. This study evaluated the antioxidant and mechanism(s) of inhibitory potential of aqueous extract of C. esculentus on α-amylase and α-glucosidase in vitro . The extract was investigated for its radical scavenging and hypoglycaemic potentials using standard experimental procedures. Lineweaver-Burke plot was used to predict the manner in which the enzymes were inhibited. The data obtained revealed that the extract moderately and potently inhibited the specific activities of α -amylase and α -glucosidase, respectively. The inhibition was concentration-related with respective IC 50 values of 5.19 and 0.78 mg/mL relative to that of the control (3.72 and 3.55 mg/mL). The extract also significantly scavenged free radicals and the effects elicited could be ascribed to its phytoconstituents. The respective competitive and non-competitive mode of action of the extract is due to its inhibitory potentials on the activities of α -amylase and α -glucosidase. Going forward, in addition to completely characterize the exact compound(s) responsible for the elicited activity in this study, pertinent attention will be given to the in vivo evaluation of the identified constituents.

Antihypoxic and antioxidant activity of Hibiscus esculentus seeds

Directory of Open Access Journals (Sweden)

Eslami, Bahman

2010-03-01

Full Text Available The antihypoxic and antioxidant activities of Hibiscus esculentus seeds were investigated employing eight in vitro assay systems. Antihypoxic activity was investigated in two models, haemic and circulatory. The effects were pronounced in both models of hypoxia. The antihypoxic effects were dose-dependent. The results indicated that the extracts have a protective effect against hypoxia induced lethality in mice. The extracts showed antioxidant activity in some models. IC50 for DPPH radical-scavenging activity was 234 ± 8.9 μg ml-1. The extracts showed weak nitric oxide-scavenging activity between 0.1 and 1.6 mg ml-1. The extracts showed weak Fe2+ chelating ability. IC50 were 150 ± 13 μg ml-1. The extracts also exhibited low antioxidant activity in the linoleic acid model but were capable of scavenging hydrogen peroxide in a concentration dependent manner. The total amount of phenolic compounds in each extract was determined as gallic acid equivalents and total flavonoid contents were calculated as quercetin equivalents from a calibration curve. Pharmacological effects may be attributed, at least in part, to the presence of phenols and flavonoids in the extracts.La actividad antihipóxica y antioxidante de semillas de Hibiscus esculentus fue investigada empleando ocho ensayos in vitro. La actividad antihipóxica fue investigada en dos modelos, uno de caracter hemínico y otro circulatorio. Los efectos fueron pronunciados en ambos modelos de hipoxia. Los efectos antihipóxicos fueron dependientes de la dosis. Los resultados indican que los extractos tienen un efecto protector contra la letabilidad inducida por hipoxia en ratones. Los extractos mostraron actividad antioxidante en algunos modelos. El IC50 para la actividad captadora de radicales fue 234 ± 8.9 μg ml-1. Los extractos muestran una débil actividad captadora de óxido nítrico comprendida entre 0.1 y 1.6 mg ml-1. Los extractos muestran una débil capacidad quelatante de Fe2+. El IC

KINETIC TEMPERATURES OF THE DENSE GAS CLUMPS IN THE ORION KL MOLECULAR CORE

International Nuclear Information System (INIS)

Wang, K.-S.; Kuan, Y.-J.; Liu, S.-Y.; Charnley, Steven B.

2010-01-01

High angular-resolution images of the J = 18 K -17 K emission of CH 3 CN in the Orion KL molecular core were observed with the Submillimeter Array (SMA). Our high-resolution observations clearly reveal that CH 3 CN emission originates mainly from the Orion Hot Core and the Compact Ridge, both within ∼15'' of the warm and dense part of Orion KL. The clumpy nature of the molecular gas in Orion KL can also be readily seen from our high-resolution SMA images. In addition, a semi-open cavity-like kinematic structure is evident at the location between the Hot Core and the Compact Ridge. We performed excitation analysis with the 'population diagram' method toward the Hot Core, IRc7, and the northern part of the Compact Ridge. Our results disclose a non-uniform temperature structure on small scales in Orion KL, with a range of temperatures from 190-620 K in the Hot Core. Near the Compact Ridge, the temperatures are found to be 170-280 K. Comparable CH 3 CN fractional abundances of 10 -8 to 10 -7 are found around both in the Hot Core and the Compact Ridge. Such high abundances require that a hot gas phase chemistry, probably involving ammonia released from grain mantles, plays an important role in forming these CH 3 CN molecules.

Structure of the neutral capsular polysaccharide of Acinetobacter baumannii NIPH146 that carries the KL37 capsule gene cluster.

Science.gov (United States)

Arbatsky, Nikolay P; Shneider, Mikhail M; Kenyon, Johanna J; Shashkov, Alexander S; Popova, Anastasiya V; Miroshnikov, Konstantin A; Volozhantsev, Nikolay V; Knirel, Yuriy A

2015-09-02

Capsular polysaccharide (CPS) was isolated from Acinetobacter baumannii NIPH146, and the following structure of branched pentasaccharide repeating unit was established by sugar analyses along with 1D and 2D NMR spectroscopy: In comparison to most other known capsular polysaccharides of A. baumannii, the CPS studied is neutral and lacks any specific monosaccharide component. The synthesis, assembly and export of this structure could be attributed to genes in a novel capsule biosynthesis gene cluster, designated KL37, which was found in the NIPH146 genome. The CPS of A. baumannii NIPH146 shares the α-d-Galp-(1→6)-β-d-Glcp-(1→3)-d-GalpNAc-(1→ trisaccharide fragment with the CPS units of several A. baumannii strains, including ATCC 17978 and LUH 5537 that carry the KL3 and KL22 gene clusters, respectively. KL37 contains two genes for glycosyltransferases that are related to two glycosyltransferase genes present in both KL3 and KL22, and the encoded proteins could be tentatively assigned to linkages between sugars in the CPS repeat. Copyright © 2015 Elsevier Ltd. All rights reserved.

Workshop on Physics with Neutral Kaon Beam at JLab (KL2016) Mini-Proceedings

Energy Technology Data Exchange (ETDEWEB)

Strakovsky, Igor I. [George Washington Univ., Washington, DC (United States); Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Amaryan, Moskov [Old Dominion Univ., Norfolk, VA (United States); Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Chudakov, Eugene A. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Meyer, Curtis A. [Carnegie Mellon Univ., Pittsburgh, PA (United States); Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Pennington, Michael R. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Ritman, James L. [Forschungszentrum Juelich Institut fuer Kernphysik

2016-05-01

The KL2016 Workshop is following the Letter of Intent LoI12-15-001 "Physics Opportunities with Secondary KL beam at JLab" submitted to PAC43 with the main focus on the physics of excited hyperons produced by the Kaon beam on unpolarized and polarized targets with GlueX setup in Hall D. Such studies will broaden a physics program of hadron spectroscopy extending it to the strange sector. The Workshop was organized to get a feedback from the community to strengthen physics motivation of the LoI and prepare a full proposal.

Flavonoids derived from Abelmoschus esculentus attenuatesUV-B Induced cell damage in human dermal fibroblasts throughNrf2-ARE pathway

OpenAIRE

Juilee Patwardhan; Purvi Bhatt

2016-01-01

Background: Ultraviolet-B (UV-B) radiation is a smaller fraction of the total radiation reaching the Earth but leads to extensive damage to the deoxyribonucleic acid (DNA) and other biomolecules through formation of free radicals altering redox homeostasis of the cell. Abelmoschus esculentus (okra) has been known in Ayurveda as antidiabetic, hypolipidemic, demulscent, antispasmodic, diuretic, purgative, etc. Objective: The aim of this study is to evaluate the protective effect of flavonoids f...

Flavonoids Derived from Abelmoschus esculentus Attenuates UV-B Induced Cell Damage in Human Dermal Fibroblasts Through Nrf2-ARE Pathway.

Science.gov (United States)

Patwardhan, Juilee; Bhatt, Purvi

2016-05-01

Ultraviolet-B (UV-B) radiation is a smaller fraction of the total radiation reaching the Earth but leads to extensive damage to the deoxyribonucleic acid (DNA) and other biomolecules through formation of free radicals altering redox homeostasis of the cell. Abelmoschus esculentus (okra) has been known in Ayurveda as antidiabetic, hypolipidemic, demulscent, antispasmodic, diuretic, purgative, etc. The aim of this study is to evaluate the protective effect of flavonoids from A. esculentus against UV-B-induced cell damage in human dermal fibroblasts. UV-B protective activity of ethyl acetate (EA) fraction of okra was studied against UV-B-induced cytotoxicity, antioxidant regulation, oxidative DNA damage, intracellular reactive oxygen species (ROS) generation, apoptotic morphological changes, and regulation of heme oxygenase-1 (HO-1) gene through nuclear factor E2-related factor 2-antioxidant response element (Nrf2-ARE) pathway. Flavonoid-rich EA fraction depicted a significant antioxidant potential also showing presence of rutin. Pretreatment of cells with EA fraction (10-30 μg/ml) prevented UV-B-induced cytotoxicity, depletion of endogenous enzymatic antioxidants, oxidative DNA damage, intracellular ROS production, apoptotic changes, and overexpression of Nrf2 and HO-1. Our study demonstrated for the 1(st) time that EA fraction of okra may reduce oxidative stress through Nrf2-ARE pathway as well as through endogenous enzymatic antioxidant system. These results suggested that flavonoids from okra may be considered as potential UV-B protective agents and may also be formulated into herbal sunscreen for topical application. Flavonoid-enriched ethyl acetate (EA) fraction from A. esculentus protected against ultraviolet-B (UV-B)-induced oxidative DNA damageEA fraction prevented UV-B-induced cytotoxicity, depletion of endogenous enzymatic antioxidants, and intracellular reactive oxygen species productionEA fraction could reduce oxidative stress through the Nrf2-ARE

B → Kl{sup +}l{sup -} decay at large hadronic recoil

Energy Technology Data Exchange (ETDEWEB)

Khodjamirian, Alexander; Mannel, Thomas [Siegen University (Germany); Wang, Yuming [TUM (Germany)

2013-07-01

We predict the amplitude of the B → Kl{sup +}l{sup -} decay in the region of the dilepton invariant mass squared 0 < q{sup 2}≤ m{sup 2}{sub J/ψ}, that is, at large hadronic recoil. The B → K form factors entering the factorizable part of the decay amplitude are obtained from QCD light-cone sum rules. The nonlocal effects, generated by the four-quark and penguin operators combined with the electromagnetic interaction, are calculated at q{sup 2}<0, far below the hadronic thresholds. For hard-gluon contributions we employ the QCD factorization approach. The soft-gluon nonfactorizable contributions are estimated from QCD light-cone sum rules. The result of the calculation is matched to the hadronic dispersion relation in the variable q{sup 2}, which is then continued to the kinematical region of the decay. The overall effect of nonlocal contributions in B → Kl{sup +}l{sup -} at large hadronic recoil is moderate. The main uncertainty of the predicted B → Kl{sup +}l{sup -} partial width is caused by the B → K form factors. Furthermore, the isospin asymmetry in this decay is expected to be very small. We investigate the deviation of the observables from the Standard Model predictions by introducing a generic new physics contribution to the effective Hamiltonian.

Redescription of Protoopalina pingi Nie, 1935 inhabiting the recta of Hylarana guentheri and Pelophylax nigromaculatus in China

Directory of Open Access Journals (Sweden)

Li Weidong

2014-01-01

Full Text Available A redescription of Protoopalina pingi Nie, 1935 is presented in this paper to complete Nie’s description at both light and scanning electron microscope levels. These organisms were collected from the recta of the frogs Hylarana guentheri Boulenger, 1882 and Pelophylax nigromaculatus Hallowell, 1861 from Jialing River, Sichuan Province and Honghu Lake, Hubei Province, respectively, in China. This is the first record of its occurrence in H. guentheri and P. nigromaculatus. The body of P. pingi is elongated and somewhat spindle-like in shape, slightly narrowed and bluntly rounded at the anterior extremity, while the posterior end is tapering or sharply pointed. The body surface is thickly flagellated, with the caudal tip being barren. The falx, located at the margin of the anterior end, is composed of a narrow band of kinetosomes. Four round or oval-shaped nuclei, usually arranged in a straight line, are situated in the middle region of the body. Comparisons are made between P. pingi and its congeners.

IDENTIFICATION OF BURSTING WATER MASER FEATURES IN ORION KL

International Nuclear Information System (INIS)

Hirota, Tomoya; Honma, Mareki; Kim, Mi Kyoung; Kobayashi, Hideyuki; Shibata, Katsunori M.; Tsuboi, Masato; Fujisawa, Kenta; Kawaguchi, Noriyuki; Imai, Hiroshi; Omodaka, Toshihiro; Shimoikura, Tomomi; Yonekura, Yoshinori

2011-01-01

In 2011 February, a burst event of the H 2 O maser in Orion KL (Kleinmann-Low object) has started after a 13 year silence. This is the third time such phenomena has been detected in Orion KL, followed by the events in 1979-1985 and 1998. We have carried out astrometric observations of the bursting H 2 O maser features in Orion KL with the VLBI Exploration of Radio Astrometry (VERA), a Japanese very long baseline interferometry network dedicated for astrometry. The total flux of the bursting feature at the local standard of rest (LSR) velocity of 7.58 km s -1 reaches 4.4 x 10 4 Jy in 2011 March. The intensity of the bursting feature is three orders of magnitude larger than that of the same velocity feature in the quiescent phase in 2006. Two months later, another new feature appears at the LSR velocity of 6.95 km s -1 in 2011 May, separated by 12 mas north of the 7.58 km s -1 feature. Thus, the current burst occurs at two spatially different features. The bursting masers are elongated along the northwest-southeast direction as reported in the previous burst in 1998. We determine the absolute positions of the bursting features for the first time ever with a submilliarcsecond (mas) accuracy. Their positions are coincident with the shocked molecular gas called the Orion Compact Ridge. We tentatively detect the absolute proper motions of the bursting features toward the southwest direction. It is most likely that the outflow from the radio source I or another young stellar object interacting with the Compact Ridge is a possible origin of the H 2 O maser burst.

Interpretation of rotationally excited far-infrared OH emission in Orion-KL

International Nuclear Information System (INIS)

Melnick, G.J.; Genzel, R.; Lugten, J.B.; California Univ., Berkeley; Max-Planck-Institut fuer Physik und Astrophysik, Garching, Germany, F.R.)

1987-01-01

The 2Pi(1/2) OH 163-micron J = 3/2-1/2 rotational transitions in Orion-KL were observed and an upper limit was set to the line strength of the 2II(1/2) OH 56-micron J = 9/2-7/2 doublet in this source. The 163-micron line intensities were modeled, along with the previously measured 2II(3/2) 119 and 84-micron rotational line emission and it is found that the gas in the Orion-KL postshocked region can produce OH 119-micron line emission of the same strength as measured; however, the resultant 84 and 163-micron line intensities would be weaker than observed. Shocked gas plus a second component which experiences strong radiative excitation can reproduce the observations. 35 references

ALMA Observations of the Archetypal “Hot Core” That Is Not: Orion-KL

International Nuclear Information System (INIS)

Orozco-Aguilera, M. T.; Zapata, Luis A.; Hirota, Tomoya; Qin, Sheng-Li; Masqué, Josep M

2017-01-01

We present sensitive high angular resolution (∼0.″1–0.″3) continuum Atacama Large Millimeter/Submillimeter Array (ALMA) observations of the archetypal hot core located in the Orion Kleinmann-Low (KL) region. The observations were made in five different spectral bands (bands 3, 6, 7, 8, and 9) covering a very broad range of frequencies (149–658 GHz). Apart from the well-known millimeter emitting objects located in this region (Orion Source I and BN), we report the first submillimeter detection of three compact continuum sources (ALMA1–3) in the vicinities of the Orion-KL hot molecular core. These three continuum objects have spectral indices between 1.47 and 1.56, and brightness temperatures between 100 and 200 K at 658 GHz, suggesting that we are seeing moderate, optically thick dust emission with possible grain growth. However, as these objects are not associated with warm molecular gas, and some of them are farther out from the molecular core, we thus conclude that they cannot heat the molecular core. This result favors the hypothesis that the hot molecular core in Orion-KL core is heated externally.

ALMA Observations of the Archetypal “Hot Core” That Is Not: Orion-KL

Energy Technology Data Exchange (ETDEWEB)

Orozco-Aguilera, M. T. [Instituto Nacional de Astrofísica, Óptica y Electrónica, Luis Enrique Erro 1, Tonantzintla, Puebla, México (Mexico); Zapata, Luis A. [Instituto de Radioastronomía y Astrofísica, UNAM, Apdo. Postal 3-72 (Xangari), 58089 Morelia, Michoacán, México (Mexico); Hirota, Tomoya [Mizusawa VLBI Observatory, National Astronomical Observatory of Japan, Osawa 2-21-1, Mitaka-shi, Tokyo 181-8588 (Japan); Qin, Sheng-Li [Department of Astronomy, Yunnan University, and Key Laboratory of Astroparticle Physics of Yunnan Province, Kunming 650091 (China); Masqué, Josep M, E-mail: lzapata@crya.unam.mx [Departamento de Astronomía, Universidad de Guanajuato, Apdo. Postal 144, 36000 Guanajuato, México (Mexico)

2017-09-20

We present sensitive high angular resolution (∼0.″1–0.″3) continuum Atacama Large Millimeter/Submillimeter Array (ALMA) observations of the archetypal hot core located in the Orion Kleinmann-Low (KL) region. The observations were made in five different spectral bands (bands 3, 6, 7, 8, and 9) covering a very broad range of frequencies (149–658 GHz). Apart from the well-known millimeter emitting objects located in this region (Orion Source I and BN), we report the first submillimeter detection of three compact continuum sources (ALMA1–3) in the vicinities of the Orion-KL hot molecular core. These three continuum objects have spectral indices between 1.47 and 1.56, and brightness temperatures between 100 and 200 K at 658 GHz, suggesting that we are seeing moderate, optically thick dust emission with possible grain growth. However, as these objects are not associated with warm molecular gas, and some of them are farther out from the molecular core, we thus conclude that they cannot heat the molecular core. This result favors the hypothesis that the hot molecular core in Orion-KL core is heated externally.

Effect of polyamines on biochemical properties in gamma irradiated Okra (Abelmoschus esculentus L.) varieties

International Nuclear Information System (INIS)

Bhushan, Himanshu; Shukla, Pradeep K.; Ramteke, Pramod W.; Misra, Pragati

2014-01-01

Gamma rays are electromagnetic radiations and can be useful for the alteration of physiological characters. In plant systems, gamma ray induced free radicals can damage or modify important components of plant cells and also modulate the morphological, anatomical and biochemical characters of the cell and the plant therein. Polyamine possesses protective role against unfavorable conditions because of its highest positive charge due to presence of amine groups. In plants polyamines are involved in organ development, flowering, fruit ripening, and senescence and stress responses. Okra (Abelmoschus esculentus L.) has captured a prominent position among vegetables and in India; it is grown on an area of 3.6 lakh hectares with a production of 34.2 lakh tones. Keeping these facts in mind, an experiment was conducted to study the effect of polyamines on biochemical properties in gamma irradiated Okra (Abelmoschus esculentus L.) varieties. Seeds of four Okra varieties (namely Kaveri 49, Kaveri 54, Deepika and OH2324) were expose to different levels of gamma radiation (T 1 = 200 Gy, T 2 = 400 Gy, T 3 = 600 Gy, and T 4 = 800 Gy) using 60 Co as source at National Botanical Research Institute (NBRI) research institute of CSIR at Lucknow. These plants were also subjected to an exogenous application of 1 mM spermine and 1 mM spermidineas foliar spray. The results showed that application of Polyamines (spermine and spermidine) increased Chlorophyll α content, Chlorophyll b content (mg/g fresh weight) in gamma treated plants as compared to control. Application of polyamines also increased enzymatic and non-enzymatic antioxidants (proline, ascorbte peroxidase and glutathione reductase) level in gamma treated plants as compared to control. Carotenoid and protein content showed variations under polyamine treatment. In general, variety Deepika was relatively tolerant to gamma radiation among all the varieties, whereas, Kaveri 49 and Kaveri 54 were relatively sensitive to gamma

Anti hypoxic and antioxidant activity of Hibiscus esculentus seeds

Energy Technology Data Exchange (ETDEWEB)

Ebrahimzadeh, M. A.; Nabavi, S. F.; Nabavi, S. M.; Eslami, B.

2010-07-01

The anti hypoxic and antioxidant activities of Hibiscus esculentus seeds were investigated employing eight in vitro assay systems. Anti hypoxic activity was investigated in two models, haemic and circulatory. The effects were pronounced in both models of hypoxia. The anti hypoxic effects were dose-dependent. The results indicated that the extracts have a protective effect against hypoxia induced lethality in mice. The extracts showed antioxidant activity in some models. IC{sub 5}0 for DPPH radical-scavenging activity was 234 {+-} 8.9 {mu}g ml{sup 1}. The extracts showed weak nitric oxide-scavenging activity between 0.1 and 1.6 mg ml{sup -}1. The extracts showed weak Fe{sup 2}+ chelating ability. IC{sub 5}0 were 150 {+-} 13 {mu}g ml{sup -}1. The extracts also exhibited low antioxidant activity in the linoleic acid model but were capable of scavenging hydrogen peroxide in a concentration dependent manner. The total amount of phenolic compounds in each extract was determined as gallic acid equivalents and total flavonoid contents were calculated as quercetin equivalents from a calibration curve. Pharmacological effects may be attributed, at least in part, to the presence of phenols and flavonoids in the extracts. (Author) 40 refs.

TIGER NUT (CYPERUS ESCULENTUS: SOURCE OF NATURAL ANTICANCER DRUG? BRIEF REVIEW OF EXISTING LITERATURE.

Directory of Open Access Journals (Sweden)

Elom Seyram Achoribo

2017-07-01

Full Text Available In some parts of the world, Cyperus esculentus L. is widely used as a healthy food for both humans and animals due to their nutritional and functional properties. Current research and reviews on this plant have focused mainly on organoleptic properties, phytochemical compositions, oil content, biochemical activities, and nutritional values. The medicinal properties of Tiger nut are seldom discussed, although its medicinal use is well known in folklore activities. To explore the medicinal properties of Tiger nut, This review tries to investigate the potential anticancer properties of components issued from Tiger nut by reviewing the existing literature in the field. Based on the evidence from the review, it is recommended that there is a need for further investigation into the proposed anticancer properties of Tiger nut.

Seasonal variations of cellular stress response in the heart and gastrocnemius muscle of the water frog (Pelophylax ridibundus).

Science.gov (United States)

Feidantsis, Konstantinos; Anestis, Andreas; Vasara, Eleni; Kyriakopoulou-Sklavounou, Pasqualina; Michaelidis, Basile

2012-08-01

The present study aimed to investigate the seasonal cellular stress response in the heart and the gastrocnemius muscle of the amphibian Pelophylax ridibundus (former name Rana ridibunda) during an 8 month acclimatization period in the field. Processes studied included heat shock protein expression and protein kinase activation. The cellular stress response was addressed through the expression of Hsp70 and Hsp90 and the phosphorylation of stress-activated protein kinases and particularly p38 mitogen-activated protein kinase (p38 MAPK), the extracellular signal-regulated kinases (ERK-1/2) and c-Jun N-terminal kinases (JNK1/2/3). Due to a general metabolic depression during winter hibernation, the induction of Hsp70 and Hsp90 and the phosphorylation of p38 MAPK, JNKs and ERKs are retained at low levels of expression in the examined tissues of P. ridibundus. Recovery from hibernation induces increased levels of the specific proteins, probably providing stamina to the animals during their arousal. Copyright © 2012 Elsevier Inc. All rights reserved.

Metakognisjon om språk og språklæring i et flerspråklighetsperspektiv

Directory of Open Access Journals (Sweden)

Åsta Haukås

2014-09-01

Full Text Available I denne artikkelen drøfter jeg betydningen av elevers refleksjon om språk og språklæring. Artikkelens første del gir en kort introduksjon til forskningsfeltet metakognisjon. Deretter presenterer jeg to underkategorier av metakognisjon som er særlig relevante i språkundervisningen, metalingvistisk bevissthet og bevissthet om språklæringsstrategier. I artikkelens andre del introduserer jeg hovedprinsippene i flerspråklighetsdidaktikken, gir eksempler på hvordan elevene kan reflektere over språk og språklæring i språkfagene og argumenterer for at økt vekt på metakognisjon i og på tvers av språkfagene er en nøkkel til bedre språkkompetanse hos fremtidige elever. Dette krever imidlertid et sterkere samarbeid mellom språkfagene i skole, lærerutdanning og forskning.

Meningoencefalite a vírus e síndrome de Klüver-Bucy: relato de dois casos

Directory of Open Access Journals (Sweden)

Eleonora V. dos Santos Montanha

1986-12-01

Full Text Available São apresentados dois casos de meningoencefalite viral, de provável etiologia herpética, que desenvolveram síndrome de Klüver-Bucy parcial. Aspectos clinicopatológicos, diagnósticos e terapêuticos da meningoencefalite herpética são discutidos revisando-se também conceitos acerca da síndrome de Klüver-Bucy.

Molecular analysis of UAS(E), a cis element containing stress response elements responsible for ethanol induction of the KlADH4 gene of Kluyveromyces lactis.

Science.gov (United States)

Mazzoni, C; Santori, F; Saliola, M; Falcone, C

2000-01-01

KlADH4 is a gene of Kluyveromyces lactis encoding a mitochondrial alcohol dehydrogenase activity, which is specifically induced by ethanol and insensitive to glucose repression. In this work, we report the molecular analysis of UAS(E), an element of the KlADH4 promoter which is essential for the induction of KlADH4 in the presence of ethanol. UAS(E) contains five stress response elements (STREs), which have been found in many genes of Saccharomyces cerevisiae involved in the response of cells to conditions of stress. Whereas KlADH4 is not responsive to stress conditions, the STREs present in UAS(E) seem to play a key role in the induction of the gene by ethanol, a situation that has not been observed in the related yeast S. cerevisiae. Gel retardation experiments showed that STREs in the KlADH4 promoter can bind factor(s) under non-inducing conditions. Moreover, we observed that the RAP1 binding site present in UAS(E) binds KlRap1p.

Genetic relationships among okra (Abelmoschus esculentus (L. Moench cultivars in Nigeria

Directory of Open Access Journals (Sweden)

Bashir O. Bello

2017-09-01

Full Text Available This study was conducted on okra (Abelmoschus esculentus (L. Moench cultivars at the Teaching and Research Farm, University of Maiduguri, Nigeria. The objective was to evaluate the level of genetic divergence and heritability of eight characters in 2015 and 2016 dry seasons using irrigation. The results showed highly significant (p<0.01 differences in the ten okra cultivars for days to anthesis, plant height, fresh capsule length, fresh mass per capsule and fresh capsule diameter across the two years. A high genotypic coefficient of variation, heritability, and genetic advance were detected in all the characters except for days to anthesis and fresh capsule diameter. This implied that different genetic constitution and preponderance of additive effects governed these characters, thus presenting a significant opportunity for selection. The Mahanalobis D2 analysis allotted the ten cultivars into four clusters. The highest was cluster I comprising four cultivars, followed by cluster II containing three cultivars, cluster III consisting two cultivars, and cluster IV with mono genotypic. The three most superior okra cultivars (Salkade, Y’ar gagure and Kwadag for yield and related characters could be exploited directly or introgressed with other promising ones in future breeding programs.

Composition and age structure of the Pelophylax esculentus complex (Anura; Ranidae) population in inland Croatia

Czech Academy of Sciences Publication Activity Database

Čavlovič, K.; Buj, I.; Karaica, D.; Jelič, D.; Choleva, Lukáš

2018-01-01

Roč. 54, č. 1 (2018), s. 11-20 ISSN 0036-3375 R&D Projects: GA ČR GJ15-19947Y Institutional support: RVO:67985904 Keywords : hybridogenesis * population composition * allozyme markers Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 1.250, year: 2016

Review of Formen des Klärens by Christian Erbacher

Directory of Open Access Journals (Sweden)

Tea Jankovic

2016-06-01

Full Text Available Book review of Christian Erbacher's Formen des Klärens, Literarisch-Philosophische Darstellungsmittel in Wittgensteins Schriften, Münster: mentis 2015. *** Christian Erbacher’s Formen des Klärens, Literarisch-Philosophische Darstellungsmittel in Wittgensteins Schriften, which I would translate as Forms of Elucidating, Literary-Philosophical Means of Presentation in Wittgenstein’s Works, comprises and critically analyzes the most important phases of almost a hundred years of both English and German speaking Wittgenstein scholarship on the form of his literary-philosophical presentation. Furthermore, Erbacher demonstrates a thorough first hand knowledge of Wittgenstein’s manuscripts and manner of work, while at the same time offering an interpretation of the Tractatus logico-philosophicus, as well as later works, that is capable of comprehending both Wittgenstein’s serious and intense ethical and aesthetic preoccupations, as well as his significant contributions to logic and philosophy of language. Furthermore, despite its density, Erbacher’s slender book admirably achieves an elegant lucidity. Thus it performatively shows the unity of aesthetic-rhetorical form and philosophical content, as well as the ethical ideal of clarity at the core of Wittgenstein’s concerns.

Observation of the Decay $\\K_{L}^{0}\\rightarrow\\mu^{+}\\mu^{-}

CERN Document Server

Carithers, W C; Nygren, D R; Pun, T P; Schwartz, E L; Sticker, H; Steinberger, J; Weilhammer, P; Christenson, J H

1973-01-01

An experiment performed at the Brookhaven National Laboratory alternating-gradient synchrotron has yielded six events above negligible background which satisfy criteria for the decay K L0 -->µ+µ-. The K L0 flux, measured by means of the decay K L0 --> pi + pi -, leads to a value for the branching ratio Gamma (K L0 -->µ+µ-) / Gamma (KL-->all)=11 x 10-9.

Scholarly productivity and professional advancement of junior researchers receiving KL2, K23, or K08 awards at a large public research institution.

Science.gov (United States)

Amory, John K; Louden, Diana K N; McKinney, Christy; Rich, Joanne; Long-Genovese, Stacy; Disis, Mary L

2017-04-01

How the productivity and careers of KL2 scholars compare with scholars receiving individual K-awards is unknown. The productivity of KL2 scholars (n=21) at our institution was compared with that of K08 (n=34) and K23 (n=26) scholars. KL2 and K23 scholars had greater productivity than K08 scholars ( p =0.01). Professional advancement was similar among groups. At our institution, scholarly productivity and professional advancement did not differ by type of K-award.

SIA “Doktora Mileika Klīnika" mārketinga kompleksa analīze.

OpenAIRE

Mileika, Nadežda

2013-01-01

Bakalaura darbs veltīts „Doktora Mileika klīnikas” „7P” modeļa marketinga kompleksa analīzei. Bakalaura darba mērķis ir, pamatojoties uz teorijas atziņām par mārketinga kompleksu pakalpojuma sfērā, uz intervijas un klientu aptaujas rezultātiem, izanalizēt „Doktora Mileika klīnika” mārketinga kompleksa elementu priekšrocības un trūkumus, kā arī izvirzīt priekšlikumus mārketinga kompleksa pilnveidošanai uzņēmumā. Pirmajā nodaļā izskatīti mārketinga kompleksa „7P” elementi ar medicīnas ...

Influence of seaweed liquid fertilizer of ulva lactuca on the seed germination, growth, productivity of Abelmoschus esculentus (L.

Directory of Open Access Journals (Sweden)

Kaisarla Divya

2015-12-01

Full Text Available The present investigation is an attempt to study the influence of seaweed liquid fertiliger (SLF extracted from the marine green algae ulva lactuca on the growth parameters of Abelmoschus esculentus (l medikus. The seeds were soaked in different concentrations of SLF viz., 2.5%, 5%, 10%, 20% and control for 6h. The foliar spry was applied twice at four concentrations of seaweed extract. The maximum growth was recorded at 5% concentration viz., seed germination, shoot length, root length, no. of flowers, no. of fruits, fresh weight and dry weight when compare to control and remaining concentrations of seaweed extract. The seaweed extract are found effective in increasing the growth parameters.

A preliminary study on micronucleus analysis and nuclear anomalies in Pelophylax ridibundus (Pallas,

Directory of Open Access Journals (Sweden)

Mert Gürkan

2015-12-01

Full Text Available Bu çalışmada Vize (Kırklareli ve Kazdağı (Yenice, Çanakkale civarında toplanan Pelophylax ridibundus örneklerine ait eritrositlerde mikronukleus analizi yapıldı ve nuklear anomaliler tespit edildi. Bu amaçla Nisan 2011’de Vize’den 9 (5♂♂, 4♀♀, Mayıs 2011’de Kazdağı’ndan 5 (3♂♂, 2♀♀ adet P. ridibundus örneği toplandı. Vize’den toplanan örneklerde ortalama mikronukleus sayısı 6±4,17, frekans % 0,3; Kazdağı’ndan toplanan örneklerde ise 0,6±0,43, frekans % 0,03 olarak hesaplandı. İstatistiksel analizler neticesinde iki lokalite arasında toplam mikronukleus sayısı bakımından önemli fark bulunduğu belirlendi (p≤0,05. Çalışmada binuklear, çentikli, tomurcuklu ve küçük loplu olmak üzere 4 tip nuklear anomali saptandı. Vize ve Kazdağı örnekleri arasında toplam nuklear anomali sayısı bakımından fark tespit edilmedi (p=0,31. Araştırmamız sonunda elde edilen bulgulara göre, Vize örneklerinde mikronukleus frekansının daha yüksek bulunması, bölgedeki yoğun tarımsal faaliyetlerde kullanılan genotoksik pestisitlere maruz kalınmayla ilişkilendirilebilir

Mid-IR Imaging of Orion BN/KL: Modeling of Physical Conditions and Energy Balance

Science.gov (United States)

Gezari, Daniel; Varosi, Frank; Dwek, Eli; Danchi, William C.; Tan, Jonathan; Okumura, Shin-ichiro

2016-01-01

We have modeled two mid-infrared imaging photometry data sets to determine the spatial distribution of physical conditions in the BN/KL (Becklin-Neugebauer / Kleinmann-Low) infrared complex. We observed the BN/KL region using the 10-meter Keck I telescope and the LWS (Living With a Star) in the direct imaging mode, over a 13 inch by 19 inch field . We also modeled images obtained with COMICS (Cooled Mid-Infrared Camera and Spectrometer, Kataza et al. 2000) at the 8.2-meter SUBARU telescope, over a total field of view [which] is 31 inches by 41 inches in a total of nine bands: 7.8, 8.8, 9.7, 10.5, 11.7, 12.4, 18.5, 20.8 and 24.8 microns with 1-micron bandwidth interference filters.

A spectroscopic survey of Orion KL between 41.5 and 50 GHz.

Science.gov (United States)

Rizzo, J R; Tercero, B; Cernicharo, J

2017-09-01

The nearby massive star-forming region Orion KL is one of the richest molecular reservoirs known in our Galaxy. The region hosts newly formed protostars, and the strong interaction between their radiation and their outflows with the environment results in a series of complex chemical processes leading to a high diversity of interstellar tracers. The region is therefore one of the most frequently observed sources, and the site where many molecular species have been discovered for the first time. With the availability of powerful wideband backends, it is nowadays possible to complete spectral surveys in the entire mm-range to obtain a spectroscopically unbiased chemical picture of the region. In this paper we present a sensitive spectral survey of Orion KL, made with one of the 34 m antennas of the Madrid Deep Space Communications Complex in Robledo de Chavela, Spain. The spectral range surveyed is from 41.5 to 50 GHz, with a frequency spacing of 180 kHz (equivalent to ≈ 1.2 km s -1 , depending on the exact frequency). The rms achieved ranges from 8 to 12 mK. The spectrum is dominated by the J = 1 → 0 SiO maser lines and by radio recombination lines (RRLs), which were detected up to Δ n = 11. Above a 3 σ level, we identified 66 RRLs and 161 molecular lines corresponding to 39 isotopologues from 20 molecules; a total of 18 lines remain unidentified, two of them above a 5 σ level. Results of radiative modelling of the detected molecular lines (excluding masers) are presented. At this frequency range, this is the most sensitive survey and also the one with the widest band. Although some complex molecules like CH 3 CH 2 CN and CH 2 CHCN arise from the hot core, most of the detected molecules originate from the low temperature components in Orion KL.

THE BLACK HOLE CENTRAL ENGINE FOR ULTRA-LONG GAMMA-RAY BURST 111209A AND ITS ASSOCIATED SUPERNOVA 2011KL

Energy Technology Data Exchange (ETDEWEB)

Gao, He; You, Zhi-Qiang [Department of Astronomy, Beijing Normal University, Beijing 100875 (China); Lei, Wei-Hua; Xie, Wei, E-mail: gaohe@bnu.edu.cn, E-mail: leiwh@hust.edu.cn [School of Physics, Huazhong University of Science and Technology, Wuhan, 430074 (China)

2016-08-01

Recently, the first association between an ultra-long gamma-ray burst (GRB) and a supernova was reported, i.e., GRB 111209A/SN 2011kl, enabling us to investigate the physics of central engines or even progenitors for ultra-long GRBs. In this paper, we inspect the broadband data of GRB 111209A/SN 2011kl. The late-time X-ray light curve exhibits a GRB 121027A-like fallback bump, suggesting a black hole (BH) central engine. We thus propose a collapsar model with fallback accretion for GRB 111209A/SN 2011kl. The required model parameters, such as the total mass and radius of the progenitor star, suggest that the progenitor of GRB 111209A is more likely a Wolf–Rayet star instead of a blue supergiant, and the central engine of this ultra-long burst is a BH. The implications of our results are discussed.

Tracing the Origins of Nitrogen Bearing Organics Toward Orion KL with Alma

Science.gov (United States)

Carroll, Brandon; Crockett, Nathan; Wilkins, Olivia H.; Bergin, Edwin; Blake, Geoffrey

2017-06-01

A comprehensive analysis of a broadband 1.2 THz wide spectral survey of the Orion Kleinmann-Low nebula (Orion KL) has shown that nitrogen bearing complex organics trace systematically hotter gas than O-bearing organics toward this source. The origin of this O/N dichotomy remains a mystery. If complex molecules originate from grain surfaces, N-bearing species may be more difficult to remove from grain surfaces than O-bearing organics. Theoretical studies, however, have shown that hot (T=300 K) gas phase chemistry can produce high abundances of N-bearing organics while suppressing the formation of O-bearing complex molecules. In order to distinguish these distinct formation pathways we have obtained extremely high angular resolution observations of methyl cyanide (CH_3CN) using the Atacama Large Millimeter/Submillimeter Array (ALMA) toward Orion KL. By simultaneously imaging ^{13}CH_3CN and CH_2DCN we map the temperature structure and D/H ratio of CH_3CN. We will present updated results of these observations and discuss their implications for the formation of N-bearing organics in the interstellar medium.

Laboratory characterization and astrophysical detection of vibrationally excited states of vinyl cyanide in Orion-KL

Science.gov (United States)

López, A.; Tercero, B.; Kisiel, Z.; Daly, A. M.; Bermúdez, C.; Calcutt, H.; Marcelino, N.; Viti, S.; Drouin, B. J.; Medvedev, I. R.; Neese, C. F.; Pszczółkowski, L.; Alonso, J. L.; Cernicharo, J.

2014-12-01

Context. We perform a laboratory characterization in the 18-1893 GHz range and astronomical detection between 80-280 GHz in Orion-KL with IRAM-30 m of CH2CHCN (vinyl cyanide) in its ground and vibrationally excited states. Aims: Our aim is to improve the understanding of rotational spectra of vibrationally excited vinyl cyanide with new laboratory data and analysis. The laboratory results allow searching for these excited state transitions in the Orion-KL line survey. Furthermore, rotational lines of CH2CHCN contribute to the understanding of the physical and chemical properties of the cloud. Methods: Laboratory measurements of CH2CHCN made on several different frequency-modulated spectrometers were combined into a single broadband 50-1900 GHz spectrum and its assignment was confirmed by Stark modulation spectra recorded in the 18-40 GHz region and by ab-initio anharmonic force field calculations. For analyzing the emission lines of vinyl cyanide detected in Orion-KL we used the excitation and radiative transfer code (MADEX) at LTE conditions. Results: Detailed characterization of laboratory spectra of CH2CHCN in nine different excited vibrational states: ν11 = 1, ν15 = 1, ν11 = 2, ν10 = 1 ⇔ (ν11 = 1,ν15 = 1), ν11 = 3/ν15 = 2/ν14 = 1, (ν11 = 1,ν10 = 1) ⇔ (ν11 = 2,ν15 = 1), ν9 = 1, (ν11 = 1,ν15 = 2) ⇔ (ν10 = 1,ν15 = 1) ⇔ (ν11 = 1,ν14 = 1), and ν11 = 4 are determined, as well as the detection of transitions in the ν11 = 2 and ν11 = 3 states for the first time in Orion-KL and of those in the ν10 = 1 ⇔ (ν11 = 1,ν15 = 1) dyad of states for the first time in space. The rotational transitions of the ground state of this molecule emerge from four cloud components of hot core nature, which trace the physical and chemical conditions of high mass star forming regions in the Orion-KL Nebula. The lowest energy vibrationally excited states of vinyl cyanide, such as ν11 = 1 (at 328.5 K), ν15 = 1 (at 478.6 K), ν11 = 2 (at 657.8 K), the ν10

Seasonal variations of anti-/apoptotic and antioxidant proteins in the heart and gastrocnemius muscle of the water frog Pelophylax ridibundus.

Science.gov (United States)

Feidantsis, Konstantinos; Anestis, Andreas; Michaelidis, Basile

2013-10-01

In the present work we investigated the seasonal variations of apoptotic and antioxidant proteins in the heart and gastrocnemius muscle of the amphibian Pelophylax ridibundus. Particularly processes studied included the evaluation of hypoxia through the levels of transcriptional factor Hif-1α, of apoptosis through the determination of Bcl-2 and Bax, ubiquitin conjugates levels and the antioxidant defense through the determination of the activity of enzymes such as superoxide dismutase, catalase and glutathione peroxidase. Due to a general metabolic depression during overwintering, levels of the above mentioned proteins and enzymes are generally retained at low levels of expression and activity in the examined tissues of P. ridibundus. On the other hand recovery from overwintering induces oxidative stress, followed by increased levels of the specific proteins and enzymes. A milder up-regulation of antioxidant enzymes during overwintering probably prepares P. ridibundus for oxidative stress during arousal. The seasonal activation of these mechanisms seems to protect this species from these unfavourable conditions. Copyright © 2013 Elsevier Inc. All rights reserved.

Mosaiigitükid vajavad uut moodi kokkupanekut / Martin Klöker ; intervjueerinud Katrin Kaugver

Index Scriptorium Estoniae

Klöker, Martin, 1966-

2012-01-01

Intervjuu kirjandus- ja kultuuriloolase Martin Klökeriga, kes viibis TLÜAR-i kutsel 2012. a märtsis Tallinnas ning pidas avaliku loengu "Ebatäielik pilt: trükitud raamat ja käsikiri kultuuride uurimises" ning kokkuvõte loengust

The neuropsychology of the Klüver-Bucy syndrome in children.

Science.gov (United States)

Lippe, S; Gonin-Flambois, C; Jambaqué, I

2013-01-01

The Klüver-Bucy syndrome (KBS) is characterized by a number of peculiar behavioral symptoms. The syndrome was first observed in 1939 by Heinrich Klüver and Paul Bucy in the rhesus monkey following removal of the greater portion of the monkey's temporal lobes and rhinencephalon. The animal showed (a) visual agnosia (inability to recognize objects without general loss of visual discrimination), (b) excessive oral tendency (oral exploration of objects), (c) hypermetamorphosis (excessive visual attentiveness), (d) placidity with loss of normal fear and anger responses, (e) altered sexual behavior manifesting mainly as marked and indiscriminate hypersexuality, and (f) changes in eating behavior. In humans, KBS can be complete or incomplete. It occurs as a consequence of neurological disorders that essentially cause destruction or dysfunction of bilateral mesial temporal lobe structures (i.e., Pick disease, Alzheimer disease, cerebral trauma, cerebrovascular accidents, temporal lobe epilepsy, herpetic encephalopathy, heat stroke). As for epilepsy, complete and incomplete KBS are well documented in temporal lobe epilepsy, temporal lobectomy, and partial status epilepticus. KBS can occur at any age. Children seem to show similar symptoms to adults, although some differences in the manifestations of symptoms may be related to the fact that children have not yet learned certain behaviors. Copyright © 2013 Elsevier B.V. All rights reserved.

Preparation and Characterization of Polyelectrolyte Complexes of Hibiscus esculentus (Okra Gum and Chitosan

Directory of Open Access Journals (Sweden)

Vivekjot Brar

2018-01-01

Full Text Available Polyelectrolyte complexes (PECs of Okra gum (OKG extracted from fruits of Hibiscus esculentus (Malvaceae and chitosan (CH were prepared using ionic gelation technique. The PECs were insoluble and maximum yield was obtained at weight ratio of 7 : 3. The supernatant obtained after extracting PECs was clearly representing complete conversion of polysaccharides into PECs. Complexation was also evaluated by measuring the viscosity of supernatant after precipitation of PECs. The dried PECs were characterized using FTIR, DSC, zeta potential, water uptake, and SEM studies. Thermal analysis of PECs prepared at all ratios (10 : 90, 20 : 80, 30 : 70, 40 : 60, 50 : 50, 60 : 40, 70 : 30, 80 : 20, and 90 : 10; OKG : CH depicted an endothermic peak at approximately 240°C representing cleavage of electrostatic bond between OKG and CH. The optimized ratio (7 : 3 exhibited a zeta potential of −0.434 mV and displayed a porous structure in SEM analysis. These OKG-CH PECs can be further employed as promising carrier for drug delivery.

Correlation of serum KL-6 and CC16 levels with neurodevelopmental outcome in premature infants at 12 months corrected age

Science.gov (United States)

Zhang, Zhiqun; Lu, Hui; Zhu, Yunxia; Xiang, Junhua; Huang, Xianmei

2015-01-01

The aim of this study was to evaluate KL-6 and CC16 levels and their correlation with neurodevelopmental outcome among very low birth weight pre-term infants at 12 months corrected age. This prospective cohort study was performed from 2011 to 2013 by enrolling pre-term neonates of gestational age ≤ 32 weeks and birth weight ≤ 1500 g. Serum KL-6 and CC16 levels were determined 7 days after birth and their correlation with neurodevelopment was evaluated using Gesell Mental Developmental Scales. Of the 86 eligible pre-term infants, 63 completed follow-up, of which 15 had bronchopulmonary dysplasia. At 12 months corrected age, 49 infants had favorable outcomes and 14 infants had poor neurodevelopmental outcome. KL-6 levels were higher and CC16 levels were lower in infants with poor neurodevelopmental outcome compared with those infants who had favourable neurodevelopmental outcome. Serum KL-6 levels less than 90.0 ng/ml and CC16 levels greater than 320.0 pg/ml at 7 days of life were found to be predictive of a favourable outcome at 12 months corrected age. These biological markers could predict neurodevelopmental outcome at 12 months corrected age in very low birth weight premature infants, and help the clinician plan early therapeutic interventions to minimize or avoid poor neurodevelopmental outcome. PMID:25631862

Legionella dumoffii Tex-KL Mutated in an Operon Homologous to traC-traD is Defective in Epithelial Cell Invasion.

Science.gov (United States)

Qin, Tian; Ken-Ichiro, Iida; Ren, Hong Yu; Zhou, Hai Jian; Yoshida, Shin-Ichi

2016-06-01

To understand the mechanism of invasion by Legionella dumoffii. The L. dumoffii strain Tex-KL was mutated using the Tn903 derivative, Tn903dIIlacZ. After screening 799 transposon insertion mutants, we isolated one defective mutant. We then constructed the gene-disrupted mutant, KL16, and studied its invasion of and intracellular growth in HeLa and A549 cells, and in A/J mice survival experiments. The structure of traC-traD operon was analyzed by RT-PCR. The transposon insertion was in a gene homologous to Salmonella typhi traC, which is required for the assembly of F pilin into the mature F pilus structure and for conjugal DNA transmission. Results from RT-PCR suggested that the traC-traD region formed an operon. We found that when the traC gene was disrupted, invasion and intracellular growth of L. dumoffii Tex-KL were impaired in human epithelial cells. When mice were infected by intranasal inoculation with a traC deficient mutant, their survival significantly increased when compared to mice infected with the wild-type strain.. Our results indicated that the traC-traD operon is required for the invasion and intracellular growth abilities of L. dumoffii Tex-KL in epithelial cells. Copyright © 2016 The Editorial Board of Biomedical and Environmental Sciences. Published by China CDC. All rights reserved.

An Empiric Linear Formula between the Internal Tetrahedron Symmetric Stretch Frequency and the Al Content in the Framework of KL Molecular Sieves

Institute of Scientific and Technical Information of China (English)

Nong Yue HE; Chun YANG; Jian Xin TANG; Peng Feng XIAO; Hong CHEN

2003-01-01

KL molecular sieves with different framework compositions were secondarily synthesized by substituting Si for Al with a solution of (NH4)2SiF6. The internal tetrahedron symmetric stretch frequency, at ν770 cm-1, is linear with the molar fraction of Al (XAl= Al/(Si+Al)) in the framework of KL samples: XAl = -7.309×10-3 (υ770-760) + 0.3242.

Genetic and genomic interactions of animals with different ploidy levels.

Science.gov (United States)

Bogart, J P; Bi, K

2013-01-01

Polyploid animals have independently evolved from diploids in diverse taxa across the tree of life. We review a few polyploid animal species or biotypes where recently developed molecular and cytogenetic methods have significantly improved our understanding of their genetics, reproduction and evolution. Mitochondrial sequences that target the maternal ancestor of a polyploid show that polyploids may have single (e.g. unisexual salamanders in the genus Ambystoma) or multiple (e.g. parthenogenetic polyploid lizards in the genus Aspidoscelis) origins. Microsatellites are nuclear markers that can be used to analyze genetic recombinations, reproductive modes (e.g. Ambystoma) and recombination events (e.g. polyploid frogs such as Pelophylax esculentus). Hom(e)ologous chromosomes and rare intergenomic exchanges in allopolyploids have been distinguished by applying genome-specific fluorescent probes to chromosome spreads. Polyploids arise, and are maintained, through perturbations of the 'normal' meiotic program that would include pre-meiotic chromosome replication and genomic integrity of homologs. When possible, asexual, unisexual and bisexual polyploid species or biotypes interact with diploid relatives, and genes are passed from diploid to polyploid gene pools, which increase genetic diversity and ultimately evolutionary flexibility in the polyploid. When diploid relatives do not exist, polyploids can interact with another polyploid (e.g. species of African Clawed Frogs in the genus Xenopus). Some polyploid fish (e.g. salmonids) and frogs (Xenopus) represent independent lineages whose ancestors experienced whole genome duplication events. Some tetraploid frogs (P. esculentus) and fish (Squaliusalburnoides) may be in the process of becoming independent species, but diploid and triploid forms of these 'species' continue to genetically interact with the comparatively few tetraploid populations. Genetic and genomic interaction between polyploids and diploids is a complex

K19 capsular polysaccharide of Acinetobacter baumannii is produced via a Wzy polymerase encoded in a small genomic island rather than the KL19 capsule gene cluster.

Science.gov (United States)

Kenyon, Johanna J; Shneider, Mikhail M; Senchenkova, Sofya N; Shashkov, Alexander S; Siniagina, Maria N; Malanin, Sergey Y; Popova, Anastasiya V; Miroshnikov, Konstantin A; Hall, Ruth M; Knirel, Yuriy A

2016-08-01

Polymerization of the oligosaccharides (K units) of complex capsular polysaccharides (CPSs) requires a Wzy polymerase, which is usually encoded in the gene cluster that directs K unit synthesis. Here, a gene cluster at the Acinetobacter K locus (KL) that lacks a wzy gene, KL19, was found in Acinetobacter baumannii ST111 isolates 28 and RBH2 recovered from hospitals in the Russian Federation and Australia, respectively. However, these isolates produced long-chain capsule, and a wzy gene was found in a 6.1 kb genomic island (GI) located adjacent to the cpn60 gene. The GI also includes an acetyltransferase gene, atr25, which is interrupted by an insertion sequence (IS) in RBH2. The capsule structure from both strains was →3)-α-d-GalpNAc-(1→4)-α-d-GalpNAcA-(1→3)-β-d-QuipNAc4NAc-(1→, determined using NMR spectroscopy. Biosynthesis of the K unit was inferred to be initiated with QuiNAc4NAc, and hence the Wzy forms the β-(1→3) linkage between QuipNAc4NAc and GalpNAc. The GalpNAc residue is 6-O-acetylated in isolate 28 only, showing that atr25 is responsible for this acetylation. The same GI with or without an IS in atr25 was found in draft genomes of other KL19 isolates, as well as ones carrying a closely related CPS gene cluster, KL39, which differs from KL19 only in a gene for an acyltransferase in the QuiNAc4NR synthesis pathway. Isolates carrying a KL1 variant with the wzy and atr genes each interrupted by an ISAba125 also have this GI. To our knowledge, this study is the first report of genes involved in capsule biosynthesis normally found at the KL located elsewhere in A. baumannii genomes.

Physicochemical, functional and sensory attributes of milk prepared from irradiated tiger nut (Cyperus esculentus L.

Directory of Open Access Journals (Sweden)

Abenaa A. Okyere

2014-10-01

Full Text Available Five tiger nut (Cyperus esculentus L. cultivars were collected from four different regions of Ghana and irradiated. The aim of this study was to evaluate some physicochemical, functional and sensory qualities of milk produced from irradiated tiger nut samples. Analysis was carried out for pH, total solids, moisture, sugar brix and viscosity. Finally the consumer acceptability of the milk prepared from the nuts was determined by a taste panel using the parameters of colour, taste, aroma, mouth feel and overall acceptability. The sugar content varied from 6.0 ± 0.3% (Techiman to 15.00 ± 1.00% (Asebu Ekroful depending on the irradiation dose applied. Generally, increase in dose increased the sugar availability but decreased viscosity of the milk prepared from the nuts. The milk with the highest viscosity was from Kwahu Aduamoa and Techiman with the least viscosity from Bawjiase. Generally, no significant difference was detected by the sensory panellists with regard to mouth feel and taste among the milk samples prepared from the various tiger nut cultivars.

Total sialic acid profile in regressing and remodelling organs during the metamorphosis of marsh frog (Pelophylax ridibundus Pallas 1771).

Science.gov (United States)

Kaptan, Engin; Bas, Serap Sancar; Inceli, Meliha Sengezer

2013-03-01

This study aimed to investigate the functional relationship of sialic acid in regressing and remodelling organs such as the tail, small intestine and liver during the metamorphosis of Pelophylax ridibundus. For this purpose, four groups were composed according to developmental periods by considering Gosner's criteria (1964). Our findings showed that the sialic acid content of the larval tail has an opposite profile to cell death process. Although the sialic acid content of the small intestine and liver did not change evidently during metamorphosis, it increased after the completion of metamorphosis. Frog tail extensively exhibited cell death process and decreased proliferative activity and underwent complete degeneration during metamorphic climax. In spite of increased apoptotic index, a decreased sialic acid level in the tail tissues during climax can be the indication of a death cell removal process. However, the intestine and the liver included both cell death and proliferative process and remodelling in their adult forms. Thus, their sialic acid profiles during metamorphosis were different from the tail's profile. These data show that sialic acid may be an indicator of the presence of some cellular events during metamorphosis and that it can have different roles in the developmental process depending on the organ's fate throughout metamorphosis. Copyright © 2012 John Wiley & Sons, Ltd.

Carma 1 CM Line Survey of Orion-Kl

Science.gov (United States)

Friedel, Douglas; Looney, Leslie; Corby, Joanna F.; Remijan, Anthony

2015-06-01

We have conducted the first 1 cm (27-35 GHz) line survey of the Orion-KL region by an array. With a primary beam of ˜4.5 arcminutes, the survey looks at a region ˜166,000 AU (0.56 pc) across. The data have a resolution of ˜6 arcseconds on the sky and 97.6 kHz(1.07-0.84 km/s) in frequency. This region of frequency space is much less crowded than at 3mm or 1mm frequencies and contains the fundamental transitions of several complex molecular species, allowing us to probe the largest extent of the molecular emission. We present the initial results, and comparison to 3mm results, from several species including, dimethyl ether [(CH_3)_2O], ethyl cyanide [C_2H_5CN], acetone [(CH_3)_2CO], SO, and SO_2.

The Deletion of the Succinate Dehydrogenase Gene KlSDH1 in Kluyveromyces lactis Does Not Lead to Respiratory Deficiency

Science.gov (United States)

Saliola, Michele; Bartoccioni, Paola Chiara; De Maria, Ilaria; Lodi, Tiziana; Falcone, Claudio

2004-01-01

We have isolated a Kluyveromyces lactis mutant unable to grow on all respiratory carbon sources with the exception of lactate. Functional complementation of this mutant led to the isolation of KlSDH1, the gene encoding the flavoprotein subunit of the succinate dehydrogenase (SDH) complex, which is essential for the aerobic utilization of carbon sources. Despite the high sequence conservation of the SDH genes in Saccharomyces cerevisiae and K. lactis, they do not have the same relevance in the metabolism of the two yeasts. In fact, unlike SDH1, KlSDH1 was highly expressed under both fermentative and nonfermentative conditions. In addition to this, but in contrast with S. cerevisiae, K. lactis strains lacking KlSDH1 were still able to grow in the presence of lactate. In these mutants, oxygen consumption was one-eighth that of the wild type in the presence of lactate and was normal with glucose and ethanol, indicating that the respiratory chain was fully functional. Northern analysis suggested that alternative pathway(s), which involves pyruvate decarboxylase and the glyoxylate cycle, could overcome the absence of SDH and allow (i) lactate utilization and (ii) the accumulation of succinate instead of ethanol during growth on glucose. PMID:15189981

Oprava klínovitosti vzorků pro měření v laserové spektroskopii

OpenAIRE

Schiffer, Štěpán

2016-01-01

Jednou z oblastí využití metody LIBS je tvorba chemických map zkoumaných vzorků. Významný vliv na přesnost měření touto metodou má vzdálenost mezi čočkou a povrchem vzorku. U klínovitých vzorků se tato vzdálenost v průběhu experimentu mění a výrazně tak snižuje kvalitu vytvořených chemických map. V této bakalářské práci je navržena a experimentálně ověřena metoda, kterou je možné klínovitost vzorku kompenzovat. Součástí práce je popis teoretických základů laserové spektroskopie a přehled někt...

Soot temperature and KL factor for biodiesel and diesel spray combustion in a constant volume combustion chamber

KAUST Repository

Zhang, Ji; Jing, Wei; Roberts, William L.; Fang, Tiegang

2013-01-01

This paper presents measurements of the soot temperature and KL factor for biodiesel and diesel combustion in a constant volume chamber using a two-color technique. This technique uses a high-speed camera coupled with two narrowband filters (550. nm

Physicochemical Characteristics and Composition of Three Morphotypes of Cyperus esculentus Tubers and Tuber Oils

Directory of Open Access Journals (Sweden)

Souleymane Bado

2015-01-01

Full Text Available Tuber characteristics and nutrient composition of three morphotypes of Cyperus esculentus tubers and tuber oils were determined. The mean value for length and width of the tuber and one thousand dried tuber weights ranged from 0.98 to 1.31 cm, 0.90 to 1.19 cm, and 598 to 1044 g, respectively. Tubers displayed high level of starch (30.54–33.21 g 100 g−1, lipid (24.91–28.94 g 100 g−1, and sucrose (17.98–20.39 g 100 g−1. The yellow tubers had significantly higher content in lipid compared to black ones. Levels of ascorbic acid, tocopherol, and β-carotene of the three morphotypes differed significantly. Yellow ones (morphotypes 1 and 2 were the richest in tocopherol and the poorest in β-carotene. Saturated fatty acid content of morphotype 2 was significantly lower than that of morphotypes 1 and 3. Morphotype 3 had the significantly lowest PUFA content compared to morphotypes 1 and 2. Morphotype 1 was found to be richer in Ca, Cu, and Mn contents. Al, Mg, P, S, and Si were most abundant in morphotype 2. Morphotype 3 had the highest content of Cl, K, and Zn.

Responses of growth of lady's fingers (Abelmoschus esculentus L.) to different treatments methods of dairy wastewater.

Science.gov (United States)

Al-Dulaimi, Rana Ibrahim; Ismail, Norli; Ibrahim, Mahamad H

2014-01-01

Water is one of the most important precious resources found on the earth, and are most often affected by anthropogenic activities and by industry. Pollution caused by human beings and industries is a serious concern throughout the world. Population growth, massive urbanization, rapid rate of industrialization and modern techniques in agriculture have accelerated water pollution and led to the gradual deterioration of its quality. A large quantity of waste water disposed of at sea or on land has caused environmental problems which have led to environmental pollution, economic losses and chemical risks caused by the wastewater, and its impact on agriculture. However, waste water which contain nutrients and organic matter has possible advantages for agricultural purposes. Therefore, the presented study was undertaken to assess the impact of Dairy Effluent (treated and untreated waste water) on seed germination, seedling growth, dry matter production and the biochemical parameters of lady's fingers (Abelmoschus esculentus L.). A field experiment in a green house was conducted to use raw and treated dairy wastewater for watering lady's fingers (Abelmoschus esculentus L.). The plants were watered using (WW) raw dairy wastewater, (T1) chemicals treatment, (T2) physical treatment, (T3) dilution method treatment and tap water (TW) in pot experiments. Ten plants of each treatment /3 replicate were randomly selected and labelled for the collection of data. The data was collected sequentially, starting with chlorophyll content pre-harvest, vegetative qualities (shoot, root and seedling length) and dry matter quality (shoot and root dry matter) pos-tharvest. The effect was seen on the germination seed and growth of the plant. The results showed inhibitory effect from dairy effluent (WW) on seed germination and plant growth. Treatment with chemicals showed statistically significant differences with other treatments. Chemical treatment (TC2) at 20 mg/L Al2(SO4)3 and pH 6

THE GBT 67–93.6 GHz SPECTRAL LINE SURVEY OF ORION-KL

International Nuclear Information System (INIS)

Frayer, D. T.; Maddalena, Ronald J.; Meijer, M.; Hough, L.; White, S.; Norrod, R.; Watts, G.; Stennes, M.; Simon, R.; Woody, D.; Whitehead, M.; Ford, P.; Mello, M.; Bloss, M.; Srikanth, S.; Pospieszalski, M.; Bryerton, E.

2015-01-01

We present a 67–93.6 GHz spectral line survey of Orion-KL with the new 4 mm Receiver on the Green Bank Telescope (GBT). The survey reaches unprecedented depths and covers the low-frequency end of the 3 mm atmospheric window which has been relatively unexplored previously. The entire spectral-line survey is published electronically for general use by the astronomical community. The calibration and performance of the 4 mm Receiver on the GBT is also summarized

Evidence for methane in orion KL: A search for the 4.6 Gigahertz line

International Nuclear Information System (INIS)

Wilson, T.L.; Snyder, L.E.

1985-01-01

A sensitive search for the J = 11 E(2)-E(1) transition of interstellar methane (CH 4 ) has resulted in a peak upper limit which is much less than the value reported by Fox and Jennings in 1978. When combined with the negative results reported by Ellder et al. in 1980, these data rule out the detection of CH 4 in Orion KL previously claimed by Fox and Jennings

Evidence for methane in Orion KL - a search for the 4.6 gigahertz line

International Nuclear Information System (INIS)

Wilson, T.L.; Snyder, L.E.

1985-01-01

A sensitive search for J = 11 E(2)-E(1) transition of interstellar methane (CH4) has resulted in a peak upper limit which is much less than the value reported by Fox and Jennings (1978). When combined with the negative results reported by Ellder et al. (1980), these data rule out the detection of CH4 in Orion KL previously claimed by Fox and Jennings. 7 references

{sup 13}C-METHYL FORMATE: OBSERVATIONS OF A SAMPLE OF HIGH-MASS STAR-FORMING REGIONS INCLUDING ORION-KL AND SPECTROSCOPIC CHARACTERIZATION

Energy Technology Data Exchange (ETDEWEB)

Favre, Cécile; Bergin, Edwin A.; Crockett, Nathan R.; Neill, Justin L. [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48109 (United States); Carvajal, Miguel [Dpto. Física Aplicada, Unidad Asociada CSIC, Facultad de Ciencias Experimentales, Universidad de Huelva, E-21071 Huelva (Spain); Field, David [Department of Physics and Astronomy, University of Aarhus, Ny Munkegade 120, DK-8000 Aarhus C (Denmark); Jørgensen, Jes K.; Bisschop, Suzanne E. [Centre for Star and Planet Formation, Niels Bohr Institute, University of Copenhagen, Juliane Maries Vej 30, DK-2100 Copenhagen Ø (Denmark); Brouillet, Nathalie; Despois, Didier; Baudry, Alain [Univ. Bordeaux, LAB, UMR 5804, F-33270, Floirac (France); Kleiner, Isabelle [Laboratoire Interuniversitaire des Systèmes Atmosphériques (LISA), CNRS, UMR 7583, Université de Paris-Est et Paris Diderot, 61, Av. du Général de Gaulle, F-94010 Créteil Cedex (France); Margulès, Laurent; Huet, Thérèse R.; Demaison, Jean, E-mail: cfavre@umich.edu, E-mail: miguel.carvajal@dfa.uhu.es [Laboratoire de Physique des Lasers, Atomes et Molécules, UMR CNRS 8523, Université Lille I, F-59655 Villeneuve d' Ascq Cedex (France)

2015-01-01

We have surveyed a sample of massive star-forming regions located over a range of distances from the Galactic center for methyl formate, HCOOCH{sub 3}, and its isotopologues H{sup 13}COOCH{sub 3} and HCOO{sup 13}CH{sub 3}. The observations were carried out with the APEX telescope in the frequency range 283.4-287.4 GHz. Based on the APEX observations, we report tentative detections of the {sup 13}C-methyl formate isotopologue HCOO{sup 13}CH{sub 3} toward the following four massive star-forming regions: Sgr B2(N-LMH), NGC 6334 IRS 1, W51 e2, and G19.61-0.23. In addition, we have used the 1 mm ALMA science verification observations of Orion-KL and confirm the detection of the {sup 13}C-methyl formate species in Orion-KL and image its spatial distribution. Our analysis shows that the {sup 12}C/{sup 13}C isotope ratio in methyl formate toward the Orion-KL Compact Ridge and Hot Core-SW components (68.4 ± 10.1 and 71.4 ± 7.8, respectively) are, for both the {sup 13}C-methyl formate isotopologues, commensurate with the average {sup 12}C/{sup 13}C ratio of CO derived toward Orion-KL. Likewise, regarding the other sources, our results are consistent with the {sup 12}C/{sup 13}C in CO. We also report the spectroscopic characterization, which includes a complete partition function, of the complex H{sup 13}COOCH{sub 3} and HCOO{sup 13}CH{sub 3} species. New spectroscopic data for both isotopomers H{sup 13}COOCH{sub 3} and HCOO{sup 13}CH{sub 3}, presented in this study, have made it possible to measure this fundamentally important isotope ratio in a large organic molecule for the first time.

Genetic diversity and distribution patterns of diploid and polyploid hybrid water frog populations (Pelophylax esculentus complex) across Europe

Czech Academy of Sciences Publication Activity Database

Hoffmann, A.; Plötner, J.; Pruvost, N. B. M.; Christiansen, D. G.; Röthlisberger, S.; Choleva, Lukáš; Mikulíček, P.; Cogalniceanu, D.; Sas-Kovács, I.; Shabanov, D.; Morozov-Leonov, S.; Reyer, H. U.

2015-01-01

Roč. 24, č. 17 (2015), s. 4371-4391 ISSN 0962-1083 R&D Projects: GA ČR(CZ) GJ15-19947Y Institutional support: RVO:67985904 Keywords : all-hybrids populations * founder effects * geographic distribution Subject RIV: EG - Zoology Impact factor: 5.947, year: 2015

Exposure to lead in water and cysteine non-oxidative metabolism in Pelophylax ridibundus tissues

International Nuclear Information System (INIS)

Kaczor, Marta; Sura, Piotr; Bronowicka-Adamska, Patrycja; Wróbel, Maria

2013-01-01

Chronic, low-level exposure to metals is an increasing global problem. Lead is an environmentally persistent toxin that causes many lead-related pathologies, directly affects tissues and cellular components or exerts an effect of the generation of reactive oxygen species causing a diminished level of available sulfhydryl antioxidant reserves. Cysteine is one of substrates in the synthesis of glutathione – the most important cellular antioxidant, and it may also undergo non-oxidative desulfuration that produces compounds containing sulfane sulfur atoms. The aim of the experiment was to examine changes of the non-oxidative metabolism of cysteine and the levels of cysteine and glutathione in the kidneys, heart, brain, liver and muscle of Marsh frogs (Pelophylax ridibundus) exposed to 28 mg/L Pb(NO 3 ) 2 for 10 days. The activities of sulfurtransferases, enzymes related to the sulfane sulfur metabolism – 3-mercaptopyruvate sulfurtransfearse, γ-cystathionase and rhodanese – were detected in tissue homogenates. The activity of sulfurtransferases was much higher in the kidneys of frogs exposed to lead in comparison to control frogs, not exposed to lead. The level of sulfane sulfur remained unchanged. Similarly, the total level of cysteine did not change significantly. The total levels of glutathione and the cysteine/cystine and GSH/GSSG ratios were elevated. Thus, it seems that the exposure to lead intensified the metabolism of sulfane sulfur and glutathione synthesis in the kidneys. The results presented in this work not only confirm the participation of GSH in the detoxification of lead ions and/or products appearing in response to their presence, such as reactive oxygen species, but also indicate the involvement of sulfane sulfur and rhodanese in this process (e.g. brain). As long as the expression of enzymatic proteins (rhodanese, MPST and CST) is not examined, no answer will be provided to the question whether changes in their activity are due to differences

Exposure to lead in water and cysteine non-oxidative metabolism in Pelophylax ridibundus tissues

Energy Technology Data Exchange (ETDEWEB)

Kaczor, Marta [Jagiellonian University Medical College, Kopernika 7, 31-034 Krakow (Poland); Sura, Piotr [Department of Human Developmental Biology, Jagiellonian University Medical College, Kopernika 7, 31-034 Krakow (Poland); Bronowicka-Adamska, Patrycja [Jagiellonian University Medical College, Kopernika 7, 31-034 Krakow (Poland); Wrobel, Maria, E-mail: mbwrobel@cyf-kr.edu.pl [Jagiellonian University Medical College, Kopernika 7, 31-034 Krakow (Poland)

2013-02-15

Chronic, low-level exposure to metals is an increasing global problem. Lead is an environmentally persistent toxin that causes many lead-related pathologies, directly affects tissues and cellular components or exerts an effect of the generation of reactive oxygen species causing a diminished level of available sulfhydryl antioxidant reserves. Cysteine is one of substrates in the synthesis of glutathione - the most important cellular antioxidant, and it may also undergo non-oxidative desulfuration that produces compounds containing sulfane sulfur atoms. The aim of the experiment was to examine changes of the non-oxidative metabolism of cysteine and the levels of cysteine and glutathione in the kidneys, heart, brain, liver and muscle of Marsh frogs (Pelophylax ridibundus) exposed to 28 mg/L Pb(NO{sub 3}){sub 2} for 10 days. The activities of sulfurtransferases, enzymes related to the sulfane sulfur metabolism - 3-mercaptopyruvate sulfurtransfearse, {gamma}-cystathionase and rhodanese - were detected in tissue homogenates. The activity of sulfurtransferases was much higher in the kidneys of frogs exposed to lead in comparison to control frogs, not exposed to lead. The level of sulfane sulfur remained unchanged. Similarly, the total level of cysteine did not change significantly. The total levels of glutathione and the cysteine/cystine and GSH/GSSG ratios were elevated. Thus, it seems that the exposure to lead intensified the metabolism of sulfane sulfur and glutathione synthesis in the kidneys. The results presented in this work not only confirm the participation of GSH in the detoxification of lead ions and/or products appearing in response to their presence, such as reactive oxygen species, but also indicate the involvement of sulfane sulfur and rhodanese in this process (e.g. brain). As long as the expression of enzymatic proteins (rhodanese, MPST and CST) is not examined, no answer will be provided to the question whether changes in their activity are due to

Prescreening based on the presence of CT-scan abnormalities and biomarkers (KL-6 and SP-D may reduce severe radiation pneumonitis after stereotactic radiotherapy

Directory of Open Access Journals (Sweden)

Wakui Reiko

2010-05-01

Full Text Available Abstract Purpose To determine the risk factors of severe radiation pneumonitis (RP after stereotactic body radiation therapy (SBRT for primary or secondary lung tumors. Materials and methods From January 2003 to March 2009, SBRT was performed on 117 patients (32 patients before 2005 and 85 patients after 2006 with lung tumors (primary = 74 patients and metastatic/recurrent = 43 patients in our institution. In the current study, the results on cases with severe RP (grades 4-5 were evaluated. Serum Krebs von den Lungen-6 (KL-6 and serum Surfactant protein-D (SP-D were used to predict the incidence of RP. A shadow of interstitial pneumonitis (IP on the CT image before performing SBRT was also used as an indicator for RP. Since 2006, patients have been prescreened for biological markers (KL-6 & SP-D as well as checking for an IP-shadow in CT. Results Grades 4-5 RP was observed in nine patients (7.7% after SBRT and seven of these cases (6.0% were grade 5 in our institution. A correlation was found between the incidence of RP and higher serum KL-6 & SP-D levels. IP-shadow in patient's CT was also found to correlate well with the severe RP. Severe RP was reduced from 18.8% before 2005 to 3.5% after 2006 (p = 0.042. There was no correlation between the dose volume histogram parameters and these severe RP patients. Conclusion Patients presenting with an IP shadow in the CT and a high value of the serum KL-6 & SP-D before SBRT treatment developed severe radiation pneumonitis at a high rate. The reduction of RP incidence in patients treated after 2006 may have been attributed to prescreening of the patients. Therefore, pre-screening before SBRT for an IP shadow in CT and serum KL-6 & SP-D is recommended in the management and treatment of patients with primary or secondary lung tumors.

Three-dimensional Shock Structure of the Orion KL Outflow with IGRINS

Science.gov (United States)

Oh, Heeyoung; Pyo, Tae-Soo; Kaplan, Kyle; Yuk, In-Soo; Park, Byeong-Gon; Mace, Gregory; Park, Chan; Chun, Moo-Young; Pak, Soojong; Kim, Kang-Min; Sok Oh, Jae; Jeong, Ueejeong; Yu, Young Sam; Lee, Jae-Joon; Kim, Hwihyun; Hwang, Narae; Lee, Hye-In; Nguyen Le, Huynh Anh; Lee, Sungho; Jaffe, Daniel T.

2016-12-01

We report a study of the three-dimensional (3D) outflow structure of a 15″ × 13″ area around the H2 peak 1 in Orion KL with slit-scan observations (13 slits) using the Immersion Grating Infrared Spectrograph. The datacubes have a high-velocity resolution (˜7.5 km s-1), provide high-contrast imaging within ultra-narrow bands, and enable the detection of the main stream of the previously reported H2 outflow fingers. We identified 31 distinct fingers in the H2 1-0 S(1) λ2.122 μm emission. The line profile at each finger shows multiple-velocity peaks with a strong low-velocity component around the systemic velocity at {V}{LSR} = +8 km s-1 and high-velocity emission (| {V}{LSR}| = 45-135 km s-1), indicating a typical bow-shock. The observed radial velocity gradients of ˜4 km s-1 arcsec-1 agree well with the velocities inferred from large-scale proper motions, where the projected motion is proportional to the distance from a common origin. We construct a conceptual 3D map of the fingers with estimated inclination angles of 57°-74°. The extinction difference (ΔA v > 10 mag) between blueshifted and redshifted fingers indicates high internal extinction. The extinction, the overall angular spread, and the scale of the flow argue for an ambient medium with a very high density (105-106 cm-3), consistent with molecular line observations of the Orion Molecular Cloud core. The radial velocity gradients and the 3D distributions of the fingers together support the hypothesis of a simultaneous radial explosion of the Orion KL outflow. This paper includes data taken at The McDonald Observatory of The University of Texas at Austin.

Soot temperature and KL factor for biodiesel and diesel spray combustion in a constant volume combustion chamber

KAUST Repository

Zhang, Ji

2013-07-01

This paper presents measurements of the soot temperature and KL factor for biodiesel and diesel combustion in a constant volume chamber using a two-color technique. This technique uses a high-speed camera coupled with two narrowband filters (550. nm and 650. nm, 10. nm FWHM). After calibration, statistical analysis shows that the uncertainty of the two-color temperature is less than 5%, while it is about 50% for the KL factor. This technique is then applied to the spray combustion of biodiesel and diesel fuels under an ambient oxygen concentration of 21% and ambient temperatures of 800, 1000 and 1200. K. The heat release result shows higher energy utilization efficiency for biodiesel compared to diesel under all conditions; meanwhile, diesel shows a higher pressure increase due to its higher heating value. Biodiesel yields a lower temperature inside the flame area, a longer soot lift-off length, and a smaller soot area compared to diesel. Both the KL factor and the total soot with biodiesel are lower than with diesel throughout the entire combustion process, and this difference becomes larger as the ambient temperature decreases. Biodiesel shows approximately 50-100. K lower temperatures than diesel at the quasi-steady stage for 1000 and 1200. K ambient temperature, while diesel shows a lower temperature than biodiesel at 800. K ambient. This result may raise the question of how important the flame temperature is in explaining the higher NO. x emissions often observed during biodiesel combustion. Other factors may also play an important role in controlling NO. x emissions. Both biodiesel and diesel temperature measurements show a monotonic dependence on the ambient temperature. However, the ambient temperature appears to have a more significant effect on the soot formation and oxidation in diesel combustion, while biodiesel combustion soot characteristics shows relative insensitivity to the ambient temperature. © 2013 Elsevier Ltd.

Işıklı Gölü ve Kaynaklarının (Çivril-Denizli Crustacea Faunası.

Directory of Open Access Journals (Sweden)

Cem Aygen

2015-12-01

Full Text Available Bu çalışmada, Işıklı Gölü Crustacea faunasının taksonomik açıdan incelenmesi hedeflenmiştir. Bu amaçla Şubat 1998-Ocak 1999 ayları arasında, gölde ve göle akan kaynak bölgesinde belirlenen 6 istasyondan aylık periyotlarla biyolojik örnekler ve su örnekleri alınmıştır. Araştırma sonunda Işıklı Gölü ve Kaynağı’nda bulunan Crustacea faunasının başlıca Cladocera (16 tür, Copepoda (12 tür, Ostracoda (1 tür, Amphipoda (2 tür, Isopoda (1 tür, Mysidacea (1 tür ve Decapoda (1 tür gruplarından oluştuğu saptanmıştır. Tespit edilen türlerden Cladocera grubundan Diaphanosoma brachyurum, Diaphanosoma mongolianum, Ceriodaphnia pulchella, Simocephalus vetulus, Macrothrix laticornis, Alona rectangula, Alona guttata, Graptoleberis testudinaria, Leydigia leydigi, Biapertura affinis, Chydorus sphaericus, Pleuroxus aduncus ve Disparalona rostrata; Copepoda grubundan Macrocyclops albidus, Eucyclops serrulatus, Eucyclops speratus, Eucyclops macruroides, Metacyclops gracilis, Mesocyclops leuckarti, Cyclops vicinus, Cyclops abyssorum, Cyclops strenuus, Megacyclops viridis, Acanthocyclops robustus, Canthocamptus staphylinus; Ostracoda grubundan Psychrodromus olivaceus; Amphipoda grubundan Gammarus balcanicus, Gammarus obnixus; Isopoda grubundan Asellus aquaticus türleri Işıklı Gölü’nden ilk kez bildirilmektedir

Podnikatelský plán lyžařské školy na Klínovci

OpenAIRE

Ketner, Robert

2016-01-01

The goal of the thesis is a business plan that will be used for presentation to shareholders in the company Skiareál Klínovec, s. r. o. and later for communication with the external environment. Content of business plan is marketing, operational and financial plan, personal plan and management organization of the proposed company. Powered by TCPDF (www.tcpdf.org)

De Novo Transcriptome Assembly and Characterization of the Synthesis Genes of Bioactive Constituents in Abelmoschus esculentus (L.) Moench

Science.gov (United States)

Zhang, Chenghao; Dong, Wenqi; Gen, Wei; Xu, Baoyu; Shen, Chenjia

2018-01-01

Abelmoschus esculentus (okra or lady’s fingers) is a vegetable with high nutritional value, as well as having certain medicinal effects. It is widely used as food, in the food industry, and in herbal medicinal products, but also as an ornamental, in animal feed, and in other commercial sectors. Okra is rich in bioactive compounds, such as flavonoids, polysaccharides, polyphenols, caffeine, and pectin. In the present study, the concentrations of total flavonoids and polysaccharides in five organs of okra were determined and compared. Transcriptome sequencing was used to explore the biosynthesis pathways associated with the active constituents in okra. Transcriptome sequencing of five organs (roots, stem, leaves, flowers, and fruits) of okra enabled us to obtain 293,971 unigenes, of which 232,490 were annotated. Unigenes related to the enzymes involved in the flavonoid biosynthetic pathway or in fructose and mannose metabolism were identified, based on Kyoto Encyclopedia of Genes and Genomes (KEGG) pathway analysis. All of the transcriptional datasets were uploaded to Sequence Read Archive (SRA). In summary, our comprehensive analysis provides important information at the molecular level about the flavonoid and polysaccharide biosynthesis pathways in okra. PMID:29495525

Antioxidant response and metal accumulation in tissues of Iberian green frogs (Pelophylax perezi) inhabiting a deactivated uranium mine.

Science.gov (United States)

Marques, Sérgio M; Antunes, Sara C; Nunes, Bruno; Gonçalves, Fernando; Pereira, Ruth

2011-08-01

Human mining activities tend often to generate greatly impacted areas which remain contaminated for long periods of time, giving rise to extreme habitats. Mining sites are usually characterized for the production of metal rich effluents with very low pH. In this work we analyzed physical and chemical parameters of water from a deactivated uranium mine pond (M) and a reference site (REF) as well as their metal content. Furthermore, we determined and compared metal accumulation in liver, kidney, bones, muscle and skin of Pelophylax perezi from REF with P. perezi from M. We also determined the enzymatic activities of glutathione-S-transferases (GSTs), catalase (CAT), glutathione reductase (Gred), and glutathione peroxidase (GPx; both selenium-dependent and selenium-independent) in liver, kidney, lung and heart. Additionally, lipoperoxidation (LPO) was also assessed in the same tissues via thiobarbituric acid reactive substances (TBARS) assay and lactate dehydrogenase (LDH) activity was determined in muscle. Our results revealed that the majority of metals were in higher concentrations in tissues of organisms from M. This trend was especially evident for U whose content reached a difference of 1350 fold between REF and M organisms. None of the organs tested for antioxidant defenses revealed LPO, nonetheless, with exception for liver, all organs from the M frogs presented increased total GPx activity and selenium-dependent GPx. However, this response was significant only for the lung, probably as a consequence of the significant inhibition of CAT upstream and to cope with the subsequent increase in H(2)O(2). Lungs were the organs displaying greater responsiveness of the anti-oxidant stress system in frogs from the uranium mine area.

Responses of growth of lady’s fingers ([i]Abelmoschus esculentus [/i]L. to different treatments methods of dairy wastewater

Directory of Open Access Journals (Sweden)

Rana Ibrahim Al-Dulaimi

2014-03-01

Full Text Available Introduction and objective. Water is one of the most important precious resources found on the earth, and are most often affected by anthropogenic activities and by industry. Pollution caused by human beings and industries is a serious concern throughout the world. Population growth, massive urbanization, rapid rate of industrialization and modern techniques in agriculture have accelerated water pollution and led to the gradual deterioration of its quality. A large quantity of waste water disposed of at sea or on land has caused environmental problems which have led to environmental pollution, economic losses and chemical risks caused by the wastewater, and its impact on agriculture. However, waste water which contain nutrients and organic matter has possible advantages for agricultural purposes. Therefore, the presented study was undertaken to assess the impact of Dairy Effluent (treated and untreated waste water on seed germination, seedling growth, dry matter production and the biochemical parameters of lady’s fingers ([i]Abelmoschus esculentus[/i] L.. Materials and methods. A field experiment in a green house was conducted to use raw and treated dairy wastewater for watering lady’s fingers (Abelmoschus esculentus L.. The plants were watered using (WW raw dairy wastewater, (T1 chemicals treatment, (T2 physical treatment, (T3 dilution method treatment and tap water (TW in pot experiments. Ten plants of each treatment /3 replicate were randomly selected and labelled for the collection of data. The data was collected sequentially, starting with chlorophyll content pre-harvest, vegetative qualities (shoot, root and seedling length and dry matter quality (shoot and root dry matter pos-tharvest. Results. The effect was seen on the germination seed and growth of the plant. The results showed inhibitory effect from dairy effluent (WW on seed germination and plant growth. Treatment with chemicals showed statistically significant differences with

Evidence for Integrity of Parental Genomes in the Diploid Hybridogenetic Water Frog Pelophylax esculentus by Genomic in situ Hybridization

Czech Academy of Sciences Publication Activity Database

Zalésna, A.; Choleva, Lukáš; Ogielska, M.; Rábová, Marie; Marec, František; Ráb, Petr

2011-01-01

Roč. 134, č. 3 (2011), s. 206-212 ISSN 1424-8581 R&D Projects: GA MŠk LC06073; GA ČR GA523/09/2106 Institutional research plan: CEZ:AV0Z50450515; CEZ:AV0Z50070508 Keywords : Amphibia * Chromosomes * Genomic in situ hybridization (GISH) Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.533, year: 2011

Antiadhesive Properties of Abelmoschus esculentus (Okra) Immature Fruit Extract against Helicobacter pylori Adhesion

Science.gov (United States)

Shevtsova, Anna; Glocker, Erik; Borén, Thomas; Hensel, Andreas

2014-01-01

Background Traditional Asian and African medicine use immature okra fruits (Abelmoschus esculentus) as mucilaginous food to combat gastritis. Its effectiveness is due to polysaccharides that inhibit the adhesion of Helicobacter pylori to stomach tissue. The present study investigates the antiadhesive effect in mechanistic detail. Methodology A standardized aqueous fresh extract (Okra FE) from immature okra fruits was used for a quantitative in vitro adhesion assay with FITC-labled H. pylori J99, 2 clinical isolates, AGS cells, and fluorescence-activated cell sorting. Bacterial adhesins affected by FE were pinpointed using a dot-blot overlay assay with immobilized Lewisb, sialyl-Lewisa, H-1, laminin, and fibronectin. 125I-radiolabeled Okra FE polymer served for binding studies to different H. pylori strains and interaction experiments with BabA and SabA. Iron nanoparticles with different coatings were used to investigate the influence of the charge-dependence of an interaction on the H. pylori surface. Principal findings Okra FE dose-dependently (0.2 to 2 mg/mL) inhibited H. pylori binding to AGS cells. FE inhibited the adhesive binding of membrane proteins BabA, SabA, and HpA to its specific ligands. Radiolabeled compounds from FE bound non-specifically to different strains of H. pylori, as well as to BabA/SabA deficient mutants, indicating an interaction with a still-unknown membrane structure in the vicinity of the adhesins. The binding depended on the charge of the inhibitors. Okra FE did not lead to subsequent feedback regulation or increased expression of adhesins or virulence factors. Conclusion Non-specific interactions between high molecular compounds from okra fruits and the H. pylori surface lead to strong antiadhesive effects. PMID:24416297

Combined effects of Psoralens and ultraviolet-B on growth, pigmentation and biochemical parameters of Abelmoschus esculentus L.

Science.gov (United States)

Kumari, Rima; Singh, Suruchi; Agrawal, S B

2009-05-01

The effects of pre-treatment of Psoralens (furocoumarin compounds) and supplemental ultraviolet-B (sUV-B) were studied on plant growth, photosynthetic and non-photosynthetic pigments, protein, phenylalanine ammonia lyase (PAL) activity and antioxidative defense potential as well as their ultimate effects on biomass production in Abelmoschus esculentus L. (Okra) plants. Psoralens are capable of absorbing radiant energy and stimulating the pigmentation of human skin when photo-activated in presence of UV-A or UV-B making them beneficial in the treatment of vitilago. Pre-treatment of Psoralens against sUV-B (pUV-B), stimulates higher production of UV-B protective pigments (flavonoids and carotenoids) and helps in maintaining its biomass against UV-B stress. Antioxidative defense system in the test plant was activated by combined treatment of Psoralens and sUV-B as evidenced by the enhanced activity of enzymatic (ascorbate peroxidase-APX, superoxide dismutase-SOD, POX) and non-enzymatic (ascorbic acid and phenol) antioxidants. Individual treatments of Psoralens and sUV-B showed inhibitory effect on various morphological traits i.e. reduction in plant height, leaf area and ultimately on biomass production. Our results clearly indicated that adverse effect of sUV-B on biomass production was ameliorated by pre- treatment with Psoralens.

Interaction between Galactomyces geotrichum KL20B, Lactobacillus plantarum LAT3 and Enterococcus faecalis KE06 during Milk Fermentation

Directory of Open Access Journals (Sweden)

Clemencia Chaves-López

2017-10-01

Full Text Available Microbial interactions are fundamental during milk fermentation, determining the product final characteristics. Galactomyces geotrichum, Lactobacillus plantarum and Enterococcus faecalis are among the most common microorganisms in the Colombian Kumis. The aim of the research was to evaluate the yeast–bacteria interactions in milk fermentation at 28 °C. UHT (Ultra-High Temperature milk was inoculated with single- or multiple-strains associations and analysed periodically to determine the microbial counts, organic acids and total free amino acids (FAA. The results evidenced different growth performance of the strains in single or co-culture, with a positive effect of G. geotrichum KL20B on the lactic acid bacteria (LAB growth performance. All the strains consumed citric acid after 6 h of incubation with E. faecalis KE06 as the major consumer; however, all the co-cultures showed an early metabolism of citrate but with a low intake rate. In addition, the interaction between G. geotrichum KL20B and E. faecalis KE06 led to a low accumulation of acetic acid. Formic acid fluctuated during fermentation. The strains interaction also led to an increase in ethanol content and a lower accumulation of FAA. In conclusion, the three strains co-culture enhances the LAB viability, with high production of lactic acid and ethanol, as a consequence of adaptation to the environment and substrate exploitation. To our knowledge, this is the first time in which it is showed that G. geotrichum KL20B could be used to compensate for the slow acid-producing ability of Lb. plantarum and E. faecalis in milk, underlining that this consortium applies some mechanisms to regulate the growth and milk composition in acids and ethanol content.

Eğirdir orman fidanlığı’nda diken ardıcı (Juniperus oxycedrus fidan yetiştirme sıklığının fidan morfolojisine etkileri

Directory of Open Access Journals (Sweden)

Esra ALIM

2017-07-01

Full Text Available Bu çalışmada, farklı yetiştirme sıklıklarının diken ardıcı (Juniperus oxycedrus L. subsp. oxycedrus’nın (1+0 çıplak köklü fidanlarının morfolojik özellikleri üzerindeki etkilerini ortaya koymak amaçlanmıştır. Araştırma Eğirdir Orman Fidanlığında kurulan deneme alanlarında yürütülmüştür. Denemede; 1.5 cm, 3 cm, 6 cm ve 9 cm mesafe olacak şekilde kontrol dâhil 5 farklı yetiştirme sıklığı uygulanmıştır. Araştırma sonuçlarına göre diken ardıcı fidanlarının morfolojik özellikleri (kök boğazı çapı, yan kök sayısı, gürbüzlük indisi, kalite indisi, fidan, gövde ve kök taze ağırlıkları ile fidan, gövde ve kök kuru ağırlıkları üzerine yetiştirme sıklığının önemli etkilerinin olduğu belirlenmiştir. Ekim yastıklarında yetiştirme sıklığı azaldıkça daha kalın çaplı, gövde taze ve kuru ağırlığı daha fazla ve daha çok yan kök sayısına sahip olan fidanlar elde edilmiştir. Çalışmada, elde edilen fidanlar arasında en yüksek kök boğazı çapı ve yan kök sayısı kontrol dışındaki ekim sıklıklarından elde edilen fidanlarda olduğu tespit edilmiştir. Fidan ağırlıkları bakımından ise en iyi sonucu 3 cm ekim sıklığı verirken, en düşük sonuç kontrol fidanlarında meydana gelmiştir. Eğirdir Orman Fidanlığı koşullarında 3 cm ekim sıklığının uygulanmasının kaliteli diken ardıcı fidan üretimi için yeterli olacağı düşünülmektedir.

Herschel Observations of Extraordinary Sources: Analysis of the HIFI 1.2 THz Wide Spectral Survey toward Orion KL. I. Methods

NARCIS (Netherlands)

Crockett, Nathan R.; Bergin, Edwin A.; Neill, Justin L.; Favre, Cécile; Schilke, Peter; Lis, Dariusz C.; Bell, Tom A.; Blake, Geoffrey; Cernicharo, José; Emprechtinger, Martin; Esplugues, Gisela B.; Gupta, Harshal; Kleshcheva, Maria; Lord, Steven; Marcelino, Nuria; McGuire, Brett A.; Pearson, John; Phillips, Thomas G.; Plume, Rene; van der Tak, Floris; Tercero, Belén; Yu, Shanshan

We present a comprehensive analysis of a broadband spectral line survey of the Orion Kleinmann-Low nebula (Orion KL), one of the most chemically rich regions in the Galaxy, using the HIFI instrument on board the Herschel Space Observatory. This survey spans a frequency range from 480 to 1907 GHz at

Toros sedirinde yetiştirme sıklığının fidan morfolojik özellikleri ve beslenme durumuna etkisi

Directory of Open Access Journals (Sweden)

Dr. Şükrü Teoman GÜNER

2018-03-01

Full Text Available Bu çalışmanın amacı, fidanlık koşullarında yetiştirme sıklığının 2+0 yaşlı Toros sediri (Cedrus libani fidanlarının bazı morfolojik özellikleri ile beslenme durumu üzerine etkisini araştırmaktır. Araştırmada, Isparta-Kapıdağ orijinli tohumlar kullanılmıştır. Eskişehir Orman Fidanlığı’nda 1,2 m genişliğindeki yüksek yastıklara, 15 cm aralıklarla oluşturulan 7 ekim çizgisinde, kontrol ( ̴ 1,5; 2,5; 5,0; 7,5; 10,0 cm mesafe ile yetiştirilen fidanların bazı morfolojik özellikleri ile ibre, gövde ve kök besin elementi içerikleri belirlenmiştir. Denemede rastlantı parselleri deneme deseni kullanılmıştır. Veriler varyans analizi, Duncan testi ve korelasyon analizi ile değerlendirilmiştir. Yetiştirme sıklığı fidan boyu (FB, kök boğazı çapı (KBÇ, FB/KBÇ oranı, sak taze ağırlığı, kök taze ağırlığı, fidan taze ağırlığı, sak kuru ağırlığı (SKA, kök kuru ağırlığı (KKA, fidan kuru ağırlığı (FKA, SKA/KKA oranı ve kök yüzdesini (KKA/FKA oranı önemli derecede etkilemiştir. İncelenen fidan morfolojik özellikleri arasında önemli ilişkiler belirlenmiştir. Fidanların sahip olduğu toplam N, P, K, Ca, Mg, Na, Fe, Zn, Cu ve Mn içeriği bakımından yetiştirme sıklıkları arasındaki farklılıklar önemli (P<0,001 bulunmuştur. Yetiştirme sıklığı azaldıkça fidanların toplam besin elementi içeriği artmıştır. Farklı sıklık derecelerinde yetiştirilen fidanların topraktan kaldırdığı besin stokları arasında anlamlı farklılıklar belirlenmiş, sıklığının azalması ile fidanların birim alandan kaldırdığı besin stokları azalmıştır. Bütün bulgular birlikte değerlendirildiğinde, kurak-yarı kurak alan ağaçlandırmalarında fidanlıkta 2,5 cm mesafeyle (232 fidan/m2; yarı nemli-nemli alan ağaçlandırmalarında ise 7,5 cm mesafeyle (77 fidan/m2 fidan yetiştirmenin uygun olacağı düşünülmektedir.

On the occurrence and identity of triploids of Rana kl. esculenta Linnaeus and R. lessonae Camerano in The Netherlands (Anura: Ranidae)

NARCIS (Netherlands)

Blommers-Schlösser, Rose M.A.

1990-01-01

According to electrophoresis and erythrocyte size the genotypes of 756 waterfrogs, collected during 1986—1988 in 54 localities in The Netherlands, were classified as belonging to 5 different genotypes: 331 diploid R. lessonae (LL), 5 triploid R. lessonae (LLL), 250 diploid R. kl. esculenta (LR), 133

Carly L. Crouch & Jonathan Stökl (eds.: In the Name of God. The Bible in the Colonial Discourse of Empire

Directory of Open Access Journals (Sweden)

Judith Becker

2015-11-01

Full Text Available This contribution offers a review of Carly L. Crouch & Jonathan Stökl (eds.: In the Name of God. The Bible in the Colonial Discourse of Empire, Biblical Interpretation Series 126. Leiden: Brill, 2014. viii and 192 pages, € 98, ISBN 978-900-425-8334.

Biological removal of nickel (II by Bacillus sp. KL1 in different conditions: optimization by Taguchi statistical approach

Directory of Open Access Journals (Sweden)

Taran Mojtaba

2015-09-01

Full Text Available Bioremediation is the removal of heavy-metals such as nickel (Ni using microorganisms and has been considered as an important field in the biotechnology. Isolation and characterization of microorganisms exhibiting bioremediation activities and their optimization to treat polluted wastewaters is a vital and difficult task in remediation technologies. In this study, investigation was carried out to isolate Ni (II remediating microbial strains from soils contaminated with municipal solid waste leachate. Furthermore, Taguchi design of experiments were used to evaluate the influence of concentration, pH, temperature, and time on bioremediation of Ni (II using isolated bacteria. This study concluded that Bacillus sp. KL1 is a Ni (II-resistant strain and had Ni (II bioremediation activity. The highest bioremediation of Ni (II was observed as 55.06% after 24 h at 30ºC, pH 7, and 100 ppm concentration. Moreover, it was also observed that concentration is the most effective factor in the bioremediation process. In conclusion, we have demonstrated that bacteria isolated from soils contaminated with garbage leachate have the Bacillus sp. KL1 bacteria which can efficiently uptake and eliminate Ni (II from contaminated sites and thus makes it possible to treat heavy-metal containing wastewaters in industry by using this microorganism at optimized conditions.

Multiple ionization effects in atomic collisions in the K-L matching region

International Nuclear Information System (INIS)

Piticu, I.; Ciortea, C.; Dumitriu, D.; Enulescu, A.; Fluerasu, D.; Szilagyi, S.Z.; Zoran, V.; Bucur, B.I.

1994-01-01

The multiple ionization effect in the determination of 3dσ vacancy production cross sections and sharing probabilities in asymmetric quasimolecular collisions near K-L level matching, for the collision systems Fe, Co, Ni, and Cu + Bi in the energy range 0.25 - 1.75 MeV/u have been studied. The experimental energy and intensity shifts of some projectile and target X-ray lines, as well as Dirac-Hartree-Fock calculations, have been used to estimate average single particle probabilities for multiple ionization of projectile L- and target M-shells. Using these estimates and a standard procedure, the experimental 3dσ vacancy production cross sections and sharing probabilities have been corrected for multiple ionization. The influence of the multiple ionization-induced increase in binding energy of the molecular orbitals implied in vacancy sharing is discussed. (Author)

Deletion of the Glucose-6-Phosphate Dehydrogenase Gene KlZWF1 Affects both Fermentative and Respiratory Metabolism in Kluyveromyces lactis▿

Science.gov (United States)

Saliola, Michele; Scappucci, Gina; De Maria, Ilaria; Lodi, Tiziana; Mancini, Patrizia; Falcone, Claudio

2007-01-01

In Kluyveromyces lactis, the pentose phosphate pathway is an alternative route for the dissimilation of glucose. The first enzyme of the pathway is the glucose-6-phosphate dehydrogenase (G6PDH), encoded by KlZWF1. We isolated this gene and examined its role. Like ZWF1 of Saccharomyces cerevisiae, KlZWF1 was constitutively expressed, and its deletion led to increased sensitivity to hydrogen peroxide on glucose, but unlike the case for S. cerevisiae, the Klzwf1Δ strain had a reduced biomass yield on fermentative carbon sources as well as on lactate and glycerol. In addition, the reduced yield on glucose was associated with low ethanol production and decreased oxygen consumption, indicating that this gene is required for both fermentation and respiration. On ethanol, however, the mutant showed an increased biomass yield. Moreover, on this substrate, wild-type cells showed an additional band of activity that might correspond to a dimeric form of G6PDH. The partial dimerization of the G6PDH tetramer on ethanol suggested the production of an NADPH excess that was negative for biomass yield. PMID:17085636

FT-IR spectroscopic and thermodynamic study on the adsorption of carbon dioxide and dinitrogen in the alkaline zeolite K-L

International Nuclear Information System (INIS)

Arean, C.O.; Bibiloni, G.F.; Delgado, M.R.

2012-01-01

Highlights: ► Variable temperature IR spectroscopy is used to study adsorption of CO 2 and N 2 in the alkaline zeolite K-L. ► By simultaneously recording IR absorbance, temperature and equilibrium pressure, standard adsorption enthalpy and entropy for each gas was determined. ► The results are discussed in the broader context of gas separation using zeolites; focusing on carbon dioxide capture. - Abstract: The thermodynamics of carbon dioxide and dinitrogen adsorption on the zeolite K-L was investigated by means of variable temperature IR spectroscopy, a technique that affords determination of standard adsorption enthalpy (ΔH°) and entropy (ΔS°) from analysis of IR spectra recorded over a temperature range while simultaneously measuring equilibrium pressure inside a closed IR cell. ΔH° resulted to be −42.5 and −20.6 kJ mol −1 for CO 2 and N 2 , respectively. Corresponding values of ΔS° were found to be −182 and −151 J mol −1 K −1 . The obtained adsorption enthalpy values are discussed in the context of carbon dioxide capture and sequestration.

The KL24 gene cluster and a genomic island encoding a Wzy polymerase contribute genes needed for synthesis of the K24 capsular polysaccharide by the multiply antibiotic resistant Acinetobacter baumannii isolate RCH51.

Science.gov (United States)

Kenyon, Johanna J; Kasimova, Anastasiya A; Shneider, Mikhail M; Shashkov, Alexander S; Arbatsky, Nikolay P; Popova, Anastasiya V; Miroshnikov, Konstantin A; Hall, Ruth M; Knirel, Yuriy A

2017-03-01

The whole-genome sequence of the multiply antibiotic resistant Acinetobacter baumannii isolate RCH51 belonging to sequence type ST103 (Institut Pasteur scheme) revealed that the set of genes at the capsule locus, KL24, includes four genes predicted to direct the synthesis of 3-acetamido-3,6-dideoxy-d-galactose (d-Fuc3NAc), and this sugar was found in the capsular polysaccharide (CPS). One of these genes, fdtE, encodes a novel bifunctional protein with an N-terminal FdtA 3,4-ketoisomerase domain and a C-terminal acetyltransferase domain. KL24 lacks a gene encoding a Wzy polymerase to link the oligosaccharide K units to form the CPS found associated with isolate RCH51, and a wzy gene was found in a small genomic island (GI) near the cpn60 gene. This GI is in precisely the same location as another GI carrying wzy and atr genes recently found in several A. baumannii isolates, but it does not otherwise resemble it. The CPS isolated from RCH51, studied by sugar analysis and 1D and 2D 1H and 13C NMR spectroscopy, revealed that the K unit has a branched pentasaccharide structure made up of Gal, GalNAc and GlcNAc residues with d-Fuc3NAc as a side branch, and the K units are linked via a β-d-GlcpNAc-(1→3)-β-d-Galp linkage formed by the Wzy encoded by the GI. The functions of the glycosyltransferases encoded by KL24 were assigned to formation of specific bonds. A correspondence between the order of the genes in KL24 and other KL and the order of the linkages they form was noted, and this may be useful in future predictions of glycosyltransferase specificities.

Lactococcus lactis Subsp. Lactis Suşlarında Yüksek Sıklıkta Konjugal Transfer Sistemlerinin Analizi

Directory of Open Access Journals (Sweden)

Çağla Tükel

2015-02-01

Full Text Available Bu çalışmada L. lactis subsp. lactis suşlarında laktoz fermentasyonu özelliğini kodlayan altı farklı plazmidin yüksek sıklıkta konjugal aktarım yeteneği araştırıldı. Bu plazmidlerin konjugal transfer sıklıkları; iki seks faktörünün interaksiyonuna bağlı olarak (Clu ve Agg, Clu-/Agg-, Agg+ x Clu-/Agg+, Agg- ya da Clu+/Agg- x Clu-/Agg- konjugasyon eşleri için 1.5x10-5–1.0x10-7 ve Clu+/Agg- x Clu-/Agg+ konjugasyon eşleri için 7.1x10-2-2.7x10-3 oranlarında değişim gösterdi. Laktoz plazmidlerinin stabiliteleri ise; doğal suşlarda %82-96, MG1390 alıcı suşu için tanımlanan konjugantlarda %77-98 ve MCL8060 alıcı suşu için tanımlanan konjugantlarda ise %44-67 arasında saptandı.

Vzpomínky prof. Arnošta Klímy na Mezinárodní kongres historiků ve Stockholmu v roce 1960 (Fragment z dosud nepublikovaných vzpomínek historika)

OpenAIRE

Myška, Milan

2013-01-01

The edition of the fragment of the reminiscences of the Czech economic historian Prof. Arnošt Klíma about the participation of Czech and Slovak historians at the World Economic History Congress in Stockholm in 1960. Within the frame of the so-called great themes, an only major report entrusted to East European historians was presented by Macůrek and Klíma – a report about the transition from feudalism to capitalism. On the eve of the congress was held the first international meeting of econom...

Is trace element concentration correlated to parasite abundance? A case study in a population of the green frog Pelophylax synkl. hispanicus from the Neto River (Calabria, southern Italy).

Science.gov (United States)

De Donato, Carlo; Barca, Donatella; Milazzo, Concetta; Santoro, Raffaella; Giglio, Gianni; Tripepi, Sandro; Sperone, Emilio

2017-06-01

Bioaccumulation of 13 trace elements in the livers of 38 Pelophylax sinkl. hispanicus (Ranidae) and its helminth communities were studied and compared among three sites, each with a different degree of pollution along River Neto (south Italy) during September, 2014. Trace element concentrations in water and liver were measured using inductively coupled plasma mass spectrometry. For most elements, the highest concentration was recorded in the frogs inhabiting the third site, the one with the highest degree of pollution. The trend of trace element concentration in the liver can be represented as follows: Cu > Zn > Mn > Se > Cr. Concentrations of some elements in water and liver samples were significantly different among the three sites and this is evidenced by the bioaccumulation in the frogs. Four species of helminths, all belonging to Nematoda, were found: Rhabdias sp., Oswaldocruzia filiformis (Goeze, 1782), Cosmocerca ornata (Dujarden, 1845), Seuratascaris numidica (Seurat, 1917). The parasite survey presents an important difference of prevalence and average number of helminths in frogs between the three sites. Correlating parasitological and ecotoxicological data showed a strong positive correlation between prevalence and number of parasites with some trace elements such as Mn, Co, Ni, As, Se, and Cd.

International Conference in Honour of L. Bittner and R. Klötzler

CERN Document Server

Heier, Knut; Bittner, Leonhard; Bulirsch, Roland

1998-01-01

The 12th conference on "Variational Calculus, Optimal Control and Applications" took place September 23-27, 1996, in Trassenheide on the Baltic Sea island of Use­ dom. Seventy mathematicians from ten countries participated. The preceding eleven conferences, too, were held in places of natural beauty throughout West Pomerania; the first time, in 1972, in Zinnowitz, which is in the immediate area of Trassenheide. The conferences were founded, and led ten times, by Professor Bittner (Greifswald) and Professor KlCitzler (Leipzig), who both celebrated their 65th birthdays in 1996. The 12th conference in Trassenheide, was, therefore, also dedicated to L. Bittner and R. Klotzler. Both scientists made a lasting impression on control theory in the former GDR. Originally, the conferences served to promote the exchange of research results. In the first years, most of the lectures were theoretical, but in the last few conferences practical applications have been given more attention. Besides their pioneering theoretical...

Kløvergræs på økologiske kvægbrug. OrgGrass 2007-2010

DEFF Research Database (Denmark)

Eriksen, Jørgen; Hansen, Lars Monrad; Askegaard, Margrethe

2009-01-01

På økologiske brug er kløvergræs essentiel for dyrevelfærd, foderforsyning og opbygning af jordens frugtbarhed. Det er i stigende grad store bedrifter med mange køer, som præger billedet i økologisk mælkeproduktion. Det fører til meget græs i sædskiftet tæt på stalden for at reducere den afstand,...... problemstillinger. I markforsøg undersøges strategier for sammensætning af sædskifter og management i græsmarker. Helt konkret arbejdes der med ind- og udmarkssædskifter. Udgivelsesdato: 2008-10-29...

The nutraceutical benefits of subfractions of Abelmoschus esculentus in treating type 2 diabetes mellitus.

Directory of Open Access Journals (Sweden)

Chien-Ning Huang

Full Text Available Abelmoschus esculentus (AE, a commonly consumed vegetable, is well-known for its anti-hyperglycemic effects. However, few scientific reports have identified its targets because mucilage increases the difficulty of manipulation. We recently reported extraction steps to obtain subfractions of AE, which were found to attenuate the adverse effects of high glucose and fatty acid in vitro. In this study, we used modified extraction steps and type 2 diabetic rats to explore whether AE subfractions can improve the metabolic disturbances caused by insulin resistance in vivo. AE subfractions (F1, F2, and FR were prepared. The type 2 diabetes model was induced by feeding male Sprague-Dawley rats with a high-fat diet and injecting them with 35 mg/kgbw streptozotocin when their body weight reached 475 ± 15 g. After a hyperglycemic status had been confirmed, the rats were tube-fed with or without different doses of AE subfractions. Serum glucose, lipid markers, insulin, HbA1c and HOMA-IR were measured in the following 12 weeks. Serum glucose promptly increased and insulin resistance was noted in the diabetic rats (glucose: 360-500 mg/dl, HOMA-IR 9.8-13.8. F2, rich in polysaccharides and carbohydrates, was most effective in attenuating hyperglycemia and insulin resistance (glucose: 200 mg/dl; HOMA-IR: 5.3 and especially HbA1C (from 8.0% to 6.5%. All of the AE subfractions lowered the level of triglycerides and free fatty acid, but not the level of total cholesterol. FR significantly increased the high-density lipoprotein/low-density lipoprotein ratio, indicating its benefits for lipoprotein profiles. While F2 and FR were associated with weight gain, F1 possessed an anti-obese effect. In conclusion, whether it is consumed as a vegetable or as a nutraceutical, AE has the potential to be an adjuvant therapy for diabetes. AE subfractions could be developed individually and deserve further investigation.

Klüver–Bucy syndrome associated with a recessive variant in HGSNAT in two siblings with Mucopolysaccharidosis type IIIC (Sanfilippo C)

OpenAIRE

Hu, Hao; Hübner, Christoph; Lukacs, Zoltan; Musante, Luciana; Gill, Esther; Wienker, Thomas F; Ropers, Hans-Hilger; Knierim, Ellen; Schuelke, Markus

2016-01-01

Klüver–Bucy syndrome (KBS) comprises a set of neurobehavioral symptoms with psychic blindness, hypersexuality, disinhibition, hyperorality, and hypermetamorphosis that were originally observed after bilateral lobectomy in Rhesus monkeys. We investigated two siblings with KBS from a consanguineous family by whole-exome sequencing and autozygosity mapping. We detected a homozygous variant in the heparan-α-glucosaminidase-N-acetyltransferase gene (HGSNAT; c.518G>A, p.(G173D), NCBI ClinVar RCV000...

Hexadactyly case at a Rana kl. esculenta sample from the north-western part of Romania (Short Notes

Directory of Open Access Journals (Sweden)

Istvan SAS

2006-05-01

Full Text Available At 17 June 2006, in a habitat close to Gherta Mica locality (47°56'0'' N, 23°14'0'' E, Satu-Mare County, Romania we had found a sample of Rana kl. esculenta which presented hexadactyly at both of its posterior feet. The captured sample of edible frog had fully formed extra (sixth toes, with phalanges (bones. The hexadactyly was perfectly symmetrical at both of the posterior feet. At this individual we did not discovered any other malformations, the biometrical characters situating in the variations limits of the other green frogs from the studied habitat. A symmetric hexadacytly can be a result of atavism.

Tolerance of chufa (Cyperus esculentus) as a vegetation unit's representative of bioregenerative life support systems to elevated temperatures

Science.gov (United States)

Shklavtsova, Ekaterina; Ushakova, Sofya; Shikhov, Valentin; Kudenko, Yurii

Plants inclusion in the photosynthesizing unit of bioregenerative life support systems (BLSS) expects knowledge of both production characteristics of plants cultivated under optimal condi-tions and their tolerance to stress-factors' effect caused by contingency origination in a system. The work was aimed at investigation of chufa (Cyperus esculentus) tolerance to the effect of super optimal air temperature of 44 subject to PAR intensity and exposure duration. Chufa was grown in light culture conditions by hydroponics method on expanded clay aggregate. The Knop solution was used as nutrition medium. Up to 30 days the plants were cultivated at the intensity of 690 micromole*m-2*s*-1 and air temperature of 25. Heat shock was employed at the age of 30 days under the air temperature of 44 during 7, 20 and 44 hours at two different PAR intensities of 690 and 1150 micromole*m-2*s*-1. Chufa heat tolerance was estimated by intensity of external 2 gas exchange and by state of leaves' photosynthetic apparatus (PSA). Effect of disturbing temperature during 44 hours at PAR intensity of 690 micromole*m-2*s*-1 resulted in frozen-in damage of PSA-leaves' die-off. Chufa plants exposed to heat stress at PAR intensity of 690 micromole*m-2*s*-1 during both 7 and 20-hours demonstrated respiration dominance over photosynthesis; and 2 emission was observed by light. Functional activity of photosynthetic apparatus estimated with respect to parameters of pulse-amplitude-modulated chlorophyll fluorescence of photosystem 2 (PS 2) decreased on 40

Bitki Sıklığının İki Farklı Kişniş (Coriandrum sativum L. Çeşidinde Verim ve Verim Unsurları Üzerine Etkisinin Belirlenmesi

Directory of Open Access Journals (Sweden)

Duran Katar

2016-05-01

Full Text Available Çalışma; çeşitlerin ve bitki sıklığının kişniş (Coriandrum sativum L. bitkisinin verim, verim unsurları ve uçucu yağ verimi üzerine etkisini belirlemek amacıyla; 2012 ve 2013 yıllarında Eskişehir Osmangazi Üniversitesi Ziraat Fakültesi Tarla Bitkileri Bölümü deneme tarlasında, Tesadüf Bloklarında Faktöriyel Deneme Desenine göre 8 uygulama ve 3 tekerrürlü olarak yürütülmüştür. Faktörler; çeşitler (Arslan ve Gürbüz ve 4 farklı bitki sıklığı (20, 30, 40 ve 50 bitki m-2’dır. Çalışma sonuçları; Arslan çeşidine kıyasla Gürbüz çeşidinden daha yüksek bitki boyu, uçucu yağ oranı ve uçucu yağ verimi elde edildiğini göstermiştir. Ayrıca bitki sıklığı değerlendirmeye alınan özelliklerin tümü üzerinde önemli etkiler göstermiştir. Maksimum bitki boyu, uçucu yağ oranı ve uçucu yağ verimi 50 bitki m-2; en yüksek bitki başına şemsiye sayısı, 1000 tohum ağırlığı ve tohum verimi sırasıyla 20, 30 ve 40 bitki m-2 bitki sıklıklarından elde edilmiştir.

Amino acid, mineral and fatty acid content of pumpkin seeds (Cucurbita spp) and Cyperus esculentus nuts in the Republic of Niger.

Science.gov (United States)

Glew, R H; Glew, R S; Chuang, L-T; Huang, Y-S; Millson, M; Constans, D; Vanderjagt, D J

2006-06-01

Dried seeds and nuts are widely consumed by indigenous populations of the western Sahel, especially those who inhabit rural areas. In light of the need for quantitative information regarding the content of particular nutrients in these plant foods, we collected dried pumpkin (Cucurbita spp) seeds and nuts of Cyperus esculentus in the Republic of Niger and analyzed them for their content of essential amino acids, minerals and trace elements, and fatty acids. On a dry weight basis, pumpkin seed contained 58.8% protein and 29.8% fat. However, the lysine score of the protein was only 65% relative to the FAO/WHO protein standard. The pumpkin seed contained useful amounts of linoleic (92 microg/g dry weight) and the following elements (on a microg per g dry weight basis): potassium (5,790), magnesium (5,690), manganese (49.3), zinc (113), selenium (1.29), copper (15.4), chromium (2.84), and molybdenum (0.81), but low amounts of calcium and iron. Except for potassium (5,573 microg/g dry weight) and chromium (2.88 microg/g dry weight), the C. esculentis nuts contained much less of these same nutrients compared to pumpkin seeds. In conclusion, pumpkin seeds represent a useful source of many nutrients essential to humans. The data in this report should of practical value to public health officials in rural areas of sub-Saharan Africa.

Digital Clubbing Is Associated with Higher Serum KL-6 Levels and Lower Pulmonary Function in Patients with Interstitial Lung Disease

Directory of Open Access Journals (Sweden)

Kazushige Shiraishi

2018-01-01

Full Text Available Background. Although digital clubbing is a common presentation in patients with interstitial lung disease (ILD, little has been reported regarding its role in assessing patients with ILD. This study evaluated patients with ILD for the presence of clubbing and investigated its association with clinical data. Methods. We evaluated patients with ILD who visited the teaching hospital at which the study was conducted, between October 2014 and January 2015. Clubbing, evaluated using a Vernier caliper for individual patients, was defined as a phalangeal depth ratio > 1. We examined the association of clubbing with clinical data. Results. Of 102 patients with ILD, we identified 17 (16.7% with clubbing. The partial pressure of oxygen in arterial blood was lower (65.2 ± 5.9 mmHg versus 80.2 ± 3.1 mmHg; p=0.03, serum Krebs von den Lugen-6 (KL-6 levels were higher (1495.0 ± 277.4 U/mL versus 839.1 ± 70.2 U/mL; p=0.001, and the percent predicted diffusing capacity of carbon monoxide was lower (50.0 ± 6.0 versus 73.5 ± 3.1; p=0.002 in these patients with clubbing. Conclusions. Patients with clubbing had lower oxygen levels, higher serum KL-6 levels, and lower pulmonary function than those without clubbing.

A direct test of time-reversal symmetry in the neutral K meson system with KS → πℓν and KL → 3π0 at KLOE-2

Directory of Open Access Journals (Sweden)

Gajos Aleksander

2014-01-01

Full Text Available Quantum entanglement of K and B mesons allows for a direct experimental test of time-reversal symmetry independent of CP violation. The T symmetry can be probed by exchange of initial and final states in the reversible transitions between flavor and CP- definite states of the mesons which are only connected by the T conjugation. While such a test was successfully performed by the BaBar experiment with neutral B mesons, the KLOE-2 detector can probe T -violation in the neutral kaons system by investigating the process with KS → π±l∓νl and KL → 3π0 decays. Analysis of the latter is facilitated by a novel reconstruction method for the vertex of KL → 3π0 decay which only involves neutral particles. Details of this new vertex reconstruction technique are presented as well as prospects for conducting the direct T symmetry test at the KLOE-2 experiment.

20-25 Yaş Arası Sağlıklı Gençlerde Gri ve Beyaz Cevher Hacimlerinin İncelenmesi: Planimetrik Çalışma

OpenAIRE

ÇAMURDANOĞLU, Niyazi ACER - Tolga ERTEKİN - Ayşegül KÜ; ACER, Niyazi; ERTEKİN, Tolga; KÜÇÜK, Ayşegül; BABAOĞLU, Cumhur; ÇANKAYA, M. Niyazi; ÇAMURDANOĞLU, Mehmet

2015-01-01

Amaç: İnsan beyninde cinsiyete ilişkin varyasyonlar birçok araştırıcı tarafından incelenmiştir. Bu çalışmaların çoğunda erkek beyin hacminin bayanlardan daha büyük olduğu bildirilmektedir. Bu çalışmanın amacı MR görüntüleri üzerinde beyaz ve gri cevher ölçümleri planimterik yöntem ile değerlendirmektir. Gereç ve Yöntemler: Bu çalışmada beyaz ve gri cevher hacimleri 20-25 yaş arası sağlıklı gençlerde incelenmiştir. T2 ağırlıklı MR görüntüleri 12 kişi üzerinde elde edilmiş, kadın ve erkeklerde ...

Searching for trans ethyl methyl ether in Orion KL.

Science.gov (United States)

Tercero, B; Cernicharo, J; López, A; Brouillet, N; Kolesniková, L; Motiyenko, R A; Margulès, L; Alonso, J L; Guillemin, J-C

2015-10-01

We report on the tentative detection of trans ethyl methyl ether (tEME), t-CH 3 CH 2 OCH 3 , through the identification of a large number of rotational lines from each one of the spin states of the molecule towards Orion KL. We also search for gauche-trans-n-propanol, Gt-n-CH 3 CH 2 CH 2 OH, an isomer of tEME in the same source. We have identified lines of both species in the IRAM 30 m line survey and in the ALMA Science Verification data. We have obtained ALMA maps to establish the spatial distribution of these species. Whereas tEME mainly arises from the compact ridge component of Orion, Gt-n-propanol appears at the emission peak of ethanol (south hot core). The derived column densities of these species at the location of their emission peaks are ≤(4.0 ± 0.8) × 10 15 cm -2 and ≤(1.0 ± 0.2)× 10 15 cm -2 for tEME and Gt-n-propanol, respectively. The rotational temperature is ~100 K for both molecules. We also provide maps of CH 3 OCOH, CH 3 CH 2 OCOH, CH 3 OCH 3 , CH 3 OH, and CH 3 CH 2 OH to compare the distribution of these organic saturated O-bearing species containing methyl and ethyl groups in this region. Abundance ratios of related species and upper limits to the abundances of non-detected ethers are provided. We derive an abundance ratio N (CH 3 OCH 3 )/ N (tEME) ≥ 150 in the compact ridge of Orion.

Physicochemical, functional and pasting properties of flour produced from gamma irradiated tiger nut (Cyperus esculentus L.)

International Nuclear Information System (INIS)

Ocloo, Fidelis C.K.; Okyere, Abenaa A.; Asare, Isaac K.

2014-01-01

Tiger nut (Cyperus esculentus L.) has been recognised as one of the best nutritional crops that can be used to augment the Ghanaian diet. The application of gamma irradiation as means of preserving tiger nut could modify the characteristics of resultant flour. The purpose of this study was to determine the physicochemical, functional and pasting characteristics of flour from gamma irradiated tiger nut. The yellow and black types of tiger nut were sorted, washed and dried in an air-oven at 60 o C for 24 h. The dried tiger nut samples were irradiated at 0.0, 2.5, 5.0 and 10.0 kGy and then flours produced from them. Moisture, ash, pH, titratable acidity, water and oil absorption capacities, swelling power, solubility, bulk density and pasting properties of the flours were determined using appropriate analytical methods. Results showed that irradiation did not significantly (P>0.05) affect the moisture and ash contents of the resultant flours. Gamma irradiation significantly (P≤0.05) increased titratable acidity with concomitant decrease in pH of the flours. No significant differences were observed for water and oil absorption capacities, swelling power as well as bulk density. Solubility significantly (P≤0.05) increased generally with irradiation dose. Peak viscosity, viscosities at 92 °C and 55 °C, breakdown and setback viscosities decreased significantly with irradiation dose. Flour produced from irradiated tiger nut has a potential in complementary food formulations due to its low viscosity and increased solubility values. - Highlights: • Physicochemical, functional and pasting characteristics of flour from gamma irradiated tiger nut were studied. • Irradiation did not affect the moisture and ash contents of the resultant flours. • Titratable acidity increased with decrease in pH of the flours from the irradiated tiger nut. • Solubility increased whereas peak viscosity decreased with irradiation dose. • Flour produced from irradiated tiger nut has a

THE PROPER MOTIONS OF THE DOUBLE RADIO SOURCE n IN THE ORION BN/KL REGION

International Nuclear Information System (INIS)

Rodríguez, Luis F.; Loinard, Laurent; Zapata, Luis; Lizano, Susana; Dzib, Sergio A.; Menten, Karl M.; Gómez, Laura

2017-01-01

We have extended the time baseline for observations of the proper motions of radio sources in the Orion BN/KL region from 14.7 to 22.5 years. We present improved determinations for the sources BN and I. In addition, we address the proper motions of the double radio source n, that have been questioned in the literature. We confirm that all three sources are moving away at transverse velocities of tens of kilometers per second from a region in-between them, where they were located about 500 years ago. Source n exhibits a new component that we interpret as due to a one-sided ejection of free–free emitting plasma that took place after 2006.36. We used the highly accurate relative proper motions between sources BN and I to determine that their closest separation took place in the year 1475 ± 6, when they were within ∼100 au or less from each other in the plane of the sky.

THE PROPER MOTIONS OF THE DOUBLE RADIO SOURCE n IN THE ORION BN/KL REGION

Energy Technology Data Exchange (ETDEWEB)

Rodríguez, Luis F.; Loinard, Laurent; Zapata, Luis; Lizano, Susana [Instituto de Radioastronomía y Astrofísica, UNAM, Apdo. Postal 3-72 (Xangari), 58089 Morelia, Michoacán, México (Mexico); Dzib, Sergio A.; Menten, Karl M. [Max Planck Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Gómez, Laura, E-mail: l.rodriguez@crya.unam.mx [Joint ALMA Observatory, Alonso de Córdoba 3107, Vitacura, Santiago (Chile)

2017-01-10

We have extended the time baseline for observations of the proper motions of radio sources in the Orion BN/KL region from 14.7 to 22.5 years. We present improved determinations for the sources BN and I. In addition, we address the proper motions of the double radio source n, that have been questioned in the literature. We confirm that all three sources are moving away at transverse velocities of tens of kilometers per second from a region in-between them, where they were located about 500 years ago. Source n exhibits a new component that we interpret as due to a one-sided ejection of free–free emitting plasma that took place after 2006.36. We used the highly accurate relative proper motions between sources BN and I to determine that their closest separation took place in the year 1475 ± 6, when they were within ∼100 au or less from each other in the plane of the sky.

S počítačem bez myši a klávesnice

OpenAIRE

Jaroň, Lukáš

2010-01-01

V této bakalářské práci jsou popsány návrhy způsobů, jakými lze ovládat počítač bez myši a klávesnice, pouhým pohybem ruky, a uživatelských rozhraní. Dále je zde popsána teorie nástrojů použitých k vytvoření experimentálních aplikací, které simulují navržená rozhraní. A celý vývojový cyklus od analýzy problému, specifikace a implementace, až k testování vytvořené aplikace. Výsledek této práce je rozhraní, které dokáže rozpoznat osm různých pohybů ruky a použít je jako vstup do systému. In ...

Herschel CHESS discovery of the fossil cloud that gave birth to the Trapezium and Orion KL

Science.gov (United States)

López-Sepulcre, A.; Kama, M.; Ceccarelli, C.; Dominik, C.; Caux, E.; Fuente, A.; Alonso-Albi, T.

2013-01-01

Context. The Orion A molecular complex is a nearby (420 pc), very well studied stellar nursery that is believed to contain examples of triggered star formation. Aims: As part of the Herschel guaranteed time key programme CHESS, we present the discovery of a diffuse gas component in the foreground of the intermediate-mass protostar OMC-2 FIR 4, located in the Orion A region. Methods: Making use of the full HIFI spectrum of OMC-2 FIR 4 obtained in CHESS, we detected several ground-state lines from OH+, H2O+, HF, and CH+, all of them seen in absorption against the dust continuum emission of the protostar's envelope. We derived column densities for each species, as well as an upper limit to the column density of the undetected H3O+. In order to model and characterise the foreground cloud, we used the Meudon PDR code to run a homogeneous grid of models that spans a reasonable range of densities, visual extinctions, cosmic ray ionisation rates and far-ultraviolet (FUV) radiation fields, and studied the implications of adopting the Orion Nebula extinction properties instead of the standard interstellar medium ones. Results: The detected absorption lines peak at a velocity of 9 km s-1, which is blue-shifted by 2 km s-1 with respect to the systemic velocity of OMC-2 FIR 4 (VLSR = 11.4 km s-1). The results of our modelling indicate that the foreground cloud is composed of predominantly neutral diffuse gas (nH = 100 cm-3) and is heavily irradiated by an external source of FUV that most likely arises from the nearby Trapezium OB association. The cloud is 6 pc thick and bears many similarities with the so-called C+ interface between Orion-KL and the Trapezium cluster, 2 pc south of OMC-2 FIR 4. Conclusions: We conclude that the foreground cloud we detected is an extension of the C+ interface seen in the direction of Orion KL, and interpret it to be the remains of the parental cloud of OMC-1, which extends from OMC-1 up to OMC-2.

Acetylated Rhamnogalacturonans from Immature Fruits of Abelmoschus esculentus Inhibit the Adhesion of Helicobacter pylori to Human Gastric Cells by Interaction with Outer Membrane Proteins

Directory of Open Access Journals (Sweden)

Christian Thöle

2015-09-01

Full Text Available Polysaccharide containing extracts from immature fruits of okra (Abelmoschus esculentus are known to exhibit antiadhesive effects against bacterial adhesion of Helicobacter pylori (H. pylori to stomach tissue. The present study investigates structural and functional features of polymers responsible for this inhibition of bacterial attachment to host cells. Ammonium sulfate precipitation of an aqueous extract yielded two fractions at 60% and 90% saturation with significant antiadhesive effects against H. pylori, strain J99, (FE60% 68% ± 15%; FE90% 75% ± 11% inhibition rates after preincubation of the bacteria at 1 mg/mL. Sequential extraction of okra fruits yielded hot buffer soluble solids (HBSS with dose dependent antiadhesive effects against strain J99 and three clinical isolates. Preincubation of H. pylori with HBSS (1 mg/mL led to reduced binding to 3ʹ-sialyl lactose, sialylated Lea and Lex. A reduction of bacterial binding to ligands complementary to BabA and SabA was observed when bacteria were pretreated with FE90%. Structural analysis of the antiadhesive polysaccharides (molecular weight, monomer composition, linkage analysis, stereochemistry, and acetylation indicated the presence of acetylated rhamnogalacturonan-I polymers, decorated with short galactose side chains. Deacetylation of HBSS and FE90% resulted in loss of the antiadhesive activity, indicating esterification being a prerequisite for antiadhesive activity.

Contrasting effects of nitrogenous pollution on fitness and swimming performance of Iberian waterfrog, Pelophylax perezi (Seoane, 1885), larvae in mesocosms and field enclosures.

Science.gov (United States)

Egea-Serrano, A; Tejedo, M

2014-01-01

Amphibians are declining worldwide and pollutants have been implicated as a major contributor to these declines. To understand these declines, many studies have assessed the impact of pollutants on amphibian behaviour. However, information regarding their effect on locomotor abilities, as well as the intra-specific variation of the tolerance to pollutants, is extremely rare. Further, the majority of studies examining the impact of pollutants on amphibians have been conducted in simplified laboratory settings. Given the complexity of natural systems, determining whether amphibian responses in laboratory studies can be generalized to more realistic natural scenarios is critical. Towards this goal, this study assessed the impact of nitrogenous pollution on survival and fitness-related larval traits (growth, mass and swimming performance) for three populations of the frog Pelophylax perezi, exposed to different degrees of eutrophication in two different and complementary experiments: (1) pond mesocosms, with NH4Cl isolated or combined with NaNO2 and NaNO3, and (2) field enclosures placed in natural streams differing in their degree of pollution. For both mesocosm and field enclosure experiments, larval mortality was unaffected by nitrogenous pollution. However, in the mesocosm experiment, exposure to nitrogenous compounds reduced final larvae mass and growth. In contrast, in the enclosure experiment, polluted locations facilitated final mass and growth of surviving tadpoles. Population-level variation in the effect of pollution was observed for final larval mass in the mesocosm but not in the field enclosure experiment. In addition, although nitrogenous compounds in both mesocosm and natural conditions had no direct effect on absolute larval swimming performance, they may impact the viability of larvae by affecting the relationships between growth and the swimming abilities. The differential pattern found in the impacts of nitrogenous compounds on larvae of P. perezi

Polarized and unpolarized lepton pair forward-backward asymmetries in B → K{sub 0}{sup *}(1430)l{sup +}l{sup -} and B → Kl{sup +}l{sup -} decays in two-Higgs-doublet model

Energy Technology Data Exchange (ETDEWEB)

Falahati, F.; Abbasi, H. [Shiraz University, Physics Department and Biruni Observatory, College of Sciences, Shiraz (Iran, Islamic Republic of)

2016-08-15

In this paper we shall focus on the effects of concrete models such as the SM and 2HDM of type III on the polarized and unpolarized forward.backward asymmetries of B → K{sub 0}{sup *}(1430)l{sup +}l{sup -} and B → Kl{sup +}l{sup -} decays. The obtained results of these decay modes are compared to each other. Also, we obtain the minimum required number of events for detecting each asymmetry and compare it with the number of produced B anti B pairs at the LHC or supposed to be produced at the Super-LHC. At the end, we conclude that the study of these asymmetries for B → K{sub 0}{sup *}(1430)l{sup +}l{sup -} and B → Kl{sup +}l{sup -} processes are very effective tools for establishing new physics in the future B-physics experiments. (orig.)

Processing Effects on the Antioxidant Activities of Beverage Blends Developed from Cyperus esculentus, Hibiscus sabdariffa, and Moringa oleifera Extracts.

Science.gov (United States)

Badejo, Adebanjo A; Damilare, Akintoroye; Ojuade, Temitope D

2014-09-01

The discovery of bioactive compounds in foods has changed the dietary lifestyle of many people. Cyperus esculentus (tigernut) is highly underutilized in Africa, yet tigernut extract is highly profitable in Europe. This study aims to add value to tigernut extract by revealing its health benefits and food value. In this study, tigernut tubers were germinated or roasted and the extracts were combined with Moringa oleifera extract (MOE) or Hibiscus sabdariffa extract (HSE) and spiced with ginger to produce functional drinks. The drinks were evaluated for physicochemical characteristics, sensory parameters, and antioxidant potentials. The total phenolic content of each beverage was measured by the Folin-Ciocalteu method, and the antioxidant activity of each beverage was determined by the 2,2-diphenyl-1-picrylhydrazyl and 2,2'-azino-bis-3-ethylbenzothiazoline-6-sulphonic acid assays. The beverages from the germinated tigernut extracts had the highest titratable acidity and the lowest pH, while beverages containing the roasted tigernut extract had the highest ∘Brix. Germination and roasting significantly enhanced the total phenolic content of the drinks. The beverage containing HSE and germinated tigernut extract had a total phenolic content of 45.67 mg/100 mL gallic acid equivalents, which was significantly higher than the total phenolic content of all other samples. The DPPH inhibition activity of the beverages prepared with germinated tigernut extracts was significantly higher than the DPPH inhibition activity of the beverages prepared with fresh tigernut extract. The taste and overall acceptability of drinks containing the roasted tigernut extract were preferred, while the color and appearance of drinks with the germinated samples were preferred. Roasting or germinating tigernuts before extraction and addition of MOE or HSE extracts is another way to add value and enhance the utilization of tigernuts.

Processing Effects on the Antioxidant Activities of Beverage Blends Developed from Cyperus esculentus, Hibiscus sabdariffa, and Moringa oleifera Extracts

Science.gov (United States)

Badejo, Adebanjo A.; Damilare, Akintoroye; Ojuade, Temitope D.

2014-01-01

The discovery of bioactive compounds in foods has changed the dietary lifestyle of many people. Cyperus esculentus (tigernut) is highly underutilized in Africa, yet tigernut extract is highly profitable in Europe. This study aims to add value to tigernut extract by revealing its health benefits and food value. In this study, tigernut tubers were germinated or roasted and the extracts were combined with Moringa oleifera extract (MOE) or Hibiscus sabdariffa extract (HSE) and spiced with ginger to produce functional drinks. The drinks were evaluated for physicochemical characteristics, sensory parameters, and antioxidant potentials. The total phenolic content of each beverage was measured by the Folin-Ciocalteu method, and the antioxidant activity of each beverage was determined by the 2,2-diphenyl-1-picrylhydrazyl and 2,2′-azino-bis-3-ethylbenzothiazoline-6-sulphonic acid assays. The beverages from the germinated tigernut extracts had the highest titratable acidity and the lowest pH, while beverages containing the roasted tigernut extract had the highest ∘Brix. Germination and roasting significantly enhanced the total phenolic content of the drinks. The beverage containing HSE and germinated tigernut extract had a total phenolic content of 45.67 mg/100 mL gallic acid equivalents, which was significantly higher than the total phenolic content of all other samples. The DPPH inhibition activity of the beverages prepared with germinated tigernut extracts was significantly higher than the DPPH inhibition activity of the beverages prepared with fresh tigernut extract. The taste and overall acceptability of drinks containing the roasted tigernut extract were preferred, while the color and appearance of drinks with the germinated samples were preferred. Roasting or germinating tigernuts before extraction and addition of MOE or HSE extracts is another way to add value and enhance the utilization of tigernuts. PMID:25320721

Klīnisko atradņu salīdzinājums FemtoLASIK un LASIK metodēs

OpenAIRE

Bistere, Aivija

2010-01-01

Maģistra darbs ir uzrakstīts latviešu valodā uz 60 lpp. Tas satur 36 att., 1 tab., 4 pielikumus. Izmantoti 57 literatūras avoti. Darba mērķis:Novērtēt un salīdzināt klīniskos rezultātus starp metodēm, kur radzenes vāciņš lāzerķirurģijas laikā veidots ar VisuMax femtosekunžu lāzeri(FemtoLASIK metode) un ar mehānisko mikrokeratomu(LASIK metode). Metodika:Pētījumā tika analizēti 84 miopi pacienti(154 acis)-LASIK metodē-59 pacienti,FemtoLASIK-25. Vidējais vecums 29±8 gadi. Pirms operācijas subjek...

Growth performance, carcass and hematological characteristics of ...

African Journals Online (AJOL)

Growth performance, carcass and hematological characteristics of rabbits fed graded levels of tiger nuts ( Cyperus esculentus ) ... (p>0.05) difference between treatments. Results demonstrated that (Cyperus esculentus) could be used up to 5% in rabbit's diets without adverse effect on the animals' performance and health.

Inhibiton of Yellow Nutsedge (Cyperus esculentus L. and Bermudagrass (Cynodon dactylon (L. Pers by a Mulch Derived from Rye (Secale cereale L. in grapevines Inhibición del Crecimiento de Chufa (Cyperus esculentus L. y Pasto Bermuda (Cynodon dactylon (L. Pers. con mulch Vegetal Proveniente de Centeno (Secale cereale L. en Vides

Directory of Open Access Journals (Sweden)

Juan Ormeño-Núñez

2008-09-01

Full Text Available Two field trials (Los Andes 1998-1999 and Santiago 2004-2005 were carried out to determine growth inhibition of yellow nutsedge (Cyperus esculentus L. and bermudagrass (Cynodon dactylon (L. Pers., growing on the plantation row, by mulch derived from a rye (Secale cereale L. cover crop established between grapevine (Vitis vinifera L. rows on overhead (cv. Flame Seedless and vertical (cv. Cabernet Sauvignon training. Spring mowing of the rye sown in the fall allowed for developing a thick and long lasting mulch along the grape rows. Nutsedge and bermudagrass control was 81 and 82%, respectively, and was more effective than conventional chemical (in the row + mechanical (between rows control. Glyphosate at 2% for nutsedge and 1% for bermudagrass control, applied twice (October and December, was insufficient to control either perennial weed adequately. Total broadleaved and grass/sedge weed control was 67.3 and 43.0% more effective with the rye mulch than with conventional treatments at Los Andes and Santiago, respectively. Perennial weed control levels could be explained as the new foliage of yellow nutsedge and bermudagrass was particularly susceptible to the shading provided by the rye mulch assembled prior to mid spring shoot emergence, and this effect remained active up until the beginning of autumn. The subsequent rye foliage mowing at the vegetative stage fully expressed the allelopathic effect produced by this local rye cultivar. The use of rye cover crop management and mulch could be applied as an effective weed control technique in conventional, as well as organic deciduous tree orchards.En dos ensayos de campo (Los Andes 1998-1999 y Santiago 2004-2005 se determinó el efecto inhibitorio sobre chufa (Cyperus esculentus L. y pasto bermuda (Cynodon dactylon (L. Pers. de residuos de centeno (Secale cereale L. establecido en otoño entre las hileras de vides (Vitis vinifera L. en parronal (cv. Flame Seedless y espaldera (cv. Cabernet Sauvignon

Health-promoting lifestyles and related factors among pregnant women/Gebelerde sağlıklı yaşam biçimi davranışları ve ilişkili faktörler

Directory of Open Access Journals (Sweden)

Güliz Onat

2014-08-01

Full Text Available AbstractObjective: A health-promoting lifestyle has an especially important role during pregnancy due to its direct link to healthy births, and to low maternal-fetal mortality and morbidity rates. The objectives of our study are to determine and analyse the health-promoting lifestyles and related factors in pregnant women. Methods: This descriptive study was carried out on 255 pregnant women in the city of Usak in Turkey, using the Health-Promoting-Lifestyle-Profile-II-(HPLP. Frequencies, percentage distributions, t tests, and the Mann Whitney U test and ANOVA were used to analyze the results. Results: The mean age of the pregnant women was 26.7±5.1 and their mean gestational week was 25.2±10.9. The mean total score on the HPLP was 130.7±20.0. The lowest score was for “physical activity” (14.4±5.0. The highest score was for “psychological wellbeing” (26.18±4.2. Smoking prevalence among the study population was 17% before the pregnancy,  and 3.9% during the pregnancy (with an average of 4 cigarettes/day. During the pregnancy diet habits improved. The rate of giving up smoking was high. Women also sought further knowledge about pregnancy and birth. Conclusions: In pregnant women the HPLP score was upper to intermediate in level. Of the women who participated in the survey, those that were unemployed, had a lower level of education, and those who had considered abortion were found to be at a higher risk of not having a health promoting life style. This finding provides a unique insight in identifying the risk group for health care providers who work at an antenatal clinic. Health caregivers should pay more attention to this risk group when evaluating healthy lifestyles during whole pregnancy. Key Words: Health-Promoting Lifestyles; pregnant women; Health Promoting Lifestyle Profile-IIÖzetAmaç: Sağlıklı yaşam biçimi davranışları; sağlıklı ve canlı bir doğum yapma, anne-yenidoğan mortalite ve morbidite oranını azaltma

Phylogeography and Demographic History of Chinese Black-Spotted Frog Populations (Pelophylax nigromaculata: Evidence for Independent Refugia Expansion and Secondary Contact

Directory of Open Access Journals (Sweden)

Zhou Kaiya

2008-01-01

Full Text Available Abstract Background Pleistocene glaciations had considerable impact on phylogeographic patterns within and among closely related species of many vertebrates. Compared to Europe and North America, research on the phylogeography of vertebrates in East Asia, particularly in China, remains limited. The black-spotted frog (Pelophylax nigromaculata is a widespread species in East Asia. The wide distribution of this species in China makes it an ideal model for the study of palaeoclimatic effects on vertebrates in East Asia. Our previous studies of P. nigromaculata revealed significant subdivisions between the northeast China populations and populations in other regions of the mainland. In the present study, we aim to see whether the deepest splits among lineages and perhaps subsequent genealogical divisions are temporally consistent with a Pleistocene origin and whether clade geographic distributions, with insight into expansion patterns, are similarly spatially consistent with this model. Results Using 1143 nucleotides of the mitochondrial cytochrome b gene from 262 individuals sampled from 28 localities, two main clades (clade A and clade B differing by c. 7.72% sequence divergence were defined from parsimony analyses. The corresponding timing of lineage divergence, 0.92 Mya, indicates a most likely Pleistocene split. The A clade is further subdivided into two sub-clades, A1 and A2 with 1.22% sequence divergence. Nested clade phylogeographical and population demographic analyses suggested that the current distribution of this frog species was the result of range expansion from two independent refugia during the last interglacial period. We discovered a population within which haplotype lineages A and B of P. nigromaculata coexist in the Dongliao area of China by nucleotide sequences, PCR-RFLP and ISSR (inter simple sequence repeat patterns. The ISSR result in particular supported divergence between the mitochondrial clades A and B and implied

Ranakinestatin-PPF from the skin secretion of the Fukien gold-striped pond frog, Pelophylax plancyi fukienensis: a prototype of a novel class of bradykinin B2 receptor antagonist peptide from ranid frogs.

Science.gov (United States)

Ma, Jie; Luo, Yu; Ge, Lilin; Wang, Lei; Zhou, Mei; Zhang, Yingqi; Duan, Jinao; Chen, Tianbao; Shaw, Chris

2014-01-01

The defensive skin secretions of many amphibians are a rich source of bradykinins and bradykinin-related peptides (BRPs). Members of this peptide group are also common components of reptile and arthropod venoms due to their multiple biological functions that include induction of pain, effects on many smooth muscle types, and lowering systemic blood pressure. While most BRPs are bradykinin receptor agonists, some have curiously been found to be exquisite antagonists, such as the maximakinin gene-related peptide, kinestatin-a specific bradykinin B2-receptor antagonist from the skin of the giant fire-bellied toad, Bombina maxima. Here, we describe the identification, structural and functional characterization of a heptadecapeptide (DYTIRTRLHQGLSRKIV), named ranakinestatin-PPF, from the skin of the Chinese ranid frog, Pelophylax plancyi fukienensis, representing a prototype of a novel class of bradykinin B2-receptor specific antagonist. Using a preconstricted preparation of rat tail arterial smooth muscle, a single dose of 10(-6)M of the peptide effectively inhibited the dose-dependent relaxation effect of bradykinin between 10(-11)M and 10(-5)M and subsequently, this effect was pharmacologically-characterized using specific bradykinin B1- (desArg-HOE140) and B2-receptor (HOE140) antagonists; the data from which demonstrated that the antagonism of the novel peptide was mediated through B2-receptors. Ranakinestatin-PPF-thus represents a prototype of an amphibian skin peptide family that functions as a bradykinin B2-receptor antagonist herein demonstrated using mammalian vascular smooth muscle.

Karyotype characteristics and polymorphism peculiarities of Chironomus bernensis Wülker & Klötzli, 1973 (Diptera, Chironomidae) from the Central Caucasus and Ciscaucasia

Science.gov (United States)

Karmokov, Mukhamed Kh.; Polukonova, Natalia V.; Sinichkina, Olga V.

2015-01-01

Abstract Data about the karyotype characteristics, features of chromosomal polymorphism and larval morphology of populations of Chironomus bernensis Wülker & Klötzli, 1973 (Diptera, Chironomidae) from the Central Caucasus (the northern macroslope) and Ciscaucasia are presented. The characteristics of the pericentromeric regions of the long chromosomes of this species from Caucasian populations were very similar to the ones from some European populations (from Poland and Italy), but differed from Swiss and Siberian populations. In the North Caucasian populations 10 banding sequences were found: two in arms A, C, and E, and one in arms B, D, F, and G. Nine of them were already known for this species, and one, berC2, is described for the first time. Cytogenetic distances between all the studied populations of Chironomus bernensis show that close geographical location of all studied populations from the Central Caucasus and Ciscaucasia is reflected in their similar cytogenetic structure, but on the other hand, that they are more closely related to populations from Europe than to populations from Western Siberia. At the same time, all studied larvae from Caucasian populations have a four-bladed premandible, instead of a two-bladed one, as in the description of Chironomus bernensis from Switzerland (Wülker and Klötzli 1973, Polukonova 2005c). These peculiarities may indicate the relative isolation of the Caucasus from the viewpoint of microevolution. Further research on karyological and morphological characteristics of Chironomus bernensis from geographically distant regions is necessary as there is a possibility that the presently known species is actually polytypic and consists of several sibling species. PMID:26312128

Karyotype characteristics and polymorphism peculiarities of Chironomus bernensis Wülker & Klötzli, 1973 (Diptera, Chironomidae from the Central Caucasus and Ciscaucasia

Directory of Open Access Journals (Sweden)

Mukhamed Kh. Karmokov

2015-06-01

Full Text Available Data about the karyotype characteristics, features of chromosomal polymorphism and larval morphology of populations of Chironomus bernensis Wülker & Klötzli, 1973 (Diptera, Chironomidae from the Central Caucasus (the northern macroslope and Ciscaucasia are presented. The characteristics of the pericentromeric regions of the long chromosomes of this species from Caucasian populations were very similar to the ones from some European populations (from Poland and Italy, but differed from Swiss and Siberian populations. In the North Caucasian populations 10 banding sequences were found: two in arms A, C, and E, and one in arms B, D, F, and G. Nine of them were already known for this species, and one, berC2, is described for the first time. Cytogenetic distances between all the studied populations of Ch. bernensis show that close geographical location of all studied populations from the Central Caucasus and Ciscaucasia is reflected in their similar cytogenetic structure, but on the other hand, that they are more closely related to populations from Europe than to populations from Western Siberia. At the same time, all studied larvae from Caucasian populations have a four-bladed premandible, instead of a two-bladed one, as in the description of Ch. bernensis from Switzerland (Wülker and Klötzli 1973, Polukonova 2005c. These peculiarities may indicate the relative isolation of the Caucasus from the viewpoint of microevolution. Further research on karyological and morphological characteristics of Chironomus bernensis from geographically distant regions is necessary as there is a possibility that the presently known species is actually polytypic and consists of several sibling species.

Field efficacy of azadirachtin-A, tetrahydroazadirachtin-A, NeemAzal and endosulfan against key pests of okra (Abelmoschus esculentus).

Science.gov (United States)

Dhingra, Swaran; Walia, Suresh; Kumar, Jitendra; Singh, Shivendra; Singh, Gyanendra; Parmar, Balraj S

2008-11-01

BACKGROUND Unlike synthetic pesticides, azadirachtin-based neem pesticides are environmentally friendly and are well known for their diverse pest control properties. Their use is, however, limited by the instability of azadirachtin, necessitating application at short intervals. The efficacy of relatively stable tetrahydroazadirachtin-A, therefore, needed to be established under field conditions. Azadirachtin-A (Aza-A), its stable derivative tetrahydroazadirachtin-A (THA) and other neem pesticides have been evaluated for their field efficacy against major insect pests of okra, Abelmoschus esculentus (L.) Moench., during summer (kharif) 2003 and 2004. The optimum doses of Aza-A and THA against the fruit borer, Earias vittella F., were also established. Reductions in population of whitefly, Bemisia tabaci (Genn.), and leafhopper (jassid), Amrasca biguttulla biguttulla Ishida, after application of THA or endosulfan was evident up to 10 days after treatment (DAT), whereas with Aza-A and NeemAzal (NZ) the effect was observed up to 7 DAT only. Endosulfan and THA also caused higher reduction in the larvae of shoot and fruit borer E. vittella and E. insulana Boisd., and recorded the highest yields of 4600 and 4180 kg ha(-1). The efficacy of THA (0.05 g L(-1) emulsion) was comparable with that of 0.5 g L(-1) endosulfan emulsion in reducing fruit borer infestation, the reduction over the control being 86.0 and 87.3%, 84.9 and 94.1% and 90.2 and 92.6% at first, second and third picking. THA 0.02 g L(-1) and Aza-A 0.05 g L(-1) were on a par. Laboratory-made neem oil emulsifiable concentrate was the least effective, but was superior to untreated check. Three consecutive sprays of THA, a neem-based biopesticide, and endosulfan have been found to be superior in controlling field pests of okra to Aza-A and NZ, which were on a par. THA thus holds potential as a component of pest management strategies against okra pests. Copyright (c) 2008 Society of Chemical Industry.

Herschel Observations of Extraordinary Sources: Analysi sof the HIFI 1.2 THz Wide Spectral Survey toward Orion KL II. Chemical Implications

Science.gov (United States)

Crockett, N. R.; Bergin, E. A.; Neill, J. L.; Favre, C.; Blake, G. A.; Herbst, E.; Anderson, D. E.; Hassel, G. E.

2015-06-01

We present chemical implications arising from spectral models fit to the Herschel/HIFI spectral survey toward the Orion Kleinmann-Low nebula (Orion KL). We focus our discussion on the eight complex organics detected within the HIFI survey utilizing a novel technique to identify those molecules emitting in the hottest gas. In particular, we find the complex nitrogen bearing species CH3CN, C2H3CN, C2H5CN, and NH2CHO systematically trace hotter gas than the oxygen bearing organics CH3OH, C2H5OH, CH3OCH3, and CH3OCHO, which do not contain nitrogen. If these complex species form predominantly on grain surfaces, this may indicate N-bearing organics are more difficult to remove from grain surfaces than O-bearing species. Another possibility is that hot (Tkin ∼ 300 K) gas phase chemistry naturally produces higher complex cyanide abundances while suppressing the formation of O-bearing complex organics. We compare our derived rotation temperatures and molecular abundances to chemical models, which include gas-phase and grain surface pathways. Abundances for a majority of the detected complex organics can be reproduced over timescales ≳105 years, with several species being underpredicted by less than 3σ. Derived rotation temperatures for most organics, furthermore, agree reasonably well with the predicted temperatures at peak abundance. We also find that sulfur bearing molecules that also contain oxygen (i.e., SO, SO2, and OCS) tend to probe the hottest gas toward Orion KL, indicating the formation pathways for these species are most efficient at high temperatures. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.

Ulrike Klöppel: XX0XY ungelöst. Hermaphroditismus, Sex und Gender in der deutschen Medizin. Eine historische Studie zur Intersexualität. Bielefeld: transcript Verlag 2010.

OpenAIRE

Sarah Radtke

2010-01-01

Ulrike Klöppel führt in ihrer materialreichen Studie vor, dass Hermaphroditismus für die Medizin immer wieder Anlass war, sich mit der Vielfalt der das Geschlecht bestimmenden Faktoren – Gestalt und Form der Genitalien, Chromosomengeschlecht, Keimdrüsengeschlecht (Hoden vs. Eierstöcke), Hormonhaushalt, Geschlechtsrolle und Geschlechtsidentität – zu befassen und zu versuchen, Geschlechtszugehörigkeiten verbindlich festzulegen. Neben einem historis...

KL Estimation of the Power Spectrum Parameters from the Angular Distribution of Galaxies in Early SDSS Data

CERN Document Server

Szalay, Alexander S.; Matsubara, Takahiko; Scranton, Ryan; Vogeley, Michael S.; Connolly, Andrew; Dodelson, Scott; Eisenstein, Daniel; Frieman, Joshua A.; Gunn, James E.; Hui, Lam; Johnston, David; Kent, Stephen M.; Kerscher, Martin; Loveday, Jon; Meiksin, Avery; Narayanan, Vijay; Nichol, Robert C.; O'Connell, Liam; Pope, Adrian; Scoccimarro, Roman; Sheth, Ravi K.; Stebbins, Albert; Strauss, Michael A.; Szapudi, Istvan; Tegmark, Max; Zehavi, Idit; Annis, James; Bahcall, Neta A.; Brinkmann, Jon; Csabai, Istvan; Fukugita, Masataka; Hennessy, Greg; Hogg, David W.; Ivezic, Zeljko; Knapp, Gillian R.; Kunszt, Peter Z.; Lamb, Don Q.; Lee, Brian C.; Lupton, Robert H.; Munn, Jeffrey R.; Peoples, John; Pier, Jeffrey R.; Rockosi, Constance; Schlegel, David; Stoughton, Christopher; Tucker, Douglas L.; Yanny, Brian; York, Donald G.; Szalay, Alexander S.; Jain, Bhuvnesh; Matsubara, Takahiko; Scranton, Ryan; Vogeley, Michael S.; Connolly, Andrew; Dodelson, Scott; Eisenstein, Daniel; Frieman, Joshua A.; Gunn, James E.; Hui, Lam; Johnston, David; Kent, Stephen; Kerscher, Martin; Loveday, Jon; Meiksin, Avery; Narayanan, Vijay; Nichol, Robert C.; Connell, Liam O'; Pope, Adrian; Scoccimarro, Roman; Sheth, Ravi K.; Stebbins, Albert; Strauss, Michael A.; Szapudi, Istvan; Tegmark, Max; Zehavi, Idit

2002-01-01

We present measurements of parameters of the 3-dimensional power spectrum of galaxy clustering from 222 square degrees of early imaging data in the Sloan Digital Sky Survey. The projected galaxy distribution on the sky is expanded over a set of Karhunen-Loeve eigenfunctions, which optimize the signal-to-noise ratio in our analysis. A maximum likelihood analysis is used to estimate parameters that set the shape and amplitude of the 3-dimensional power spectrum. Our best estimates are Gamma=0.188 +/- 0.04 and sigma_8L = 0.915 +/- 0.06 (statistical errors only), for a flat Universe with a cosmological constant. We demonstrate that our measurements contain signal from scales at or beyond the peak of the 3D power spectrum. We discuss how the results scale with systematic uncertainties, like the radial selection function. We find that the central values satisfy the analytically estimated scaling relation. We have also explored the effects of evolutionary corrections, various truncations of the KL basis, seeing, sam...

A comparative study of track registration response of Makrofol-(KG, KL and N) polycarbonate to sup 4 sup 0 Ar ions

CERN Document Server

Kumar, A

1999-01-01

In the present work a comparative study of track registration response of sup 4 sup 0 Ar ions in different types of Makrofol polycarbonates viz. Makrofol-KG, KL and N have been done. The etched track parameters viz. bulk etch rate, track etch rate, etch rate ratio, cone angle and etching efficiency were calculated. The variation of etching rates with temperature were found to be exponential and follow the Arrhenius equation. The values of activation energy for bulk and track etching were also calculated. Maximum etchable track length/range were also obtained and compared with the theoretical values obtained from computer program RANGE. From the results it is found that the polycarbonates having same chemical composition manufactured by different chemical processes have slightly different behavior

Ranakinestatin-PPF from the Skin Secretion of the Fukien Gold-Striped Pond Frog, Pelophylax plancyi fukienensis: A Prototype of a Novel Class of Bradykinin B2 Receptor Antagonist Peptide from Ranid Frogs

Directory of Open Access Journals (Sweden)

Jie Ma

2014-01-01

Full Text Available The defensive skin secretions of many amphibians are a rich source of bradykinins and bradykinin-related peptides (BRPs. Members of this peptide group are also common components of reptile and arthropod venoms due to their multiple biological functions that include induction of pain, effects on many smooth muscle types, and lowering systemic blood pressure. While most BRPs are bradykinin receptor agonists, some have curiously been found to be exquisite antagonists, such as the maximakinin gene-related peptide, kinestatin—a specific bradykinin B2-receptor antagonist from the skin of the giant fire-bellied toad, Bombina maxima. Here, we describe the identification, structural and functional characterization of a heptadecapeptide (DYTIRTRLHQGLSRKIV, named ranakinestatin-PPF, from the skin of the Chinese ranid frog, Pelophylax plancyi fukienensis, representing a prototype of a novel class of bradykinin B2-receptor specific antagonist. Using a preconstricted preparation of rat tail arterial smooth muscle, a single dose of 10−6 M of the peptide effectively inhibited the dose-dependent relaxation effect of bradykinin between 10−11 M and 10−5 M and subsequently, this effect was pharmacologically-characterized using specific bradykinin B1- (desArg-HOE140 and B2-receptor (HOE140 antagonists; the data from which demonstrated that the antagonism of the novel peptide was mediated through B2-receptors. Ranakinestatin—PPF—thus represents a prototype of an amphibian skin peptide family that functions as a bradykinin B2-receptor antagonist herein demonstrated using mammalian vascular smooth muscle.

Form factors for semileptonic Bs→Klν decays in lattice QCD

International Nuclear Information System (INIS)

Bahr, Felix Tobias

2015-01-01

We present an exploratory study of the calculation of the form factor f + (q 2 ) for the semileptonic decay B s →Klν in large-volume lattice QCD simulations with two dynamical sea quark flavours using O(a) improved Wilson fermions. We discuss the computation of relevant two- and three-point functions and consider complementary methods how these can be combined to obtain the form factor. In particular, we put forward the strategy of a combined fit in which data of all correlators enter and which has as fit parameters energies and amplitudes of the correlators and the form factor. The b quark is treated in HQET; our present analysis focuses on the static limit. Meanwhile, we have developed the code and performed the measurements of all needed O(1/m h ) corrections which will be used as soon as their coefficients will have been computed by the ALPHA collaboration. In order to be able to measure the form factor at the same value of the momentum transfer q 2 on all ensembles, we impose twisted boundary conditions on the s and b quarks that allow for a free tuning of the quark momenta and thus of q 2 . We perform measurements on a subset of N f =2 CLS gauge configurations, obtaining the form factor at three different lattice spacings and roughly the same pion mass of about 330 MeV. Using these, we carry out a continuum extrapolation and observe that it is relatively flat in a 2 . A measurement at a different pion mass indicates that quark mass effects are small. We compare our continuum value of the form factor with recently published results of other collaborations and observe a good agreement.

Is elevated CO2 in space really harmful to growth and development? A case study of Chufa (Cyperus esculentus L.) in Lunar Palace-1

Science.gov (United States)

Liu, Guanghui; Dong, Chen; Fu, Yuming; Wang, Minjuan; Shao, Lingzhi; Yu, Juan; Liu, Hong

2018-05-01

CO2 concentration [CO2] level in artificial ecosystems such as greenhouse agriculture and space farming can easily exceed 1000 μmol mol-1 (or ppm). In order to understand how the growth and development in crop plants may respond to elevated CO2, it is necessary to determine if crop leaves in the closed artificial ecosystem have a fully developed photosynthetic apparatus, and whether or not photosynthesis in these leaves is more responsive to elevated CO2 concentration. To address this issue, we evaluated the response of photosynthetic characteristics, leaf water status and antioxidant capacity of Chufa (Cyperus esculentus L.), which is a sedge-like plant with 1-2 cm small sweet tubers in length, under elevated CO2 concentrations in an artificial closed ecosystem. The results showed that Chufa plants cultivated in the elevated CO2 environment from the seedling stage to the maturity stage were characterized by more appropriate chlorophyll content and photosynthetic rate. The photosynthetic rate of Chufa plants in the 1000 and 3000 ppm treatments was no significant difference with that in 500 ppm CO2 condition both at seedling stage and rapid growth stage. All the treatments had a high relative water content (RWC) about 60% at the maturity stage. However, there was no significant difference in membrane stability index (MSI) at the rapid growth stage. The antioxidase enzymes activities experienced a rise and a drop and reached the peak at the rapid growth stage. Elevated CO2, especially more than 1000 ppm conditions, may accelerant Chufa plants aging process.

Remedial Investigation of Contaminant Mobility at Naval Weapons Station, Concord, California.

Science.gov (United States)

1986-01-01

Houghton. 1983. Heavy Metal Uptake by Agronomic Crops Grown on Contaminated Soils and Cyperus esculentus Grown on Oxidized and Reduced Contaminated Soils...Respiratory Metabolism and Haemoglobin Concentration in an Earthworm Eisenia foetida (SAVIGNY 1826) Under Exposure of Lead Intoxication . Acta...Comparison of the Heavy-Metal Uptake of Cyperus esculentus and of Agronomic Plants Grown on Contaminated Sediments. Miscellaneous Paper D-83-1. US

Sıklık Bakımının Doğal Sarıçam (Pinus sylvestris L. Meşcerelerinde Çap ve Göğüs Yüzeyi Üzerine Etkisi

Directory of Open Access Journals (Sweden)

Ömer ÖNCÜL

2016-07-01

Full Text Available Bu çalışmada, idare süresi sonunda işletme amacına uygun nitelikte ve ekonomik getirisi yüksek meşcereler oluşturabilmek için, sıklık çağındaki doğal sarıçam meşcerelerinde bakım tedbirleri sonucu, hektarda olması gereken göğüs yüzeyi miktarını ve birey sayısını belirlemek amaçlanmıştır. Bu amaçla Sarıkamış ve Ardahan’da belirlenen iki deneme alanında (18-20 yaş aralığında dört işlem (kontrol, zayıf, orta ve kuvvetli müdahale işlemi ve üç tekerrürden oluşan her biri 500 m²’lik toplam 24 parsel oluşturulmuştur. Zayıf müdahale parselinde alandaki toplam göğüs yüzeyinin %10-15’i, orta müdahale parselinde %20-25’i ve kuvvetli müdahale parselinde ise %30-35’i çıkarılmış, kontrol parsellerinde herhangi bir müdahale yapılmamıştır.  Deneme parsellerindeki bireylerde 2010 yılı ilkbaharında başlangıç çap değerleri ölçülmüş ve işlemlere göre müdahale kesimleri yapılarak, 2013 yılı ilkbaharındaki çap değerleri ile karşılaştırılıp her iki müdahale yılı arasındaki gelişim farkı tespitleri yapılmıştır. Elde edilen sonuçlara göre; yapılan sıklık bakımı müdahalelerinin gelişmeye etkisinin olduğu ve bu etkinin çap ve göğüs yüzeyi değerleri açısından en iyi gelişiminin kuvvetli müdahale işleminde gerçekleştiği tespit edilmiştir. Çalışma sonucunda, genel olarak 18-20 yaşlarındaki doğal sarıçam meşcerelerinde sıklık bakımı yapılan alanlarda ilk sıklık bakımı kesimlerinde hektardaki birey sayısının 3000-4000 adet civarında tutulması çap ve göğüs yüzeyi açısından en iyi sonucu vermektedir.Anahtar Kelimeler: Çap, göğüs yüzeyi, sarıçam, sıklık bakımı.

The exposure assessment of airborne particulates matter (PM10 & PM2.5) towards building occupants: A case study at KL Sentral, Kuala Lumpur, Malaysia

Science.gov (United States)

Mohddin, S. A.; Aminuddin, N. M.

2014-02-01

Airborne particulates have been recognized as a crucial pollutant of indoor air. These pollutants can contribute towards poor indoor air quality (IAQ), which may affect human health in immediate or long term. This study aims to determine the level of IAQ and the effects of particulate towards occupants of office buildings (the office buildings selected for the case study are SSM, KTMB and MRCB at KL Sentral). The objectives of study are (i) to measure the level of airborne particulates that contribute to the IAQ during working hours, (ii) to compare the level of airborne particulates with the existing guidelines and standards of IAQ in Malaysia and other Asian countries and (iii) to assess the symptoms associated with airborne particulates among the building occupants, which were achieved through primary data collection (case study or site survey, structured interview and questionnaire survey) and supported by literature reviews. The results showed that the mass concentration level of airborne particulates within the areas has exceeded the allowable limit of 0.15mg/m3 by IAQ Code of Practice, 2005 of the Department of Safety and Health (DOSH), Malaysia and 0.05mg/m3 by the Department of Environmental (DOE) (outdoor) of 8 hours continuous sampling. Based on the findings, the highest mass concentration values measured is 2.581 mg/m3 at lobby of SSM building which is the highest recorded 17 times higher from the maximum limit recommended by DOSH than the others. This is due to the nearby construction works and the high numbers of particulates are generated from various types of vehicles for transportation surrounding KL Sentral. Therefore, the development of Malaysian Ambient Air Quality Guidelines on PM2.5 as one of the crucial parameters is highly recommended.

PENERAPAN STRATEGI PERMAINAN CATALISTING YANG BERORIENTASI PADA KECERDASAN LINGUISTIK (PC-KL DALAM PEMBELAJARAN MENULIS ESAI

Directory of Open Access Journals (Sweden)

Nofiyanti Nofiyanti

2018-01-01

Full Text Available Penelitian ini bertujuan untuk menjelaskan perbedaan hasil menulis esai antara kelas kontrol dengan kelas eksperimen melalui strategi permainan catalisting yang berorientasi pada kecerdasan linguistik pada mahasiswa tingkat III di STKIP Siliwangi Bandung. Desain penelitian ini adalah kuasi eksperimen (Quasi Experimental Design dengan menggunakan bentuk nonequivalent control group design. Teknik pengumpulan data meliputi observasi, angket dan tes. Hasil penelitian menunjukan bahwa strategi permainan catalisting yang berorientasi pada kecerdasan linguistik pada mahasiswa tingkat III di STKIP Siliwangi Bandung terbukti efektif, baik dari segi pembelajaran maupun proses pembelajaran. Secara rinci dijelaskan sebagai berikut, (1 Nilai rata-rata kelas eksperimen adalah 76,39 sedangkan kelas kontrol nilai rata-ratanya adalah 70,31. Hasil uji statistik menunjukan nilai signifikasi pada uji independent t test nilai sig. 0, 03 < 0,05 maka ada perbedaan di antara nilai kelas eksperimen dengan kelas kontrol. Dengan kata lain Ho ditolak, Ha diterima. Maka dapat disimpulkan adanya perbedaan yang signifikan pada hasil belajar menuls esai antara kelas kontrol dan kelas eksperimen. (2 Hasil respons tanggapan mahasiswa terhadap penggunaan strategi permainan catalisting yang berorientasi pada kecerdasan linguistik dalam pembelajaran menulis esai menunjukkan respons yang baik, yaitu sebanyak 91,81% (32 mahasiswa memberikan respons positif sedangkan 8,19% (3 mahasiswa memberikan respons negatif. (3 pembelajaran menulis esai dengan strategi PC-KL lebih menyenangkan dan memudahkan mahasiswa dalam mencari ide sebuah tulisan. Kata kunci: Strategi catalisting, kecerdasan linguistik, pembelajaran, menulis esai

Analysis of WBV on standing and seated passengers during off-peak operation in KL monorail

Science.gov (United States)

Hasnan, K.; Bakhsh, Q.; Ahmed, A.; Ali, D.; Jamali, A. R.

2018-03-01

In this study, the Whole-Body Vibration (WBV) was analyzed on the standing and seated passenger during off-peak operating hours when train was on the track. The experiments were conducted on two car train at one constant location (bogie-1, which is near to driver’s cabin) during downward direction from KL sentral station towards Titiwangsa station. The aim of this study was to analyze that, in which posture of passenger’s exposures the maximum level of WBV. Since, one passenger was performed the whole journey in standing posture whereas, the other passenger was in seated posture. The result obtained from experiments for the RMS accelerations (Arms), maximum acceleration (Amax) and minimum acceleration (Amin) during the trip. As per standard ISO 2631-1, the daily vibration exposure (A8), Vibration Dose value (VDV) and Crest Factor (CF) of this trip for both standing and sitting orientations were calculated. Results shows that the seated passenger was exposed to longer periods of continuous vibration as compared to the standing passenger. Whereas, the Vibration Dose value (VDV) value was greater than the action value as per ISO 2631-1 and within the limit values. The study concluded that whole body vibration transmitted towards both passengers either standing or seated during their journey. But in overall results comparison of both orientations, the seated passengers gained higher vibration than the standing one.

Devlet ve Vakıf Üniversiteleri Eğitim Fakültesi Öğrencilerinin Cep Telefonu Kullanım Sıklıklarının ve Marka Tercihlerinin Karşılaştırılması

OpenAIRE

TUTGUN ÜNAL, Aylin; ARSLAN, Ahmet

2013-01-01

Bu araştırmada, devlet ve vakıf üniversiteleri eğitim fakültesi öğrencilerinin cep telefonu kullanım sıklıkları ve marka tercihleri incelenmiştir. Araştırma, İstanbul’da yer alan Marmara Üniversitesi Atatürk Eğitim Fakültesi ve Maltepe Üniversitesi Eğitim Fakültesi’ne devam eden 985 öğrenci ile yürütülmüştür. Verilerin toplanmasında araştırmacılar tarafından geliştirilen “Cep Telefonu Kullanımı Sıklığı ve Marka Tercihi Belirleme Formu” kullanılmıştır. Araştırmada, eğitim fakültesi öğrencileri...

The exposure assessment of airborne particulates matter (PM10 and PM2.5) towards building occupants: A case study at KL Sentral, Kuala Lumpur, Malaysia

International Nuclear Information System (INIS)

Mohddin, S A; Aminuddin, N M

2014-01-01

Airborne particulates have been recognized as a crucial pollutant of indoor air. These pollutants can contribute towards poor indoor air quality (IAQ), which may affect human health in immediate or long term. This study aims to determine the level of IAQ and the effects of particulate towards occupants of office buildings (the office buildings selected for the case study are SSM, KTMB and MRCB at KL Sentral). The objectives of study are (i) to measure the level of airborne particulates that contribute to the IAQ during working hours, (ii) to compare the level of airborne particulates with the existing guidelines and standards of IAQ in Malaysia and other Asian countries and (iii) to assess the symptoms associated with airborne particulates among the building occupants, which were achieved through primary data collection (case study or site survey, structured interview and questionnaire survey) and supported by literature reviews. The results showed that the mass concentration level of airborne particulates within the areas has exceeded the allowable limit of 0.15mg/m 3 by IAQ Code of Practice, 2005 of the Department of Safety and Health (DOSH), Malaysia and 0.05mg/m 3 by the Department of Environmental (DOE) (outdoor) of 8 hours continuous sampling. Based on the findings, the highest mass concentration values measured is 2.581 mg/m 3 at lobby of SSM building which is the highest recorded 17 times higher from the maximum limit recommended by DOSH than the others. This is due to the nearby construction works and the high numbers of particulates are generated from various types of vehicles for transportation surrounding KL Sentral. Therefore, the development of Malaysian Ambient Air Quality Guidelines on PM 2.5 as one of the crucial parameters is highly recommended

Novel Antimicrobial Peptides EeCentrocins 1, 2 and EeStrongylocin 2 from the Edible Sea Urchin Echinus esculentus Have 6-Br-Trp Post-Translational Modifications.

Directory of Open Access Journals (Sweden)

Runar Gjerp Solstad

Full Text Available The global problem of microbial resistance to antibiotics has resulted in an urgent need to develop new antimicrobial agents. Natural antimicrobial peptides are considered promising candidates for drug development. Echinoderms, which rely on innate immunity factors in the defence against harmful microorganisms, are sources of novel antimicrobial peptides. This study aimed to isolate and characterise antimicrobial peptides from the Edible sea urchin Echinus esculentus. Using bioassay-guided purification and cDNA cloning, three antimicrobial peptides were characterised from the haemocytes of the sea urchin; two heterodimeric peptides and a cysteine-rich peptide. The peptides were named EeCentrocin 1 and 2 and EeStrongylocin 2, respectively, due to their apparent homology to the published centrocins and strongylocins isolated from the green sea urchin Strongylocentrotus droebachiensis. The two centrocin-like peptides EeCentrocin 1 and 2 are intramolecularly connected via a disulphide bond to form a heterodimeric structure, containing a cationic heavy chain of 30 and 32 amino acids and a light chain of 13 amino acids. Additionally, the light chain of EeCentrocin 2 seems to be N-terminally blocked by a pyroglutamic acid residue. The heavy chains of EeCentrocins 1 and 2 were synthesised and shown to be responsible for the antimicrobial activity of the natural peptides. EeStrongylocin 2 contains 6 cysteines engaged in 3 disulphide bonds. A fourth peptide (Ee4635 was also discovered but not fully characterised. Using mass spectrometric and NMR analyses, EeCentrocins 1 and 2, EeStrongylocin 2 and Ee4635 were all shown to contain post-translationally brominated Trp residues in the 6 position of the indole ring.

Abelmoschus esculentus

African Journals Online (AJOL)

Pedro

2015-02-16

Doreddula et al., 2014). World ... sense, in order to introduce the market a new plant product, a study on the nutritional quality and ..... For some derivatives of phenolic acids, antioxidant activity has been reported, except for those of ...

Oreochromis esculentus

African Journals Online (AJOL)

Prof. Adipala Ekwamu

Displacement of the two LVR indigenous tilapiines was .... potential contamination of reaction conditions were ... populations was taken as a single locus. ... Table 1. Microsatellite primer sequences and reaction conditions for 10 loci used for.

Temporal changes of aquatic macrophytes vegetation in a Iowland groundwater feed eutrophic course (Klátovské rameno, Slovakia

Directory of Open Access Journals (Sweden)

Helena Oťahel'ová

2011-01-01

Full Text Available Klátovské rameno is the lowland slow-flowing groundwater feed eutrophic tributary of the Malý Dunaj River (Danube Plain, where our study of temporal changes of aquatic macrophytes vegetation was realised in 1999 and 2005. For survey of aquatic vascular macrophytes the Kohler’s method (Janauer 2003 was used, which is compliant with European standard EN 14184. Altogether 35 aquatic macrophyte species were recorded during the survey. Nuphar lutea persisted as the most dominant species in 1996 and 2005. Species diversity increased slightly after the nine years: ten species immigrated to the watercourse. The changes in species abundance have shown weak differences, however the abundance of Sparganium emersum has increased markedly. Alien species Elodea canadensis and both S. emersum and Hydrocharis morsus-ranae significantly enlarged their distribution in the stream. The ecological quality of the river, based on the aquatic macrophytes assessment criteria, was slightly impaired after nine years, but still 90% of its studied course has a high or good ecological status.

"KinLeaves" reklāmas aktivitātes sociālajā tīklā “Facebook” 2016. gadā

OpenAIRE

Mandrika, Dana

2017-01-01

Bakalaura darba mērķis ir izpētīt, kādas reklāmas aktivitātes uzņēmums ir veicis un noskaidrot, vai sociālajā tīklā “Facebook” ar reklāmas aktivitātēm ir iespējams sasniegt mērķauditoriju. Darbs sastāv no trīs daļām – teorētiskās, metodoloģiskās un empīriskās. Teorētisko daļu veido nodaļas par reklāmu, sociālo tīklu vietnēm, sociālo tīklu „Facebook” un reklāmu sociālo tīklu vietnēs. Metodoloģiskajā daļā apskatītas pētījumā izmantotās metodes - kontentanalīze, intervija, anketēšana. Empīrisk...

Molecular genetic tests for JAK2V617F, Exon12_JAK2 and MPLW515K/L are highly informative in the evaluation of patients suspected to have BCR-ABL1-negative myeloproliferative neoplasms.

Science.gov (United States)

dos Santos, Marcos Tadeu; Mitne-Neto, Miguel; Miyashiro, Kozue; Chauffaille, Maria de Lourdes L Ferrari; Rizzatti, Edgar Gil

2014-02-01

Polycythaemia vera (PV), essential thrombocythemia (ET) and idiopathic myelofibrosis (MF), are the most common myeloproliferative neoplasms (MPN) in patients without the BCR-ABL1 gene rearrangement. They are caused by clonal expansion of haematopoietic stem cells and share, as a diagnostic criterion, the identification of JAK2V617F mutation. Classically, when other clinical criteria are present, a JAK2V617F negative case requires the analysis of Exon12_JAK2 for the diagnosis of PV, and of MPL515K/L mutations for the diagnosis of ET and MF. Here, we evaluated 78 samples from Brazilian patients suspected to have MPN, without stratification for PV, ET or MF. We found that 28 (35.9%) are JAK2V617F carriers; from the 50 remaining samples, one (2%) showed an Exon12_JAK2 mutation, and another (2%) was positive for MPLW515L mutation. In summary, the investigation of JAK2V617F, Exon12_JAK2 and MPLW515K/L was relevant for the diagnosis of 38.4% of patients suspected to have BCR-ABL1-negative MPN, suggesting that molecular genetic tests are useful for a quick and unequivocal diagnosis of MPN.

Herschel Observations of EXtra-Ordinary Sources: H2S as a Probe of Dense Gas and Possibly Hidden Luminosity Toward the Orion KL Hot Core

Science.gov (United States)

Crockett, N. R.; Bergin, E. A.; Neill, J. L.; Black, J. H.; Blake, G. A.; Kleshcheva, M.

2014-02-01

We present Herschel/HIFI observations of the light hydride H2S obtained from the full spectral scan of the Orion Kleinmann-Low nebula (Orion KL) taken as part of the Herschel Observations of EXtra-Ordinary Sources GT (guaranteed time) key program. In total, we observe 52, 24, and 8 unblended or slightly blended features from H2 32S, H2 34S, and H2 33S, respectively. We only analyze emission from the so-called hot core, but emission from the plateau, extended ridge, and/or compact ridge are also detected. Rotation diagrams for ortho and para H2S follow straight lines given the uncertainties and yield T rot = 141 ± 12 K. This indicates H2S is in local thermodynamic equilibrium and is well characterized by a single kinetic temperature or an intense far-IR radiation field is redistributing the population to produce the observed trend. We argue the latter scenario is more probable and find that the most highly excited states (E up >~ 1000 K) are likely populated primarily by radiation pumping. We derive a column density, N tot(H2 32S) = 9.5 ± 1.9 × 1017 cm-2, gas kinetic temperature, T kin = 120+/- ^{13}_{10} K, and constrain the H2 volume density, n_H_2 >~ 9 × 10 7 cm-3, for the H2S emitting gas. These results point to an H2S origin in markedly dense, heavily embedded gas, possibly in close proximity to a hidden self-luminous source (or sources), which are conceivably responsible for Orion KL's high luminosity. We also derive an H2S ortho/para ratio of 1.7 ± 0.8 and set an upper limit for HDS/H2S of <4.9 × 10 -3. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.

Evaluation of growth, biochemical and bioaccumulation parameters in Pelophylax perezi tadpoles, following an in-situ acute exposure to three different effluent ponds from a uranium mine

International Nuclear Information System (INIS)

Marques, Sérgio M.; Chaves, Sandra; Gonçalves, Fernando; Pereira, Ruth

2013-01-01

Mining activities invariably produce metal contaminated effluents. Depending on factors such as pH and metal concentration the toxicity of the effluent may vary. To assess the effects of three characteristically different effluent ponds from a deactivated uranium mine, with toxicologically relevant data, an in situ exposure with Pelophylax perezi tadpoles, was conducted. Tadpoles were exposed to the three effluent ponds, ranked by increasing order of metals concentrations (REF, M1, M2). Survival, growth, metal accumulation, antioxidant enzymes (catalase, glutathione peroxidase and glutathione reductase) and lipid peroxidation (LPO) were determined in tadpoles. As well, physical and chemical variables of the effluents were measured. Death percentage in the effluents was 3.17 (REF), 9.84 (M1) and 42.86% (M2) and was not coincident with metal accumulation which was highest in tadpoles exposed to M1, while metal contents in M2 tadpoles were quite similar to those recorded in REF tadpoles. However, high mortality in M2 was attributed to the extremely low pH (≈ 3.77). From the three effluents M2 tadpoles had the lowest growth and the antioxidant enzymatic activity was only affected in the case glutathione peroxidase (GPx) with significantly higher activity in M1, being in accordance with the highest accumulation of metals. LPO, usually associated with metal accumulation, had the following pattern M1 > REF > M2. Overall, effluent toxicity in tadpoles exposed to M2 effluent seems to be primarily an effect of pH while in M1 toxicity is mainly owed to high metal concentrations. The effluent acidity seems to reduce metal accumulation probably due to damage in the integument, affecting ion uptake. The results obtained bring a better understanding of the toxicological processes that local P. perezi population is subjected to, mainly in the early life stages. Furthermore this study highlights the influence of pH in the toxicity of metal rich effluents. - Highlights: �

Evaluation of growth, biochemical and bioaccumulation parameters in Pelophylax perezi tadpoles, following an in-situ acute exposure to three different effluent ponds from a uranium mine

Energy Technology Data Exchange (ETDEWEB)

Marques, Sérgio M., E-mail: s.reis.marques@gmail.com [Departamento de Biologia da Universidade de Aveiro, Campus de Santiago, 3810-193 Aveiro (Portugal); CESAM (Centro de Estudos do Ambiente e do Mar), Universidade de Aveiro, Campus de Santiago, 3810-193 Aveiro (Portugal); Chaves, Sandra [Universidade de Lisboa, Faculdade de Ciências, Centro de Biodiversidade, Genómica Integrativa e Funcional (BioFIG), Edifício ICAT, Campus da FCUL Campo Grande, Lisboa (Portugal); Gonçalves, Fernando [Departamento de Biologia da Universidade de Aveiro, Campus de Santiago, 3810-193 Aveiro (Portugal); CESAM (Centro de Estudos do Ambiente e do Mar), Universidade de Aveiro, Campus de Santiago, 3810-193 Aveiro (Portugal); Pereira, Ruth [CESAM (Centro de Estudos do Ambiente e do Mar), Universidade de Aveiro, Campus de Santiago, 3810-193 Aveiro (Portugal); Departamento de Biologia da Faculdade de Ciências da Universidade do Porto, Rua do Campo Alegre, 4169-007 Porto (Portugal)

2013-02-15

Mining activities invariably produce metal contaminated effluents. Depending on factors such as pH and metal concentration the toxicity of the effluent may vary. To assess the effects of three characteristically different effluent ponds from a deactivated uranium mine, with toxicologically relevant data, an in situ exposure with Pelophylax perezi tadpoles, was conducted. Tadpoles were exposed to the three effluent ponds, ranked by increasing order of metals concentrations (REF, M1, M2). Survival, growth, metal accumulation, antioxidant enzymes (catalase, glutathione peroxidase and glutathione reductase) and lipid peroxidation (LPO) were determined in tadpoles. As well, physical and chemical variables of the effluents were measured. Death percentage in the effluents was 3.17 (REF), 9.84 (M1) and 42.86% (M2) and was not coincident with metal accumulation which was highest in tadpoles exposed to M1, while metal contents in M2 tadpoles were quite similar to those recorded in REF tadpoles. However, high mortality in M2 was attributed to the extremely low pH (≈ 3.77). From the three effluents M2 tadpoles had the lowest growth and the antioxidant enzymatic activity was only affected in the case glutathione peroxidase (GPx) with significantly higher activity in M1, being in accordance with the highest accumulation of metals. LPO, usually associated with metal accumulation, had the following pattern M1 > REF > M2. Overall, effluent toxicity in tadpoles exposed to M2 effluent seems to be primarily an effect of pH while in M1 toxicity is mainly owed to high metal concentrations. The effluent acidity seems to reduce metal accumulation probably due to damage in the integument, affecting ion uptake. The results obtained bring a better understanding of the toxicological processes that local P. perezi population is subjected to, mainly in the early life stages. Furthermore this study highlights the influence of pH in the toxicity of metal rich effluents. - Highlights: �

When a clonal genome finds its way back to a sexual species: evidence from ongoing but rare introgression in the hybridogenetic water frog complex

Czech Academy of Sciences Publication Activity Database

Mikulíček, P.; Kautman, M.; Demovič, B.; Janko, Karel

2014-01-01

Roč. 27, č. 3 (2014), s. 628-642 ISSN 1010-061X R&D Projects: GA ČR GA206/09/1298 Institutional support: RVO:67985904 Keywords : hybridization * hybridogenesis * Pelophylax Subject RIV: EG - Zoology Impact factor: 3.232, year: 2014

Klüver-Bucy syndrome associated with a recessive variant in HGSNAT in two siblings with Mucopolysaccharidosis type IIIC (Sanfilippo C).

Science.gov (United States)

Hu, Hao; Hübner, Christoph; Lukacs, Zoltan; Musante, Luciana; Gill, Esther; Wienker, Thomas F; Ropers, Hans-Hilger; Knierim, Ellen; Schuelke, Markus

2017-02-01

Klüver-Bucy syndrome (KBS) comprises a set of neurobehavioral symptoms with psychic blindness, hypersexuality, disinhibition, hyperorality, and hypermetamorphosis that were originally observed after bilateral lobectomy in Rhesus monkeys. We investigated two siblings with KBS from a consanguineous family by whole-exome sequencing and autozygosity mapping. We detected a homozygous variant in the heparan-α-glucosaminidase-N-acetyltransferase gene (HGSNAT; c.518G>A, p.(G173D), NCBI ClinVar RCV000239404.1), which segregated with the phenotype. Disease-causing variants in this gene are known to be associated with autosomal recessive Mucopolysaccharidosis type IIIC (MPSIIIC, Sanfilippo C). This lysosomal storage disease is due to deficiency of the acetyl-CoA:α-glucosaminidase-N-acetyltransferase, which was shown to be reduced in patient fibroblasts. Our report extends the phenotype associated with MPSIIIC. Besides MPSIIIA and MPSIIIB, due to variants in SGSH and NAGLU, this is the third subtype of Sanfilippo disease to be associated with KBS. MPSIII should be included in the differential diagnosis of young patients with KBS.

Klüver–Bucy syndrome associated with a recessive variant in HGSNAT in two siblings with Mucopolysaccharidosis type IIIC (Sanfilippo C)

Science.gov (United States)

Hu, Hao; Hübner, Christoph; Lukacs, Zoltan; Musante, Luciana; Gill, Esther; Wienker, Thomas F; Ropers, Hans-Hilger; Knierim, Ellen; Schuelke, Markus

2017-01-01

Klüver–Bucy syndrome (KBS) comprises a set of neurobehavioral symptoms with psychic blindness, hypersexuality, disinhibition, hyperorality, and hypermetamorphosis that were originally observed after bilateral lobectomy in Rhesus monkeys. We investigated two siblings with KBS from a consanguineous family by whole-exome sequencing and autozygosity mapping. We detected a homozygous variant in the heparan-α-glucosaminidase-N-acetyltransferase gene (HGSNAT; c.518G>A, p.(G173D), NCBI ClinVar RCV000239404.1), which segregated with the phenotype. Disease-causing variants in this gene are known to be associated with autosomal recessive Mucopolysaccharidosis type IIIC (MPSIIIC, Sanfilippo C). This lysosomal storage disease is due to deficiency of the acetyl-CoA:α-glucosaminidase-N-acetyltransferase, which was shown to be reduced in patient fibroblasts. Our report extends the phenotype associated with MPSIIIC. Besides MPSIIIA and MPSIIIB, due to variants in SGSH and NAGLU, this is the third subtype of Sanfilippo disease to be associated with KBS. MPSIII should be included in the differential diagnosis of young patients with KBS. PMID:27827379

Folikül Büyüklüğü ve Folikül Uyarıcı Hormon Konsantrasyonunun Sığır Oositlerinin İn Vitro Nükleer Olgunlaşması Üzerine Etkisi

Directory of Open Access Journals (Sweden)

Uğur Şen

2015-05-01

Full Text Available Bu çalışma folikül büyüklüğü ve folikül uyarıcı hormon (FSH konsantrasyonunun sığır oositlerinin in vitro nükleer olgunlaşması üzerine etkisini araştırmak amacıyla yapılmıştır. Sığır ovaryumundaki (87 adet foliküller küçük (

Rezension von: Ulrike Klöppel: XX0XY ungelöst. Hermaphroditismus, Sex und Gender in der deutschen Medizin. Eine historische Studie zur Intersexualität. Bielefeld: transcript Verlag 2010.

Directory of Open Access Journals (Sweden)

Sarah Radtke

2010-10-01

Full Text Available Ulrike Klöppel führt in ihrer materialreichen Studie vor, dass Hermaphroditismus für die Medizin immer wieder Anlass war, sich mit der Vielfalt der das Geschlecht bestimmenden Faktoren – Gestalt und Form der Genitalien, Chromosomengeschlecht, Keimdrüsengeschlecht (Hoden vs. Eierstöcke, Hormonhaushalt, Geschlechtsrolle und Geschlechtsidentität – zu befassen und zu versuchen, Geschlechtszugehörigkeiten verbindlich festzulegen. Neben einem historischen Teil, der vor allem die Medizingeschichte der Frühen Neuzeit, der Aufklärungszeit und des 19. Jahrhunderts in den Blick nimmt, wird im zweiten Teil der Arbeit der Zusammenhang zwischen der Formierung des gender-Konzepts und dem damit verbundenen Paradigmenwechsel in der Behandlung von Intersexualität dargestellt.

Phytoremediation potential and ecological and phenological changes of native pioneer plants from weathered oil spill-impacted sites at tropical wetlands.

Science.gov (United States)

Palma-Cruz, Felipe de J; Pérez-Vargas, Josefina; Rivera Casado, Noemí Araceli; Gómez Guzmán, Octavio; Calva-Calva, Graciano

2016-08-01

Pioneer native plant species from weathered oil spill-affected sites were selected to study their potential for phytoremediation on the basis of their ecological and phenological changes during the phytoremediation process. Experiments were conducted in field and in greenhouse. In field, native plants from aged oil spill-impacted sites with up 400 g of weathered petroleum hydrocarbons per kilogram soil were selected. In the impacted sites, the principal dominant plant species with potential for hydrocarbons removal were Cyperus laxus, Cyperus esculentus, and Ludwigia peploides. In greenhouse, the phenology of the selected plant species was drastically affected by the hydrocarbons level above 325 g total petroleum hydrocarbons (TPH) per kilogram soil after 2 years of phytoremediation of soils from the aged oil spill-impacted sites. From the phytoremediation treatments, a mix-culture of C. laxus, C. esculentus, and L. peploides in soil containing 325 g TPH/kg soil, from which 20.3 % were polyaromatic hydrocarbons (PAH) and 34.2 % were asphaltenes (ASF), was able to remove up 93 % of the TPH, while in unvegetated soil the TPH removal was 12.6 %. Furthermore, evaluation of the biodiversity and life forms of plant species in the impacted sites showed that phytoremediation with C. esculentus, alone or in a mix-culture with C. laxus and L. peploides, reduces the TPH to such extent that the native plant community was progressively reestablished by replacing the cultivated species resulting in the ecological recovery of the affected soil. These results demonstrate that native Cyperus species from weathered oil spill-affected sites, specifically C. esculentus and C. laxus, alone or in a mix-culture, have particular potential for phytoremediation of soils from tropical wetlands contaminated with weathered oil hydrocarbons.

Complete Genome Sequence of a Common Midwife Toad Virus-Like Ranavirus Associated with Mass Mortalities in Wild Amphibians in the Netherlands

Science.gov (United States)

Hughes, Joseph; Saucedo, Bernardo; Rijks, Jolianne; Kik, Marja; Haenen, Olga L. M.; Engelsma, Marc Y.; Gröne, Andrea; Verheije, M. Helene; Wilkie, Gavin

2014-01-01

A ranavirus associated with mass mortalities in wild water frogs (Pelophylax spp.) and other amphibians in the Netherlands since 2010 was isolated, and its complete genome sequence was determined. The virus has a genome of 107,772 bp and shows 96.5% sequence identity with the common midwife toad virus from Spain. PMID:25540340

Global exponential stability of periodic solution for shunting inhibitory CNNs with delays

International Nuclear Information System (INIS)

Li Yongkun; Liu Chunchao; Zhu Lifei

2005-01-01

By using the continuation theorem of coincidence degree theory and constructing suitable Lyapunov functions, we study the existence and stability of periodic solution for shunting inhibitory cellular neural networks (SICNNs) with delays x-bar ij (t)=-a ij (t)x ij (t)--bar B kl -bar Nr(i,j)B ij kl (t)f ij (x kl (t))x ij (t)--bar C kl -bar Nr(i,j)C ij kl (t)g ij (x kl (t-τ kl ))x ij (t)+L ij (t)

Protective roles of DMP1 in high phosphate homeostasis.

Directory of Open Access Journals (Sweden)

Afsaneh Rangiani

Full Text Available Dmp1 (dentin matrix protein1 null mice (Dmp1(-/- display hypophosphatemic rickets with a sharp increase in fibroblast growth factor 23 (FGF23. Disruption of Klotho (the obligatory co-receptor of FGF23 results in hyperphosphatemia with ectopic calcifications formed in blood vessels and kidneys. To determine the role of DMP1 in both a hyperphosphatemic environment and within the ectopic calcifications, we created Dmp1/Klotho compound deficient (Dmp1(-/-kl/kl mice.A combination of TUNEL, immunohistochemistry, TRAP, von Kossa, micro CT, bone histomorphometry, serum biochemistry and Scanning Electron Microscopy techniques were used to analyze the changes in blood vessels, kidney and bone for wild type control, Dmp1(-/-, Klotho deficient (kl/kl and Dmp1(-/-kl/kl animals.Interestingly, Dmp1(-/-kl/kl mice show a dramatic improvement of rickets and an identical serum biochemical phenotype to kl/kl mice (extremely high FGF23, hyperphosphatemia and reduced parathyroid hormone (PTH levels. Unexpectedly, Dmp1(-/-kl/kl mice presented elevated levels of apoptosis in osteocytes, endothelial and vascular smooth muscle cells in small and large blood vessels, and within the kidney as well as dramatic increase in ectopic calcification in all these tissues, as compared to kl/kl.These findings suggest that DMP1 has an anti-apoptotic role in hyperphosphatemia. Discovering this novel protective role of DMP1 may have clinical relevance in protecting the cells from apoptosis in high-phosphate environments as observed in chronic kidney disease (CKD.

Effect of cooking methods on the micronutrient profile of selected ...

African Journals Online (AJOL)

Effect of cooking methods on the micronutrient profile of selected vegetables: okra fruit ( Abelmoshcus esculentus ), fluted pumpkin ( Telfairia occidentalis ), African spinach ( Amarantus viridis ), and scent leaf ( Ocumum gratissimum.

Ernst Enno 121 : [Ernst Enno nimelise kirjandusliku omaloominguvõistluse 1996. aasta paremad luuletused

Index Scriptorium Estoniae

1996-01-01

Janek Nee (Haapsalu Wiedemanni gümnaasiumi 11. kl.). Teed lõpmatusse; Liina Krips (Haapsalu gümnaasiumi 12. kl.). Inimene, 'Olin arvanud, et minust hoolitakse...'; Loola Hütt (Haapsalu sanatoorse internaatkooli 13. kl.). 'Mäletad kui hele oli kuu..., 'Jälle ei jõa kuu...', 'Suveöö sumedates silmapilkudes...'; Evelin Lillepuu (Taebla gümnaasiumi 9. kl.). Tuul; Anne Roovere (Kullamaa keskk. 8. kl.). See on koht; Martin Kaasik (Haapsalu Wiedemanni gümnaasiumi 7. kl.). Vembumehed; Külli Kivi (Haapsalu Wiedemanni gümnaasiumi 9. kl.). Vaikus

Global exponential stability of periodic solution for shunting inhibitory CNNs with delays

Energy Technology Data Exchange (ETDEWEB)

Li Yongkun [Department of Mathematics, Yunnan University, Kunming, Yunnan 650091 (China)]. E-mail: yklie@ynu.edu.cn; Liu Chunchao [Department of Mathematics, Yunnan University, Kunming, Yunnan 650091 (China); Zhu Lifei [Department of Mathematics, Yunnan University, Kunming, Yunnan 650091 (China)

2005-03-28

By using the continuation theorem of coincidence degree theory and constructing suitable Lyapunov functions, we study the existence and stability of periodic solution for shunting inhibitory cellular neural networks (SICNNs) with delays x-bar {sub ij}(t)=-a{sub ij}(t)x{sub ij}(t)--bar B{sup kl}-bar Nr(i,j)B{sub ij}{sup kl}(t)f{sub ij}(x{sub kl}(t))x{sub ij}(t)--bar C{sup kl}-bar Nr(i,j)C{sub ij}{sup kl}(t)g{sub ij}(x{sub kl}(t-{tau}{sub kl}))x{sub ij}(t)+L{sub ij}(t)

HERSCHEL FAR-INFRARED SPECTRAL-MAPPING OF ORION BN/KL OUTFLOWS: SPATIAL DISTRIBUTION OF EXCITED CO, H{sub 2}O, OH, O, AND C{sup +} IN SHOCKED GAS

Energy Technology Data Exchange (ETDEWEB)

Goicoechea, Javier R.; Cernicharo, José; Cuadrado, Sara; Etxaluze, Mireya [Instituto de Ciencia de Materiales de Madrid (ICMM-CSIC). Sor Juana Ines de la Cruz 3, E-28049 Cantoblanco, Madrid (Spain); Chavarría, Luis [Centro de Astrobiología, CSIC-INTA, Ctra. de Torrejón a Ajalvir km 4, E-28850 Madrid (Spain); Neufeld, David A. [Department of Physics and Astronomy, Johns Hopkins University, 3400 North Charles Street, Baltimore, MD 21218 (United States); Vavrek, Roland [Herschel Science Center, ESA/ESAC, P.O. Box 78, Villanueva de la Cañada, E-28691 Madrid (Spain); Bergin, Edwin A. [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48109 (United States); Encrenaz, Pierre [LERMA, UMR 8112 du CNRS, Observatoire de Paris, École Normale Supérieure, F-75014 Paris (France); Melnick, Gary J. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, MS 66, Cambridge, MA 02138 (United States); Polehampton, Edward, E-mail: jr.goicoechea@icmm.csic.es [RAL Space, Rutherford Appleton Laboratory, Chilton, Didcot, Oxfordshire OX11 0QX (United Kingdom)

2015-01-20

We present ∼2' × 2' spectral-maps of Orion Becklin-Neugebauer/Kleinmann-Low (BN/KL) outflows taken with Herschel at ∼12'' resolution. For the first time in the far-IR domain, we spatially resolve the emission associated with the bright H{sub 2} shocked regions ''Peak 1'' and ''Peak 2'' from that of the hot core and ambient cloud. We analyze the ∼54-310 μm spectra taken with the PACS and SPIRE spectrometers. More than 100 lines are detected, most of them rotationally excited lines of {sup 12}CO (up to J = 48-47), H{sub 2}O, OH, {sup 13}CO, and HCN. Peaks 1/2 are characterized by a very high L(CO)/L {sub FIR} ≈ 5 × 10{sup –3} ratio and a plethora of far-IR H{sub 2}O emission lines. The high-J CO and OH lines are a factor of ≈2 brighter toward Peak 1 whereas several excited H{sub 2}O lines are ≲50% brighter toward Peak 2. Most of the CO column density arises from T {sub k} ∼ 200-500 K gas that we associate with low-velocity shocks that fail to sputter grain ice mantles and show a maximum gas-phase H{sub 2}O/CO ≲ 10{sup –2} abundance ratio. In addition, the very excited CO (J > 35) and H{sub 2}O lines reveal a hotter gas component (T {sub k} ∼ 2500 K) from faster (v {sub S} > 25 km s{sup –1}) shocks that are able to sputter the frozen-out H{sub 2}O and lead to high H{sub 2}O/CO ≳ 1 abundance ratios. The H{sub 2}O and OH luminosities cannot be reproduced by shock models that assume high (undepleted) abundances of atomic oxygen in the preshock gas and/or neglect the presence of UV radiation in the postshock gas. Although massive outflows are a common feature in other massive star-forming cores, Orion BN/KL seems more peculiar because of its higher molecular luminosities and strong outflows caused by a recent explosive event.

Bicarbonate-sensitive calcification and lifespan of klotho-deficient mice.

Science.gov (United States)

Leibrock, Christina B; Voelkl, Jakob; Kohlhofer, Ursula; Quintanilla-Martinez, Leticia; Kuro-O, Makoto; Lang, Florian

2016-01-01

Klotho, a protein counteracting aging, is a powerful inhibitor of 1,25-dihydroxyvitamin D3 [1,25(OH)2D3] formation and regulator of mineral metabolism. In klotho hypomorphic (kl/kl) mice, excessive 1,25(OH)2D3 formation leads to hypercalcemia, hyperphosphatemia and vascular calcification, severe growth deficits, accelerated aging and early death. Kl/kl mice further suffer from extracellular volume depletion and hypotension, leading to the stimulation of antidiuretic hormone and aldosterone release. A vitamin D-deficient diet, restriction of dietary phosphate, inhibition of mineralocorticoid receptors with spironolactone, and dietary NaCl all extend the lifespan of kl/kl mice. Kl/kl mice suffer from acidosis. The present study explored whether replacement of tap drinking water by 150 mM NaHCO3 affects the growth, tissue calcification, and lifespan of kl/kl mice. As a result, NaHCO3 administration to kl/kl mice did not reverse the growth deficit but substantially decreased tissue calcification and significantly increased the average lifespan from 78 to 127 days. NaHCO3 did not significantly affect plasma concentrations of 1,25(OH)2D3 and Ca(2+) but significantly decreased plasma phosphate concentration and plasma aldosterone concentration. The present study reveals a novel effect of bicarbonate, i.e., a favorable influence on vascular calcification and early death of klotho-deficient mice. Copyright © 2016 the American Physiological Society.

(Abelmoschus esculentus (L.) Moench)

Indian Academy of Sciences (India)

Kundapura V. Ravishankar

as okra, is one of the important pod vegetable crops in tropics and subtropics .... study. Genotypes/accession number. 1. Kashi Vibhuti. 2. Komal 2486. 3. Kashi Lalima. 4 ..... the microsatellite-enriched library method (Phuekvilai and. Wolff 2013 ...

Genetic relationships among West African okra ( Abelmoschus caillei )

African Journals Online (AJOL)

Abelmoschus caillei) and 43 Asian genotypes (A. esculentus) were assessed for genetic distinctiveness and relationships using random amplified polymorphic DNA (RAPD). The molecular analysis showed that all the thirteen primers used ...

Wound healing delays in α-Klotho-deficient mice that have skin appearance similar to that in aged humans - Study of delayed wound healing mechanism.

Science.gov (United States)

Yamauchi, Makoto; Hirohashi, Yoshihiko; Torigoe, Toshihiko; Matsumoto, Yoshitaka; Yamashita, Ken; Kayama, Musashi; Sato, Noriyuki; Yotsuyanagi, Takatoshi

2016-05-13

Skin atrophy and delayed wound healing are observed in aged humans; however, the molecular mechanism are still elusive. The aim of this study was to analyze the molecular mechanisms of delayed wound healing by aging using α-Klotho-deficient (kl/kl) mice, which have phenotypes similar to those of aged humans. The kl/kl mice showed delayed wound healing and impaired granulation formation compared with those in wild-type (WT) mice. The skin graft experiments revealed that delayed wound healing depends on humoral factors, but not on kl/kl skin tissue. The mRNA expression levels of cytokines related to acute inflammation including IL-1β, IL-6 and TNF-α were higher in wound lesions of kl/kl mice compared with the levels in WT mice by RT-PCR analysis. LPS-induced TNF-α production model using spleen cells revealed that TNF-α production was significantly increased in the presence of FGF23. Thus, higher levels of FGF23 in kl/kl mouse may have a role to increase TNF-α production in would lesion independently of α-Klotho protein, and impair granulation formation and delay wound healing. Copyright © 2016 Elsevier Inc. All rights reserved.

The use of hogdahl convention k0 neutron activation analysis (NAA) standardization method and atomic absortion spectroscopy (ASS) for determination of toxic elements in foodstuffs

International Nuclear Information System (INIS)

Ahiamadie, H.

2008-06-01

Copper, cadmium, tin, chromium, arsenic, antimony, vanadium and mercury contents were determined in various foodstuffs (Mussa paradisiaca (plantains), Manihot esculentus (cassavas), Vantosoma sagittifolium (cocoyam). Vantosoma sagittifolium leaves (kontomire), Lycopersicum esculentus (tomatoes), Capsicum species (peppers), Solanum melongena (garden eggs), Nbelmoschus esculentus (okro), and Colocasia esculenta (kooko or taro)) produced in the Wassa West District, Ghana. These plants are the basis of human nutrition in the study area. These elements were determined using Hogdahl convention k 0 Instrumental Neutron Activation Analysis (NAA) Standardization Method and Atomic Absorption Spectroscopy (AAS). The elements in the various foodstuffs and their concentration ranges were Cu (16.87-180.06) mg/kg, As (2.68-9.84) µg/g, Cd (0.63-5.64) µg/g, Hg (0.01-67) ng/g, Cr (0.03-3.66) µg/g, Sb (1.1- 18.6) ng/g, Sn (3.4-58.4) ng/g, and V (12-99) ng/g. The study showed that there are high levels of toxic elements in the foodstuffs grown in the mining areas as compared to that of the non-mining area (i.e., control area). This could be attributed to gold mines pollution. Compared to the World Health Organization (WHO) permissible levels of toxic elements in foods, Cu, Cr and Hg were above the permissible levels whereas the concentrations of As, Cd. Sb, Sn and V fall within the permissible levels. (au)

14-18 yaş arası ergenlerin benlik saygısı ve psikolojik dayanıklılık düzeyleri arasındaki ilişki

OpenAIRE

Sarıkaya, Açelya

2015-01-01

Bu araştırmanın amacı lise çağındaki ergenlerin benlik saygıları ile psikolojik dayanıklılıkları arasındaki ilişkinin incelenmesidir. Bunun yanı sıra teorik anlamda benlik saygısıyla ilişkili olduğu düşünülen; cinsiyet, yaş, doğum sırası, ebeveynlerin eğitim durumu, ebeveynlerin birliktelik durumu, algılanan sosyoekonomik düzey gibi demografik özelliklerin de bu değişkenle ilişkileri araştırılmıştır. Araştırmada ilişkisel tarama modeli kullanılmıştır ve araştırmanın evrenini Yalova ...

Characterization of antimicrobial substance from Lactobacillus salivarius KL-D4 and its application as biopreservative for creamy filling.

Science.gov (United States)

Therdtatha, Phatthanaphong; Tandumrongpong, Chanabhorn; Pilasombut, Komkhae; Matsusaki, Hiromi; Keawsompong, Suttipun; Nitisinprasert, Sunee

2016-01-01

Lactobacillus salivarius KL-D4 isolated from duck intestine produced bacteriocin which was stable at high temperature and a wide pH range of 3-10. Its cell free supernatant at pH 5.5 exhibited wide inhibitory spectrum against both G+ and G- bacteria. The highest bacteriocin production was obtained in MRS broth supplemented with 0.5 % (w/v) CaCO3 at 6 h by gentle shaking. PCR walking using specific primers at the conserved region of class-II bacteriocin resulted in 4 known genes of kld1, kld2, kld3 and kld4 with 100 % similarity to genes encoding for salivaricin α, β, induction peptide and histidine protein kinase of Lb. salivarius GJ-24 which did not previously report for bacteriocin characterization, while showing 94, 93, 59 and 62 % to other salivaricin gene cluster, respectively. The high activities of 25,600 AU/ml indicated a strong induction peptide expressed by kld3 which has low similarity to previous inducer reported. Based on operon analysis, only kld1, kld3 and kld4 could be expressed and subsequently elucidated that only salivaricin α like bacteriocin was produced and secreted out of the cells. Using protein purification, only a single peptide band obtained showed that this strain produced one bacteriocin which could be salivaricin α namely salivaricin KLD showing about 4.3 kDa on SDS-PAGE. Partial purification by 20 % ammonium sulfate precipitation of the product was tested on the artificial contamination of creamy filling by Bacillus cereus, Enterococcus faecalis, Pseudomonas stutzeri, Staphylococcus sp. and Stenotrophomonas sp. resulting the growth inhibitory efficiency of 4.45-66.9, 11.5-100, 100, 0-28.1 and 5-100 % respectively. Therefore, salivaricin KLD can be a tentative biopreservative for food industry in the future.

20. Yüzyıl Âşıklık Geleneğinde Gezginci Bir Âşık: Âşık Talibî Coşkun

OpenAIRE

CERRAHOĞLU, Münir

2013-01-01

Âşık Talibî Coşkun, yaşadığı dönemde unutulmaya yüz tutan âşıklık geleneğine hizmetleri olmuş 20. yüzyılın önemli âşıklarından biridir. Sanatıyla ve eserleriyle edebiyatımıza önemli katkıları olmuş hacimli destanlarıyla adından “destan şairi” olarak söz ettirmiştir. Çok yer gezmesi onu bir “gezgin” ve aynı zamanda bir “gezginci âşık” olmasını sağlamış; bu nedenle kendisi “İkinci Evliya Çelebi, 20. Yüzyılın Evliya Çelebisi, Turizm Halk Şairi” gibi sıfatlarla anılmıştır. Eserlerinde halkın zevk...

Turbulence effects on volatilization rates of liquids and solutes.

Science.gov (United States)

Lee, Jiunn-Fwu; Chao, Huan-Ping; Chiou, Cary T; Manes, Milton

2004-08-15

Volatilization rates of neat liquids (benzene, toluene, fluorobenzene, bromobenzene, ethylbenzene, m-xylene, o-xylene, o-dichlorobenzene, and 1-methylnaphthalene) and of solutes (phenol, m-cresol, benzene, toluene, ethylbenzene, o-xylene, and ethylene dibromide) from dilute water solutions have been measured in the laboratory over a wide range of air speeds and water-stirring rates. The overall transfer coefficients (K(L)) for individual solutes are independent of whether they are in single- or multi-solute solutions. The gas-film transfer coefficients (kG) for solutes in the two-film model, which have hitherto been estimated by extrapolation from reference coefficients, can now be determined directly from the volatilization rates of neat liquids through a new algorithm. The associated liquid-film transfer coefficients (kL) can then be obtained from measured K(L) and kG values and solute Henry law constants (H). This approach provides a novel means for checking the precision of any kL and kG estimation methods for ultimate prediction of K(L). The improved kG estimation enables accurate K(L) predictions for low-volatility (i.e., low-H) solutes where K(L) and kGH are essentially equal. In addition, the prediction of K(L) values for high-volatility (i.e., high-H) solutes, where K(L) approximately equal to kL, is also improved by using appropriate reference kL values.

Download this PDF file

African Journals Online (AJOL)

User

ABSTRACT. The deteriorating effect of microorganisms on tiger nut (Cyperus esculentus) milk has hampered its ..... of food poisoning (Kloos, 1980). .... Food Uses and Health Benefits. American .... Ihekoronye, A.I. and Ngoddy, P.O. (1985).

Morphological classification of genetic diversity in cultivated okra ...

African Journals Online (AJOL)

Morphological classification of genetic diversity in cultivated okra, Abelmoschus esculentus (L) Moench using principal component analysis (PCA) and single linkage cluster analysis (SLCA). CC Nwangburuka, OB Kehinde, DK Ojo, OA Denton, AR Popoola ...

Taxonomic evaluation using pollen grain sculpture and seed coat characters of 11 taxa of genus Hibiscus (Malvaceae in Egypt

Directory of Open Access Journals (Sweden)

M.A. El-Kholy

2011-06-01

Full Text Available Pollen grain morphology and seed coat characters of 11 cultivars belonging to two species of genus Hibiscus (Family Malvaceae namely H. esculentus, H. abelmoschus and H. sabdariffa were investigated. This study was carried out using light microscope (LM and scanning electron microscopy (SEM. Pollen morphology of this genus is fairly uniform. Generally radially symmetrical apolar, mostly spheroidal, pantoporate. Seed exomorphic characters revealed four types of ornamentations; reticulate, ocealate, foveolate and ruminate. Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS–PAGE was employed to characterize those taxa. Thirty-one bands of seed protein profiles have been constructed from the gel. The produced dendrograms that were analyzed by STATISCA program using UPGMA clustering method showed a close affinity among the seven H. esculentus cultivars and the four H. sabdariffa cultivars.

Hybridization studies in Okra (Abelmoschus spp (L.) Moench)

International Nuclear Information System (INIS)

Amitaaba, Theophilus

2016-07-01

Okra (Abelmoschus spp. L. Moench) is an important multi-purpose vegetable crop cultivated and consumed across all tropical and temperate regions of the world. In Ghana, it is popular in all ten regions and increasing quantities are exported to Europe in the fresh form. The crop has received little attention by way of breeding to produce varieties combining the most desirable qualities to boost local cultivation and export. Ten accessions of Abelmoschus spp., comprising two species, A. esculentus (T1, T2, T3, VT, ID and AG) and A. callei (KB, AM, YL and T4) collected from six geographical regions of Ghana were crossed in all possible combinations to assess inter-specific as well as intra-specific hybridisation between and within species. Reciprocal crosses were also carried out and the performances of their F1 offspring were evaluated against the respective parents for expression of heterosis for key quantitative traits including days to 50% germination, days to 50% flowering, plant height, fresh fruit weight, length of pod and number of seeds per pod. Genetic relatedness among the accessions and their progeny was established by way of a dendrogrom based on furthest neighbour method (Euclidean). All six accessions of Abelmoschus esculentus were able to hybridize with one another in both direct and reciprocal cross combinations with high degree of crossability index (CI) (45.71% to 90.32%). On the other hand, cross-compatibility among A. esculentus and A. callei was successful only in one direction when A. esculentus was used asesculentus was used as females also with a CI between 34.48% and 60%. Parental lines T3 and T1 emerged as the most compatible female and male respectively. Crossability success was relatively high during early hours of the day but decreased continuously in subsequent hours. Ten parental accessions and 61 F1 progenies of A. esculentus and A.callei evaluated for 15 qualitative and 8 quantitative traits exhibited significant variations in all

Nigeria Agricultural Journal - Vol 38 (2007)

African Journals Online (AJOL)

Plectranthus esculentus), Hausa potato (Selenosterum rotundifolius) and Tumeric (Curcuma longa) in Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. ON Eke-Okoro, AO Olojede, C Nwadili, 24-30.

Biodigestion of cassava peels blended with pig dung for methane ...

African Journals Online (AJOL)

OKOROIGWE

2013-10-02

Oct 2, 2013 ... Biogas production from cassava (Manihot esculentus) peels and pig dung under a mesophilic ... is a gap to be filled up by further investigation. Ezekoye ..... Biofertilizer and Chemical Fertilizer Application on Maize Production.

Browse Title Index

African Journals Online (AJOL)

Items 51 - 100 of 227 ... ... on Soil Physical Properties in Enugu State South Eastern Nigeria, Abstract PDF ... on hydrocarbon reduction and growth of Abelmoschus esculentus ... volatile oils of Eucalyptus citrodora and lemon grass, Abstract PDF.

Klärung des urheberrechtlichen Status: Wege und Perspektiven in der Deutschen Nationalbibliothek

Directory of Open Access Journals (Sweden)

Kathrin Jockel

2015-12-01

Full Text Available In welcher Weise ein Digitalisat den Nutzerinnen und Nutzern zur Verfügung gestellt werden darf, ist abhängig vom urheberrechtlichen Status des zugrunde liegenden analogen Werks. Dieses kann gemeinfrei sein, weil Urheberrechte erloschen sind, was nach deutschem Recht 70 Jahre nach dem Tod des Urhebers der Fall ist, oder es kann urheberrechtlich geschützt sein, weil der Urheber oder dessen Erben noch Rechte daran halten. Grundsätzlich gilt: Je älter ein Werk, desto wahrscheinlicher ist seine Gemeinfreiheit. Aufgrund des historisch eher jungen Bestandes der Deutschen Nationalbibliothek, deren Sammlung mit dem Erscheinungsjahr 1913 einsetzt, fallen gegenwärtig weit über 90% der Publikationen in den urheberrechtlich geschützten Bereich. Die Deutsche Nationalbibliothek hat 2013 im Rahmen ihrer Digitalisierungsaktivitäten ein Verfahren zur Klärung des Rechtestatus von Werken aufgebaut. Dabei mussten verschiedene Aspekte berücksichtigt werden: neben den rechtlichen Voraussetzungen auch die Wirtschaftlichkeit und die Skalierbarkeit des Arbeitsablaufs auf größere Stückzahlen sowie die Handhabbarkeit der Dokumentation und der Verzeichnung von urheberrechtlich relevanten Informationen im Bibliothekskatalog. Der Workflow kam inzwischen bei mehreren Digitalisierungsprojekten zum Einsatz, unter anderem wurden 22.275 digitalisierte Monografien der Exilsammlungen der Deutschen Nationalbibliothek bearbeitet. Der Vortrag stellt den Workflow zur Rechteklärung anhand des Exil-Projektes vor und gibt einen Ausblick auf die Erweiterungen beispielsweise für andere Medienarten. The way in which a digital copy can be made available to users depends on the copyright status of the original analogue work. It may be public domain because the copyright has expired. Under German law this happens 70 years after the originator’s death. Or it may be copyright-protected because its originator, or his or her heirs, still holds the rights. Basically, the older a

Prevalence, incidence and progression of lumbar spondylosis by gender and age strata.

Science.gov (United States)

Muraki, Shigeyuki; Yoshimura, Noriko; Akune, Toru; Tanaka, Sakae; Takahashi, Ikuno; Fujiwara, Saeko

2014-07-01

To identify the prevalence, incidence and progression of radiographic lumbar spondylosis (LS). From the Adult Health Study conducted by the Radiation Effects Research Foundation, 1,204 participants aged 44-85 years who had lumbar spine radiographs in 1990-1992 were reexamined in 1998-2000 (mean 7.9-year interval). The radiographic severity of LS was determined by Kellgren/Lawrence (KL) grading. In the overall population, the prevalence of radiographic KL ≥ 2 and ≥ 3 LS was 52.9% and 23.6%, respectively. KL ≥ 2 LS was more prevalent in men, whereas KL ≥ 3 LS was more prevalent in women. During the 8-year follow-up, the incidence of KL ≥ 2 LS in men and women was 65.5% and 46.6%, that of KL ≥ 3 LS was 27.3% and 29.5%, that of progressive LS was 31.3% and 34.0%, and multilevel LS was 44.9% and 33.4%, respectively. Body-mass index was a risk factor for both KL ≥ 2 and KL ≥ 3 LS, after adjusting for age and sex. The present longitudinal study revealed the prevalence, incidence and progression of radiographic LS. Prevalence and incidence of KL ≥ 2 LS was higher in men than women, while, those of KL ≥ 3 were similar between men and women.

Genetic analysis of a Y-chromosome region that induces triplosterile phenotypes and is essential for spermatid individualization in Drosophila melanogaster.

Science.gov (United States)

Timakov, B; Zhang, P

2000-01-01

The heterochromatic Y chromosome of Drosophila melanogaster contains approximately 40 Mb of DNA but has only six loci mutable to male sterility. Region h1-h9 on YL, which carries the kl-3 and kl-5 loci, induces male sterility when present in three copies. We show that three separate segments within the region are responsible for the triplosterility and have an additive effect on male fertility. The triplosterile males displayed pleiotropic defects, beginning at early postmeiotic stages. However, the triplosterility was unaffected by kl-3 or kl-5 alleles. These data suggest that region h1-h9 is complex and may contain novel functions in addition to those of the previously identified kl-3 and kl-5 loci. The kl-3 and kl-5 mutations as well as deficiencies within region h1-h9 result in loss of the spermatid axonemal outer dynein arms. Examination using fluorescent probes showed that males deficient for h1-h3 or h4-h9 displayed a postmeiotic lesion with disrupted individualization complexes scattered along the spermatid bundle. In contrast, the kl-3 and kl-5 mutations had no effect on spermatid individualization despite the defect in the axonemes. These results demonstrate that region h1-h9 carries genetically separable functions: one required for spermatid individualization and the other essential for assembling the axonemal dynein arms. PMID:10790393

Nigerian Journal of Chemical Research 1 Vol. 15, 2010 ...

African Journals Online (AJOL)

Hp

University of Benin, GeoEnvironmental & Climate Change Adaptation ... transferability of the metal to okra (Abelmoschus esculentus) plant, and the long term ... to 85% in poultry manure amended soil for As. Post-harvest acid treatment of the ...

Prevalence of radiographic lumbar spondylosis and its association with low back pain in elderly subjects of population-based cohorts: the ROAD study.

Science.gov (United States)

Muraki, S; Oka, H; Akune, T; Mabuchi, A; En-Yo, Y; Yoshida, M; Saika, A; Suzuki, T; Yoshida, H; Ishibashi, H; Yamamoto, S; Nakamura, K; Kawaguchi, H; Yoshimura, N

2009-09-01

Although lumbar spondylosis is a major cause of low back pain and disability in elderly people, few epidemiological studies have been performed. The prevalence of radiographic lumbar spondylosis was investigated in a large-scale population study and the association with low back pain was examined. From a nationwide cohort study (Research on Osteoarthritis Against Disability; ROAD), 2288 participants aged > or =60 years (818 men and 1470 women) living in urban, mountainous and coastal communities were analysed. The radiographic severity at lumbar intervertebral levels from L1/2 to L5/S was determined by Kellgren/Lawrence (KL) grading. In the overall population the prevalence of radiographic spondylosis with KL> or =2 and > or =3 at the severest intervertebral level was 75.8% and 50.4%, respectively, and that of low back pain was 28.8%. Although KL> or =2 spondylosis was more prevalent in men, KL> or =3 spondylosis and low back pain were more prevalent in women. Age and body mass index were risk factors for both KL > or =2 and KL> or =3 spondylosis. Although KL = 2 spondylosis was not significantly associated with low back pain compared with KL = 0 or 1, KL> or =3 spondylosis was related to the pain only in women. This cross-sectional study in a large population revealed a high prevalence of radiographic lumbar spondylosis in elderly subjects. Gender seems to be distinctly associated with KL> or =2 and KL> or =3 lumbar spondylosis, and disc space narrowing with or without osteophytosis in women may be a risk factor for low back pain.

Az ipar 4.0 fogalma, összetevői és hatása az értékláncra ----- Industry 4.0: definition, elements and effect on corporate value chain

OpenAIRE

Nagy, Judit

2017-01-01

Absztrakt: A tanulmány célja, hogy meghatározza az Ipar 4.0 fogalmát és mögé tekintsen, azaz magyarázatot találjon kialakulására, mozgatórugóira és legfőképpen, jelentőségére a vállalati értéklánc szempontjából. A dolgozat során rövid kitekintés erejéig foglalkozom makro, vagy gazdaságpolitikai kérdésekkel, de legfőképpen a vállalati szint vizsgálatára fókuszálok. A tanulmány megírása során azt tapasztaltam, hogy a szakirodalom is még ismerkedik a fogalommal, annak gazdasági hatásaival...

Avoidance, biomass and survival response of soil dwelling (endogeic) earthworms to OECD artificial soil: potential implications for earthworm ecotoxicology.

Science.gov (United States)

Brami, C; Glover, A R; Butt, K R; Lowe, C N

2017-05-01

Soil dwelling earthworms are now adopted more widely in ecotoxicology, so it is vital to establish if standardised test parameters remain applicable. The main aim of this study was to determine the influence of OECD artificial soil on selected soil-dwelling, endogeic earthworm species. In an initial experiment, biomass change in mature Allolobophora chlorotica was recorded in Standard OECD Artificial Soil (AS) and also in Kettering Loam (KL). In a second experiment, avoidance behaviour was recorded in a linear gradient with varying proportions of AS and KL (100% AS, 75% AS + 25% KL, 50% KS + 50% KL, 25% AS + 75% KL, 100% KL) with either A. chlorotica or Octolasion cyaneum. Results showed a significant decrease in A. chlorotica biomass in AS relative to KL, and in the linear gradient, both earthworm species preferentially occupied sections containing higher proportions of KL over AS. Soil texture and specifically % composition and particle size of sand are proposed as key factors that influenced observed results. This research suggests that more suitable substrates are required for ecotoxicology tests with soil dwelling earthworms.

Herschel observations of extraordinary sources: Analysis of the HIFI 1.2 THz wide spectral survey toward orion KL. I. method

Energy Technology Data Exchange (ETDEWEB)

Crockett, Nathan R.; Bergin, Edwin A.; Neill, Justin L.; Favre, Cécile [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48109 (United States); Schilke, Peter [Physikalisches Institut, Universität zu Köln, Zülpicher Str. 77, D-50937 Köln (Germany); Lis, Dariusz C.; Emprechtinger, Martin; Phillips, Thomas G. [Cahill Center for Astronomy and Astrophysics 301-17, California Institute of Technology, Pasadena, CA 91125 (United States); Bell, Tom A.; Cernicharo, José; Esplugues, Gisela B. [Centro de Astrobiología (CSIC/INTA), Laboratiorio de Astrofísica Molecular, Ctra. de Torrejón a Ajalvir, km 4, E-28850 Torrejón de Ardoz, Madrid (Spain); Blake, Geoffrey; Kleshcheva, Maria [Division of Geological and Planetary Sciences, California Institute of Technology, MS 150-21, Pasadena, CA 91125 (United States); Gupta, Harshal; Pearson, John [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States); Lord, Steven [Infrared Processing and Analysis Center, California Institute of Technology, MS 100-22, Pasadena, CA 91125 (United States); Marcelino, Nuria [National Radio Astronomy Observatory, 520 Edgemont Road, Charlottesville, VA 22903 (United States); McGuire, Brett A. [Division of Chemistry and Chemical Engineering, California Institute of Technology Pasadena, CA 91125 (United States); Plume, Rene [Department of Physics and Astronomy, University of Calgary, 2500 University Drive NW, Calgary, AB T2N 1N4 (Canada); Van der Tak, Floris [SRON Netherlands Institute for Space Research, P.O. Box 800, 9700 AV Groningen (Netherlands); and others

2014-06-01

We present a comprehensive analysis of a broadband spectral line survey of the Orion Kleinmann-Low nebula (Orion KL), one of the most chemically rich regions in the Galaxy, using the HIFI instrument on board the Herschel Space Observatory. This survey spans a frequency range from 480 to 1907 GHz at a resolution of 1.1 MHz. These observations thus encompass the largest spectral coverage ever obtained toward this high-mass star-forming region in the submillimeter with high spectral resolution and include frequencies >1 THz, where the Earth's atmosphere prevents observations from the ground. In all, we detect emission from 39 molecules (79 isotopologues). Combining this data set with ground-based millimeter spectroscopy obtained with the IRAM 30 m telescope, we model the molecular emission from the millimeter to the far-IR using the XCLASS program, which assumes local thermodynamic equilibrium (LTE). Several molecules are also modeled with the MADEX non-LTE code. Because of the wide frequency coverage, our models are constrained by transitions over an unprecedented range in excitation energy. A reduced χ{sup 2} analysis indicates that models for most species reproduce the observed emission well. In particular, most complex organics are well fit by LTE implying gas densities are high (>10{sup 6} cm{sup –3}) and excitation temperatures and column densities are well constrained. Molecular abundances are computed using H{sub 2} column densities also derived from the HIFI survey. The distribution of rotation temperatures, T {sub rot}, for molecules detected toward the hot core is significantly wider than the compact ridge, plateau, and extended ridge T {sub rot} distributions, indicating the hot core has the most complex thermal structure.

Author Details

African Journals Online (AJOL)

Plectranthus esculentus), Hausa potato (Selenosterum rotundifolius) and Tumeric (Curcuma longa) in Nigeria Abstract · Vol 39 (2008) - Articles Preliminary elations of temperate sugar beet accession s for tuber yield and quality 8in the high altitude of ...

Establishment of sandwich ELISA for soluble alpha-Klotho measurement: Age-dependent change of soluble alpha-Klotho levels in healthy subjects.

Science.gov (United States)

Yamazaki, Yuji; Imura, Akihiro; Urakawa, Itaru; Shimada, Takashi; Murakami, Junko; Aono, Yukiko; Hasegawa, Hisashi; Yamashita, Takeyoshi; Nakatani, Kimihiko; Saito, Yoshihiko; Okamoto, Nozomi; Kurumatani, Norio; Namba, Noriyuki; Kitaoka, Taichi; Ozono, Keiichi; Sakai, Tomoyuki; Hataya, Hiroshi; Ichikawa, Shoji; Imel, Erik A; Econs, Michael J; Nabeshima, Yo-Ichi

2010-07-30

Alpha-Klotho (alphaKl) regulates mineral metabolism such as calcium ion (Ca(2+)) and inorganic phosphate (Pi) in circulation. Defects in mice result in clinical features resembling disorders found in human aging. Although the importance of transmembrane-type alphaKl has been demonstrated, less is known regarding the physiological importance of soluble-type alphaKl (salphaKl) in circulation. The aims of this study were: (1) to establish a sandwich ELISA system enabling detection of circulating serum salphaKl, and (2) to determine reference values for salphaKl serum levels and relationship to indices of renal function, mineral metabolism, age and sex in healthy subjects. We successively developed an ELISA to measure serum salphaKl in healthy volunteers (n=142, males 66) of ages (61.1+/-18.5year). The levels (mean+/-SD) in these healthy control adults were as follows: total calcium (Ca; 9.46+/-0.41mg/dL), Pi (3.63+/-0.51mg/dL), blood urea nitrogen (BUN; 15.7+/-4.3mg/dL), creatinine (Cre; 0.69+/-0.14mg/dL), 1,25 dihydroxyvitamin D (1,25(OH)(2)D; 54.8+/-17.7pg/mL), intact parathyroid hormone (iPTH; 49.2+/-20.6pg/mL), calcitonin (26.0+/-12.3pg/mL) and intact fibroblast growth factor (FGF23; 43.8+/-17.6pg/mL). Serum levels of salphaKl ranged from 239 to 1266pg/mL (mean+/-SD; 562+/-146pg/mL) in normal adults. Although salphaKl levels were not modified by gender or indices of mineral metabolism, salphaKl levels were inversely related to Cre and age. However, salphaKl levels in normal children (n=39, males 23, mean+/-SD; 7.1+/-4.8years) were significantly higher (mean+/-SD; 952+/-282pg/mL) than those in adults (mean+/-SD; 562+/-146, Plevel was notably lower than those of age-matched controls. We established a detection system to measure human serum salphaKl for the first time. Age, Ca and Pi seem to influence serum salphaKl levels in a normal population. This detection system should be an excellent tool for investigating salphaKl functions in mineral metabolism. Copyright

Gambaran Pasien Tuli Mendadak di Bagian THT-KL RSUP Dr. M. Djamil Padang

Directory of Open Access Journals (Sweden)

Hedo Hidayat

2016-08-01

Full Text Available AbstrakTuli mendadak adalah penurunan pendengaran sensorineural yang berlangsung dalam waktu kurang dari 72 jam. Penyakit ini merupakan salah satu kegawatdaruratan neurotologi dan memerlukan penatalaksanaan dini untuk menghindari kecacatan yang dapat ditimbulkan. Tujuan penelitian ini adalah melihat gambaran kejadian tuli mendadak di Bagian THT-KL RSUP Dr. M.Djamil. Ini merupakan penelititan deskriptif retrospektif dengan menggunakan data rekam medik di RSUP Dr. M. Djamil Padang selama tahun 2010 sampai tahun 2013. Didapatkan hasil sebanyak 26 kasus yang masuk kriteria inklusi pada periode tersebut. Sebaran umur penderita dari 8 sampai 79 tahun, dengan distribusi terbanyak pada usia 40 – 60 tahun. Faktor resiko yang ditemukan berupa hipertensi dan diabetes melitus sama besar yaitu 11,54%. Gejala klinis terdiri atas tinitus (76,92%, diikuti vertigo (38,46%, dan rasa penuh di telinga (15,38%. Pasien terbanyak pada derajat ketulian sangat berat (38,46%, kemudian derajat sedang berat dan berat (23,08%, diikuti derajat ringan (11,54% dan sedang (3,85%. Distribusi onset terapi terbanyak pada 0 – 7 hari (50,00%, kemudian onset > 14 hari (30,77% dan onset 8 – 14 hari (19,23%. Perbaikan pendengaran ditemukan sama banyak pada kategori sangat baik dan baik sebanyak 6 kasus dan diikuti kategori sembuh satu kasus. Dari penelitian ini dapat dikatakan tidak hanya satu faktor yang menentukan perbaikan tuli mendadak.Kata kunci: tuli mendadak, retrospektif, gejala klinis1Mahasiswa FK Unand, 2Bagian Pulmonologi FK Unand, 3Bagian Patologi Anatomi FK UnandAbstractSudden deafness is a sensorineural hearing loss  in less than 72 hours. Sudden deafness is a neurotological emergency and requiring an early management to avoid the defects that can be caused. The objective of  this study was to see cases of sudden deafness in Dr. M. Djamil General Hospital. This was a descriptive research with retrospective design using medical record data in Dr. M. Djamil General

Beneficial effect of medicinal plants on the contractility of post-hypoxic isolated guinea pig atria - Potential implications for the treatment of ischemic-reperfusion injury

NARCIS (Netherlands)

Bipat, Robbert; Toelsie, Jerry R.; Magali, Indira; Soekhoe, Rubaina; Stender, Karin; Wangsawirana, Angelique; Oedairadjsingh, Krishan; Pawirodihardjo, Jennifer; Mans, Dennis R. A.

Context Ischemic-reperfusion injury is accompanied by a decreased contractility of the myocardium. Positive-inotropic agents have proven useful for treating this condition but may exert serious side-effects.Objective In this study, aqueous preparations from Abelmoschus esculentus L. Moench

WATER AND PHYSIOLOGICAL RESPONSES OF OKRA ...

African Journals Online (AJOL)

H. Rahim Guealia

1 sept. 2017 ... for agricultural production. ... bentonite (WB) under controlled greenhouse conditions. ..... esculentus L.) âgées de deux mois cultivé sur substrat sans ..... Kırnak H et Taş I. Amelioratrive effect of calcium nitrate on cucumber.

Vecāku prombūtnes un klātesošā vecāka audzināšanas pieejas saistība ar pusaudžu depresijas pazīmēm

OpenAIRE

Ločmele, Renāte

2014-01-01

Pētījuma mērķis bija noskaidrot, kādas ir saistības starp vecāku prombūtni, klātesošā vecāka audzināšanas pieeju un pusaudžu depresijas pazīmēm. Pētījumā piedalījās 62 respondenti – 37 meitenes un 25 zēni vecumā no 11 līdz 16 gadiem. Respondentu vidējais vecums bija 14 gadi. Tie tika sadalīti divās grupās: vienā grupā bija pusaudži, kuriem viens no vecākiem atrodas prombūtnē (n=31), otrā grupā bija pusaudži, kas dzīvo kopā ar abiem vecākiem ( n=31). Datu ievākšanai tika izmantotas sekojoš...

A homozygous missense mutation in human KLOTHO causes severe tumoral calcinosis

Science.gov (United States)

Ichikawa, Shoji; Imel, Erik A.; Kreiter, Mary L.; Yu, Xijie; Mackenzie, Donald S.; Sorenson, Andrea H.; Goetz, Regina; Mohammadi, Moosa; White, Kenneth E.; Econs, Michael J.

2007-01-01

Familial tumoral calcinosis is characterized by ectopic calcifications and hyperphosphatemia due to inactivating mutations in FGF23 or UDP-N-acetyl-α-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GALNT3). Herein we report a homozygous missense mutation (H193R) in the KLOTHO (KL) gene of a 13-year-old girl who presented with severe tumoral calcinosis with dural and carotid artery calcifications. This patient exhibited defects in mineral ion homeostasis with marked hyperphosphatemia and hypercalcemia as well as elevated serum levels of parathyroid hormone and FGF23. Mapping of H193R mutation onto the crystal structure of myrosinase, a plant homolog of KL, revealed that this histidine residue was at the base of the deep catalytic cleft and mutation of this histidine to arginine should destabilize the putative glycosidase domain (KL1) of KL, thereby attenuating production of membrane-bound and secreted KL. Indeed, compared with wild-type KL, expression and secretion of H193R KL were markedly reduced in vitro, resulting in diminished ability of FGF23 to signal via its cognate FGF receptors. Taken together, our findings provide what we believe to be the first evidence that loss-of-function mutations in human KL impair FGF23 bioactivity, underscoring the essential role of KL in FGF23-mediated phosphate and vitamin D homeostasis in humans. PMID:17710231

Turbulence effects on volatilization rates of liquids and solutes

Science.gov (United States)

Lee, J.-F.; Chao, H.-P.; Chiou, C.T.; Manes, M.

2004-01-01

Volatilization rates of neat liquids (benzene, toluene, fluorobenzene, bromobenzene, ethylbenzene, m-xylene, o-xylene, o-dichlorobenzene, and 1-methylnaphthalene) and of solutes (phenol, m-cresol, benzene, toluene, ethylbenzene, o-xylene, and ethylene dibromide) from dilute water solutions have been measured in the laboratory over a wide range of air speeds and water-stirring rates. The overall transfer coefficients (KL) for individual solutes are independent of whether they are in single- or multi-solute solutions. The gas-film transfer coefficients (kG) for solutes in the two-film model, which have hitherto been estimated by extrapolation from reference coefficients, can now be determined directly from the volatilization rates of neatliquids through anew algorithm. The associated liquid-film transfer coefficients (KL) can then be obtained from measured KL and kG values and solute Henry law constants (H). This approach provides a novel means for checking the precision of any kL and kG estimation methods for ultimate prediction of KL. The improved kG estimation enables accurate K L predictions for low-volatility (i.e., low-H) solutes where K L and kGH are essentially equal. In addition, the prediction of KL values for high-volatility (i.e., high-H) solutes, where KL ??? kL, is also improved by using appropriate reference kL values.

In silico Analysis and Experimental Validation of Lignan Extracts from Kadsura longipedunculata for Potential 5-HT1AR Agonists.

Directory of Open Access Journals (Sweden)

Yaxin Zheng

Full Text Available Kadsura longipedunculata (KL has been widely used for the treatment of insomnia in traditional Chinese medicine. The aim of this study was to explore the mechanism of the sedative and hypnotic effects of KL.The content of KL was evaluated by HPLC-TOF-MS, and a potential target was found and used to construct its 3D structure to screen for potential ligands among the compounds in KL by using bioinformatics analysis, including similarity ensemble approach (SEA docking, homology modeling, molecular docking and ligand-based pharmacophore. The PCPA-induced insomnia rat model was then applied to confirm the potential targets related to the sedative effects of KL by performing the forced swimming test (FST, the tail suspension test (TST and the measurement of target-related proteins using western blotting and immunofluorescence.Bioinformatics analysis showed that most of lignan compounds in KL were optimal ligands for the 5-HT1A receptor (5-HT1AR, and they were found to be potential targets related to sedative effects; the main lignan content of KL extracts was characterized by HPLC-TOF-MS, with 7 proposed lignans detected. Administration of KL could significantly reduce FST and TST immobility time in the PCPA-induced 5HT-depleted insomnia rat model. The expressions of proteins related to the 5-HT1AR pathway were regulated by extracts of KL in a concentration-dependent manner, indicating that extracts of KL had 5-HT1AR agonist-like effects.In silico analysis and experimental validation together demonstrated that lignan extracts from KL can target 5-HT1AR in insomniac rats, which could shed light on its use as a potential 5-HT1AR agonist drug.

Efeito do bentazon e bentazon + dichlorprop na cultura do arroz irrigado e sobre as plantas daninhas Effect of bentazon and bentazon + dichlorprop on irrigated rice and weeds

Directory of Open Access Journals (Sweden)

C.A.L. dos Santos

1979-06-01

Full Text Available Foi instalado um experimento de campo, em solo barrento, com a finalidade de se verificar o efeito do bentazon e da mistura de bentazon + dichlorprop sobre o desenvolvimento do arroz em cultura irrigada e sobre o controle das plantas daninhas. Os tratamentos utilizados foram os seguintes: bentazon á 0,75-1,00 e1,50 kg/ha; bentazon + dichlorprop a 0,80 + 1,00 e 1,00 + 1,40 kg/ha; propanil a 4,20 kg/ha (tratamento padrão; testemunha capinada e testemunha sem capina. Todas as pulverizações foram realizadas em pósemergência. As plantas daninhas encontradas no experimento foram: capituva - Echinochloa colonum (L Link, tiririca amarela - Cyperus esculentus L., beldroega - Portulaca oleracea L. e carurú comum - Amaranthus viridis L. Bentazon a 1,00 e 1,50 kg/ha e bentazon + dichlorprop a 1,00 + 1,40 kg/ha foram eficientes no controle de P. oleracea, A. viridis e C. esculentus; já a dose menor de bentazon apresentou bons resultados contra P. oleracea e A. viridis, enquanto que a dose menor de bentazon + dichlorprop controlou apenas P. oleracea. Propanil, de uma maneira geral, proporcionou eficiente ação sobre as plantas daninhas. Nas condições em que foi realizado o experimento nenhum dos herbicidas, nas suas respectivas doses, apresentou fitotoxicidade para as plantas de arroz da variedade IAC-435 ou prejudicou a produção da cultura.Bentazon at 0.75 - 1.00 and 1.50 kg/ha a.i ., bentazon + dichlorprop at 0.80 + 1.00 and 1.00 + 1.40 kg and propanil at 4.20 kg were applied in post-emergence on irrigated rice, against the following weeds: Echinochloa colonum (L. Link, Cy-perus esc-ulentus L., Portulaca oleracea L. and Amaranthus viridis L. Bentazon at 1.00 - 1.50 kg and bentazon + dichlorprop at 1.00 + 1.40 kg gave good control of P. oleracea, A. viridis and C. esculentus; bentazon at 0.75 kg controlled P. oleracea and A. viridis; bentazon + dichlorprop at 0.80 + 1.00 kg only showed effeciency for P. oleracea; propanil, in general, gave good

effect of the liming materials and rates on plant growth and nutrient ...

African Journals Online (AJOL)

Mrs Ify Greg Onwuka

(Elaeis guineensis), raphia palm (Raphia spp), cocoyam (Colocasia esculentus), avocado tree (Persea. Americana), shrubs (mainly Sponelias munibin) and sparsely distributed grasses. The upland farm close to this stream was grown to cassava (Manihot esculenta), pepper (Capsicum spp), and yam (Dioscorea spp). The.

Plant species responses to oil degradation and toxicity reduction in ...

African Journals Online (AJOL)

Vegetated plots were established by planting different plant species – legumes and vegetable (Abelmoschus, esculentus, Telfaria occidentalis and Vigna unguiculata) and applied with sawdust and chromolaena leaves at different intensities of oil pollution. Toxicity of the soil was evaluated using germination percentage, ...

On the botanical distribution of chiral forms of gossypol

DEFF Research Database (Denmark)

Jaroszewski, J W; Strøm-Hansen, T; Hansen, S H

1992-01-01

to the cotton tribe (Gossypieae) contained gossypol (detection limit better than 0.001%). In particular, no gossypol could be detected in ABELMOSCHUS ESCULENTUS (ocra), HIBISCUS TILIACEUS, H. SABDARIFFA, and HEREA BRASI-LIENSIS, earlier claimed to contain this compound. Gossypol-containing plants usually...

Nomenclatural notes on living and fossil amphibians

Directory of Open Access Journals (Sweden)

Martín, C.

2012-06-01

Taylor, 1942; Lithobates rexroadensis for Rana rexroadensis Taylor, 1942; Lithobates robustocondylus for Anchylorana robustocondyla Taylor, 1942; Ommatotriton roehrsi for Triturus roehrsi Herre, 1955; Pelophylax barani for Rana barani Rückert-Ülkumen, 1980; Pelophylax meriani for Rana meriani Meyer, 1853; Pelophylax pueyoi for Rana pueyoi Navás, 1922a; Pelophylax quellenbergi for Rana quellenbergi Navás, 1922; Philoria borealis for Kyarranus borealis Tyler, 1991; Pseudepidalea belogorica for Bufo belogoricus Ratnikov, 1993; Pseudepidalea plana for Bufo planus Ratnikov, 1993; Pseudepidalea prisca for Bufo priscus Spinar, Klembara et Meszáros, 1993, and Pseudepidalea stranensis for Bufo stranensis Nemec, 1972. The names Geyeriellinae Brame, 1958, Palaeurodelidae Brame, 1958, Prosalamandridae Stefano, 1903, Lipelucidae Huene, 1956, Rana temporaria fossilis Stefanov, 1951, Salteniidae Kuhn, 1962, Vieraellidae Reig, 1961, and Voigtiellinae Brame, 1958 are nomenclaturally deemed unavailable. The family name based on Scapherpeton Cope, 1876 is Scapherpetidae and not Scapherpetonidae nor Scapherpetontidae.

Una revisión de anfibios extintos y actuales en estado fósil (Allocaudata, Anura y Caudata ha permitido detectar diversos casos que precisan cambios nomenclaturales a fin de estabilizar la taxonomía del grupo. Los cambios nomenclaturales incluyen homonimias, correcciones de variantes gramaticales y autorías, disponibilidad de nombres, y en especial la propuesta de nuevas combinaciones, necesarias para ajustar algunos taxones paleontológicos a los modelos de relaciones evolutivas entre formas vivientes, fundamentados en filogenias moleculares. Las nuevas combinaciones que se proponen son: Anaxyrus defensor para Bufo defensor Meylan, 2005; Anaxyrus hibbardi para

Acinetobacter baumannii K11 and K83 capsular polysaccharides have the same 6-deoxy-l-talose-containing pentasaccharide K units but different linkages between the K units.

Science.gov (United States)

Kenyon, Johanna J; Shashkov, Alexander S; Senchenkova, Sof'ya N; Shneider, Mikhail M; Liu, Bin; Popova, Anastasiya V; Arbatsky, Nikolay P; Miroshnikov, Konstantin A; Wang, Lei; Knirel, Yuriy A; Hall, Ruth M

2017-10-01

Acinetobacter baumannii produces a variety of capsular polysaccharides (CPS) via genes located at the chromosomal K locus and some KL gene clusters include genes for the synthesis of specific sugars. The structures of K11 and K83 CPS produced by isolates LUH5545 and LUH5538, which carry related KL11a and KL83 gene clusters, respectively, were established by sugar analysis and one- and two-dimensional 1 H and 13 C NMR spectroscopy. Both CPS contain l-rhamnose (l-Rha) and 6-deoxy-l-talose (l-6dTal), and both KL gene clusters include genes for dTDP-l-Rhap synthesis and a tle (talose epimerase) gene encoding an epimerase that converts dTDP-l-Rhap to dTDP-l-6dTalp. The K11 and K83 repeat units are the same pentasaccharide, consisting of d-glucose, l-Rha, l-6dTal, and N-acetyl-d-glucosamine, except that l-6dTal is 2-O-acetylated in K83. However, the K units are linked differently, with l-Rha in the main chain in K11, but as a side-branch in K83. KL11 and KL83 encode unrelated Wzy polymerases that link the K units together and different acetyltransferases, though only Atr8 from KL83 is active. The substrate specificity of each Wzy polymerase was assigned, and the functions of all glycosyltransferases were predicted. The CPS structures produced by three closely related K loci, KL29, KL105 and KL106, were also predicted. Copyright © 2017 Elsevier B.V. All rights reserved.

Outflow of traffic from the national capital Kuala Lumpur to the north, south and east coast highways using flow, speed and density relationships

Institute of Scientific and Technical Information of China (English)

Nik Hashim Nik Mustapha; Nik Nur Wahidah Nik Hashim

2016-01-01

The functional relationships between flow (veh/km), density (veh/h) and speed (km/h) in traffic congestion have a long history of research. However, their findings and techniques persist to be relevant to this day. The analysis is pertinent, particularly in finding the best fit for the three major highways in Malaysia, namely the KL-Karak Highway, KL-Seremban Highway and KL-Ipoh Highway. The trans-logarithm function of density—speed model was compared to the classical models of Greenshields, Greenberg, Underwood and Drake et al. using data provided by the Transport Statistics Malaysia 2014. The results of regression analysis revealed that the Greenshields and Greenberg models were statistically signifi-cant. The trans-logarithm function was also tested and the results were nonetheless without exception. Its usefulness in addition to statistical significance related to the derived economic concepts of maximum speed and the related number of vehicles, flow and density and the limits of free speed were relevant in comparing the individual levels of traffic congestion between highways. For instance, KL-Karak Highway was least congested compared to KL-Seremban Highway and KL-Ipoh Highway. Their maximum speeds, based on three lanes carriage capacity of one direction, were 33.4 km/h for KL-Karak, 15.9 km/h for KL-Seremban, and 21.1 km/h for KL-Ipoh. Their corresponding flows were approxi-mated at 1080.9 veh/h, 1555.4 veh/h, and 1436.6 veh/h.

African Journal of Biotechnology - Vol 10, No 54 (2011)

African Journals Online (AJOL)

Morphological classification of genetic diversity in cultivated okra, Abelmoschus esculentus (L) Moench using principal component analysis (PCA) and single ... Evaluation of 14 winter bread wheat genotypes in normal irrigation and stress conditions after anthesis stage · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

Journal of Genetics | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Journal of Genetics. SUBRATA DUTTA. Articles written in Journal of Genetics. Volume 97 Issue 1 March 2018 pp 25-33 RESEARCH ARTICLE. Genetic control of yellow vein mosaic virus disease tolerance in Abelmoschus esculentus (L.) Moench · PUSHPARANI SENJAM BIJOY KUMAR SENAPATI ARUP ...

Physicochemical and Sensory Properties, and In-Vitro Digestibility of ...

African Journals Online (AJOL)

Physicochemical and Sensory Properties, and In-Vitro Digestibility of Biscuits Made from Blends of Tigernut ( Cyperus esculentus ) and Pigeon Pea ( Cajanus cajan ) ... Nigerian Journal of Nutritional Sciences ... Objective: The study explored the potential of tigernut and pigeon pea flour blends in the preparation of biscuits.

Serum periostin is associated with prevalent knee osteoarthritis and disease incidence/progression in women: the OFELY study.

Science.gov (United States)

Rousseau, J C; Sornay-Rendu, E; Bertholon, C; Garnero, P; Chapurlat, R

2015-10-01

Our aim was to investigate the relationships between serum periostin (POSTN) and both prevalence and incidence/progression of knee osteoarthritis (OA) in women. We investigated 594 women (62.7 ± 11.2 yr) from the OFELY cohort. Knee radiographs were scored according to the Kellgren & Lawrence (KL) grading system at baseline and 4 years later. Spine, hip and hand OA were assessed at baseline. Prevalent knee OA was defined by a KL score higher or equal in 2. Progression of KL was defined as an increase of the KL score ≥1 during the 4 years follow-up. Serum POSTN was measured at baseline by ELISA. By non-parametric tests, POSTN was significantly lower in 83 women with a KL score ≥2 at baseline, compared to those with a KL score women. Copyright © 2015 Osteoarthritis Research Society International. Published by Elsevier Ltd. All rights reserved.

Microstructural investigation into calcium phosphate biomaterials by spatially resolved cathodoluminescence

Energy Technology Data Exchange (ETDEWEB)

Goetze, J.; Heimann, R.B.; Hildebrandt, H. [Freiberg Univ. of Mining and Technology (Germany). Dept. of Mineralogy; Gburek, U. [Wuerzburg Univ. (Germany). Dept. of Experimental Dentistry

2001-02-01

From cathodoluminescence (CL) investigations of synthetic and natural calcium phosphates it can be concluded that the CL of pure synthetic apatite is mainly characterized by intrinsic luminescence, whereas the luminescence of naturally occurring apatites is frequently activated by trace elements. CL revealed internal structures within plasma-sprayed hydroxyapatite coatings which were not discernible by SEM-BSE imaging. However, cathodoluminescence microscopy alone can presently not be used in every case to characterize synthetic calcium phosphate biomaterials because of the dominant intrinsic blue CL emission. In the future, optimum results will likely be achieved by using a combination of CL microscopy and spectroscopy with other spatially resolved analytical methods such as SEM-BSE, SEM-CL or micro-Raman spectroscopy. In the present study, different types of tetracalcium phosphate dental cements could be distinguished due to varying CL colours and CL spectra that are caused by a different content of impurity Mn. These results emphasize the advantages of spectral CL measurements for spatially resolved detection of trace elements in solids. (orig.) [German] Ergebnisse von Kathodolumineszenz- (KL-) Untersuchungen synthetischer und natuerlicher Apatite zeigen, dass die KL synthetischer Apatite vorrangig durch intrinsische Lumineszenz gekennzeichnet ist, waehrend die KL natuerlicher Apatite meist durch Spurenlemente aktiviert wird. Mittels KL koennen Internstrukturen in plasmagespritzten Hydroxylapatit-Schichten sichtbar gemacht werden, die im REM-BSE nicht nachweisbar sind. Allerdings kann die KL-Mikroskopie aufgrund der dominierenden blauen intrinsischen Lumineszenz gegenwaertig nicht als alleinige Untersuchungsmethode zur Charakterisierung von Calciumphosphat Biomaterialien eingesetzt werden. Optimale Resultate werden zukuenftig durch Kombination von KL-Mikrroskopie und -spektroskopie mit anderen ortsaufgeloesten analytischen Methoden wie REM-BSE, REM-KL oder Mikro

[Research on Rapid Discrimination of Edible Oil by ATR Infrared Spectroscopy].

Science.gov (United States)

Ma, Xiao; Yuan, Hong-fu; Song, Chun-feng; Hu, Ai-qin; Li, Xiao-yu; Zhao, Zhong; Li, Xiu-qin; Guo Zhen; Zhu, Zhi-qiang

2015-07-01

A rapid discrimination method of edible oils, KL-BP model, was proposed by attenuated total reflectance infrared spectroscopy. The model extracts the characteristic of classification from source data by KL and reduces data dimension at the same time. Then the neural network model is constructed by the new data which as the input of the model. 84 edible oil samples which include sesame oil, corn oil, canola oil, blend oil, sunflower oil, peanut oil, olive oil, soybean oil and tea seed oil, were collected and their infrared spectra determined using an ATR FT-IR spectrometer. In order to compare the method performance, principal component analysis (PCA) direct-classification model, KL direct-classification model, PLS-DA model, PCA-BP model and KL-BP model are constructed in this paper. The results show that the recognition rates of PCA, PCA-BP, KL, PLS-DA and KL-BP are 59.1%, 68.2%, 77.3%, 77.3% and 90.9% for discriminating the 9 kinds of edible oils, respectively. KL extracts the eigenvector which make the distance between different class and distance of every class ratio is the largest. So the method can get much more classify information than PCA. BP neural network can effectively enhance the classification ability and accuracy. Taking full of the advantages of KL in extracting more category information in dimension reducing and the features of BP neural network in self-learning, adaptive, nonlinear, the KL-BP method has the best classification ability and recognition accuracy and great importance for rapidly recognizing edible oil in practice.

Outflow of traffic from the national capital Kuala Lumpur to the north, south and east coast highways using flow, speed and density relationships

Directory of Open Access Journals (Sweden)

Nik Hashim Nik Mustapha

2016-12-01

Full Text Available The functional relationships between flow (veh/km, density (veh/h and speed (km/h in traffic congestion have a long history of research. However, their findings and techniques persist to be relevant to this day. The analysis is pertinent, particularly in finding the best fit for the three major highways in Malaysia, namely the KL-Karak Highway, KL-Seremban Highway and KL-Ipoh Highway. The trans-logarithm function of density–speed model was compared to the classical models of Greenshields, Greenberg, Underwood and Drake et al. using data provided by the Transport Statistics Malaysia 2014. The results of regression analysis revealed that the Greenshields and Greenberg models were statistically significant. The trans-logarithm function was also tested and the results were nonetheless without exception. Its usefulness in addition to statistical significance related to the derived economic concepts of maximum speed and the related number of vehicles, flow and density and the limits of free speed were relevant in comparing the individual levels of traffic congestion between highways. For instance, KL-Karak Highway was least congested compared to KL-Seremban Highway and KL-Ipoh Highway. Their maximum speeds, based on three lanes carriage capacity of one direction, were 33.4 km/h for KL-Karak, 15.9 km/h for KL-Seremban, and 21.1 km/h for KL-Ipoh. Their corresponding flows were approximated at 1080.9 veh/h, 1555.4 veh/h, and 1436.6 veh/h.

Kuzeydoğu Anadolu Bölgesi Kapsamında Su Ürünleri Sektörünün Ulaşabileceği Potansiyel Büyüklüğünün Mali Projeksiyonu / Financial Projection of Potential of Aquaculture Sector in Northern Anatolia

OpenAIRE

Aras, N. Mevlüt; Yanık, Telat; Kocaman, E. Mahmut; Haliloğlu, H. İbrahim

2011-01-01

ÖZET: Bu çalışmada Doğu Anadolu Projesi (DAP) kapsamında merkezi hükümet tarafından yürütülen alt yapı destekleme programının aksatılmadan devreye girmesiyle daha çok Kuzeydoğu Anadolu Bölgesi illerinde ulaşılabilecek potansiyelin mali büyüklüğü üzerinde durulmuştur. Ayrıca projelerin katma değerleri açısından istihdam kapasitesi, sosyal değeri ve illere...

KOKO KL.xps

African Journals Online (AJOL)

HP Pro 2000

En Côte d'Ivoire, le cacaoyer (Theobroma cacao L.) est traditionnellement cultivé selon un système extensif et itinérant, utilisant du matériel végétal peu performant. Les rendements en cacao sont donc faible (260 à 600 kg·ha-1·an-1). Pour améliorer la productivité des cacaoyères, les chercheurs ivoiriens ont mis au point.

KL63 METAR

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...

KL38 METAR

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...

Distúrbios neuropsiquiátricos por lesões bilaterais do lobo temporal: síndrome de Klüver e Bucy

Directory of Open Access Journals (Sweden)

José Longman

1957-03-01

Full Text Available Estudo clínico e paraclíníco de uma criança do sexo feminino, de quatro anos de idade, que, após um processo encefalopático agudo, de etiologia não esclarecida, apresentou um quadro neuropsiquiátrico comparável ao descrito por Klüver e Bucy em primatas sub-humanos, após lobectomia temporal bilateral. O quadro clínico caracterizou-se por: hipermetamorfose, tendência oral, cegueira psíquica com conservação da acuidade visual e, aparentemente, dos campos visuais, afasia global, ausência de reação os estímulos auditivos e olfativos, não participação táctil no reconhecimento dos objetos e alterações afetivas (ausência das reações de medo e raiva, assim como do riso. A paciente foi observada no período de 7 meses, tendo apresentado somente modificações moderadas, no sentido de atenuação das manifestações. A pneumoventriculografia, a pneumocisternografia e a isotopoencefalometria objetivaram um comprometimento bilateral da região fronto-temporal. Entretanto, êstes exames não esclareceram a natureza das lesões, nem mesmo se os distúrbios decorriam apenas do processo relacionado com a moléstia atual ou se - visto tratar-se de paciente que desde os dois anos de idade vinha apresentando crises convulsivas - se correspondiam a uma disgenesia cerebral. Dada a importância de que se reveste a observação dêste caso, foram comentadas, em relação à fisiopatologia cerebral, algumas das principais manifestações psicopatológicas.

Phytochemical screening and nutrient-antinutrient composition of ...

African Journals Online (AJOL)

Levels of some nutrients and antinutrients in 14 commonly consumed tropical green leafy vegetables were evaluated and also screened for some phytochemicals. Saponin was present in all the vegetables with the exception of Hibiscus esculentus, Solanum macrocarpon and Piper guineese while only tannin was absent in ...

Chemical, physical and biological features of Okra pectin

NARCIS (Netherlands)

Sengkhamparn, N.

2009-01-01

In Thailand, many plants have been used as vegetables as well as for traditional
medicine. Okra, Abelmoschus esculentus (L.) Moench, is an example of such a plant.
Examples for the medical use are treatment of gastric irritation, treatment of dental
diseases, lowering cholesterol

Infrared spectra of 4HeH+, 4HeD+, 3HeH+, and 3HeD+

International Nuclear Information System (INIS)

Crofton, M.W.; Altman, R.S.; Haese, N.N.; Oka, T.

1989-01-01

Isotopic species of the HeH + molecular ion provide an excellent testing ground for studying isotopic dependence of vibration--rotation constants because of the small masses of He and H isotopes. We have observed infrared spectra of the hot band v=2 left-arrow 1 of HeH + and fundamental bands of isotopic species HeD + , 3 HeH + , and 3 HeD + , and obtained the Dunham coefficients Y kl , and the isotopically independent parameters U kl , Δ He kl , and Δ H kl

Nutrient elements distribution in cultivated and uncultivated soils ...

African Journals Online (AJOL)

The Okai stream was surrounded by a three-year old fallow land dominated by oil palm (Elaeis guineensis), raphia palm (Raphia spp), cocoyam (Colocasia esculentus), avocado tree (Persea Americana), shrubs (mainly Sponelias munibin) and sparsely distributed grasses. The upland farm close to this stream was grown to ...

Effect of industrial effluents on the growth and anatomical structures ...

African Journals Online (AJOL)

The authors investigated the impact of industrial effluents from 5 different industrial concerns in Lagos, Nigeria on Okra (Abelmoschus esculentus). During the study, it was observed that these effluents induced detrimental effects on the flowering, fruiting, stem length, leaf width and leaf length of okra. Other parameters ...

Effects of spacing on the growth and yield of Okra ( Abelmochus ...

African Journals Online (AJOL)

The effects of plant population on growth and yield of Okra (Abelmoschus esculentus L. Moench) was investigated for two planting seasons (2008 and 2009) in the teaching and research farm, Department of Agronomy, Cross River University of Technology, Obubra . Treatments were five Okra plant populations : 111,111, ...

Fulltext PDF

Indian Academy of Sciences (India)

2015-04-20

Apr 20, 2015 ... 2011). The effect of the composition may be due to the presence of Hibiscus esculentus ... Prospects for preventive anti-aging measures. Compared to ... Furthermore, a pulsed electric field has also been reported in the patent literature to ..... stem cells after radiofrequency treatment for aging skin. Dermatol.

Prevalence of oral soft tissue lesions in out-patients at two Malaysian and Thai dental schools.

Science.gov (United States)

Axéll, T; Zain, R B; Siwamogstham, P; Tantiniran, D; Thampipit, J

1990-04-01

At the Faculties of Dentistry in Chiang Mai, Thailand (CM), and Kuala Lumpur, Malaysia (KL), 234 and 233 consecutive out-patients of mean ages 33.8 and 31.0 yr, respectively, were examined for the presence of oral mucosal lesions. Tobacco in some form was regularly used by 31.7% and 27.5% of the study populations in CM and KL, respectively. Cigarette smoking was the predominant habit. In CM three persons chewed betel quids and nine smoked banana leaf cigars daily. In addition, there were 24 habitual chewers of tea leaves (miang). In KL six persons chewed betel quids daily. In CM and KL three cases each (1.3%) of tobacco-associated leukoplakias were found. In KL an additional idiopathic leukoplakia was registered. One and three cases of betel related lesions were found in CM and KL, respectively. One case of a squamous cell carcinoma was found in a 45-yr-old Indian woman in KL who had been chewing betel with tobacco daily for many years. High prevalence figures were found for lichen planus, 3.8% in CM and 2.1% in KL, and an extremely high one, 48.3%, in CM for episodes of aphthous ulcers experienced during the last 2 yr. Comparatively low prevalence figures were found for herpes labialis. As could be expected melanin pigmentation was prevalent while only low figures were encountered for denture-related lesions and amalgam tattoos.

Variation in the complex carbohydrate biosynthesis loci of Acinetobacter baumannii genomes.

Directory of Open Access Journals (Sweden)

Johanna J Kenyon

Full Text Available Extracellular polysaccharides are major immunogenic components of the bacterial cell envelope. However, little is known about their biosynthesis in the genus Acinetobacter, which includes A. baumannii, an important nosocomial pathogen. Whether Acinetobacter sp. produce a capsule or a lipopolysaccharide carrying an O antigen or both is not resolved. To explore these issues, genes involved in the synthesis of complex polysaccharides were located in 10 complete A. baumannii genome sequences, and the function of each of their products was predicted via comparison to enzymes with a known function. The absence of a gene encoding a WaaL ligase, required to link the carbohydrate polymer to the lipid A-core oligosaccharide (lipooligosaccharide forming lipopolysaccharide, suggests that only a capsule is produced. Nine distinct arrangements of a large capsule biosynthesis locus, designated KL1 to KL9, were found in the genomes. Three forms of a second, smaller variable locus, likely to be required for synthesis of the outer core of the lipid A-core moiety, were designated OCL1 to OCL3 and also annotated. Each K locus includes genes for capsule export as well as genes for synthesis of activated sugar precursors, and for glycosyltransfer, glycan modification and oligosaccharide repeat-unit processing. The K loci all include the export genes at one end and genes for synthesis of common sugar precursors at the other, with a highly variable region that includes the remaining genes in between. Five different capsule loci, KL2, KL6, KL7, KL8 and KL9 were detected in multiply antibiotic resistant isolates belonging to global clone 2, and two other loci, KL1 and KL4, in global clone 1. This indicates that this region is being substituted repeatedly in multiply antibiotic resistant isolates from these clones.

Growth Responses of Two Cultivated Okra Species (Abelmoschus ...

African Journals Online (AJOL)

Abelmoschus esculentus was investigated using six accessions; three for each species in crude oil contaminated soil. The seeds ..... industrial waste. Environmental and Experimental. Botany, 52.79-88. Siemonsma, J. S and Hamon, S. (2002). Abelmoschus caillei (A. chev) Stevels. In: Oyen, L.P.A. and. Lemmens R.H.M. ...

Carbon Nanostructure of Kraft Lignin Thermally Treated at 500 to 1000 °C.

Science.gov (United States)

Zhang, Xuefeng; Yan, Qiangu; Leng, Weiqi; Li, Jinghao; Zhang, Jilei; Cai, Zhiyong; Hassan, El Barbary

2017-08-21

Kraft lignin (KL) was thermally treated at 500 to 1000 °C in an inert atmosphere. Carbon nanostructure parameters of thermally treated KL in terms of amorphous carbon fraction, aromaticity, and carbon nanocrystallites lateral size ( L a ), thickness ( L c ), and interlayer space ( d 002 ) were analyzed quantitatively using X-ray diffraction, Raman spectroscopy, and high-resolution transmission electron microscopy. Experimental results indicated that increasing temperature reduced amorphous carbon but increased aromaticity in thermally treated KL materials. The L c value of thermally treated KL materials averaged 0.85 nm and did not change with temperature. The d 002 value decreased from 3.56 Å at 500 °C to 3.49 Å at 1000 °C. The L a value increased from 0.7 to 1.4 nm as temperature increased from 500 to 1000 °C. A nanostructure model was proposed to describe thermally treated KL under 1000 °C. The thermal stability of heat treated KL increased with temperature rising from 500 to 800 °C.

Ultrasonographic assessment of pes anserinus tendon and pes anserinus tendinitis bursitis syndrome in patients with knee osteoarthritis.

Science.gov (United States)

Toktas, Hasan; Dundar, Umit; Adar, Sevda; Solak, Ozlem; Ulasli, Alper Murat

2015-01-01

The aim of this study was to assess the ultrasonographic (US) findings of pes anserinus tendon and bursa in patients with knee osteoarthritis (OA) with or without clinical pes anserinus tendinitis bursitis syndrome (PATBS). A total of 157 female patients with the diagnosis of knee OA on both knees (314 knees), and 30 age, and body mass index- matched healthy female controls without knee pain (60 knees), were included in the study. PATBS was clinically diagnosed. US evaluation parameters were the measurement of the thickness of pes anserinus tendon insertion region (PA) and examination of the morphologic intratendinous PA tissue characteristics and pes anserinus bursitis (PAB). Radiographic knee osteoarthritis graded I-IV according to Kellgren and Lawrence (KL) for each knee was recorded. Pain and functional status were assessed by the Visual Analog Scale (VAS) and Western Ontario and McMaster Universities Osteoarthritis Index (WOMAC). There were 183 PATBS (58.3%) clinical diagnoses among the 314 knees with OA. The mean thickness of PA in the patients with knee OA graded 1,2,3,4 with/without PATBS was significantly greater than the controls (p = 0.001). The mean thickness of PA in knees with OA KL graded 3 and 4 with/without PATBS, was greater than knees with OA KL graded 1 and 2 with/without PATBS (p < 0,05) (except knee OA KL graded 2 with PATBS versus knee OA KL graded 4 without PATBS).The knee OA KL graded 1,2,3,4 with PATBS had significantly more PAB and less loss of normal fibrillar echotexture of PA compared to controls and knees with OA KL graded 1,2,3,4 without PATBS (p < 0.05). The VAS scores of knees with OA KL graded 3, 4 with PATBS were significantly greater than those of knees with OA KL graded 3,4 without PATBS (p < 0.05). PA thickness was significantly associated with the KL grade (r: 0.336, p:0.001) and PATBS (r: 0.371, p < 0.001). It is concluded that the mean thickness of PA in knees with OA with/without PATBS was significantly greater than the

An allosteric gating model recapitulates the biophysical properties of IK,L expressed in mouse vestibular type I hair cells.

Science.gov (United States)

Spaiardi, Paolo; Tavazzani, Elisa; Manca, Marco; Milesi, Veronica; Russo, Giancarlo; Prigioni, Ivo; Marcotti, Walter; Magistretti, Jacopo; Masetto, Sergio

2017-11-01

Vestibular type I and type II hair cells and their afferent fibres send information to the brain regarding the position and movement of the head. The characteristic feature of type I hair cells is the expression of a low-voltage-activated outward rectifying K + current, I K,L , whose biophysical properties and molecular identity are still largely unknown. In vitro, the afferent nerve calyx surrounding type I hair cells causes unstable intercellular K + concentrations, altering the biophysical properties of I K,L . We found that in the absence of the calyx, I K,L in type I hair cells exhibited unique biophysical activation properties, which were faithfully reproduced by an allosteric channel gating scheme. These results form the basis for a molecular and pharmacological identification of I K,L . Type I and type II hair cells are the sensory receptors of the mammalian vestibular epithelia. Type I hair cells are characterized by their basolateral membrane being enveloped in a single large afferent nerve terminal, named the calyx, and by the expression of a low-voltage-activated outward rectifying K + current, I K,L . The biophysical properties and molecular profile of I K,L are still largely unknown. By using the patch-clamp whole-cell technique, we examined the voltage- and time-dependent properties of I K,L in type I hair cells of the mouse semicircular canal. We found that the biophysical properties of I K,L were affected by an unstable K + equilibrium potential (V eq K + ). Both the outward and inward K + currents shifted V eq K + consistent with K + accumulation or depletion, respectively, in the extracellular space, which we attributed to a residual calyx attached to the basolateral membrane of the hair cells. We therefore optimized the hair cell dissociation protocol in order to isolate mature type I hair cells without their calyx. In these cells, the uncontaminated I K,L showed a half-activation at -79.6 mV and a steep voltage dependence (2.8 mV). I K,L also

Inactivation of the forkhead transcription factor FoxO3 is essential for PKB-mediated survival of hematopoietic progenitor cells by kit ligand

DEFF Research Database (Denmark)

Engström, Maria; Karlsson, Richard; Jönsson, Jan-Ingvar

2003-01-01

OBJECTIVE: Kit ligand (KL) is a major survival factor for hematopoietic stem cells. Although anti-apoptotic bcl-2 family members are expressed in these cells, the survival effects by KL appear to involve other mechanisms. Survival signals can also be elicited by the activation of phosphatidylinos......OBJECTIVE: Kit ligand (KL) is a major survival factor for hematopoietic stem cells. Although anti-apoptotic bcl-2 family members are expressed in these cells, the survival effects by KL appear to involve other mechanisms. Survival signals can also be elicited by the activation......, immunofluorescence, and subcellular fractionation, we analyzed the effects of KL on PKB and different forkhead family members in two factor-dependent cell lines, FDCP-mix and FDC-P1, as well as primary mouse bone marrow-derived Lin(-) progenitors. Forced overexpression of triple mutated form of FoxO3 by retroviral...

Dicty_cDB: VHG624 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ---DYMTLXIGTYSFEGKFIKKAIINGNRIVTINNXLLNENQLNSNSTIXKEKDSSNQLS SFISIEIPHYDSTCIIRSKFFSFIRFK*ii*kl*kfnlyfkkilktyyrsnxcycygfcs fcnns...NQLS SFISIEIPHYDSTCIIRSKFFSFIRFK*ii*kl*kfnlyfkkilktyyrsnxcycygfcs fcnnssslynr*ifxi**ifiyknfll*iixti*xkvlnlff

Klotho-related Molecules Upregulated by Smoking Habit in Apparently Healthy Men: A Cross-sectional Study.

Science.gov (United States)

Nakanishi, Kaori; Nishida, Makoto; Harada, Masaya; Ohama, Tohru; Kawada, Noritaka; Murakami, Masaaki; Moriyama, Toshiki; Yamauchi-Takihara, Keiko

2015-09-18

While aging is unavoidable, the aging mechanism is still unclear because of its complexity. Smoking causes premature death and is considered as an environmental aging accelerator. In the present study, we focused on the influence of smoking to the serum concentration of anti-aging protein α-klotho (αKl) and the β-klotho-associated protein fibroblast growth factor (FGF)-21 in men. Subjects consisted of apparently healthy men over 40 years of age who underwent health examination. Physical and biochemical parameters, including the levels of several cytokines and growth factors, were obtained from the subjects. Among middle-aged men (46.1 ± 5.1 years), serum levels of FGF-21, soluble αKl (sαKl), and inflammation-related cytokine interleukin (IL)-6 were significantly higher in smokers than in never-smokers. Serum levels of FGF-21 increased and correlated with alanine transaminase, γ guanosine-5'-triphosphate, and total cholesterol only in smokers, suggesting FGF-21 as a metabolic disorder-related factor in smokers. In aged men (60.3 ± 1.7 years), although the serum levels of sαKl in never-smokers were low, smokers showed highly increased serum levels of sαKl. Serum levels of sαKl was correlated with IL-6 in middle-aged never-smokers, suggesting sαKl regulates IL-6. However, this correlation was disrupted in smokers and aged men.

Effect of animal manures on soil properties, growth, nutrients status ...

African Journals Online (AJOL)

A comparative field study was carried out at two sites in Akure, Southwest Nigeria to determine effect of different animal manures on soil physical and chemical properties and performance of tomato (Lycopersicm esculentus Mill). Analysis of cattle (CM), goat (GM), pig (PG) and poultry (PM) manures showed that N, K, Ca ...

Author Details

African Journals Online (AJOL)

Nwaoguala, CNC. Vol 15, No 2 (2015) - Articles Influence by artificial defoliation and NPK fertilizer application on growth and yield of Okra (Abelmoschus esculentus (L) Moench) Abstract PDF. ISSN: 1684-5374. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...

Effects of different traditional cooking methods on nutrients and ...

African Journals Online (AJOL)

The objective of this research was to determine the effect of cooking using two different methods of preparing okra soup in Ondo state on nutrient, mineral content including zinc bioavailability of okra, Abelmoschus esculentus. The okra fruits were grated and divided into four lots; two lots were cooked with other ingredients of ...

Does Participation in Sports Affect Osteoarthritic Progression After Periacetabular Osteotomy?

Science.gov (United States)

Hara, Daisuke; Hamai, Satoshi; Fukushi, Jun-Ichi; Kawaguchi, Ken-Ichi; Motomura, Goro; Ikemura, Satoshi; Komiyama, Keisuke; Nakashima, Yasuharu

2017-09-01

Periacetabular osteotomy (PAO) is an effective treatment for symptomatic acetabular dysplasia. However, whether postoperative participation in sports leads to progression of the Kellgren-Lawrence (KL) grade of osteoarthritis (OA) in these patients is unclear. To investigate (1) participation in sports before and after PAO and (2) whether postoperative participation in sports leads to progression of the KL grade. Case-control study; Level of evidence, 3. The authors retrospectively reviewed data on 161 patients (183 hips) who underwent PAO for symptomatic acetabular dysplasia with preoperative KL grade 1 or 2 between 1998 and 2011. The mean age at the time of surgery was 42.0 ± 10.9 years (range, 12-64 years), and the mean follow-up duration was 100 months (range, 13-180 months). Data included participation in sports, the University of California, Los Angeles (UCLA) activity scale score, age at the time of surgery, body mass index, follow-up duration, history of treatment for developmental hip dislocations, Merle d'Aubigné-Postel score, Oxford Hip Score, center-edge angle, and KL grade. Univariate and multivariate analyses were applied to determine which factors were associated with progression to KL grade 3 or 4 after PAO. The number of patients who participated in sports significantly increased from 50 (31.1%) preoperatively to 89 (55.3%) postoperatively. The mean UCLA score significantly increased from 4.7 ± 2.1 preoperatively to 5.5 ± 2.0 postoperatively. The KL grade progressed to grade 3 or 4 in 16 hips, including 4 hips that underwent conversion to total hip arthroplasty. No significant differences were found in postoperative participation in sports (89 hips [53.3%] vs 11 hips [68.8%], respectively; P = .24) and the UCLA score (5.6 ± 2.0 vs 5.1 ± 2.0, respectively; P = .30) between hips with KL grade 1 or 2 and KL grade 3 or 4. A multivariate analysis revealed that no factors, including postoperative participation in sports, were significantly

Inhibitory mechanism of chroman compound on LPS-induced nitric oxide production and nuclear factor-κB activation

International Nuclear Information System (INIS)

Kim, Byung Hak; Reddy, Alavala Matta; Lee, Kum-Ho; Chung, Eun Yong; Cho, Sung Min; Lee, Heesoon; Min, Kyung Rak; Kim, Youngsoo

2004-01-01

6-Hydroxy-7-methoxychroman-2-carboxylic acid phenylamide (KL-1156) is a novel chemically synthetic compound. In the present study, the chroman KL-1156 compound was found to inhibit lipopolysaccharide (LPS)-induced nitric oxide production in macrophages RAW 264.7. KL-1156 compound attenuated LPS-induced synthesis of both mRNA and protein of inducible nitric oxide synthase (iNOS), in parallel, and inhibited LPS-induced iNOS promoter activity, indicating that the chroman compound down-regulated iNOS expression at transcription level. As a mechanism of the anti-inflammatory action shown by KL-1156 compound, suppression of nuclear factor (NF)-κB has been documented. KL-1156 compound exhibited a dose-dependent inhibitory effect on LPS-induced NF-κB transcriptional activity in macrophages RAW 264.7. Furthermore, the compound inhibited LPS-induced nuclear translocation of NF-κB p65 and DNA binding activity of NF-κB complex, in parallel, but did not affect IκBα degradation. Taken together, this study demonstrated that chroman KL-1156 compound interfered with nuclear translocation step of NF-κB p65, which was attributable to its anti-inflammatory action

Evaluation of the normal fetal kidney length and its correlation with gestational age.

Science.gov (United States)

Seilanian Toosi, Farrokh; Rezaie-Delui, Hossein

2013-05-30

A true estimation of gestational age (GA) plays an important role in quality maternity care and scheduling the labor date. This study aimed to evaluate the normal fetal kidney length (KL) and its correlation with GA. A cross-sectional study on 92 pregnant women between 8th and 10th week of gestation with normal singleton pregnancy underwent standard ultrasound fetal biometry and kidney length measurement. univariate and multivariate linear regression analysis was used to create a predictive equation to estimate GA on the KL and fetobiometry parameters. A significant correlation was found between GA and KL (r=0.83, P<0.002). The best GA predictor was obtained by combining head circumference, fetal biparietal diameter, femur length and KL with a standard error (SE) about 14.2 days. Our findings showed that KL measurements combination with other fetal biometric parameters could predict age of pregnancy with a better precision.

Myostatin serum concentrations are correlated with the severity of knee osteoarthritis.

Science.gov (United States)

Zhao, Chang; Shao, Yan; Lin, Chuangxin; Zeng, Chun; Fang, Hang; Pan, Jianying; Cai, Daozhang

2017-09-01

Myostatin, a member of the transforming growth factor-β family, contributes to joint deterioration in mice. Thus, we aimed to assess the correlation of myostatin concentrations with the presence and severity of knee osteoarthritis (OA). We determined serum and synovial fluid (SF) myostatin concentrations in a population of 184 patients with knee OA and 109 healthy controls. The knee OA group presented with higher serum myostatin concentrations than the controls. Knee OA patients with KL grade 4 showed higher serum and SF myostatin concentrations compared with those with KL grade 2 and 3. Knee OA patients with KL grade 3 had higher serum and SF myostatin concentrations compared with those with KL grade 2. Serum and SF myostatin concentrations were significantly correlated with KL grading. Serum and SF myostatin concentrations were correlated with the presence and severity of knee OA. © 2016 Wiley Periodicals, Inc.

Genetic Variants in KLOTHO Associate With Cognitive Function in the Oldest Old Group

DEFF Research Database (Denmark)

Mengel-From, Jonas; Sørensen, Mette; Nygaard, Marianne

2016-01-01

, for example, growth factor signaling. In the present study, 19 tagging gene variants in KL were studied in relation to 2 measures of cognitive function, a 5-item cognitive composite score and the Mini Mental State Examination, in 1,480 Danes 92-100 years of age. We found that heterozygotes for the previously......Decline in cognitive abilities is a major concern in aging individuals. A potential important factor for functioning of the central nervous system in late-life stages is the KLOTHO (KL) gene. KL is expressed in various organs including the brain and is involved in multiple biological processes...... reported KL-VS had poorer cognitive function than noncarriers. Two other variants positioned in the 5' end of the gene, rs398655 and rs562020, were associated with better cognitive function independently of KL-VS, and the common haplotype AG was associated with poorer cognition, consistently across two...

Macro and Trace Element Accumulation in Edible Crabs and Frogs ...

African Journals Online (AJOL)

The tissue accumulation of five macroelements (Na, Mg, K, Ca, Fe) and twelve trace elements (Vd, Mn, Co, Ni, Cu, Zn, As, Se, Mo, Ag, Cd, Pb) were assessed in the organs of the edible frogs; Xenopus laevis and Rana esculentus, and whole body of the crab, Callinestes caught from Alaro Stream Floodplain (Ibadan, ...

Genetic Perturbations Suggest a Role of the Resting Potential in Regulating the Expression of the Ion Channels of the KCNA and HCN families in Octopus Cells of the Ventral Cochlear Nucleus

Science.gov (United States)

Cao, Xiao-Jie; Oertel, Donata

2017-01-01

Low-voltage-activated K+ (gKL) and hyperpolarization-activated mixed cation conductances (gh) mediate currents, IKL and Ih, through channels of the Kv1 (KCNA) and HCN families respectively and give auditory neurons the temporal precision required for signaling information about the onset, fine structure, and time of arrival of sounds. Being partially activated at rest, gKL and gh contribute to the resting potential and shape responses to even small subthreshold synaptic currents. Resting gKL and gh also affect the coupling of somatic depolarization with the generation of action potentials. To learn how these important conductances are regulated we have investigated how genetic perturbations affect their expression in octopus cells of the ventral cochlear nucleus (VCN). We report five new findings: First, the magnitude of gh and gKL varied over more than two-fold between wild type strains of mice. Second, average resting potentials are not different in different strains of mice even in the face of large differences in average gKL and gh. Third, IKL has two components, one being α-dendrotoxin (α-DTX)-sensitive and partially inactivating and the other being α-DTX-insensitive, tetraethylammonium (TEA)-sensitive, and non-inactivating. Fourth, the loss of Kv1.1 results in diminution of the α-DTX-sensitive IKL, and compensatory increased expression of an α-DTX-insensitive, tetraethylammonium (TEA)-sensitive IKL. Fifth, Ih and IKL are balanced at the resting potential in all wild type and mutant octopus cells even when resting potentials vary in individual cells over nearly 10 mV, indicating that the resting potential influences the expression of gh and gKL. The independence of resting potentials on gKL and gh shows that gKL and gh do not, over days or weeks, determine the resting potential but rather that the resting potential plays a role in regulating the magnitude of either or both gKL and gh. PMID:28065805

Formulation and in vitro evaluation of theophylline matrix tablets prepared by direct compression: Effect of polymer blends

Science.gov (United States)

El-Bagory, Ibrahim; Barakat, Nahla; Ibrahim, Mohamed A.; El-Enazi, Fouza

2011-01-01

The deformation mechanism of pharmaceutical powders, used in formulating directly compressed matrix tablets, affects the characteristics of the formed tablets. Three polymers of different deformation mechanisms were tested for their impact on theophylline directly compressed tablets namely Kollidon SR (KL SR, plastic deformation), Ethylcellulose (EC, elastic deformation) and Carnauba wax (CW, brittle deformation) at different compression forces. However, tablets based mainly on KL SR, the plastically deformed polymer (TN1) exhibited the highest hardness values compared to the other formulae which are based on either blends of KL SR with CW, the very brittle deformed polymer. The upper detected force for TN formulae and the lower punch force were found to dependent mainly on the powder deformation. This difference is attributed to the work done during the compression phase as well as the work lost during the decompression phase. Furthermore, the release profiles of TN from formulae TN2 and TN4 that are based on the composition (2KL SR:1EC) and (1KL SR:2EC), respectively, were consistent with different deformation mechanisms of KL SR and EC and on the physicochemical properties like the water absorptive capacity of EC. Upon increasing the weight ratio of KL SR (TN2), the release rate was greatly retarded (39.4%, 37.1%, 35.0% and 33.6% released after 8 h at 5, 10, 15 and 20 kN. PMID:24115902

Okra (Abelmoschus esculentus Linn) inhibits lipopolysaccharide ...

African Journals Online (AJOL)

Tropical Journal of Pharmaceutical Research June 2017; 16 (6): 1285-1292 ... lipopolysaccharide-induced inflammatory mediators in .... Multiple comparison of data was carried out by one-way. ANOVA followed by Bonferroni post-tests. P <.

Development of Abelmoschus esculentus (Okra)-Based ...

African Journals Online (AJOL)

Results: Okra gel formulation showed good properties in terms of pH, viscosity and mucoadhesion. ... filter and precipitated with three times the volume ... 2 days in hot air oven (NAAY-M40, Naugra, .... biodegradable nature as well as likely low.

Comparison of nutritional compositions and antioxidant activities of building blocks in shinseoncho and kale green vegetable juices.

Science.gov (United States)

Kim, Seong Yeong

2012-12-01

Shinseoncho and kale were divided into stem [shinseoncho stems (SS) and kale stems (KS)] and leaf parts [shinseoncho leaves (SL) and kale leaves (KL)] and made into green vegetable juices for analyses of nutritional compositions and antioxidant activities. Higher values of total acidity were observed in SL (0.736%) and KL (0.841%) than in SS (0.417%) and KS (0.335%) (p KL (218.494 μg/mL)> KS (107.269 μg/mL)> SS (75.894 μg/mL). KL exerted the highest DPPH radical scavenging activity (84.834%) (p SL (63.473%)> KS (52.894%)> SS (35.443%). ABTS radical scavenging activity showed that SL (66.088%) and KL (38.511%) had higher scavenging activities, whereas SS (7.695%) and KS (9.609%) demonstrated to be lower activities (pgreen vegetable juices and the consumption of them may be beneficial as a nutrition source and in health protection.

Evaluation of the Normal Fetal Kidney Length and Its Correlation with Gestational Age

Directory of Open Access Journals (Sweden)

Farrokh Seilanian Toosi

2013-05-01

Full Text Available A true estimation of gestational age (GA plays an important role in quality maternity care and scheduling the labor date. This study aimed to evaluate the normal fetal kidney length (KL and its correlation with GA. A cross-sectional study on 92 pregnant women between 8th and 10th week of gestation with normal singleton pregnancy underwent standard ultrasound fetal biometry and kidney length measurement. univariate and multivariate linear regression analysis was used to create a predictive equation to estimate GA on the KL and fetobiometry parameters. A significant correlation was found between GA and KL (r=0.83, P<0.002. The best GA predictor was obtained by combining head circumference, fetal biparietal diameter, femur length and KL with a standard error (SE about 14.2 days. Our findings showed that KL measurements combination with other fetal biometric parameters could predict age of pregnancy with a better precision.

Oxygen-Dependent Transcriptional Regulator Hap1p Limits Glucose Uptake by Repressing the Expression of the Major Glucose Transporter Gene RAG1 in Kluyveromyces lactis▿

Science.gov (United States)

Bao, Wei-Guo; Guiard, Bernard; Fang, Zi-An; Donnini, Claudia; Gervais, Michel; Passos, Flavia M. Lopes; Ferrero, Iliana; Fukuhara, Hiroshi; Bolotin-Fukuhara, Monique

2008-01-01

The HAP1 (CYP1) gene product of Saccharomyces cerevisiae is known to regulate the transcription of many genes in response to oxygen availability. This response varies according to yeast species, probably reflecting the specific nature of their oxidative metabolism. It is suspected that a difference in the interaction of Hap1p with its target genes may explain some of the species-related variation in oxygen responses. As opposed to the fermentative S. cerevisiae, Kluyveromyces lactis is an aerobic yeast species which shows different oxygen responses. We examined the role of the HAP1-equivalent gene (KlHAP1) in K. lactis. KlHap1p showed a number of sequence features and some gene targets (such as KlCYC1) in common with its S. cerevisiae counterpart, and KlHAP1 was capable of complementing the hap1 mutation. However, the KlHAP1 disruptant showed temperature-sensitive growth on glucose, especially at low glucose concentrations. At normal temperature, 28°C, the mutant grew well, the colony size being even greater than that of the wild type. The most striking observation was that KlHap1p repressed the expression of the major glucose transporter gene RAG1 and reduced the glucose uptake rate. This suggested an involvement of KlHap1p in the regulation of glycolytic flux through the glucose transport system. The ΔKlhap1 mutant showed an increased ability to produce ethanol during aerobic growth, indicating a possible transformation of its physiological property to Crabtree positivity or partial Crabtree positivity. Dual roles of KlHap1p in activating respiration and repressing fermentation may be seen as a basis of the Crabtree-negative physiology of K. lactis. PMID:18806211

Radiation application for upgrading of bioresources - Development of antifungal and/or nitrogen fixative microbes

Energy Technology Data Exchange (ETDEWEB)

Lee, Ki Sung; Ko, Dong Kyu; Han, Gab Jin [Paichai University, Taejon (Korea)

2000-04-01

(1) In this study, the antifungal bacteria six strains were isolated from various environment located in Chung-cheong area, Korea. These isolates were identified the genera Bacillus sp, Pseudomonas sp. through morphological, physiological and biochemical analysis. Strains KL3362 and KL3397 were identified as Pseudomonas aurantiaca and Alcaligenes faecalis, respectively. Considering antifungal(AF) spectrum, strain KL3303, 3334, and 3341 show the broad range, KL3362 and KL3397 the narrow range of AF activity on a number of pathogenic fungi. Therefore, strains KL3341 and KL3362 were selected as the strong candidate of antifungal bacteria on every purpose and usage related with our research goal. (2) KL3341 producing-antifungal substances were consisted of five different kinds of low molecular weight polypeptides (3) Optimal conditions for the production of antifungal substances were analyzed under various environmental conditions. Growth rates were different according to carbon and nitrogen source, antifungal substance production yields were not different, however. Product of antifungal substances according t phosphate is proportional to the concentration. And productivity of antifungal substances was generally high in the range 30 {approx} 37 deg. C at pH 7. In case of adding vitamin B1 or lysine to medium, the antifungal activity was enhanced. (4) Mutants with enhanced antifungal activities were constructed by radiation of {gamma}-ray. (5) AF strains were screened and selected from this research can be used in the microbial biocides as well as multifunctional bio-controllers in order to remove plant pathogenic fungi and to clarify the polluted environment. Due to their excellent degradation capability for agricultural and/or organic substances, they also can be used to improve soil quality, to ferment compost and to clean up the environment. 35 refs., 17 figs., 15 tabs. (Author)

ORF Alignment: NC_004354 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... Length = 122 ... Query: 96 ... LVDWINDELAEQRIIVQHLEEDMYDGQVLHKLWEKLTGKKLDVPEVTQSEQGQHEKLNIV 155 ... L+DWIND...EL E+RIIV ++EED+YDGQVL+KLWEKL+ ... KL+VPEVTQS +GQ +KL++V Sbjct: 1 ... LIDWINDELVEERIIVTNIEEDLYDGQVLQKLWEKLSNNKLNVPEVTQSAEGQRQKLSVV 60 ...

Observation of the Rotational Spectra of 4HeH+, 4HeD+, 3HeH+, and 3HeD+

International Nuclear Information System (INIS)

Matsushima, F.; Oka, T.; Takagi, K.

1997-01-01

Low J rotational transitions of 4 HeH + , 4 HeD + , 3 HeH + , and 3 HeD + were observed in the 2 endash 5THz region with a high-precision far-infrared spectrometer. Dunham coefficients Y kl and isotopically independent parameters U kl , Δ He kl , and Δ H kl were determined. In particular, Δ parameters with k=0 and l=1,2 were determined with unprecedented accuracy, and provide important information for breakdown of the Born-Oppenheimer approximation. The lowest J=1 left-arrow 0 transition of 4 HeH + observed at 2010.1839(2)GHz will be an important future probe for detecting this species in space. copyright 1997 The American Physical Society

The Role of Molecular Motors in the Mechanics of Active Gels and the Effects of Inertia, Hydrodynamic Interaction and Compressibility in Passive Microrheology

Science.gov (United States)

2014-07-01

g(kl) 2( 2G + λ) + f(kt) + g(kt) 2G , (A.16) A∥ − A⊥ = − f(kl)− 3g (kl) 2( 2G + λ) + f(kt)− 3g (kt) 2G .. (A.17) Where f(x) and g(x) are given by: f(x...spheri- cal particles resulting from the time-dependent linearized Navier-Stokes equation. In that work the time-dependent mobilities for the particles...the shear and longitudinal waves respectively, kt(ω) = −ω √ ρ G∗(ω) , kl(ω) = −ω √ ρ (2ν∗(ω)− 1) 2G ∗(ω) (ν∗(ω)− 1) = −ω √ ρ K∗(ω) + 4 3 G∗(ω) (4.5

Dicty_cDB: Contig-U05646-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available HLWFY HYHQDY*kl*llislgfywllfllslvi*l*lvvlqi*l*lkxxx*nwffrifkiwctfn yishfnwctdcsfnw*iif*iyiyiyi**nki Translat...WTILEPFVPIDSTHLNVLKIFIFSILILVLCNILGNVHLWFY HYHQDY*kl*llislgfywllfllslvi*l*lvvlqi*l*lkxxx*nwffrifkiwctfn yishfnwctdcs

Association of Irisin and CRP Levels with the Radiographic Severity of Knee Osteoarthritis.

Science.gov (United States)

Mao, Yongtao; Xu, Wei; Xie, Zonggang; Dong, Qirong

2016-02-01

Irisin, a recently identified myokine, is implicated in protecting mice from obesity. This study was designed to examine the relation of irisin levels in serum and synovial fluid (SF) with the radiographic severity of osteoarthritis (OA). Our study included 215 patients with knee OA. Irisin levels in serum and SF were evaluated using an enzyme-linked immunosorbent assay. The progression of OA was assessed using Kellgren-Lawrence grading system. Knee OA patients had lower serum irisin concentrations and increased serum C-reactive protein (CRP) levels compared with healthy controls. There were markedly decreased irisin levels in both the serum and the SF, as well as increased serum CRP levels of knee OA patients with Kellgren and Lawrence (KL) grade 4 compared with patients classified as KL grade 2 and 3. Furthermore, patients with KL grade 3 showed markedly reduced serum and SF levels of irisin, as well as increased serum CRP levels compared with patients classified as KL grade 2. Irisin levels in serum and SF of knee OA patients were negatively correlated with disease severity evaluated by KL grading criteria. Irisin levels in the serum and SF of knee OA patients were negatively correlated with disease severity evaluated by the radiographic KL grading criteria.

Factors affecting colonization and abundance of Aphis gossypii glover (hemiptera: aphididae on okra plantations Fatores que afetam a colonização e abundância de Aphis gossypii glover (Hemiptera: Aphididae em plantações de quiabeiro

Directory of Open Access Journals (Sweden)

Germano Leão Demolin Leite

2007-04-01

Full Text Available The control of Aphis gossypii Glover (Hemiptera: Aphididae on okra Abelmoschus esculentus (L. (Malvaceae consist primarily in the use of insecticides, due to the lack of information on other mortality factors. The objective of this study was to determine the effects of predators and parasitoids, height of canopy, plant age, leaf areas, organic compounds leaves, levels of leaf nitrogen and potassium, density of leaf trichomes, total rainfall and median temperature on attack intensity of A. gossypii on two successive A. esculentus var. Santa Cruz plantations. Monthly number estimates of A. gossypii and natural enemies (visual inspection occurred on bottom, middle and apical parts of 30 plants/plantation (one leaf/plant. Plants senescence, leaf areas and natural enemies, mainly Adialytus spp., spiders and Coccinellidae, were some of the factors that most contributed to aphid reduction. A higher number of aphids was found on the bottom part than medium and apical parts of okra plants. Total rainfall can reduce the aphid population. Trichomes non-glandular or low density, organic compounds leaves and levels of N and K were not important for reducing aphid population.O controle de Aphis gossypii Glover (Hemiptera: Aphididae em quiabeiro Abelmoschus esculentus (L. (Malvaceae consiste principalmente no uso de inseticidas, em virtude da falta de informação sobre outros fatores de mortalidade. Objetivou-se com este estudo determinar os efeitos de predadores e parasitóides, altura de dossel, idade da planta, área foliar, compostos orgânicos foliares, níveis de nitrogênio e potássio, densidade de tricomas, pluviosidade e temperatura na intensidade de ataque de A. gossypii em dois cultivos sucessivos de Abelmoschus esculentus var. Santa Cruz. Estimou-se, mensalmente, o número de A. gossypii e de inimigos naturais (inspeção visual ocorridos nas folhas (uma folha/planta localizadas nas partes basal, mediana e apical de 30 plantas/plantação. Os

Promoter methylation and age-related downregulation of Klotho in rhesus monkey.

Science.gov (United States)

King, Gwendalyn D; Rosene, Douglas L; Abraham, Carmela R

2012-12-01

While overall DNA methylation decreases with age, CpG-rich areas of the genome can become hypermethylated. Hypermethylation near transcription start sites typically decreases gene expression. Klotho (KL) is important in numerous age-associated pathways including insulin/IGF1 and Wnt signaling and naturally decreases with age in brain, heart, and liver across species. Brain tissues from young and old rhesus monkeys were used to determine whether epigenetic modification of the KL promoter underlies age-related decreases in mRNA and protein levels of KL. The KL promoter in genomic DNA from brain white matter did not show evidence of oxidation in vivo but did exhibit an increase in methylation with age. Further analysis identified individual CpG motifs across the region of interest with increased methylation in old animals. In vitro methyl modification of these individual cytosine residues confirmed that methylation of the promoter can decrease gene transcription. These results provide evidence that changes in KL gene expression with age may, at least in part, be the result of epigenetic changes to the 5' regulatory region.

sur la croissance des graines de gombo en serre Résumé Abstract

African Journals Online (AJOL)

AKA BOKO

Le gombo (Abelmoschus esculentus L., Malvaceae) est une herbe annuelle érigée et couverte de soies duveteuses [1]. C'est une plante de grande valeur nutritionnelle, riche en protéines, sels minéraux (Calcium, fer, magnésium, potassium, sodium etc.) vitamines (A, C E et K) et lipides (acides oléiques et linoléiques, et.

Gidon Kremer ja Kremerata Baltica

Index Scriptorium Estoniae

2001-01-01

G. Kremer ja Kremerata Baltica esitamas Tshaikovski, shostakovitshi ja Desjatnikovi loomingut pühapäeval, 16. detsembril kl.19 Vanemuise Kontserdimajas ja esmaspäeval, 17. detsembril kl.19 Estonia kontserdisaalis

Tank Closure Progress at the Department of Energy's Idaho National Engineering Laboratory Tank Farm Facility

International Nuclear Information System (INIS)

Butterworth, St.W.; Shaw, M.R.

2009-01-01

Significant progress continued at the U.S. Department of Energy (DOE) Idaho National Laboratory (INL) with the completion of the closure process to empty, clean and close radioactive liquid waste storage tanks at the Idaho Nuclear Technology and Engineering Center (INTEC) Tank Farm Facility (TFF). The TFF includes eleven 1,135.6-kL (300,000-gal) underground stainless steel storage tanks and four smaller, 113.5-kL (30,000-gal) stainless steel tanks, along with tank vaults, interconnecting piping, and ancillary equipment. The TFF tanks had historically been used to store a variety of radioactive liquid waste, including wastes associated with past spent nuclear fuel reprocessing. Four of the large storage tanks remain in use for waste storage while the other seven 1,135.6-kL (300,000-gal) tanks and the four 113.5-kL (30,000-gal) tanks have been emptied of waste, cleaned and filled with grout. Recent issuance of an Amended Record of Decision (ROD) in accordance with the National Environmental Policy Act, and a Waste Determination complying with Section 3116 of the Ronald W. Reagan National Defense Authorization Act (NDAA) for Fiscal Year 2005, allowed commencement of grouting activities on the cleaned tanks. The first three 113.5-kL (30,000-gal) tanks were grouted in the Fall of 2006 and the fourth tank and the seven 1,135.6-kL (300,000-gal) tanks were filled with grout in 2007 to provide long-term stability. During 2008 over seven miles of underground process piping along with associated tank valve boxes and secondary containment systems was stabilized with grout. Lessons learned were compiled and implemented during the closure process and will be utilized on the remaining four 1,135.6-kL (300,000-gal) underground stainless steel storage tanks. Significant progress has been made to clean and close emptied tanks at the INTEC TFF. Between 2002 and 2005, seven of the eleven 1,135.6-kL (300,000-gal) tanks and all four 113.5-kL (30,000-gal) tanks were cleaned and prepared

Presence, location, type and size of denuded areas of subchondral bone in the knee as a function of radiographic stage of OA - data from the OA initiative.

Science.gov (United States)

Frobell, R B; Wirth, W; Nevitt, M; Wyman, B T; Benichou, O; Dreher, D; Davies, R Y; Lee, J H; Baribaud, F; Gimona, A; Hudelmaier, M; Cotofana, S; Eckstein, F

2010-05-01

To assess the presence, location, type and size of denuded areas of subchondral bone (dAB) in the femorotibial joint, measured quantitatively with 3T MRI, in a large subset of OAI participants. One knee of 633 subjects (250 men, 383 women, aged 61.7+/-9.6 y) were studied, spanning all radiographic osteoarthritis (OA) stages. dABs were determined quantitatively using segmentations of coronal FLASHwe images, representing areas where the subchondral bone was not covered by cartilage. Post hoc visual examination of segmented images determined whether dABs represented full thickness cartilage loss or internal osteophyte. 7% Of the knees were Kellgren & Lawrence (KL) grade 0, 6% grade 1, 41% grade 2, 41% grade 3, and 5% grade 4. 39% Of the participants (48% of the men and 33% of the women) displayed dABs; 61% of the dABs represented internal osteophytes. 1/47 Participants with KL grade 0 displayed 'any' dAB whereas 29/32 of the KL grade 4 knees were affected. Even as early as KL grade 1, 29% of the participants showed dABs. There were significant relationships of dAB with increasing KL grades (Posteophytes were more frequent laterally (mainly posterior tibia and internal femur) whereas full thickness cartilage loss was more frequent medially (mainly external tibia and femur). dABs occur already at earliest stages of radiographic OA (KL grades 1 and 2) and become more common (and larger) with increasing disease severity. Almost all KL grade 4 knees exhibited dABs, with cartilage loss being more frequent than internal osteophytes. Copyright 2010 Osteoarthritis Research Society International. Published by Elsevier Ltd. All rights reserved.

A Chimeric LysK-Lysostaphin Fusion Enzyme Lysing Staphylococcus aureus Cells: a Study of Both Kinetics of Inactivation and Specifics of Interaction with Anionic Polymers.

Science.gov (United States)

Filatova, Lyubov Y; Donovan, David M; Ishnazarova, Nadiya T; Foster-Frey, Juli A; Becker, Stephen C; Pugachev, Vladimir G; Balabushevich, Nadezda G; Dmitrieva, Natalia F; Klyachko, Natalia L

2016-10-01

A staphylolytic fusion protein (chimeric enzyme K-L) was created, harboring three unique lytic activities composed of the LysK CHAP endopeptidase, and amidase domains, and the lysostaphin glycyl-glycine endopeptidase domain. To assess the potential of possible therapeutic applications, the kinetic behavior of chimeric enzyme K-L was investigated. As a protein antimicrobial, with potential antigenic properties, the biophysical effect of including chimeric enzyme K-L in anionic polymer matrices that might help reduce the immunogenicity of the enzyme was tested. Chimeric enzyme K-L reveals a high lytic activity under the following optimal ( opt ) conditions: pH opt 6.0-10.0, t opt 20-30 °C, NaCl opt 400-800 mM. At the working temperature of 37 °C, chimeric enzyme K-L is inactivated by a monomolecular mechanism and possesses a high half-inactivation time of 12.7 ± 3.0 h. At storage temperatures of 22 and 4 °C, a complex mechanism (combination of monomolecular and bimolecular mechanisms) is involved in the chimeric enzyme K-L inactivation. The optimal storage conditions under which the enzyme retains 100 % activity after 140 days of incubation (4 °C, the enzyme concentration of 0.8 mg/mL, pH 6.0 or 7.5) were established. Chimeric enzyme K-L is included in complexes with block-copolymers of poly-L-glutamic acid and polyethylene glycol, while the enzyme activity and stability are retained, thus suggesting methods to improve the application of this fusion as an effective antimicrobial agent.

Use of the KlADH3 promoter for the quantitative production of the murine PDE5A isoforms in the yeast Kluyveromyces lactis.

Science.gov (United States)

Cardarelli, Silvia; Giorgi, Mauro; Naro, Fabio; Malatesta, Francesco; Biagioni, Stefano; Saliola, Michele

2017-09-22

Phosphodiesterases (PDE) are a superfamily of enzymes that hydrolyse cyclic nucleotides (cAMP/cGMP), signal molecules in transduction pathways regulating crucial aspects of cell life. PDEs regulate the intensity and duration of the cyclic nucleotides signal modulating the downstream biological effect. Due to this critical role associated with the extensive distribution and multiplicity of isozymes, the 11 mammalian families (PDE1 to PDE11) constitute key therapeutic targets. PDE5, one of these cGMP-specific hydrolysing families, is the molecular target of several well known drugs used to treat erectile dysfunction and pulmonary hypertension. Kluyveromyces lactis, one of the few yeasts capable of utilizing lactose, is an attractive host alternative to Saccharomyces cerevisiae for heterologous protein production. Here we established K. lactis as a powerful host for the quantitative production of the murine PDE5 isoforms. Using the promoter of the highly expressed KlADH3 gene, multicopy plasmids were engineered to produce the native and recombinant Mus musculus PDE5 in K. lactis. Yeast cells produced large amounts of the purified A1, A2 and A3 isoforms displaying K m , V max and Sildenafil inhibition values similar to those of the native murine enzymes. PDE5 whose yield was nearly 1 mg/g wet weight biomass for all three isozymes (30 mg/L culture), is well tolerated by K. lactis cells without major growth deficiencies and interferences with the endogenous cAMP/cGMP signal transduction pathways. To our knowledge, this is the first time that the entire PDE5 isozymes family containing both regulatory and catalytic domains has been produced at high levels in a heterologous eukaryotic organism. K. lactis has been shown to be a very promising host platform for large scale production of mammalian PDEs for biochemical and structural studies and for the development of new specific PDE inhibitors for therapeutic applications in many pathologies.

Dicty_cDB: SSJ246 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ifihf*kkkkkkkkkkkkkkkk Translated Amino Acid sequence (All Frames) Frame A: kl*nviqiitinhkc*lnpkesnffnfsrkhtik**cstlrccstccnsrfid...nfsrkhtik**cstlrccstccnsrfidccrccsy lnlqriln*liihilipweifenlivylinn*LYLLIFKKKKKKK...AAAAAAAAAAAAAAAAAAAAAAAA sequence update 1998.12.21 Translated Amino Acid sequence kl*nviqiitinhkc*lnpkesnff

Genetics Home Reference: FG syndrome

Science.gov (United States)

... MJ, Hoo JJ, Jones KL, McKeown C, Moeschler JB, Raymond FL, Rogers RC, Schwartz CE, Battaglia A, ... E, Huddleston L, Clark RD, Jones KL, Moeschler JB, Opitz JM, Morford J, Simensen R, Rogers RC, ...

Effects of water management, connectivity, and surrounding land use on habitat use by frogs in rice paddies in Japan.

Science.gov (United States)

Naito, Risa; Yamasaki, Michimasa; Lmanishi, Ayumi; Natuhara, Yosihiro; Morimoto, Yukihiro

2012-09-01

In Japan, rice paddies play an important role as a substitute habitat for wetland species, and support rich indigenous ecosystems. However, since the 1950s, agricultural modernization has altered the rice paddy environment, and many previously common species are now endangered. It is urgently necessary to evaluate rice paddies as habitats for conservation. Among the species living in rice paddies, frogs are representative and are good indicator species, so we focused on frog species and analyzed the influence of environmental factors on their habitat use. We found four frog species and one subspecies (Hyla japonica, Pelophylax nigromaculatus, Glandirana rugosa, Lithobates catesbeianus, and Pelophylax porosa brevipoda) at our study sites in Shiga prefecture. For all but L. catesbeianus, we analyzed the influence of environmental factors related to rice paddy structure, water management and availability, agrochemical use, connectivity, and land use on breeding and non-breeding habitat use. We constructed generalized additive mixed models with survey date as the smooth term and applied Akaike's information criterion to choose the bestranked model. Because life histories and biological characteristics vary among species, the factors affecting habitat use by frogs are also expected to differ by species. We found that both breeding and non-breeding habitat uses of each studied species were influenced by different combinations of environmental factors and that in most cases, habitat use showed seasonality. For frog conservation in rice paddies, we need to choose favorable rice paddy in relation to surrounding land use and apply suitable management for target species.

Divergent Evolution of the Transcriptional Network Controlled by Snf1-Interacting Protein Sip4 in Budding Yeasts.

Directory of Open Access Journals (Sweden)

Constance Mehlgarten

Full Text Available Cellular responses to starvation are of ancient origin since nutrient limitation has always been a common challenge to the stability of living systems. Hence, signaling molecules involved in sensing or transducing information about limiting metabolites are highly conserved, whereas transcription factors and the genes they regulate have diverged. In eukaryotes the AMP-activated protein kinase (AMPK functions as a central regulator of cellular energy homeostasis. The yeast AMPK ortholog SNF1 controls the transcriptional network that counteracts carbon starvation conditions by regulating a set of transcription factors. Among those Cat8 and Sip4 have overlapping DNA-binding specificity for so-called carbon source responsive elements and induce target genes upon SNF1 activation. To analyze the evolution of the Cat8-Sip4 controlled transcriptional network we have compared the response to carbon limitation of Saccharomyces cerevisiae to that of Kluyveromyces lactis. In high glucose, S. cerevisiae displays tumor cell-like aerobic fermentation and repression of respiration (Crabtree-positive while K. lactis has a respiratory-fermentative life-style, respiration being regulated by oxygen availability (Crabtree-negative, which is typical for many yeasts and for differentiated higher cells. We demonstrate divergent evolution of the Cat8-Sip4 network and present evidence that a role of Sip4 in controlling anabolic metabolism has been lost in the Saccharomyces lineage. We find that in K. lactis, but not in S. cerevisiae, the Sip4 protein plays an essential role in C2 carbon assimilation including induction of the glyoxylate cycle and the carnitine shuttle genes. Induction of KlSIP4 gene expression by KlCat8 is essential under these growth conditions and a primary function of KlCat8. Both KlCat8 and KlSip4 are involved in the regulation of lactose metabolism in K. lactis. In chromatin-immunoprecipitation experiments we demonstrate binding of both, KlSip4 and

Pseudomonas alkylphenolica sp. nov., a bacterial species able to form special aerial structures when grown on p-cresol.

Science.gov (United States)

Mulet, Magdalena; Sánchez, David; Lalucat, Jorge; Lee, Kyoung; García-Valdés, Elena

2015-11-01

Pseudomonas sp. KL28T is an aerobic, rod-shaped bacterium that was isolated from the soil of Changwon, South Korea, based on its ability to grow in the presence of linear alkylphenols (C1-C5). Despite several studies on strain KL28T, it could not be assigned to any known species in the genus Pseudomonas. The name 'Pseudomonas alkylphenolia' was proposed for KL28T, but the strain had not until now been characterized taxonomically and the name currently has no standing in the bacterial nomenclature. A 16S rRNA gene sequence based phylogenetic analysis suggested an affiliation of strain KL28T with the Pseudomonas putida group, with Pseudomonas vranovensis DSM 16006T as the most closely related type strain (99.1 % similarity). A multilocus phylogenetic sequence analysis performed by concatenating 16S rRNA, gyrB, rpoD and rpoB partial gene sequences showed that isolate KL28T could be differentiated from P. vranovensis DSM 16006T (sequence similarity 93.7 %). Genomic comparisons of strain KL28T with the type strains of the species in the P. putida group using average nucleotide index based on blast (ANIb) and genome-to genome distances (GGDC) revealed 87.06 % and 32.20 % similarities with P. vranovensis DSM 16006T, respectively, as the closest type strain. Both values are far from the thresholds established for species differentiation. These results, together with differences in phenotypic features and chemotaxonomic analyses [fatty acids and whole-cell matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) MS], support the proposal of strain KL28T ( = JCM 16553T = KCTC 22206T) as the type strain of a novel species, for which the formerly proposed name, 'P. alkylphenolia', is correctly latinized as Pseudomonas alkylphenolica sp. nov.

Deletion of PTH rescues skeletal abnormalities and high osteopontin levels in Klotho-/- mice.

Directory of Open Access Journals (Sweden)

Quan Yuan

Full Text Available Maintenance of normal mineral ion homeostasis is crucial for many biological activities, including proper mineralization of the skeleton. Parathyroid hormone (PTH, Klotho, and FGF23 have been shown to act as key regulators of serum calcium and phosphate homeostasis through a complex feedback mechanism. The phenotypes of Fgf23(-/- and Klotho(-/- (Kl(-/- mice are very similar and include hypercalcemia, hyperphosphatemia, hypervitaminosis D, suppressed PTH levels, and severe osteomalacia/osteoidosis. We recently reported that complete ablation of PTH from Fgf23(-/- mice ameliorated the phenotype in Fgf23(-/-/PTH(-/- mice by suppressing serum vitamin D and calcium levels. The severe osteomalacia in Fgf23(-/- mice, however, persisted, suggesting that a different mechanism is responsible for this mineralization defect. In the current study, we demonstrate that deletion of PTH from Kl(-/- (Kl(-/-/PTH(-/- or DKO mice corrects the abnormal skeletal phenotype. Bone turnover markers are restored to wild-type levels; and, more importantly, the skeletal mineralization defect is completely rescued in Kl(-/-/PTH(-/- mice. Interestingly, the correction of the osteomalacia is accompanied by a reduction in the high levels of osteopontin (Opn in bone and serum. Such a reduction in Opn levels could not be observed in Fgf23(-/-/PTH(-/- mice, and these mice showed sustained osteomalacia. This significant in vivo finding is corroborated by in vitro studies using calvarial osteoblast cultures that show normalized Opn expression and rescued mineralization in Kl(-/-/PTH(-/- mice. Moreover, continuous PTH infusion of Kl(-/- mice significantly increased Opn levels and osteoid volume, and decreased trabecular bone volume. In summary, our results demonstrate for the first time that PTH directly impacts the mineralization disorders and skeletal deformities of Kl(-/-, but not of Fgf23(-/- mice, possibly by regulating Opn expression. These are significant new perceptions into

Acinetobacter baumannii K13 and K73 capsular polysaccharides differ only in K-unit side branches of novel non-2-ulosonic acids: di-N-acetylated forms of either acinetaminic acid or 8-epiacinetaminic acid.

Science.gov (United States)

Kenyon, Johanna J; Kasimova, Anastasiya A; Notaro, Anna; Arbatsky, Nikolay P; Speciale, Immacolata; Shashkov, Alexander S; De Castro, Cristina; Hall, Ruth M; Knirel, Yuriy A

2017-11-27

Structures of capsular polysaccharides of Acinetobacter baumannii isolates carrying KL13 and KL73 gene clusters were established. The closely related KL73 and KL13 gene clusters differ only by one gene in the module responsible for synthesis of the non-2-ulosonic acids. The K13 and K73 polysaccharides differ only in a single side-chain sugar, which is either 5,7-diacetamido-3,5,7,9-tetradeoxy-l-glycero-l-altro- or -d-glycero-l-altro-non-2-ulosonic acid [di-N-acetylated forms of acinetaminic acid (Aci5Ac7Ac) or 8-epiacinetaminic acid (8eAci5Ac7Ac), respectively]. The KL13 also is closely related to the KL12 gene cluster, which contains a different wzy gene encoding the K unit polymerase. Accordingly, the otherwise near identical K units are linked differently via an α-d-FucpNAc-(1 → 4)-d-Galp linkage in K13 and K73 or an α-d-FucpNAc-(1 → 3)-d-GalpNAc linkage in K12. This finding confirms the predicted substrate of the ItrB3 initiating transferase as d-FucpNAc. Glycosyltransferases predicted to catalyse the linkage of d-Galp or d-GalpNAc to l-FucpNAc in the growing K13 and K73 or K12 units, respectively, differ by only two amino acids. Copyright © 2017 Elsevier Ltd. All rights reserved.

Produção de protoplastos e lise da parede celular de leveduras utilizando β-1,3 glucanase Protoplasts production and yeast cell wall lysis using β-1,3 glucanase

Directory of Open Access Journals (Sweden)

Luciana Francisco Fleuri

2010-06-01

Full Text Available O presente trabalho visou a aplicação da β-1,3 glucanase lítica, obtida do microrganismo Cellulosimicrobium cellulans 191, na produção de protoplastos e na lise da parede celular de leveduras. A preparação bruta da enzima foi capaz de lisar as leveduras Kluyveromyces lodderi, Saccharomyces cerevisiae (Fleischmann e Itaiquara, S. cerevisiae KL-88, S. diastaticus NCYC 713, S. cerevisiae NCYC 1001, Candida glabrata NCYC 388, Kluyveromyces marxianus NCYC 587 e Hansenula mrakii NCYC 500. A β-1,3 glucanase purificada foi capaz de lisar as leveduras Saccharomyces cerevisiae KL-88, Saccharomyces capensis, Debaromyces vanriji, Pachysolen tannophillus, Kluyveromyces drosophilarum, Candida glabrata, Hansenula mrakii e Pichia membranaefaciens e formar protoplastos de Saccharomyces cerevisiae KL-88.The aim of this work was the application of lytic β-1,3 glucanase obtained from Cellulosimicrobium cellulans strain 191 in the production of protoplasts and lysis of yeast cell walls. The crude extract demonstrated lysis activity against the yeasts Kluyveromyces lodderi, Saccharomyces cerevisiae (Fleischmann and Itaiquara, S. cerevisiae KL-88, S. diastaticus NCYC 713, S. cerevisiae NCYC 1001, Candida glabrata NCYC 388, Kluyveromyces marxianus NCYC 587, and Hansenula mrakii NCYC 500. The purified β-1,3 glucanase demonstrated lysis activity against the yeasts Saccharomyces cerevisiae KL-88, Saccharomyces capensis, Debaromyces vanriji, Pachysolen tannophillus, Kluyveromyces drosophilarum, Candida glabrata, Hansenula mrakii, and Pichia membranaefaciens, and it was able to produce Saccharomyces cerevisiae KL-88 protoplasts.

Analysis of morphological traits in different host plants associated ...

African Journals Online (AJOL)

Maximum trichome density per plant was 444±72.4 in sunflower followed by 411.6±19.6, 399±52, 391.6±22.0, in C. bonariensis, Abelmoschus esculentus and Withania somnifera respectively but minimum were 2.33±1.45 in Chinopodium morale, followed by 2.66±1.4, and 3±2.08 in Portulaca oleracea and Trianthema ...

Gamma ray and sodium azide induced heterophylly of Bhindi and Clusterbean

International Nuclear Information System (INIS)

Khaleel Basha, S.; Gopala Rao, P.

1988-01-01

Gamma rays (35, 45 Krad) and sodium azide (100, 200 ppm) and their combinations caused heterophylly in Bhindi (Hibiscus esculentus) and Clusterbean (Cyamopsis tetragonoloba). Changes like notching of leaf at the tip region, reduction of secondary and tertiary veins, formation of 2,4 leaflets, reduction of leaf lobes and change of shape were noticed. More changes were observed at higher doses of the mutagens. (author). 12 refs

CARACTERISATION PHYSICO-CHIMIQUE ET POTENTIALITES ...

African Journals Online (AJOL)

AISA

Le pois sucré (Cyperus esculentus L. Cyperaceae) présente des potentialités insuffisamment exploitées sur le plan nutritionnel. Afin de contribuer à la connaissance de ce produit, une enquête a été menée auprès d'une frange de la population d'Abidjan (Côte d'Ivoire). Des analyses physiques et chimiques ont été.

Sumi-sludge system; Sumisurajji system

Energy Technology Data Exchange (ETDEWEB)

NONE

2000-04-20

The subject facilities, delivered to Kakegawa City, Shizuoka Prefecture, in December, 1999, are the first machine by the heavy load denitrification processing system adaptive to purifying tank sludge 'Sumi-sludge system'. It enhanced the capacity of 84 kl/day by about 30% to 109 kl/day through the remodeling of the existing facilities. Its major specifications are capacity: 109 kl/day (human wastes 18 kl/day, purifying tank sludge 91 kl/day) and final effluent quality: pH 5.8-8.6, BOD 10 mg/l or less, COD 20 mg/l or less, SS 10 mg/l or less, T-N 10 mg/l or less, T-P 1 mg/l or less, chromaticity 30 degrees or less, coliform group quantity 3,000 pieces/ml or less. It has the following features. (1) Bio-treatment load is reduced by dehydrating human wastes and purifying tank sludge in the prestage of the bio-treatment. (2) Bio-treatment and flocculation separating treatment are integrated. (3) A high-speed flocculation sedimentation tank 'Sumi-thickner' is employed in the solid-liquid separator, enabling stable solid-liquid separation. (translated by NEDO)

Impact of Different Lignin Fractions on Saccharification Efficiency in Diverse Species of the Bioenergy Crop Miscanthus

NARCIS (Netherlands)

Weijde, van der Tim; Torres Salvador, Andres Francisco; Dolstra, Oene; Dechesne, Annemarie; Visser, Richard G.F.; Trindade, Luisa M.

2016-01-01

Lignin is a key factor limiting saccharification of lignocellulosic feedstocks. In this comparative study, various lignin methods—including acetyl bromide lignin (ABL), acid detergent lignin (ADL), Klason lignin (KL), and modified ADL and KL determination methods—were evaluated for their

Soot measurements for diesel and biodiesel spray combustion under high temperature highly diluted ambient conditions

KAUST Repository

Zhang, Ji; Jing, Wei; Roberts, William L.; Fang, Tiegang

2014-01-01

This paper presents the soot temperature and KL factor for biodiesel, namely fatty acid methyl ester (FAME) and diesel fuel combustion in a constant volume chamber using a two-color technique. The KL factor is a parameter for soot concentration

Dicty_cDB: CHD673 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available TKSSLIG*kfnsqishfrctk***stfiyk*ikki*rlsfs*sm *snifn*ttssnwypsa*yaicrwwfss*cgck*ld*ntwgilqkrfkrnywyslccrtw *stsfsgncid*gwnests...rwwfss*cgck*ld*ntwgilqkrfkrnywyslccrtw*st sfsgncid*gwnestsss*ihs*kkkrfn*y*tnsis*kl*kqkeifmqnhvnesfilyi i*mlk...k*ld*ntwgilqkrfkrnywyslccrtw *stsfsgncid*gwnestsss*ihs*kkkrfn*y*tnsis*kl*kqkeifmq

Evaluation of a Silicone Membrane as an Alternative to Human Skin for Determining Skin Permeation Parameters of Chemical Compounds.

Science.gov (United States)

Uchida, Takashi; Yakumaru, Masafumi; Nishioka, Keisuke; Higashi, Yoshihiro; Sano, Tomohiko; Todo, Hiroaki; Sugibayashi, Kenji

2016-01-01

We evaluated the effectiveness of a silicone membrane as an alternative to human skin using the skin permeation parameters of chemical compounds. An in vitro permeation study using 15 model compounds was conducted, and permeation parameters comprising permeability coefficient (P), diffusion parameter (DL(-2)), and partition parameter (KL) were calculated from each permeation profile. Significant correlations were obtained in log P, log DL(-2), and log KL values between the silicone membrane and human skin. DL(-2) values of model compounds, except flurbiprofen, in the silicone membrane were independent of the lipophilicity of the model compounds and were 100-fold higher than those in human skin. For antipyrine and caffeine, which are hydrophilic, KL values in the silicone membrane were 100-fold lower than those in human skin, and P values, calculated as the product of a DL(-2) and KL, were similar. For lipophilic compounds, such as n-butyl paraben and flurbiprofen, KL values for silicone were similar to or 10-fold higher than those in human skin, and P values for silicone were 100-fold higher than those in human skin. Furthermore, for amphiphilic compounds with log Ko/w values from 0.5 to 3.5, KL values in the silicone membrane were 10-fold lower than those in human skin, and P values for silicone were 10-fold higher than those in human skin. The silicone membrane was useful as a human skin alternative in an in vitro skin permeation study. However, depending on the lipophilicity of the model compounds, some parameters may be over- or underestimated.

Different thresholds for detecting osteophytes and joint space narrowing exist between the site investigators and the centralized reader in a multicenter knee osteoarthritis study - data from the Osteoarthritis Initiative

Energy Technology Data Exchange (ETDEWEB)

Guermazi, Ali; Hayashi, Daichi [Boston University School of Medicine, Quantitative Imaging Center, Department of Radiology, Boston, MA (United States); Hunter, David J. [New England Baptist Hospital, Division of Research, Boston, MA (United States); University of Sydney, Northern Clinical School, Sydney (Australia); Li, Ling [New England Baptist Hospital, Division of Research, Boston, MA (United States); Benichou, Olivier [Eli Lilly and Co, Indianapolis, IN (United States); Eckstein, Felix [Paracelsus Medical University, Salzburg (Austria); Chondrometrics GmbH, Ainring (Germany); Kwoh, C.K. [University of Pittsburgh School of Medicine, Division of Rheumatology and Clinical Immunology, Pittsburgh, PA (United States); Nevitt, Michael [University of California, Department of Epidemiology and Biostatistics, San Francisco, CA (United States)

2012-02-15

To evaluate how the reading of knee radiographs by site investigators differs from that by an expert musculoskeletal radiologist who trained and validated them in a multicenter knee osteoarthritis (OA) study. A subset of participants from the Osteoarthritis Initiative progression cohort was studied. Osteophytes and joint space narrowing (JSN) were evaluated using Kellgren-Lawrence (KL) and Osteoarthritis Research Society International (OARSI) grading. Radiographs were read by site investigators, who received training and validation of their competence by an expert musculoskeletal radiologist. Radiographs were re-read by this radiologist, who acted as a central reader. For KL and OARSI grading of osteophytes, discrepancies between two readings were adjudicated by another expert reader. Radiographs from 96 subjects (49 women) and 192 knees (138 KL grade {>=} 2) were included. The site reading showed moderate agreement for KL grading overall (kappa=0.52) and for KL {>=} 2 (i.e., radiographic diagnosis of ''definite OA''; kappa=0.41). For OARSI grading, the site reading showed substantial agreement for lateral and medial JSN (kappa=0.65 and 0.71), but only fair agreement for osteophytes (kappa=0.37). For KL grading, the adjudicator's reading showed substantial agreement with the centralized reading (kappa=0.62), but only slight agreement with the site reading (kappa = 0.10). Site investigators over-graded osteophytes compared to the central reader and the adjudicator. Different thresholds for scoring of JSN exist even between experts. Our results suggest that research studies using radiographic grading of OA should use a centralized reader for all grading. (orig.)

Different thresholds for detecting osteophytes and joint space narrowing exist between the site investigators and the centralized reader in a multicenter knee osteoarthritis study - data from the Osteoarthritis Initiative

International Nuclear Information System (INIS)

Guermazi, Ali; Hayashi, Daichi; Hunter, David J.; Li, Ling; Benichou, Olivier; Eckstein, Felix; Kwoh, C.K.; Nevitt, Michael

2012-01-01

To evaluate how the reading of knee radiographs by site investigators differs from that by an expert musculoskeletal radiologist who trained and validated them in a multicenter knee osteoarthritis (OA) study. A subset of participants from the Osteoarthritis Initiative progression cohort was studied. Osteophytes and joint space narrowing (JSN) were evaluated using Kellgren-Lawrence (KL) and Osteoarthritis Research Society International (OARSI) grading. Radiographs were read by site investigators, who received training and validation of their competence by an expert musculoskeletal radiologist. Radiographs were re-read by this radiologist, who acted as a central reader. For KL and OARSI grading of osteophytes, discrepancies between two readings were adjudicated by another expert reader. Radiographs from 96 subjects (49 women) and 192 knees (138 KL grade ≥ 2) were included. The site reading showed moderate agreement for KL grading overall (kappa=0.52) and for KL ≥ 2 (i.e., radiographic diagnosis of ''definite OA''; kappa=0.41). For OARSI grading, the site reading showed substantial agreement for lateral and medial JSN (kappa=0.65 and 0.71), but only fair agreement for osteophytes (kappa=0.37). For KL grading, the adjudicator's reading showed substantial agreement with the centralized reading (kappa=0.62), but only slight agreement with the site reading (kappa = 0.10). Site investigators over-graded osteophytes compared to the central reader and the adjudicator. Different thresholds for scoring of JSN exist even between experts. Our results suggest that research studies using radiographic grading of OA should use a centralized reader for all grading. (orig.)

A chimeric LysK-lysostaphin fusion enzyme lysing Staphylococcus aureus cells: a study of both kinetics of inactivation and specifics of interaction with anionic polymers

Science.gov (United States)

A staphylolytic fusion protein (K-L) was created, harboring three unique lytic activities comprised of the LysK CHAP endopeptidase, and amidase domains, and the lysostaphin glycyl-glycine endopeptidase domain. To assess the potential of possible therapeutic applications, the kinetic behavior of K-L...

Dramatic Decline of Respiratory Illness Among US Military Recruits After the Renewed Use of Adenovirus Vaccines

Science.gov (United States)

2014-10-01

editors consider relevant to the con- tent of the manuscript have been disclosed. References 1. Broderick MP, Hansen CJ, Russell KL. Exploration of...Russell KL, Broderick MP, Franklin SE, et al. Transmission dynamics and prospective environmental sampling of adenovirus in a military recruit setting

Studied on Virgin Coconut Oil (VCO) and Olive Oil (OO) as an Alternative for Stabilizer of Radiation Vulcanized Natural Rubber Latex (RVNRL) Preparation

International Nuclear Information System (INIS)

Syuhada Ramli; Sofian Ibrahim; Mohd Noorwadi Mat Lazim

2016-01-01

This paper presents the effects of virgin coconut oil (VCO) and olive oil (OO) as an alternative stabilizer in the radiation vulcanized natural rubber latex (RVNRL). Potassium laurite (KL) as a stabilizer considered as a control of RVNRL sample were compared to mixed ratio 1:1 KL: VCO and 1:1 KL: OO stabilizer formulation. Total solid content (TSC) and tensile strength (TS) results showed no significant different between the formulations. Mechanical stability time (MST) indicates higher stability of RVNRL with addition of VCO. The fatty acid composition in VCO indicate VCO was acting well as stabilizer for latex stabilizer formulation. (author)

Reductive de-polymerization of kraft lignin for chemicals and fuels using formic acid as an in-situ hydrogen source.

Science.gov (United States)

Huang, Shanhua; Mahmood, Nubla; Tymchyshyn, Matthew; Yuan, Zhongshun; Xu, Chunbao Charles

2014-11-01

In this study, formic acid (FA) was employed as an in-situ hydrogen donor for the reductive de-polymerization of kraft lignin (KL). Under the optimum operating conditions, i.e., 300 °C, 1 h, 18.6 wt.% substrate concentration, 50/50 (v/v) water-ethanol medium with FA at a FA-to-lignin mass ratio of 0.7, KL (Mw∼10,000 g/mol) was effectively de-polymerized, producing de-polymerized lignin (DL, Mw 1270 g/mol) at a yield of ∼90 wt.% and polymerization of KL. Copyright © 2014 Elsevier Ltd. All rights reserved.

Phosphatidylinositol 3-kinase is essential for kit ligand-mediated survival, whereas interleukin-3 and flt3 ligand induce expression of antiapoptotic Bcl-2 family genes

DEFF Research Database (Denmark)

Karlsson, Richard; Engström, Maria; Jönsson, Maria

2003-01-01

Cytokines such as interleukin 3 (IL-3), kit ligand (KL), and flt3 ligand (FL) promote survival of hematopoietic stem cells and myeloid progenitor cells. In many cell types, members of the Bcl-2 gene family are major regulators of survival, but the mediating mechanisms are not fully understood....... Using two myeloid progenitor cell lines, FDCP-mix and FDC-P1, as well as primary mouse bone marrow progenitors, we demonstrate that KL-mediated survival is dependent on the activation of phosphatidylinositol-3 (PI-3) kinase. The inhibitor LY294002 was able to completely abolish survival mediated by KL...

Osteoarthritis Severity Determination using Self Organizing Map Based Gabor Kernel

Science.gov (United States)

Anifah, L.; Purnomo, M. H.; Mengko, T. L. R.; Purnama, I. K. E.

2018-02-01

The number of osteoarthritis patients in Indonesia is enormous, so early action is needed in order for this disease to be handled. The aim of this paper to determine osteoarthritis severity based on x-ray image template based on gabor kernel. This research is divided into 3 stages, the first step is image processing that is using gabor kernel. The second stage is the learning stage, and the third stage is the testing phase. The image processing stage is by normalizing the image dimension to be template to 50 □ 200 image. Learning stage is done with parameters initial learning rate of 0.5 and the total number of iterations of 1000. The testing stage is performed using the weights generated at the learning stage. The testing phase has been done and the results were obtained. The result shows KL-Grade 0 has an accuracy of 36.21%, accuracy for KL-Grade 2 is 40,52%, while accuracy for KL-Grade 2 and KL-Grade 3 are 15,52%, and 25,86%. The implication of this research is expected that this research as decision support system for medical practitioners in determining KL-Grade on X-ray images of knee osteoarthritis.

First Responder Immersive Training Simulation Environment (FRITSE): Downwind Hazard Modeling of Scenarios

Science.gov (United States)

2014-07-31

MODULE datatype !>>TYPE TYPE OUTPUT_TYPE INTEGER :: MX INTEGER :: IL, JL, KL INTEGER :: IG, JG, KG END TYPE...PARAMETER :: C_cutoff = 1.E-20 END MODULE datatype 21 in which (IL,JL,KL) and (IG,JG,KG) represent (I,J,K) indices in the local and

Kroppen

DEFF Research Database (Denmark)

2002-01-01

Et interaktivt undervisningsprogram om krop og idræt, edb og ergonomi. Til idræts- og klasselæreren. Fra 5.kl......Et interaktivt undervisningsprogram om krop og idræt, edb og ergonomi. Til idræts- og klasselæreren. Fra 5.kl...

Osteoarthritic cartilage is more homogeneous than healthy cartilage

DEFF Research Database (Denmark)

Qazi, Arish A; Dam, Erik B; Nielsen, Mads

2007-01-01

it evolves as a consequence to disease and thereby can be used as a progression biomarker. MATERIALS AND METHODS: A total of 283 right and left knees from 159 subjects aged 21 to 81 years were scanned using a Turbo 3D T1 sequence on a 0.18-T MRI Esaote scanner. The medial compartment of the tibial cartilage...... sheet was segmented using a fully automatic voxel classification scheme based on supervised learning. From the segmented cartilage sheet, homogeneity was quantified by measuring entropy from the distribution of signal intensities inside the compartment. Each knee was examined by radiography...... of the region was evaluated by testing for overfitting. Three different regularization techniques were evaluated for reducing overfitting errors. RESULTS: The P values for separating the different groups based on cartilage homogeneity were 2 x 10(-5) (KL 0 versus KL 1) and 1 x 10(-7) (KL 0 versus KL >0). Using...

EKONOMİK KARŞILIKLI BAĞIMLILIK KAPSAMINDA AB-ÇİN İLİŞKİLERİ

OpenAIRE

Akçadağ Alagöz, Emine

2017-01-01

Bu çalışma, AB ve Çin arasındaki ekonomik ve ticari ilişkileri Keohane ve Nye tarafından formüle edilen karşılıklı bağımlılık teorisi çerçevesinde irdeleme amacı taşımaktadır. Farklı ekonomik parametreler aracılığıyla bu iki önemli güç arasındaki ekonomik ve ticari ilişkilerin mevcut durumu analiz edilerek, karşılıklı bağımlılığın asimetrik niteliği ortaya konulacaktır. Karşılıklı bağımlılıktaki asimetrilerin bir güç unsuru olduğu varsayımından hareketle, bu asimetrik karşılıklı bağımlılığın ...

Lesser known aspects of Ludwik Fleck's (1896-1961) heroic life during World War II.

Science.gov (United States)

Grzybowski, Andrzej; Ciesielska, Maria

2016-08-01

Professor Ludwik Fleck was a famous scientist and a prominent philosopher. Although his life and work were studied extensively, the Second World War period was a subject of some discussion and controversy. On account of his Jewish origin, he was first arrested and moved from the Lwów ghetto to the 'Laokoon' factory and then imprisoned in KL Auschwitz-Birkenau and in KL Buchenwald. Fleck produced the anti-typhus vaccine in the chemo-bacteriological laboratory in the Jewish Hospital at Kuszewicza Street and in the 'Laokoon' factory in Lwów. During his incarceration in KL Auschwitz-Birkenau, Fleck worked in the camp laboratory in Block 10 carrying out bacteriological studies for the inmates and then was assigned to work in the Wasserman station in Rajsko. From January 1944 Fleck performed routine laboratory tests in Block 50 in KL Buchenwald. Though Fleck had a privileged life in the camp, he participated in the sabotage activities organized by the camp resistance. © The Author(s) 2016.

Prevalence of diffuse idiopathic skeletal hyperostosis (DISH) of the whole spine and its association with lumbar spondylosis and knee osteoarthritis: the ROAD study.

Science.gov (United States)

Kagotani, Ryohei; Yoshida, Munehito; Muraki, Shigeyuki; Oka, Hiroyuki; Hashizume, Hiroshi; Yamada, Hiroshi; Enyo, Yoshio; Nagata, Keiji; Ishimoto, Yuyu; Teraguchi, Masatoshi; Tanaka, Sakae; Nakamura, Kozo; Kawaguchi, Hiroshi; Akune, Toru; Yoshimura, Noriko

2015-03-01

We aimed to assess the prevalence of diffuse idiopathic skeletal hyperostosis (DISH) and its association with lumbar spondylosis (LS) and knee osteoarthritis (KOA) using a population-based cohort study entitled Research on Osteoarthritis/osteoporosis Against Disability (ROAD). In the baseline ROAD study, which was performed between 2005 and 2007, 1,690 participants in mountainous and coastal areas underwent anthropometric measurements and radiographic examinations of the whole spine (cervical, thoracic, and lumbar) and both knees. They also completed an interviewer-administered questionnaire. Presence of DISH was diagnosed according to Resnick criteria, and LS and KOA were defined as Kellgren-Lawrence (KL) grade ≥3. Among the 1,690 participants, whole-spine radiographs of 1,647 individuals (97.5%; 573 men, 1,074 women; mean age, 65.3 years) were evaluated. Prevalence of DISH was 10.8% (men 22.0%, women 4.8%), and was significantly higher in older participants (presence of DISH 72.3 years, absence of DISH 64.4 years) and mainly distributed at the thoracic spine (88.7%). Logistic regression analysis revealed that presence of DISH was significantly associated with older age [+1 year, odds ratio (OR): 1.06, 95% confidence interval (CI): 1.03-1.14], male sex (OR: 5.55, 95% CI: 3.57-8.63), higher body mass index (+1 kg/m(2), OR: 1.08, 95% CI: 1.02-1.14), presence of LS (KL2 vs KL0: 1, OR: 5.50, 95% CI: 2.81-10.8) (KL ≥3 vs KL0: 1, OR: 4.09, 95% CI: 2.08-8.03), and presence of KOA (KL ≥3 vs KL0: 1, OR: 1.89, 95% CI: 1.14-3.10) after adjusting for smoking, alcohol consumption, and residential area (mountainous vs coastal). This cross-sectional population-based study clarified the prevalence of DISH in general inhabitants and its significant association with LS and severe KOA.

Radiation application for upgrading of bioresources - Development of antifungal and-or nitrogen fixative microbes

Energy Technology Data Exchange (ETDEWEB)

Lee, Ki Sung; Kim, Soo Ki; Lee, Sung Ho; Lee, Jung Suk [Paichai University, Taejon (Korea)

1999-04-01

(1) In this study, the antifungal bacterial eight strains were isolated from various environment located in Chung-cheong area, Korea. These isolates were identified the genera Bacillus sp, Pseudomonas sp. through morphological, physiological and biochemical analysis. Especially, strain KL2143, 2367 were identified as Bacillus subtilis (KL2143/KL2367) and strain KL2326, KL2314 identified as Pseudomonas aurantiaca have never been reported internationally. Considering antifungal(AF) spectrum of strain KL2143 show the broad range of AF activity on a number of pathogenic fungi. Therefore, strain KL2143 was selected with the strong candidate of antifungal bacteria on every purpose and usage related with our research goal. (2) Optimal conditions for the production of antifungal material were analyzed under various environmental conditions (carbon source, nitrogen source, phosphate concentration, pH, temperature, amino acids, vitamins). Growth rates were different according to carbon and nitrogen source, antifungal material production yield were not different, however. Product of antifungal material according to phosphate is proportional to concentration; the higher in high concentration and the low in lower concentration. And productivity of antifungal material is was generally high in the range 30 - 37 deg C at pH7 and in case of adding vitamin B12, lysine and aginine to medium it was enhanced. (3) Moreover, bio-degradability upon agricultural substance and organic substances by AF bacteria was strikingly effective. (4) AF stains were screened and selected from this research can be used in the microbial biocides as well as multifunctional bio-controllers in order to remove plant pathogenic fungi and to clarify the polluted environment. Due to their excellent degradation capability for agricultural and/or organic substances, they also can be used to improve soil quality, to ferment compost and to clean up the environment. (5) Establishment of a new technology for the

Comparison of plant growth-promotion with Pseudomonas aeruginosa and Bacillus subtilis in three vegetables Comparação da promoção de crescimento de plantas por Pseudomonas aeruginosa e Bacillus subtilis em três vegetais

Directory of Open Access Journals (Sweden)

A.O. Adesemoye

2008-09-01

Full Text Available Our objective was to compare some plant growth promoting rhizobacteria (PGPR properties of Bacillus subtilis and Pseudomonas aeruginosa as representatives of their two genera. Solanum lycopersicum L. (tomato, Abelmoschus esculentus (okra, and Amaranthus sp. (African spinach were inoculated with the bacterial cultures. At 60 days after planting, dry biomass for plants treated with B. subtilis and P. aeruginosa increased 31% for tomato, 36% and 29% for okra, and 83% and 40% for African spinach respectively over the non-bacterized control. Considering all the parameters tested, there were similarities but no significant difference at P Nosso objetivo foi comparar as propriedades PGPR (rizobactérias promotoras de crescimento de plantas de Bacillus subtilis e Pseudomonas aeruginosa. Solanum licopersicum (tomate, Asbelmoschus esculentus (ocra e Amaranthus sp (espinafre africano foram inoculados com as culturas bacterianas. Após 60 dias de plantio, a biomassa seca das plantas tratadas com B.subtilis e P. aeruginosa aumentou 31% para o tomate, 36% e 29% para ocra, e 83% e 40% para espinafre africano, respectivamente, em comparação com o controle não inoculado. Considerando os parâmetros testados, o desempenho dos dois microrganismos foi similar, sem diferença estatisticamente significativa (p< 0,05.

Using an alignment of fragment strings for comparing protein structures

DEFF Research Database (Denmark)

Friedberg, Iddo; Harder, Tim; Kolodny, Rachel

2007-01-01

. RESULTS: Here we describe the use of a particular structure fragment library, denoted here as KL-strings, for the 1D representation of protein structure. Using KL-strings, we develop an infrastructure for comparing protein structures with a 1D representation. This study focuses on the added value gained...

Loaded versus unloaded magnetic resonance imaging (MRI of the knee: Effect on meniscus extrusion in healthy volunteers and patients with osteoarthritis

Directory of Open Access Journals (Sweden)

Rina Patel

2016-01-01

Conclusion: Our study demonstrated that medial meniscal extrusion significantly increased during loading, specifically in those low KL scores (0 and 1 and in KL score of 3. Loaded MRI may more accurately determine the extent of medial meniscal extrusion in particular in those with no to minimal OA.

Decontamination of sliced and powdered okra (Abelmoschus esculentus) and some aspects of nutrient quality before and after gamma irradiation

International Nuclear Information System (INIS)

Ofori-Appiah, D.

2012-01-01

Food security in Africa is crucial for survival of the increasing population. However, agricultural produce in the field are drastically reduced along the food pipeline (from farm gate to the consumer's table) by bioderioagents including microorganisms. Okra (Abelmoschus esculentus (L) Moench) is one such farm produce of economic importance in Ghana with a great potential of providing essential nutrients and vitamins in our diet. The high moisture content of the fresh fruit makes it susceptible to microbial deterioration in a short time. Dehydration methods (sun-drying and solar drying) are practiced worldwide but in Africa, this is attended by contamination by aeromycoflora and other agents such as insect eggs and larvae. In addition are physical and chemical contaminants. In this thesis, the mycoflora and Total Aerobic Bacteria load of market samples and solar-dried okra (Clemson spineless and Legon Finger) chips and powder were ascertained with the view to documenting toxin-producing fungal species and update the resident mycoflora and bacteria load. Insects resident in the samples were detected by the hidden infestation technique; mycoflora was determined by the decimal serial dilution method on different media and Total Aerobic Bacteria population was determined on Plate Count Agar at 320C for 48hr. In order to establish storage stability of the okra, the chips and powdered samples were placed in glass desiccators with glycerol: water mixtures providing Environmental Relative Humidities of 20, 55, 65, 75, 85 and 95% representative of the Ghanaian Tropic Conditions to undergo sorption at the same temperature. Gamma irradiation doses (0, 5, 10, 20kGy) were used as a preservation process to decontaminate resident mycoflora and total aerobic bacteria. This was supplemented by an in vitro study in the radio-resistance of six selected resident fungi (Aspergillus; Penicllium spp). The veracity of the dry okra supporting growth of selected Aspergillus and Penicillium

Rare KL decays at Fermilab

International Nuclear Information System (INIS)

Schnetzer, St.

1997-01-01

Recent results and the future prospects for rare K L decay at Fermilab are described. A summary of all rare decay results from E799 Phase I (the 1991 run) are presented. Three new results: K L → e + e - μ + μ - , K L → π 0 μe, and π 0 → e + e - e + e - are discussed in detail. Improvements for KTeV (the 1996-1997 run) are discussed and the expected sensitivities listed. Finally, the KAMI program for rare decays with the Main Injector (2000 and beyond) is presented with emphasis on a search for the decay K L → π 0 νν-bar at O(10 -12 ) single-event-sensitivity. (author)

Klüver-Bucy Syndrome

Science.gov (United States)

... inappropriate sexual behavior. Other symptoms may include visual agnosia (inability to visually recognize objects), loss of normal ... inappropriate sexual behavior. Other symptoms may include visual agnosia (inability to visually recognize objects), loss of normal ...

Selective Media for Actinide Collection and Pre-Concentration: Results of FY 2006 Studies

Energy Technology Data Exchange (ETDEWEB)

Lumetta, Gregg J.; Addleman, Raymond S.; Hay, Benjamin P.; Hubler, Timothy L.; Levitskaia, Tatiana G.; Sinkov, Sergey I.; Snow, Lanee A.; Warner, Marvin G.; Latesky, Stanley L.

2006-11-17

In this work, we have investigated new materials for potential use in automated radiochemical separations. The work can be divided into three primary tasks: (1) synthesis of new ligands with high affinity for actinide ions, (2) evaluation of new materials for actinide ion affinity, and (3) computational design of advanced ligand architectures for highly selective binding of actinide ions. Ligand Synthesis Work was conducted on synthesizing Kl?ui ligand derivatives containing functionalized pendant groups on the cyclopentadienyl ring. The functionalized pendent groups would allow these ligands to be attached to organic and inorganic solid supports. This work focused on synthesizing the compound Na[Cp?Co(PO(OC2H5)2)3], where Cp?= C5H4C(O)OCH3. Synthesizing this compound is feasible, but the method used in FY 2006 produced an impure material. A modified synthetic scheme has been developed and will be pursued in FY 2007. Work was also initiated on synthesizing bicyclic diamides functionalized for binding to polymeric resins or other surfaces. Researchers at the University of Oregon are collaborators in this work. To date, this effort has focused on synthesizing and characterizing a symmetrically substituted bicyclic diamide ligand with the ?COOH functionality. Again, this synthetic effort will continue into FY 2007. Separations Material Evaluation Work was conducted in FY 2006 to provide a more extensive set of data on the selectivity and affinity of extraction chromatography resins prepared by sorption of Kl?ui ligand onto an inert macroreticular polymeric support. Consistent with previous observations, it was found that these materials strongly bind tetravalent actinides. These materials also adsorb trivalent actinides at low nitric acid concentrations, but the affinity for the trivalent actinides decreases with increasing nitric acid concentration. These materials have relatively low affinity for U(VI), but they do sorb U(VI) to a greater extent than Am(III) at [HNO

Selective Media for Actinide Collection and Pre-Concentration: Results of FY 2006 Studies

International Nuclear Information System (INIS)

Lumetta, Gregg J.; Addleman, Raymond S.; Hay, Benjamin P.; Hubler, Timothy L.; Levitskaia, Tatiana G.; Sinkov, Sergey I.; Snow, Lanee A.; Warner, Marvin G.; Latesky, Stanley L.

2006-01-01

In this work, we have investigated new materials for potential use in automated radiochemical separations. The work can be divided into three primary tasks: (1) synthesis of new ligands with high affinity for actinide ions, (2) evaluation of new materials for actinide ion affinity, and (3) computational design of advanced ligand architectures for highly selective binding of actinide ions. Ligand Synthesis Work was conducted on synthesizing Kl?ui ligand derivatives containing functionalized pendant groups on the cyclopentadienyl ring. The functionalized pendent groups would allow these ligands to be attached to organic and inorganic solid supports. This work focused on synthesizing the compound Na[Cp?Co(PO(OC2H5)2)3], where Cp?C5H4C(O)OCH3. Synthesizing this compound is feasible, but the method used in FY 2006 produced an impure material. A modified synthetic scheme has been developed and will be pursued in FY 2007. Work was also initiated on synthesizing bicyclic diamides functionalized for binding to polymeric resins or other surfaces. Researchers at the University of Oregon are collaborators in this work. To date, this effort has focused on synthesizing and characterizing a symmetrically substituted bicyclic diamide ligand with the ?COOH functionality. Again, this synthetic effort will continue into FY 2007. Separations Material Evaluation Work was conducted in FY 2006 to provide a more extensive set of data on the selectivity and affinity of extraction chromatography resins prepared by sorption of Kl?ui ligand onto an inert macroreticular polymeric support. Consistent with previous observations, it was found that these materials strongly bind tetravalent actinides. These materials also adsorb trivalent actinides at low nitric acid concentrations, but the affinity for the trivalent actinides decreases with increasing nitric acid concentration. These materials have relatively low affinity for U(VI), but they do sorb U(VI) to a greater extent than Am(III) at [HNO3

EFFECT OF POLYETHYLENE BLACK PLASTIC MULCH ON GROWTH AND YIELD OF TWO SUMMER VEGETABLE CROPS UNDER RAIN-FED CONDITIONS UNDER SEMI-ARID REGION CONDITIONS

OpenAIRE

Atif Y. Mahadeen

2014-01-01

Water use efficiency in agriculture can be enhanced by several strategies mainly by reducing evaporation from the soil surface. The mulching techniques were being used widely in irrigated crop production worldwide. The mulching techniques can be also implemented in summer vegetables production under rain-fed conditions. The current study aimed at evaluating the effect of polyethylene black plastic mulch on growth and yield of okra, Abelmoschus esculentus and summer squash, ...

A survey of ichthyofauna of Lake Kanyaboli and other small waterbodies in Kenya: alternative refugia for endangered fish species

OpenAIRE

Maithya, J.

1998-01-01

In 1988, the World Conservation Union (WCU) Red Book of Endangered Species listed hundreds of endemic fishes of Lake Victoria under a single heading - "ENDANGERED". Most of the endemic native food fishes are either endangered or extinct. However, a survey of the fauna of Lake Kanyaboli, revealed that a few remaining samples of these native fishes are actually thriving. These include several unidentified Haplochromis spp., Oreochromis esculentus and Oreochromis variabilis. As a resul...

Catalytic efficiency of natural and synthetic compounds used as laccase-mediators in oxidising veratryl alcohol and a kraft lignin, estimated by electrochemical analysis

International Nuclear Information System (INIS)

Gonzalez Arzola, K.; Arevalo, M.C.; Falcon, M.A.

2009-01-01

The electrochemical properties of eighteen natural and synthetic compounds commonly used to expand the oxidative capacity of laccases were evaluated in an aqueous buffered medium using cyclic voltammetry. This clarifies which compounds fulfil the requisites to be considered as redox mediators or enhancers. Cyclic voltammetry was also applied as a rapid way to assess the catalytic efficiency (CE) of those compounds which oxidise a non-phenolic lignin model (veratryl alcohol, VA) and a kraft lignin (KL). With the exception of gallic acid and catechol, all assayed compounds were capable of oxidising VA with varying CE. However, only some of them were able to oxidise KL. Although the oxidised forms of HBT and acetovanillone were not electrochemically stable, their reduced forms were quickly regenerated in the presence of VA. They thus act as chemical catalysts. Importantly, HBT and HPI did not attack the KL via the same mechanism as in VA oxidation. Electrochemical evidence suggests that violuric acid oxidises both substrates by an electron transfer mechanism, unlike the other N-OH compounds HBT and HPI. Acetovanillone was found to be efficient in oxidising VA and KL, even better than the synthetic mediators TEMPO, violuric acid or ABTS. Most of the compounds produced a generalised increase in the oxidative charge of KL, probably attributed to chain reactions arising between the phenolic and non-phenolic components of this complex molecule

Kalman filter parameter estimation for a nonlinear diffusion model of epithelial cell migration using stochastic collocation and the Karhunen-Loeve expansion.

Science.gov (United States)

Barber, Jared; Tanase, Roxana; Yotov, Ivan

2016-06-01

Several Kalman filter algorithms are presented for data assimilation and parameter estimation for a nonlinear diffusion model of epithelial cell migration. These include the ensemble Kalman filter with Monte Carlo sampling and a stochastic collocation (SC) Kalman filter with structured sampling. Further, two types of noise are considered -uncorrelated noise resulting in one stochastic dimension for each element of the spatial grid and correlated noise parameterized by the Karhunen-Loeve (KL) expansion resulting in one stochastic dimension for each KL term. The efficiency and accuracy of the four methods are investigated for two cases with synthetic data with and without noise, as well as data from a laboratory experiment. While it is observed that all algorithms perform reasonably well in matching the target solution and estimating the diffusion coefficient and the growth rate, it is illustrated that the algorithms that employ SC and KL expansion are computationally more efficient, as they require fewer ensemble members for comparable accuracy. In the case of SC methods, this is due to improved approximation in stochastic space compared to Monte Carlo sampling. In the case of KL methods, the parameterization of the noise results in a stochastic space of smaller dimension. The most efficient method is the one combining SC and KL expansion. Copyright © 2016 Elsevier Inc. All rights reserved.

Catalytic efficiency of natural and synthetic compounds used as laccase-mediators in oxidising veratryl alcohol and a kraft lignin, estimated by electrochemical analysis

Energy Technology Data Exchange (ETDEWEB)

Gonzalez Arzola, K. [Department of Microbiology and Cell Biology, Faculty of Pharmacy, University of La Laguna, 38206 La Laguna, Tenerife (Spain); Arevalo, M.C. [Department of Physical Chemistry, Faculty of Chemistry, University of La Laguna, 38206 La Laguna, Tenerife (Spain)], E-mail: carevalo@ull.es; Falcon, M.A. [Department of Microbiology and Cell Biology, Faculty of Pharmacy, University of La Laguna, 38206 La Laguna, Tenerife (Spain)], E-mail: mafalcon@ull.es

2009-03-30

The electrochemical properties of eighteen natural and synthetic compounds commonly used to expand the oxidative capacity of laccases were evaluated in an aqueous buffered medium using cyclic voltammetry. This clarifies which compounds fulfil the requisites to be considered as redox mediators or enhancers. Cyclic voltammetry was also applied as a rapid way to assess the catalytic efficiency (CE) of those compounds which oxidise a non-phenolic lignin model (veratryl alcohol, VA) and a kraft lignin (KL). With the exception of gallic acid and catechol, all assayed compounds were capable of oxidising VA with varying CE. However, only some of them were able to oxidise KL. Although the oxidised forms of HBT and acetovanillone were not electrochemically stable, their reduced forms were quickly regenerated in the presence of VA. They thus act as chemical catalysts. Importantly, HBT and HPI did not attack the KL via the same mechanism as in VA oxidation. Electrochemical evidence suggests that violuric acid oxidises both substrates by an electron transfer mechanism, unlike the other N-OH compounds HBT and HPI. Acetovanillone was found to be efficient in oxidising VA and KL, even better than the synthetic mediators TEMPO, violuric acid or ABTS. Most of the compounds produced a generalised increase in the oxidative charge of KL, probably attributed to chain reactions arising between the phenolic and non-phenolic components of this complex molecule.

Composição florística de plantas daninhas em um lago do Rio Solimões, Amazonas Floristic composition of weeds in a lake of Solimoes River, Amazonas, Brazil

Directory of Open Access Journals (Sweden)

S.M.F. Albertino

2009-03-01

Full Text Available As áreas inundáveis localizadas na bacia dos rios Amazonas e Solimões são denominadas várzeas. A inundação é um evento natural que promove mudanças na estrutura e composição florística dessas comunidades. O conhecimento da diversidade de espécies é de fundamental importância para o entendimento da dinâmica da regeneração natural de espécies nos ecossistemas amazônicos. Este trabalho teve como objetivo levantar a composição florística do solo do fundo do lago do Manaquiri-AM, em um período de seca excepcional, ocorrida em 2005, na Amazônia. Foram realizadas coletas de material botânico em duas áreas do lago, em novembro de 2005; para a amostragem, utilizou-se um quadrado de madeira de 0,36 m², atirado aleatoriamente por 20 vezes em cada local de estudo. A vegetação emergente foi de 5.958 indivíduos, distribuídos em sete famílias e nove espécies. As famílias mais representativas em número de espécies foram Poaceae e Cyperaceae. Cyperus esculentus e Luziola spruceana foram as mais frequentes, e Mimosa pudica e Alternanthera sessilis, as de maior abundância. C. esculentus e M. pudica apresentaram maior número de indivíduos, de densidade e de valor de importância. As espécies de plantas encontradas neste estudo mantiveram sua capacidade de crescer e se desenvolver mesmo após longo período submersas.The swamps located at the basins of the Amazonas and Solimões rivers are denominated "várzeas". In these areas, flooding is a natural event that changes the structure and composition of the local plants. Thus, knowing the species diversity in these Amazon region areas is extremely important to understand the dynamics of the natural regeneration of the Amazon ecosystem species. Accordingly, the goal of this study was to survey the soil floristic composition at the bottom of the Manaquiri Lake, Amazon, during an exceptional dry period in 2005. Plants were collected in two areas of the lake in November 2005. Flora

Interferência de plantas daninhas na cultura do quiabo Weed interference in okra crop

Directory of Open Access Journals (Sweden)

J.B. Santos

2010-06-01

Full Text Available Objetivou-se com este trabalho avaliar os períodos de interferência das plantas daninhas na cultura do quiabo (Abelmoschus esculentus na região do Médio Vale do Rio Doce, em Minas Gerais. O experimento foi conduzido em campo, entre maio e outubro de 2007. Utilizaram-se sementes do quiabo Santa Cruz-47, semeadas no espaçamento de 0,25 x 1 m. Foram estabelecidos diferentes períodos de controle das plantas daninhas na cultura, variando entre zero e 120 dias após a emergência (DAE. Foram avaliados 12 tratamentos, correspondendo a diferentes períodos de controle das plantas daninhas na cultura: capina após a emergência a partir dos 20, 40, 60, 80 e 100 dias; capina após a emergência até os 20, 40, 60, 80 e 100 dias; além de duas testemunhas com capina, ou não capinadas, ambas por 120 dias. Determinou-se o número de frutos por planta e o rendimento (produtividade, bem como os valores em dias para período anterior à interferência (PAI, período crítico de prevenção da interferência (PCPI e período total de prevenção da interferência (PTPI, considerando 5% de perdas. A partir das espécies encontradas na área experimental, avaliou-se também, em vasos, isoladamente ou em competição com o quiabeiro, a capacidade competitiva das principais plantas daninhas. Com base nos resultados, verificou-se que o PAI estimado foi de 25 DAE, indicando a época de início das capinas. Para o PCPI, o período observado foi de 75 dias, indicando PTPI de 100 DAE. Entre as plantas daninhas presentes, Eleusine indica apresentou maior capacidade competitiva sobre a cultura.An experiment was carried out under field conditions in Médio Vale do Rio Doce-MG, from May to October, 2007, to establish periods of weed interference in Abelmoschus esculentus crop. 'Santa Cruz-47' seeds were sown in a 0.25 x 1.0 m spacing, and weed control times varied from 0 to 120 days after emergence (DAE. Number of fruit per plant and yield as well as values in days

Effect of Bench Press Load Knowledge on Repetitions, Rating of Perceived Exertion, and Attentional Focus.

Science.gov (United States)

Beaudoin, Christina M; Cox, Zachary; Dundore, Tyler; Thomas, Tayler; Kim, Johnathon; Pillivant, Daniel

2018-02-01

Beaudoin, CM, Cox, Z, Dundore, T, Thomas, T, Kim, J, and Pillivant, D. Effect of bench press load knowledge on repetitions, rating of perceived exertion, and attentional focus. J Strength Cond Res 32(2): 514-519, 2018-Few studies have examined the role of the teleoanticipation during resistance training. The purpose of this study was to examine the effect of bench press (BP) load knowledge on repetitions completed, ratings of perceived exertion (RPEs), and attentional focus (% associative). Thirty-six recreationally active resistance-trained men (n = 25) and women (n = 11) participated in this study (age = 20.97 ± 1.87 years; ht = 174.12 ± 9.41 cm; and mass = 80.14 ± 14.03 kg). All subjects completed 3 testing sessions: (a) 1 repetition maximum (1RM) BP determination; (b) submaximal BP repetitions to fatigue known load (KL); and (c) submaximal BP repetitions to fatigue unknown load (UL). Known load and UL sessions were randomized and counterbalanced and both completed at 70% 1RM. An estimated weight ratio was computed using the subject's estimate of the UL weight relative to the KL weight. An independent samples t-test revealed no significant testing order difference for the estimated weight ratio. Two-way repeated-measures analysis of variances revealed no significant differences in the number of repetitions (p = 0.63), RPE (p = 0.18), or attentional focus (% associative) (p = 0.93) between the KL and UL conditions. Pearson correlations found a moderate positive association between KL repetitions completed and % associative focus when the UL was completed before the KL. Load knowledge did not influence the number of repetitions, RPE, or attentional focus while completing the BP. Further research examining the use of pacing strategies, RPE, and attentional focus during KL and UL conditions are warranted.

Klotho expression in long bones regulates FGF23 production during renal failure.

Science.gov (United States)

Kaludjerovic, Jovana; Komaba, Hirotaka; Sato, Tadatoshi; Erben, Reinhold G; Baron, Roland; Olauson, Hannes; Larsson, Tobias E; Lanske, Beate

2017-05-01

Circulating levels of bone-derived fibroblast growth factor 23 (FGF23) increase early during acute and chronic kidney disease and are associated with adverse outcomes. Membrane-bound Klotho acts as a permissive coreceptor for FGF23, and its expression was recently found in osteoblasts/osteocytes. We hypothesized that Klotho in bone cells is part of an autocrine feedback loop that regulates FGF23 expression during renal failure. Thus, we induced renal failure in mice with targeted deletion of Klotho in long bones. Uremic wild-type ( KL fl/fl ) and knockout ( Prx1-Cre;KL fl/fl ) mice both responded with reduced body weight, kidney atrophy, hyperphosphatemia, and increased bone turnover. Importantly, long bones of Prx1-Cre;KL fl/fl mice but not their axial skeleton failed to increase FGF23 expression as observed in uremic KL fl/fl mice. Consequently, Prx1-Cre;KL fl/fl mice had significantly lower serum FGF23 and parathyroid hormone levels, and higher renal 1-α-hydroxylase expression, serum 1,25-dihydroxyvitamin D, and calcium levels than KL fl/fl mice. These results were confirmed in two independent models of renal failure, adenine diet induced and 5/6 nephrectomy. Moreover, FGF23-treated bone cells required Klotho to increase FGF23 mRNA and ERK phosphorylation. In summary, our novel findings show that Klotho in bone is crucial for inducing FGF23 production upon renal failure. We propose the presence of an autocrine feedback loop in which Klotho senses the need for FGF23.-Kaludjerovic, J., Komaba, H., Sato, T., Erben, R. G., Baron, R., Olauson, H., Larsson, T. E., Lanske, B. Klotho expression in long bones regulates FGF23 production during renal failure. © FASEB.

Radiation transport and the kinematics of molecular clouds

International Nuclear Information System (INIS)

Kwan, J.

1978-01-01

We compare line profiles calculated under either the systematic mottion interpretation or the turbulent motion interpretation of the molecular line widths, with the stipulation that both the density and temperature distributions be decreasing functions of radius. In systematic motion of the form V (r) proportional/sup -alpha/, α>0, optically thin lines observed toward the center are flat-topped or double-peaked, and optically thick lines are asymmetric. In a constant collapes or outflow velocity, optically thin lines observed toward the center are double-peaked, and optically thick lines arfe flat-topped. In systematic motion of the form V (r) proportionalr/sup α/,α>0, both optically thin and optically thick lines are centrally peaked. The distinguishing feature in this case is that the width (FWHM) of the CS 3→ 2 line is considerably smaller that that of the 13 CO 1 → 0 line. In turbulent motion, the CO 1 → 0, 2 → 1, and 3 → 2 lines are marked by progressively more pronounced self-absorptions.The observations at M17 SW and the Kleinmann-Low (KL) nebula are studied. At M17 SW, they are best accounted for by a model in which turbulence dominates the central part of the molecular region but collapse prevails at the outer part. At KL, the present observations can be equally well explained by one of two models. The first model postulates that KL is at the front face of the molecular cloud and that the temperature is highest at the surface. Turbulence gives rise to the line broadening. The second model postulates that KL is deep within the molecular cloud. Systematic motion about KL accounts for the CO and 13 CO line widths, but high-density fragments at KL are required to provide excitations in other molecular lines with considerably larger spontaneous emission rates

The CIE94 colour difference formula for describing visual detection thresholds in static noise

NARCIS (Netherlands)

Lucassen, M.P.; Bijl, P.

2004-01-01

The parametric factors kL, kC and kH that scale the CIELAB components kL*, kC* and kH* in the CIE94 colour difference formula are unity under reference conditions. When the conditions are changed, the scaling factors may be adapted to account for the influence of specific experimental conditions on

USING THE KARHUNEN-LOÈVE TRANSFORM TO SUPPRESS GROUND ROLL IN SEISMIC DATA

Directory of Open Access Journals (Sweden)

Kazmierczak Thaís de Souza

2005-08-01

Full Text Available ABSTRACTThe Sacchi's algorithm (2002 based on the Karhunen-Loève (K-L Transform was modified and implemented to suppress Ground Roll without distortion of the reflection signals, it provided better results than conventional techniques for noise removal like f-k, High-Pass and Band Pass Filters. The K-L Transform is well known in other fields as image processing (Levy and Linderbaurn, 2000, face, iris and fingerprint identification. A seismic section is an image of subsurface where the K-L can be useful in seismic processing because spatially uncorrelated signals can be removed providing a clear and coherent image. The algorithm was applied to seismic data generated with hammer, thumper and explosive sources. Conventional processing flows were used, but one replaced filters with K-L Transform, providing stacked sections. The K-L Transform recovers better the reflector amplitudes when compared with others filters, also it removes refractions that cause unreal shallow events and increases the lateral coherence of seismic events showing a more interpretable geology.

Investigation of the chiral antiferromagnetic Heisenberg model using projected entangled pair states

Science.gov (United States)

Poilblanc, Didier

2017-09-01

A simple spin-1/2 frustrated antiferromagnetic Heisenberg model (AFHM) on the square lattice—including chiral plaquette cyclic terms—was argued [A. E. B. Nielsen, G. Sierra, and J. I. Cirac, Nat. Commun. 4, 2864 (2013), 10.1038/ncomms3864] to host a bosonic Kalmeyer-Laughlin (KL) fractional quantum Hall ground state [V. Kalmeyer and R. B. Laughlin, Phys. Rev. Lett. 59, 2095 (1987), 10.1103/PhysRevLett.59.2095]. Here, we construct generic families of chiral projected entangled pair states (chiral PEPS) with low bond dimension (D =3 ,4 ,5 ) which, upon optimization, provide better variational energies than the KL Ansatz. The optimal D =3 PEPS exhibits chiral edge modes described by the Wess-Zumino-Witten SU(2) 1 model, as expected for the KL spin liquid. However, we find evidence that, in contrast to the KL state, the PEPS spin liquids have power-law dimer-dimer correlations and exhibit a gossamer long-range tail in the spin-spin correlations. We conjecture that these features are genuine to local chiral AFHM on bipartite lattices.

[Handbuch des personalen Gelegenheitsschrifttums in europäischen Bibliotheken und Archiven] / Jürgen Beyer

Index Scriptorium Estoniae

Beyer, Jürgen, 1965-

2007-01-01

Arvustus: Handbuch des personalen Gelegenheitsschrifttums in europäischen Bibliotheken und Archiven. Bd. 7., Reval - Tallinn. Estnische Akademische Bibliothek - Eesti Akadeemiline Raamatukogu ; Estnisches Historisches Museum - Eesti Ajaloomuuseum ; Estnische Nationalbibliothek - Eesti Rahvusraamatukogu ; Revaler Stadtarchiv - Tallinna Linnaarhiiv / mit einer bibliotheksgeschichtlichen Einleitung und einer kommentierten Bibliographie von Martin Klöker ; herausgegeben von Sabine Beckmann... [et al.]. - Hildesheim [etc.], 2003 ; Handbuch des personalen Gelegenheitsschrifttums in europäischen Bibliotheken und Archiven. Bd. 8., Dorpat - Tartu. Universitätsbibliothek - Ülikooli Raamatukogu ; Estnisches Literaturmuseum - Eesti Kirjandusmuuseum ; Estnisches Historisches Archiv - Eesti Ajalooarhiiv / mit einer bibliotheksgeschichtlichen Einleitung und einer kommentierten Bibliographie von Martin Klöker ; herausgegeben von Klaus Garber, Sabine Beckmann... [et al.]. - Hildesheim [etc.], 2003 ; Handbuch des personalen Gelegenheitsschrifttums in europäischen Bibliotheken und Archiven. Bd. 12-15, Riga: Akademische Bibliothek Lettlands. Historisches Staatsarchiv Lettlands. Spezialbibliothek des Archivwesens. Nationalbibliothek Lettlands. Baltische Zentrale Bibliothek. T. 1-4 / mit einer bibliotheksgeschichtlichen Einleitung und einer kommentierten Bibliographie von Martin Klöker ; herausgegeben von Sabine Beckmann und Martin Klöker unter Mitarbeit von Stefan Anders. - Hildesheim [etc.], 2004

SPECTROSCOPIC CHARACTERIZATION AND DETECTION OF ETHYL MERCAPTAN IN ORION

International Nuclear Information System (INIS)

Kolesniková, L.; Alonso, J. L.; Daly, A. M.; Tercero, B.; Cernicharo, J.; Gordon, B. P.; Shipman, S. T.

2014-01-01

New laboratory data of ethyl mercaptan, CH 3 CH 2 SH, in the millimeter- and submillimeter-wave domains (up to 880 GHz) provided very precise values of the spectroscopic constants that allowed the detection of gauche-CH 3 CH 2 SH toward Orion KL. This identification is supported by 77 unblended or slightly blended lines plus no missing transitions in the range 80-280 GHz. A detection of methyl mercaptan, CH 3 SH, in the spectral survey of Orion KL is reported as well. Our column density results indicate that methyl mercaptan is ≅ 5 times more abundant than ethyl mercaptan in the hot core of Orion KL

SPECTROSCOPIC CHARACTERIZATION AND DETECTION OF ETHYL MERCAPTAN IN ORION

Energy Technology Data Exchange (ETDEWEB)

Kolesniková, L.; Alonso, J. L.; Daly, A. M. [Grupo de Espectroscopía Molecular (GEM), Edificio Quifima, Laboratorios de Espectroscopía y Bioespectroscopía, Parque Científico UVa, Unidad Asociada CSIC, Universidad de Valladolid, E-47011 Valladolid (Spain); Tercero, B.; Cernicharo, J. [Departamento de Astrofísica, Centro de Astrobiología CAB, CSIC-INTA, Ctra. de Torrejón a Ajalvir km 4, E-28850 Madrid (Spain); Gordon, B. P.; Shipman, S. T., E-mail: lucie.kolesnikova@uva.es, E-mail: jlalonso@qf.uva.es, E-mail: adammichael.daly@uva.es, E-mail: terceromb@cab.inta-csic.es, E-mail: jcernicharo@cab.inta-csic.es, E-mail: brittany.gordon@ncf.edu, E-mail: shipman@ncf.edu [Division of Natural Sciences, New College of Florida, Sarasota, FL 34243 (United States)

2014-03-20

New laboratory data of ethyl mercaptan, CH{sub 3}CH{sub 2}SH, in the millimeter- and submillimeter-wave domains (up to 880 GHz) provided very precise values of the spectroscopic constants that allowed the detection of gauche-CH{sub 3}CH{sub 2}SH toward Orion KL. This identification is supported by 77 unblended or slightly blended lines plus no missing transitions in the range 80-280 GHz. A detection of methyl mercaptan, CH{sub 3}SH, in the spectral survey of Orion KL is reported as well. Our column density results indicate that methyl mercaptan is ≅ 5 times more abundant than ethyl mercaptan in the hot core of Orion KL.

En av gutta

DEFF Research Database (Denmark)

Neumann, Cecilie Basberg; Rysst, Mari; Bjerck, Mari

2012-01-01

Hvilken betydning har kjønn og klær for kvinner som arbeider i mannsdominerte arbeiderklasseyrker? Forfatterne av denne artikkelen finner at kvinnene må nedtone sitt kjønn og sin seksualitet gjennom å dekke til kroppen, i klær laget for menn, for å signalisere at de er på jobb for å arbeide. Hvor...

A short Introduction to Danish Hymnody

DEFF Research Database (Denmark)

Balslev-Clausen, Peter

1988-01-01

After a general introduction of Danish Hymnody an analysis of 4 Danish Hymns from Thomas Kingo to K.L. Aastrup, followed by a presentation of "Songs from Denmark"......After a general introduction of Danish Hymnody an analysis of 4 Danish Hymns from Thomas Kingo to K.L. Aastrup, followed by a presentation of "Songs from Denmark"...

Collisional Dynamics of the B 3Pi(O+) State of Bromine Monochloride.

Science.gov (United States)

1986-08-01

Hays, Optics Comm, 28(2), 209, Feb 1979. 132. M. Giegelmann, H.P. Grienelsen, K. Hola , Yue-Jing Hu, J Krasinski and K.L. Kompa, AP Phys, 23, 283, 1980...133. M. Diegelmann, K. Hola , and K.L. Kompa, Optics Comm, 29(3), 334, June 1979. 134. S.J. Davis, AFWL-TR-79-104, Air Force Weapons Laboratory, 167

Characterization and genomic analysis of kraft lignin biodegradation by the beta-proteobacterium Cupriavidus basilensis B-8

Directory of Open Access Journals (Sweden)

Shi Yan

2013-01-01

Full Text Available Abstract Background Lignin materials are abundant and among the most important potential sources for biofuel production. Development of an efficient lignin degradation process has considerable potential for the production of a variety of chemicals, including bioethanol. However, lignin degradation using current methods is inefficient. Given their immense environmental adaptability and biochemical versatility, bacterial could be used as a valuable tool for the rapid degradation of lignin. Kraft lignin (KL is a polymer by-product of the pulp and paper industry resulting from alkaline sulfide treatment of lignocellulose, and it has been widely used for lignin-related studies. Results Beta-proteobacterium Cupriavidus basilensis B-8 isolated from erosive bamboo slips displayed substantial KL degradation capability. With initial concentrations of 0.5–6 g L-1, at least 31.3% KL could be degraded in 7 days. The maximum degradation rate was 44.4% at the initial concentration of 2 g L-1. The optimum pH and temperature for KL degradation were 7.0 and 30°C, respectively. Manganese peroxidase (MnP and laccase (Lac demonstrated their greatest level of activity, 1685.3 U L-1 and 815.6 U L-1, at the third and fourth days, respectively. Many small molecule intermediates were formed during the process of KL degradation, as determined using GC-MS analysis. In order to perform metabolic reconstruction of lignin degradation in this bacterium, a draft genome sequence for C. basilensis B-8 was generated. Genomic analysis focused on the catabolic potential of this bacterium against several lignin-derived compounds. These analyses together with sequence comparisons predicted the existence of three major metabolic pathways: β-ketoadipate, phenol degradation, and gentisate pathways. Conclusion These results confirmed the capability of C. basilensis B-8 to promote KL degradation. Whole genomic sequencing and systematic analysis of the C. basilensis B-8 genome

Restoration thinning and influence of tree size and leaf area to sapwood area ratio on water relations of Pinus ponderosa.

Science.gov (United States)

Simonin, K; Kolb, T E; Montes-Helu, M; Koch, G W

2006-04-01

Ponderosa pine (Pinus ponderosa Dougl. ex P. Laws) forest stand density has increased significantly over the last century (Covington et al. 1997). To understand the effect of increased intraspecific competition, tree size (height and diameter at breast height (DBH)) and leaf area to sapwood area ratio (A(L):A(S)) on water relations, we compared hydraulic conductance from soil to leaf (kl) and transpiration per unit leaf area (Q(L)) of ponderosa pine trees in an unthinned plot to trees in a thinned plot in the first and second years after thinning in a dense Arizona forest. We calculated kl and Q(L) based on whole- tree sap flux measured with heat dissipation sensors. Thinning increased tree predawn water potential within two weeks of treatment. Effects of thinning on kl and Q(L) depended on DBH, A(L):A(S) and drought severity. During severe drought in the first growing season after thinning, kl and Q(L) of trees with low A(L):A(S) (160-250 mm DBH; 9-11 m height) were lower in the thinned plot than the unthinned plot, suggesting a reduction in stomatal conductance (g(s)) or reduced sapwood specific conductivity (K(S)), or both, in response to thinning. In contrast kl and Q(L) were similar in the thinned plot and unthinned plot for trees with high A(L):A(S) (260-360 mm DBH; 13-16 m height). During non-drought periods, kl and Q(L) were greater in the thinned plot than in the unthinned plot for all but the largest trees. Contrary to previous studies of ponderosa pine, A(L):A(S) was positively correlated with tree height and DBH. Furthermore, kl and Q(L) showed a weak negative correlation with tree height and a strong negative correlation with A(S) and thus A(L):A(S) in both the thinned and unthinned plots, suggesting that trees with high A(L):A(S) had lower g(s). Our results highlight the important influence of stand competitive environment on tree-size-related variation in A(L):A(S) and the roles of A(L):A(S) and drought on whole-tree water relations in response to

Penalized weighted least-squares approach for low-dose x-ray computed tomography

Science.gov (United States)

Wang, Jing; Li, Tianfang; Lu, Hongbing; Liang, Zhengrong

2006-03-01

The noise of low-dose computed tomography (CT) sinogram follows approximately a Gaussian distribution with nonlinear dependence between the sample mean and variance. The noise is statistically uncorrelated among detector bins at any view angle. However the correlation coefficient matrix of data signal indicates a strong signal correlation among neighboring views. Based on above observations, Karhunen-Loeve (KL) transform can be used to de-correlate the signal among the neighboring views. In each KL component, a penalized weighted least-squares (PWLS) objective function can be constructed and optimal sinogram can be estimated by minimizing the objective function, followed by filtered backprojection (FBP) for CT image reconstruction. In this work, we compared the KL-PWLS method with an iterative image reconstruction algorithm, which uses the Gauss-Seidel iterative calculation to minimize the PWLS objective function in image domain. We also compared the KL-PWLS with an iterative sinogram smoothing algorithm, which uses the iterated conditional mode calculation to minimize the PWLS objective function in sinogram space, followed by FBP for image reconstruction. Phantom experiments show a comparable performance of these three PWLS methods in suppressing the noise-induced artifacts and preserving resolution in reconstructed images. Computer simulation concurs with the phantom experiments in terms of noise-resolution tradeoff and detectability in low contrast environment. The KL-PWLS noise reduction may have the advantage in computation for low-dose CT imaging, especially for dynamic high-resolution studies.

Reliability and Accuracy of Cross-sectional Radiographic Assessment of Severe Knee Osteoarthritis: Role of Training and Experience.

Science.gov (United States)

Klara, Kristina; Collins, Jamie E; Gurary, Ellen; Elman, Scott A; Stenquist, Derek S; Losina, Elena; Katz, Jeffrey N

2016-07-01

To dêtermine the reliability of radiographic assessment of knee osteoarthritis (OA) by nonclinician readers compared to an experienced radiologist. The radiologist trained 3 nonclinicians to evaluate radiographic characteristics of knee OA. The radiologist and nonclinicians read preoperative films of 36 patients prior to total knee replacement. Intrareader and interreader reliability were measured using the weighted κ statistic and intraclass correlation coefficient (ICC). Scores κ reliability among nonclinicians (κ) ranged from 0.40 to 1.0 for individual radiographic features and 0.72 to 1.0 for Kellgren-Lawrence (KL) grade. ICC ranged from 0.89 to 0.98 for the Osteoarthritis Research Society International (OARSI) summary score. Interreader agreement among nonclinicians ranged from κ of 0.45 to 0.94 for individual features, and 0.66 to 0.97 for KL grade. ICC ranged from 0.87 to 0.96 for the OARSI Summary Score. Interreader reliability between nonclinicians and the radiologist ranged from κ of 0.56 to 0.85 for KL grade. ICC ranged from 0.79 to 0.88 for the OARSI Summary Score. Intrareader and interreader agreement was variable for individual radiograph features but substantial for summary KL grade and OARSI Summary Score. Investigators face tradeoffs between cost and reader experience. These data suggest that in settings where costs are constrained, trained nonclinicians may be suitable readers of radiographic knee OA, particularly if a summary score (KL grade or OARSI Score) is used to determine radiographic severity.

Rheology of Cross-linked Polymer Networks

DEFF Research Database (Denmark)

Jensen, Mette Krog

. Denne afhandling beskæftiger sig med de mekaniske egenskaber og klæbeevner for en bestemt type hudklæbere. Rent videnskabeligt karakteriseres denne type klæbere, som bløde polymere netværk. Vores primære interesse er at give en forståelse mellem sammensætningen af prøverne og de mekaniske egenskaber af...

Response of Okra (Abelmoschus esculentus) varieties to NPK ...

African Journals Online (AJOL)

Pot and field experiments were conducted to determine the response of three okra varieties to four NPK fertilizers. The okra varieties; V35 (in the pot experiment and Clemson spineless in the field trial), Jokoso, and Sologo formed the main plot treatments and four NPK fertilizer rates: no fertilizer (control), 30 +15 +15, 60 +30 ...

Tiger Nut ( Cyperus Esculentus ): Composition, Products, Uses and ...

African Journals Online (AJOL)

... flour and be used for different purposes such as bread and substitute in animal feed manufacture. Oil can also be obtained from tigernut, which is highly unsaturated and good for the health of humans. Tigernut can be used to produce drink/milk, which can serve as substitute of traditional cow milk, different types of tigernut ...

An improved image non-blind image deblurring method based on FoEs

Science.gov (United States)

Zhu, Qidan; Sun, Lei

2013-03-01

Traditional non-blind image deblurring algorithms always use maximum a posterior(MAP). MAP estimates involving natural image priors can reduce the ripples effectively in contrast to maximum likelihood(ML). However, they have been found lacking in terms of restoration performance. Based on this issue, we utilize MAP with KL penalty to replace traditional MAP. We develop an image reconstruction algorithm that minimizes the KL divergence between the reference distribution and the prior distribution. The approximate KL penalty can restrain over-smooth caused by MAP. We use three groups of images and Harris corner detection to prove our method. The experimental results show that our algorithm of non-blind image restoration can effectively reduce the ringing effect and exhibit the state-of-the-art deblurring results.

Alteration geochemistry of the volcanic-hosted Dedeninyurdu, Yergen and Fındıklıyar Fe-Cu mineralization at Gökçedoǧan, Çorum-Kargi region, Turkey

Science.gov (United States)

Gumus, Lokman; Öztürk, Sercan; Yalçın, Cihan; Abdelnasser, Amr; Hanilçi, Nurullah; Kumral, Mustafa

2016-04-01

This study is to determine the mass/volume gain and loss of the major and trace elements during the alteration processes on Dedeninyurdu, Yergen and Fındıklıyar Fe-Cu mineralizations of the area. Fe-Cu mineralization occurred in the spilitic volcanic a rock of Saraycık Formation is associated with the different types of alteration zones which are pyritization, silicification and sericitization. The study area comprises Bekirli Formation, Saraycık Formation, Beşpınar Formation, and Ilgaz Formation. Saraycık formation consists of spilitic volcanic rocks with pelagic limestone, siltstone and chert. The ore mineralogical data show that the pyrite, chalcopyrite, covellite, hematite, malachite and goethite formed during three phases of mineralization. As well as the geologic and petrographic studies reveal three alteration zones with definite mineral assemblages; phyllic alteration (quartz + sericite + pyrite) that represents the main alteration and mineralized zone; propylitic alteration; and carbonatized sericitic alteration zone. The boundaries between these zones are gradual. Mass balance calculations suggested that the phyllic alteration zone represented by gain in Si, Fe, K, S, and LOI and loss in Mg, Ca, and Na refers to silicification, sericitization and pyritization as well as replacement of Fe-Mg silicate and plagioclase. While, in the propylitic alteration zone, enrichment of Si, Fe, Mg, LOI and S occurred with depletions of Ca, Na, and K reflecting chloritization alteration type. On the other hand, carbonatized sericitic alteration zone shows local gain in Si, CaO and K reflects the occurrence of calc-silicate alteration. All alteration zones contain a large proportion of sulfide minerals (gain in S) with increase in loss on ignition (LOI). Keywords: Alteration geochemistry; Mass balance calculation, Fe-Cu mineralization; phyllic alteration, propylitic alteration.

Calpain 1 inhibitor BDA-410 ameliorates α-klotho-deficiency phenotypes resembling human aging-related syndromes.

Science.gov (United States)

Nabeshima, Yoko; Washida, Miwa; Tamura, Masaru; Maeno, Akiteru; Ohnishi, Mutsuko; Shiroishi, Toshihiko; Imura, Akihiro; Razzaque, M Shawkat; Nabeshima, Yo-ichi

2014-08-01

Taking good care of elderly is a major challenge of our society, and thus identification of potential drug targets to reduce age-associated disease burden is desirable. α-klotho(-/-) (α-kl) is a short-lived mouse model that displays multiple phenotypes resembling human aging-related syndromes. Such ageing phenotype of α-kl(-/-) mice is associated with activation of a proteolytic enzyme, Calpain-1. We hypothesized that uncontrolled activation of calpain-1 might be causing age-related phenotypes in α-kl-deficient mice. We found that daily administration of BDA-410, a calpain-1 inhibitor, strikingly ameliorated multiple aging-related phenotypes. Treated mice showed recovery of reproductive ability, increased body weight, reduced organ atrophy, and suppression of ectopic calcifications, bone mineral density reduction, pulmonary emphysema and senile atrophy of skin. We also observed ectopic expression of FGF23 in calcified arteries of α-kl(-/-) mice, which might account for the clinically observed association of increased FGF23 level with increased risk of cardiovascular mortality. These findings allow us to propose that modulation of calpain-1 activity is a potential therapeutic option for delaying age-associated organ pathology, particularly caused by the dysregulation of mineral ion homeostasis.

Facile Fabrication of a PDMS@Stearic Acid-Kaolin Coating on Lignocellulose Composites with Superhydrophobicity and Flame Retardancy

Directory of Open Access Journals (Sweden)

Zhe Wang

2018-05-01

Full Text Available The disadvantages such as swelling after absorbing water and flammability restrict the widespread applications of lignocellulose composites (LC. Herein, a facile and effective method to fabricate superhydrophobic surfaces with flame retardancy on LC has been investigated by coating polydimethylsiloxane (PDMS and stearic acid (STA modified kaolin (KL particles. The as-prepared coatings on the LC exhibited a good repellency to water (a contact angle = 156°. Owing to the excellent flame retardancy of kaolin particles, the LC coated with PDMS@STA-KL displayed a good flame retardancy during limiting oxygen index and cone calorimeter tests. After the coating treatment, the limiting oxygen index value of the LC increased to 41.0. Cone calorimetry results indicated that the ignition time of the LC coated with PDMS@STA-KL increased by 40 s compared with that of uncoated LC. Moreover, the peak heat release rate (PHRR and the total heat release (THR of LC coated with PDMS@STA-KL reduced by 18.7% and 19.2% compared with those of uncoated LC, respectively. This LC coating with improved water repellency and flame retardancy can be considered as a potential alternative to protect the lignocellulose composite.

Energy expenditure in adolescents playing new generation computer games.

Science.gov (United States)

Graves, Lee; Stratton, Gareth; Ridgers, N D; Cable, N T

2008-07-01

To compare the energy expenditure of adolescents when playing sedentary and new generation active computer games. Cross sectional comparison of four computer games. Setting Research laboratories. Six boys and five girls aged 13-15 years. Participants were fitted with a monitoring device validated to predict energy expenditure. They played four computer games for 15 minutes each. One of the games was sedentary (XBOX 360) and the other three were active (Wii Sports). Predicted energy expenditure, compared using repeated measures analysis of variance. Mean (standard deviation) predicted energy expenditure when playing Wii Sports bowling (190.6 (22.2) kl/kg/min), tennis (202.5 (31.5) kl/kg/min), and boxing (198.1 (33.9) kl/kg/min) was significantly greater than when playing sedentary games (125.5 (13.7) kl/kg/min) (Pgames. Playing new generation active computer games uses significantly more energy than playing sedentary computer games but not as much energy as playing the sport itself. The energy used when playing active Wii Sports games was not of high enough intensity to contribute towards the recommended daily amount of exercise in children.

Policies, activities, and structures supporting research mentoring: a national survey of academic health centers with clinical and translational science awards.

Science.gov (United States)

Tillman, Robert E; Jang, Susan; Abedin, Zainab; Richards, Boyd F; Spaeth-Rublee, Brigitta; Pincus, Harold Alan

2013-01-01

To document the frequency of policies and activities in support of mentoring practices at institutions receiving a U.S. National Institutes of Health's Clinical and Translational Science Award (CTSA). The study consisted of a 69-item survey with questions about the inclusion (formal or informal) of policies, activities, and structures supporting mentoring within CTSA-sponsored research (i.e., KL2 programs) and, more broadly, in the CTSA's home institution. The survey, conducted from November 2010 through January 2011, was sent to the 55 institutions awarded CTSAs at the time of the survey. Follow-up phone interviews were conducted to clarify responses as needed. Fifty-one of 55 (92%) institutions completed the survey for institutional programs and 53 of 55 (96%) for KL2 programs. Responses regarding policies and activities involving mentor criteria, mentor-mentee relationship, incentives, and evaluative mechanisms revealed considerable variability between KL2 and institutional programs in some areas, such as having mentor qualification criteria and processes to evaluate mentors. The survey also identified areas, such as training and women and minority mentoring programs, where there was frequent sharing of activities between the institutional and KL2 programs. KL2 programs and institutional programs tend to have different preferences for policies versus activities to optimize qualification of mentors, the mentor-mentee relationship, incentives, and evaluation mechanisms. Frequently, these elements are informal. Individuals in charge of implementing and maintaining mentoring initiatives can use the results of the study to consider their current mentoring policies, structures, and activities by comparing them with national patterns within CTSA institutions.

Measurements of Neutral Kaon Decays to Two Electron Positron Pairs

Energy Technology Data Exchange (ETDEWEB)

Halkiadakis, Eva [Rutgers U., Piscataway

2001-01-01

We observed 441 $K_L \\to e^+ e^- e^+ e^-$ events with a background of 4.2 events in the KTeV/E799II experiment at Fermilab. We present here a measurement of the $K_L \\to e^+ e^- e^+ e^-$ branching ratio (B), a study of CP symmetry and the first detailed study of the $e^+ e^-$ invariant mass spectrum in this decay mode....

Soot measurements for diesel and biodiesel spray combustion under high temperature highly diluted ambient conditions

KAUST Repository

Zhang, Ji

2014-11-01

This paper presents the soot temperature and KL factor for biodiesel, namely fatty acid methyl ester (FAME) and diesel fuel combustion in a constant volume chamber using a two-color technique. The KL factor is a parameter for soot concentration, where K is an absorption coefficient and proportional to the number density of soot particles, L is the geometric thickness of the flame along the optical detection axis, and KL factor is proportional to soot volume fraction. The main objective is to explore a combustion regime called high-temperature and highly-diluted combustion (HTHDC) and compare it with the conventional and low-temperature combustion (LTC) modes. The three different combustion regimes are implemented under different ambient temperatures (800 K, 1000 K, and 1400 K) and ambient oxygen concentrations (10%, 15%, and 21%). Results are presented in terms of soot temperature and KL factor images, time-resolved pixel-averaged soot temperature, KL factor, and spatially integrated KL factor over the soot area. The time-averaged results for these three regimes are compared for both diesel and biodiesel fuels. Results show complex combined effects of the ambient temperature and oxygen concentration, and that two-color temperature for the HTHDC mode at the 10% oxygen level can actually be lower than the conventional mode. Increasing ambient oxygen and temperature increases soot temperature. Diesel fuel results in higher soot temperature than biodiesel for all three regimes. Results also show that diesel and biodiesel fuels have very different burning and sooting behavior under the three different combustion regimes. For diesel fuel, the HTHDC regime offers better results in terms of lower soot than the conventional and LTC regimes, and the 10% O2, 1400 K ambient condition shows the lowest soot concentration while maintaining a moderate two-color temperature. For biodiesel, the 15% O2, 800 K ambient condition shows some advantages in terms of reducing soot

Biomarkers to identify ILD and predict lung function decline in scleroderma lung disease or idiopathic pulmonary fibrosis.

Science.gov (United States)

Kennedy, Barry; Branagan, Peter; Moloney, Fiachra; Haroon, Muhammad; O'Connell, Oisin J; O'Connor, Terence M; O'Regan, Kevin; Harney, Sinead; Henry, Michael T

2015-09-14

SSc-ILD and IPF demonstrate significant morbidity and mortality. Predicting disease progression is challenging in both diseases. We sought a serum biomarker that could identify patients with SSc-ILD or IPF and prospectively predict short-term decline in lung function in these patients. 10 healthy controls, 5 SSc w/o ILD, 6 SSc-ILD and 13 IPF patients underwent venesection. An array of cytokines including KL-6, SP-D and MMP7 were measured. PFTs were obtained at baseline and six months. Cytokine measurements were correlated with PFTs. KL-6 in IPF patients (633 ng/ml, IQR 492-1675) was significantly elevated compared to controls (198 ng/ml, IQR 52-360, p<0.01) and SSc w/o ILD patients (192 ng/ml, IQR 0-524, p<0.05); KL-6 in SSc-ILD patients (836 ng/ml, IQR 431-1303) was significantly higher than in controls (p<0.05). SP-D was significantly higher in IPF patients (542 ng/ml, IQR 305-577) compared to controls (137 ng/ml, IQR 97-284, p<0.01) or to SSc w/o ILD patients (169 ng/ml, IQR 137-219, p<0.05). In comparison with controls (0.0 ng/ml, IQR 0.0-0.6), MMP7 was significantly higher in both IPF patients (2.85 ng/ml, IQR 1.5-3.6, p<0.05) and SSc-ILD patients (5.41 ng/ml, IQR 2.6-7.2, p<0.001). Using a cut-off level of 459ng/ml for KL-6 and of 1.28 ng/ml for MMP7, 18 out of 19 patients with ILD had a serum value of either KL-6 or MMP7 above these thresholds. For all ILD patients, baseline serum SP-D correlated with ΔFVC %pred over six months (r=-0.63, p=0.005, 95% CI -0.85 to -0.24). Combining KL-6 with MMP7 may be a useful screening tool for patients at risk of ILD. SP-D may predict short-term decline in lung function.

Immunophenotype of hematopoietic stem cells from placental/umbilical cord blood after culture

Directory of Open Access Journals (Sweden)

P. Pranke

2005-12-01

Full Text Available Identification and enumeration of human hematopoietic stem cells remain problematic, since in vitro and in vivo stem cell assays have different outcomes. We determined if the altered expression of adhesion molecules during stem cell expansion could be a reason for the discrepancy. CD34+CD38- and CD34+CD38+ cells from umbilical cord blood were analyzed before and after culture with thrombopoietin (TPO, FLT-3 ligand (FL and kit ligand (KL; or stem cell factor in different combinations: TPO + FL + KL, TPO + FL and TPO, at concentrations of 50 ng/mL each. Cells were immunophenotyped by four-color fluorescence using antibodies against CD11c, CD31, CD49e, CD61, CD62L, CD117, and HLA-DR. Low-density cord blood contained 1.4 ± 0.9% CD34+ cells, 2.6 ± 2.1% of which were CD38-negative. CD34+ cells were isolated using immuno-magnetic beads and cultured for up to 7 days. The TPO + FL + KL combination presented the best condition for maintenance of stem cells. The total cell number increased 4.3 ± 1.8-fold, but the number of viable CD34+ cells decreased by 46 ± 25%. On the other hand, the fraction of CD34+CD38- cells became 52.0 ± 29% of all CD34+ cells. The absolute number of CD34+CD38- cells was expanded on average 15 ± 12-fold when CD34+ cells were cultured with TPO + FL + KL for 7 days. The expression of CD62L, HLA-DR and CD117 was modulated after culture, particularly with TPO + FL + KL, explaining differences between the adhesion and engraftment of primary and cultured candidate stem cells. We conclude that culture of CD34+ cells with TPO + FL + KL results in a significant increase in the number of candidate stem cells with the CD34+CD38- phenotype.

QTL Analysis of Kernel-Related Traits in Maize Using an Immortalized F2 Population

Science.gov (United States)

Hu, Yanmin; Li, Weihua; Fu, Zhiyuan; Ding, Dong; Li, Haochuan; Qiao, Mengmeng; Tang, Jihua

2014-01-01

Kernel size and weight are important determinants of grain yield in maize. In this study, multivariate conditional and unconditional quantitative trait loci (QTL), and digenic epistatic analyses were utilized in order to elucidate the genetic basis for these kernel-related traits. Five kernel-related traits, including kernel weight (KW), volume (KV), length (KL), thickness (KT), and width (KWI), were collected from an immortalized F2 (IF2) maize population comprising of 243 crosses performed at two separate locations over a span of two years. A total of 54 unconditional main QTL for these five kernel-related traits were identified, many of which were clustered in chromosomal bins 6.04–6.06, 7.02–7.03, and 10.06–10.07. In addition, qKL3, qKWI6, qKV10a, qKV10b, qKW10a, and qKW7a were detected across multiple environments. Sixteen main QTL were identified for KW conditioned on the other four kernel traits (KL, KWI, KT, and KV). Thirteen main QTL were identified for KV conditioned on three kernel-shape traits. Conditional mapping analysis revealed that KWI and KV had the strongest influence on KW at the individual QTL level, followed by KT, and then KL; KV was mostly strongly influenced by KT, followed by KWI, and was least impacted by KL. Digenic epistatic analysis identified 18 digenic interactions involving 34 loci over the entire genome. However, only a small proportion of them were identical to the main QTL we detected. Additionally, conditional digenic epistatic analysis revealed that the digenic epistasis for KW and KV were entirely determined by their constituent traits. The main QTL identified in this study for determining kernel-related traits with high broad-sense heritability may play important roles during kernel development. Furthermore, digenic interactions were shown to exert relatively large effects on KL (the highest AA and DD effects were 4.6% and 6.7%, respectively) and KT (the highest AA effects were 4.3%). PMID:24586932

Molecular evolution of a Y chromosome to autosome gene duplication in Drosophila.

Science.gov (United States)

Dyer, Kelly A; White, Brooke E; Bray, Michael J; Piqué, Daniel G; Betancourt, Andrea J

2011-03-01

In contrast to the rest of the genome, the Y chromosome is restricted to males and lacks recombination. As a result, Y chromosomes are unable to respond efficiently to selection, and newly formed Y chromosomes degenerate until few genes remain. The rapid loss of genes from newly formed Y chromosomes has been well studied, but gene loss from highly degenerate Y chromosomes has only recently received attention. Here, we identify and characterize a Y to autosome duplication of the male fertility gene kl-5 that occurred during the evolution of the testacea group species of Drosophila. The duplication was likely DNA based, as other Y-linked genes remain on the Y chromosome, the locations of introns are conserved, and expression analyses suggest that regulatory elements remain linked. Genetic mapping reveals that the autosomal copy of kl-5 resides on the dot chromosome, a tiny autosome with strongly suppressed recombination. Molecular evolutionary analyses show that autosomal copies of kl-5 have reduced polymorphism and little recombination. Importantly, the rate of protein evolution of kl-5 has increased significantly in lineages where it is on the dot versus Y linked. Further analyses suggest this pattern is a consequence of relaxed purifying selection, rather than adaptive evolution. Thus, although the initial fixation of the kl-5 duplication may have been advantageous, slightly deleterious mutations have accumulated in the dot-linked copies of kl-5 faster than in the Y-linked copies. Because the dot chromosome contains seven times more genes than the Y and is exposed to selection in both males and females, these results suggest that the dot suffers the deleterious effects of genetic linkage to more selective targets compared with the Y chromosome. Thus, a highly degenerate Y chromosome may not be the worst environment in the genome, as is generally thought, but may in fact be protected from the accumulation of deleterious mutations relative to other nonrecombining

Improved upper limits on B(KL0 → μe) and B(KL0 → ee) and a new value for B(KL0 → μμ)

International Nuclear Information System (INIS)

Molzon, W.R.

1998-01-01

The author gives recent results from E791 at BNL with improved upper limits on the branching fractions B(K L 0 → μe) and B(K L 0 → ee) of 8.5 x 10 -11 and 11.6 x 10 -11 at 90% C.L. He also gives a preliminary result of a new measurement B(K L 0 → μμ) = 7.6 ± 0.5(stat) ± 0.4(syst) x 10 -9

Long-range outlook of energy demands and supplies

International Nuclear Information System (INIS)

1984-01-01

An interim report on the long-range outlook of energy demands and supplies in Japan as prepared by an ad hoc committee, Advisory Committee for Energy was given for the period up to the year 2000. As the energy demands in terms of crude oil, the following figures are set: 460 million kl for 1990, 530 million kl for 1995, and 600 million kl for 2000. In Japan, without domestic energy resources, over 80% of the primary energy has been imported; the reliance on Middle East where political situation is unstable, for petroleum is very large. The following things are described. Background and policy; energy demands in industries, transports, and people's livelihood; energy supplies by coal, nuclear energy, petroleum, etc.; energy demand/supply outlook for 2000. (Mori, K.)

Meta Analiz Yaklaşımı ile Laktasyon Sırası ve Buzağılama Mevsiminin 305 Günlük Laktasyon Süt Verimi Üzerindeki Etki Büyüklüğünün Tahmini

Directory of Open Access Journals (Sweden)

Hande Küçükönder

2014-08-01

Full Text Available Bu çalışmada, Siyah Alaca ırkı ineklerde süt verimini etkileyen faktörlerden laktasyon sırası ve buzağılama mevsimin etkisi meta analiz yöntemi ile incelenmiştir. Meta analiz aynı amaca yönelik olarak başka araştırıcılar tarafından yapılmış olan çalışmaların bir araya getirilerek yeniden değerlendirilmesini sağlayan istatistiksel bir tekniktir. Bu yöntem, çeşitli alanlarda yapılmış olan çalışmaların sonuçlarını birleştirir, özetler ve araştırıcılar arasında ortak bir yargının oluşturulmasında katkı sağlar. Bu sebeplerden ötürü, bu çalışmada 7 farklı araştırıcının çalışmaları meta analiz ile birleştirilmiş ve incelenen parametreler hakkında ortak bir bakış açısının yaratılması hedeflenmiştir. Ayrıca araştırmada etki büyüklüklerinin heterojenlik durumu Ki kare ve I2 test istatistikleri ile araştırılmış ve bu değerler sırasıyla ×^2=50,205 ve I2=%88 olarak bulunmuştur. Bundan dolayı çalışmaların birleştirilmesi için sabit etki modeli kullanılmamıştır. Araştırmada, söz konusu konuya ilişkin olarak araştırıcıların bulmuş oldukları çalışma sonuçları meta analitik tarama yöntemi ile taranmış meta analizde etki büyüklüğü ölçütü olan odds oranının (OR kullanılması ile birleştirilmiştir. Meta analiz sonucunda Odds oranı değeri 0,759 bulunmuş olup, bulunan etki düzeyi orta olarak tespit edilmiştir. Yapılan bu çalışmayla Siyah Alaca sığırlarda 305 günlük laktasyon süt verimi üzerinde, laktasyon sırasının yüksek süt verimi elde edilmesinde Yapmış olduğu katkı payının buzağılama mevsimine nazaran 0,759 kat daha fazla olduğu belirlenmiştir.

Baryons as solitonic solutions of the chiral sigma model

International Nuclear Information System (INIS)

Bentz, W.; Hartmann, J.; Beck, F.

1996-01-01

Self-consistent solitonic solutions with baryon number one are obtained in the chiral quark sigma model. The translational invariant vacuum is stabilized by a Landau ghost subtraction procedure based on the requirement of the Kaellacute en-Lehmann (KL) representation for the meson propagators. The connection of this ghost free model (KL model) to the more popular Nambu-Jona-Lasinio (NJL) model is discussed in detail. copyright 1996 The American Physical Society

Critical Taxonomic Appraisal of Some Taxa of Pedicularis from Indian Himalayas Belonging to Section Siphonanthae

Directory of Open Access Journals (Sweden)

Arti Garg

2009-06-01

Full Text Available The existing confusion on the taxonomic status of five taxa of Pedicularis viz. P. punctata Decne, P. siphonantha D. Don, P. hookeriana Wall. ex Benth., P. megalantha D. Don and P. hoffmeisteri Kl. ex Kl. & Garcke is resolved on the basis of critical morphological study. These taxa belong to section Siphonanthae, subgenus Longirostres. Pennell’s view of segregating these taxa into distinct species is defended and upheld.

IS Л Kl JW'Mí i

African Journals Online (AJOL)

The preferred method for diagnosis of endometriosis is surgical visual inspection ... cause the varied appearance of the disease allows less-obvious lesions to be overlooked. Empiric use of .... Musculoskeletal causes (e.g., pelvic. Male factor ...

Feminist i nye klæder

DEFF Research Database (Denmark)

Simonsen, Dorthe Gert

1997-01-01

Historie, Kønskonstruktioner, hverdags-misogyni og feminisme i akademia. Når man taler om feminisme, eller som feminist, taler man ind i et rum, der allerede er fyldt. Den kollektive viden om feminisme er fordomsfuld, og feminster har forsømt at forhandle med eller at forholde sig til de negative...

Association of Cross Linked C-Telopeptide II Collagen and Hyaluronic Acid with Knee Osteoarthritis Severity

Directory of Open Access Journals (Sweden)

John Butar Butar

2013-12-01

Full Text Available BACKGROUND: This study was carried out to investigate the association of Cross Linked C-Telopeptide Type I & II Collagen (CTX-I and II and hyaluronic acid (HA with knee osteoarthritis (OA severity. METHODS: Sixty menopause women with primary knee OA were enrolled in this study during their visits to the Outpatient Department. Patients with knee pain during weight bearing, active or passive range of motion, or tenderness with Kellgren-Lawrence (KL grade of more than I were included. Patients with injury, inflammatory and metabolic diseases were excluded. Patients were put in a 10-hour fasting prior to withdrawal of morning blood samples for examinations of HA, CTX-I, interleukin 1 beta (IL-1β, and high sensitivity C reactive protein (hs-CRP level. Second void morning urine specimens were taken for CTXII assessment. HA, CTX-I and II levels were measured by enzyme-linked immunosorbent assay. RESULTS: Sixty menopausal female patients were included in this study, 35 with KL grade II, 17 grade III, and 8 grade IV. Means of CTX-II were significantly different between subjects KL grade IV and III (p=0.021. Correlation of KL grade was significant with CTX-II (p=0.001, r=0.412 and HA (p=0.0411, r=0.269. KL grades were not significantly associated with CTX-I (p=0.8364, r=-0.0272; IL-1β (p=0.5773, r=0.0853 and hs-CRP (p=0.2625, r=0.1470. CONCLUSIONS: CTX-II and HA were associated with severity of knee OA, suggesting that CTX-II and HA can be used as marker for knee OA severity. KEYWORDS: CTX-II, hyaluronic acid, otestoarthritis, knee.

Comparison of soot formation for diesel and jet-a in a constant volume combustion chamber using two-color pyrometry

KAUST Repository

Jing, Wei

2014-04-01

The measurement of the two-color line of sight soot and KL factor for NO.2 diesel and jet-A fuels was conducted in an optical constant volume combustion chamber by using a high speed camera under 1000 K ambient temperature and varied oxygen concentration conditions. The ambient conditions were set as follows: four oxygen cases including 10%, 15%, 18% and 21% at 1000 K ambient temperature. KL factor and soot temperature were determined based on the two-color pyrometry technique using two band-pass filters with wavelengths of 650 nm and 550 nm. The results show that low soot temperature is observed in the upstream inner flame along the centerline, which is surrounded by high soot temperature regions, and a high KL factor is found in the same region with a low soot temperature. The results under different times suggest that soot temperature is higher for high O2 conditions during the entire flame development; meanwhile, both integrated KL factor and soot area decrease with the increase of O2 concentration. The two fuels share a similar trend of soot temperature and KL factor, however, diesel flame has a higher soot temperature and a larger high soot temperature area compared to jet-A flame. On the other hand, diesel flame shows a lower soot level during the quasi-steady state with a higher total soot level at the end of the combustion under low O2 conditions. A lower O2 concentration range from 10% to 15% is expected to have the possibility to achieve a simultaneous reduction of soot and NOx in sooting flames under the 1000 K ambient temperature condition. Copyright © 2014 SAE International.

Combining multiple hypothesis testing and affinity propagation clustering leads to accurate, robust and sample size independent classification on gene expression data

Directory of Open Access Journals (Sweden)

Sakellariou Argiris

2012-10-01

Full Text Available Abstract Background A feature selection method in microarray gene expression data should be independent of platform, disease and dataset size. Our hypothesis is that among the statistically significant ranked genes in a gene list, there should be clusters of genes that share similar biological functions related to the investigated disease. Thus, instead of keeping N top ranked genes, it would be more appropriate to define and keep a number of gene cluster exemplars. Results We propose a hybrid FS method (mAP-KL, which combines multiple hypothesis testing and affinity propagation (AP-clustering algorithm along with the Krzanowski & Lai cluster quality index, to select a small yet informative subset of genes. We applied mAP-KL on real microarray data, as well as on simulated data, and compared its performance against 13 other feature selection approaches. Across a variety of diseases and number of samples, mAP-KL presents competitive classification results, particularly in neuromuscular diseases, where its overall AUC score was 0.91. Furthermore, mAP-KL generates concise yet biologically relevant and informative N-gene expression signatures, which can serve as a valuable tool for diagnostic and prognostic purposes, as well as a source of potential disease biomarkers in a broad range of diseases. Conclusions mAP-KL is a data-driven and classifier-independent hybrid feature selection method, which applies to any disease classification problem based on microarray data, regardless of the available samples. Combining multiple hypothesis testing and AP leads to subsets of genes, which classify unknown samples from both, small and large patient cohorts with high accuracy.

Attainment of dosimetric pediatrics grandeur to computed tomography examinations of the abdomen

International Nuclear Information System (INIS)

Jormada, Tiago S.

2013-01-01

Currently, 10% of all computerized tomography exams (CT) are made in pediatric patients. In developed countries, the practice of obtaining the dosimetric quantities (weighted index dose C w , index air kerma volumetric C vol product kerma-length P KL , CT ) and effective dose (E) in pediatric CT scans is common. In Brazil, data like these are practically nonexistent. The goal of this work is to obtain the dosimetric quantities and the dose effective in pediatric CT scans, and study its application in the optimization process. The study took place in a thermographs' Toshiba Asteion Single-Slice and a GE Brightsped's multi-slice where measurements were made with type pencil ionization chamber and a trunk's phantom of PMMA with diameter of 16 cm. In single-slice CT scanner, the results obtained for the C vol , P KL , CT and E were 18.73 mGy, 15.61 mGy and 6.87 mSv mGy.cm 343.51, respectively, whereas in multi-slice CT scanner the results were 18.81 mGy, 20.07 mGy, 441.64 mGy.cm and 8,83 mSv. There was no significant difference between the values of C w obtained already in the values of the Cvol, P KL , CT and E dose the differences between the results were quite significant. Comparing the C w and P KL , CT and with the values recommended by UCRP 87 (25 mGy for C vol and 360 mGy.cm for P KL , CT in pediatric CT scans of the abdomen), the two scanners were below reference levels for C w and not require an start on process of optimization. (author)

The investigation of soot and temperature distributions in a visualized direct injection diesel engine using laser diagnostics

Science.gov (United States)

Han, Yong-taek; Kim, Ki-bum; Lee, Ki-hyung

2008-11-01

Based upon the method of temperature calibration using the diffusion flame, the temperature and soot concentrations of the turbulent flame in a visualized diesel engine were qualitatively measured. Two different cylinder heads were used to investigate the effect of swirl ratio within the combustion chamber. From this experiment, we find that the highest flame temperature of the non-swirl head engine is approximately 2400 K and that of the swirl head engine is 2100 K. In addition, as the pressure of fuel injection increases, the in-cylinder temperature increases due to the improved combustion of a diesel engine. This experiment represented the soot quantity in the KL factor and revealed that the KL factor was high when the fuel collided with the cylinder wall. Moreover, the KL factor was also high in the area of the chamber where the temperature dropped rapidly.

Dynamical eigenfunction decomposition of turbulent channel flow

Science.gov (United States)

Ball, K. S.; Sirovich, L.; Keefe, L. R.

1991-01-01

The results of an analysis of low-Reynolds-number turbulent channel flow based on the Karhunen-Loeve (K-L) expansion are presented. The turbulent flow field is generated by a direct numerical simulation of the Navier-Stokes equations at a Reynolds number Re(tau) = 80 (based on the wall shear velocity and channel half-width). The K-L procedure is then applied to determine the eigenvalues and eigenfunctions for this flow. The random coefficients of the K-L expansion are subsequently found by projecting the numerical flow field onto these eigenfunctions. The resulting expansion captures 90 percent of the turbulent energy with significantly fewer modes than the original trigonometric expansion. The eigenfunctions, which appear either as rolls or shearing motions, possess viscous boundary layers at the walls and are much richer in harmonics than the original basis functions.

MPLW515L mutation in acute megakaryoblastic leukaemia.

Science.gov (United States)

Hussein, K; Bock, O; Theophile, K; Schulz-Bischof, K; Porwit, A; Schlue, J; Jonigk, D; Kreipe, H

2009-05-01

The thrombopoietin receptor gene (MPL) is expressed in megakaryocytes and exhibits the gain of function point mutation W515K/L in approximately 5% of patients with primary myelofibrosis/idiopathic myelofibrosis (PMF) representing one subtype of the chronic myeloproliferative disorders (myeloproliferative neoplasm). A series of primary and secondary acute myeloid leukaemias (AML) with megakaryoblastic phenotype and myelofibrosis unrelated to PMF (n=12) was analysed for the MPL(W515K/L) mutation by pyrosequencing. In three cases (25%), MPL(W515L) was found and in two of these a combination with trisomy 21 or the Philadelphia chromosome occurred. None of the secondary AML cases evolving from pre-existing PMF showed MPL(W515K/L) (n=4). We conclude that MPL(W515L) occurs in a considerable proportion of acute megakaryoblastic leukaemias with myelofibrosis unrelated to PMF.

A New Study of Two Divergence Metrics for Change Detection in Data Streams

KAUST Repository

Qahtan, Abdulhakim Ali Ali; Wang, Suojin; Carroll, Raymond; Zhang, Xiangliang

2014-01-01

Streaming data are dynamic in nature with frequent changes. To detect such changes, most methods measure the difference between the data distributions in a current time window and a reference window. Divergence metrics and density estimation are required to measure the difference between the data distributions. Our study shows that the Kullback-Leibler (KL) divergence, the most popular metric for comparing distributions, fails to detect certain changes due to its asymmetric property and its dependence on the variance of the data. We thus consider two metrics for detecting changes in univariate data streams: a symmetric KL-divergence and a divergence metric measuring the intersection area of two distributions. The experimental results show that these two metrics lead to more accurate results in change detection than baseline methods such as Change Finder and using conventional KL-divergence.

A New Study of Two Divergence Metrics for Change Detection in Data Streams

KAUST Repository

Qahtan, Abdulhakim Ali Ali

2014-08-01

Streaming data are dynamic in nature with frequent changes. To detect such changes, most methods measure the difference between the data distributions in a current time window and a reference window. Divergence metrics and density estimation are required to measure the difference between the data distributions. Our study shows that the Kullback-Leibler (KL) divergence, the most popular metric for comparing distributions, fails to detect certain changes due to its asymmetric property and its dependence on the variance of the data. We thus consider two metrics for detecting changes in univariate data streams: a symmetric KL-divergence and a divergence metric measuring the intersection area of two distributions. The experimental results show that these two metrics lead to more accurate results in change detection than baseline methods such as Change Finder and using conventional KL-divergence.

The Effect of Special Operations Training on Testosterone, Lean Body Mass, and Strength and the Potential for Therapeutic Testosterone Replacement: A Review of the Literature

Science.gov (United States)

2016-07-01

low bone mass, and physical frailty. J Am Geriatr Soc. 2010; 58(6):1134-1143. 22. Hildreth KL, Barry DW, Moreau KL, Vande Griend J, Meacham RB, et...88PA, Case # 2016-0120, 15 Jan 2016. 14. ABSTRACT Special Operations Forces (SOF) are routinely exposed to physically demanding missions that...deprivation, and decreased testosterone. A secondary purpose is to summarize the effects of exogenous testosterone therapy in healthy males as well as to

State-Owned Enterprises and Economic Reform in Vietnam

Science.gov (United States)

2013-11-01

12. DISTRIBUTION / AVAILABILITY STATEMENT Distribution Statement A: Approved for public release; Distribution is unlimited. Reference: DOD...Southeast_Asia/KL09Ae01.html. Nike is a one of the largest foreign investors in Vietnam. 31 Hakkala and Kokko, “The State and the Private Sector...Asia Times Online, December 9, 2009, http://www.atimes.com/atimes/Southeast_Asia/KL09Ae01.html. Nike is a one of the largest foreign investors in

Triacylglycerols in some underutilised tropical seed oils 1. Systematic studies of ten oils

International Nuclear Information System (INIS)

Adebowale, K.O.; Adebowale, Y.A.; Nicholson, G.

2002-05-01

Triacylglycerols composition of ten lesser known and underutilised tropical seed oils have been determined. The seed oils include Monodora tenuifolia, Monodora myristica, Colocynthis citrullus, Cyperus esculentus, Cucumeropsis edulis, Andenopus breviflorus, Telfairia occidentalis, Blighia sapida, Antiaris africana and Sesame indicum. In the Moreaceae family (M. tenuifolia, M. myristica) the dominant triacylglycerol are OPO/POO, LLO, OOL, and OOO. They accounted for over 60% of the total triacylglycerol content in the oils. In the Cyperaceae family (C. esculentus), OPP/POO, POL and OOO accounted for over 80% of the total triacylglycerol content. In the Cucurbitaceae family, SSP was the dominant triacylglycerol specie in A. breviflorus, while OPO/POO and OOO were the dominant species in C. citrullus and C. edulis. Blighia sapida recorded a different distribution of triacylglycerols composition. PLL occurred at the highest concentration, while other high molecular weight triacylglycerols were also identified in the oil. They include, SSA, OSA, LSA, OAA and LLA. Analysis of A. antiaris oil showed a different pattern in the distribution of the triacylglycerols. LaLaM, MMLa and LaLaLa accounted for about 80% of the total triacylglycerols. This result reflected the fatty acid composition of the oil. Lauric acid (C12:0) and Myristic acid (C14:0) accounted for 71.5% of the total fatty acid. The possible use of the oils as cocoa butter equivalents CBEs and cocoa butter substitutes CBSs are discussed. (author)

Volatile components associated with bacterial spoilage of tropical prawns

DEFF Research Database (Denmark)

Chinivasagam, H.N.; Bremner, Allan; Wood, A.F.

1998-01-01

Analysis of headspace volatiles by gas chromatography/mass spectrometry from king (Penaeus plebejus), banana (P. merguiensis), tiger (P. esculentus/semisulcatus) and greasy (Metapenaeus bennettae) prawns stored in ice or ice slurry, which is effectively an environment of low oxygen tension...... inoculated with a total of 15 cultures of Ps. fragi and S. putrefaciens and incubated for two weeks at 5°C, showed the presence of 17 major compounds in the headspace volatiles analysed using gas chromatography/mass spectrometry (GC/MS). These were mainly amines, sulphides, ketones and esters. Principal...

2006 Workplace and Gender Relations Survey of Active Duty Members: Tabulations of Responses

Science.gov (United States)

2008-01-01

382 35. Sexual Coercion incident rate: Constructed from Q35k-l and Q35o-p. Sexual Coercion can be defined as classic quid pro quo ...Coercion incident rate: Constructed from Q35k-l and Q35o-p. Sexual Coercion can be defined as classic quid pro quo , instances of special treatment...90 15. To what extent do/would you feel safe during deployments from being sexually harassed at the following times and

Shigella flexneri infection in a newly acquired rhesus macaque (Macaca mulatta)

OpenAIRE

Lee, Jae-Il; Kim, Sang-Joon; Park, Chung-Gyu

2011-01-01

A 3.4 year-old rhesus macaque weighing 4.5 kg, was suffering from anorexia, acute mucous and bloody diarrhea. On physical examination, the monkey showed a loss of activity, hunched posture, abdominal pain, dehydration, mild gingivitis and unclean anus with discharge. Whole blood was collected for the examination of electrolytes, hematology and serum chemistry; fresh stool was also collected for bacterial culture. Blood profiles showed leukocytosis (14.5 K/?L) and neutrophilia (11.0 K/?L) on c...

Far-infared spectroscopic observations with a Balloon-Borne infrared telescope

International Nuclear Information System (INIS)

Maihara, Toshinori; Takami, Hideki; Mizutani, Kohei

1986-01-01

The first observations of far-infrared celestial objects using the 50-cm Balloon-Borne Infrared Telescope were made in Alice Springs, Australia. Far-infrared spectrophotometric data between 45 and 115 μm were taken for the Orion-KL region, Saturn and a southern H II region RCW 38. The data including high excitation transition lines of CO for Orion-KL, O III lines for RCW 38 and a PH 3 absorption feature of Saturn will be presented. (author)

Tank characterization report for single-shell tank 241-B-104

International Nuclear Information System (INIS)

Field, J.G.

1996-01-01

This document summarizes information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-B-104. Sampling and analyses meet safety screening and historical data quality objectives. This report supports the requirements of Tri-party Agreement Milestone M-44-09. his characterization report summoned the available information on the historical uses and the current status of single-shell tank 241-B-104, and presents the analytical results of the June 1995 sampling and analysis effort. This report supports the requirements of the Hanford Federal Facility Agreement and Consent Order Milestone M-44-09 (Ecology et al. 1994). Tank 241-B-104 is a single-shell underground waste storage tank located in the 200 East Area B Tank Farm on the Hanford Site. It is the first tank in a three-tank cascade series. The tank went into service in August 1946 with a transfer of second-cycle decontamination waste generated from the bismuth phosphate process. The tank continued to receive this waste type until the third quarter of 1950, when it began receiving first-cycle decontamination waste also produced during the bismuth phosphate process. Following this, the tank received evaporator bottoms sludge from the 242-B Evaporator and waste generated from the flushing of transfer lines. A description and the status of tank 241-B-104 are sum in Table ES-1 and Figure ES-1. The tank has an operating capacity of 2,010 kL (530 kgal), and presently contains 1,400 kL (371 kgal) of waste. The total amount is composed of 4 kL (1 kgal) of supernatant, 260 kL (69 kgal) of saltcake, and 1,140 kL (301 kgal) of sludge (Hanlon 1995). Current surveillance data and observations appear to support these results

Effects of resistance training using known vs unknown loads on eccentric-phase adaptations and concentric velocity.

Science.gov (United States)

Hernández-Davó, J L; Sabido, R; Behm, D G; Blazevich, A J

2018-02-01

The aims of this study were to compare both eccentric- and concentric-phase adaptations in highly trained handball players to 4 weeks of twice-weekly rebound bench press throw training with varying loads (30%, 50% and 70% of one-repetition maximum [1-RM]) using either known (KL) or unknown (UL) loads and to examine the relationship between changes in eccentric- and concentric-phase performance. Twenty-eight junior team handball players were divided into two experimental groups (KL or UL) and a control group. KL subjects were told the load prior each repetition, while UL were blinded. For each repetition, the load was dropped and then a rebound bench press at maximum velocity was immediately performed. Both concentric and eccentric velocity as well as eccentric kinetic energy and musculo-articular stiffness prior to the eccentric-concentric transition were measured. Results showed similar increases in both eccentric velocity and kinetic energy under the 30% 1-RM but greater improvements under 50% and 70% 1-RM loads for UL than KL. UL increased stiffness under all loads (with greater magnitude of changes). KL improved concentric velocity only under the 30% 1-RM load while UL also improved under 50% and 70% 1-RM loads. Improvements in concentric movement velocity were moderately explained by changes in eccentric velocity (R 2 =.23-.62). Thus, UL led to greater improvements in concentric velocity, and the improvement is potentially explained by increases in the speed (as well as stiffness and kinetic energy) of the eccentric phase. Unknown load training appears to have significant practical use for the improvement of multijoint stretch-shortening cycle movements. © 2017 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

Mapping QTLs controlling kernel dimensions in a wheat inter-varietal RIL mapping population.

Science.gov (United States)

Cheng, Ruiru; Kong, Zhongxin; Zhang, Liwei; Xie, Quan; Jia, Haiyan; Yu, Dong; Huang, Yulong; Ma, Zhengqiang

2017-07-01

Seven kernel dimension QTLs were identified in wheat, and kernel thickness was found to be the most important dimension for grain weight improvement. Kernel morphology and weight of wheat (Triticum aestivum L.) affect both yield and quality; however, the genetic basis of these traits and their interactions has not been fully understood. In this study, to investigate the genetic factors affecting kernel morphology and the association of kernel morphology traits with kernel weight, kernel length (KL), width (KW) and thickness (KT) were evaluated, together with hundred-grain weight (HGW), in a recombinant inbred line population derived from Nanda2419 × Wangshuibai, with data from five trials (two different locations over 3 years). The results showed that HGW was more closely correlated with KT and KW than with KL. A whole genome scan revealed four QTLs for KL, one for KW and two for KT, distributed on five different chromosomes. Of them, QKl.nau-2D for KL, and QKt.nau-4B and QKt.nau-5A for KT were newly identified major QTLs for the respective traits, explaining up to 32.6 and 41.5% of the phenotypic variations, respectively. Increase of KW and KT and reduction of KL/KT and KW/KT ratios always resulted in significant higher grain weight. Lines combining the Nanda 2419 alleles of the 4B and 5A intervals had wider, thicker, rounder kernels and a 14% higher grain weight in the genotype-based analysis. A strong, negative linear relationship of the KW/KT ratio with grain weight was observed. It thus appears that kernel thickness is the most important kernel dimension factor in wheat improvement for higher yield. Mapping and marker identification of the kernel dimension-related QTLs definitely help realize the breeding goals.

Evaluation of Hibiscus esculentus Linn. on the Mechanical and ...

African Journals Online (AJOL)

Malvaceae) on the mechanical and disintegration properties of paracetamol tablets were investigated against gum acacia as a standard binding agent. The effects of the nature and concentration of the mucilage binder and the relative density ...

Evaluation of Hibiscus esculentus Linn. on the Mechanical and ...

African Journals Online (AJOL)

Nx 6110

of lamination and capping are of particular concern. REFERENCES. [1]. J.N. BeMiller, R.L. Whistler, D.G.. Barkalow and C.C. Chen in R. L.. Whistler and J. N. BeMiller (eds.). Industrial Gums, 3rd Edition, Academic. Press, New York. 1993, p 227-256. [2]. R.C. Woolfall, Soap Perfume Cosmet. 37 (1964) 965-970. [3]. O.A. Itiola ...

Response of okra [ Abelmoschus esculentus (L.) Moench] to water ...

African Journals Online (AJOL)

Parameters such as relative water content, membrane permeability, chlorophyll content and yield of capsules varieties were evaluated. Our results show that water deficiency reduces relative water content of okra leaves. This reduction is more pronounced when water lack occurs at flowering stage of plants and, leakage of ...

Sağlıklı genç olgularda yüksek yoğunluklu intervalli aerobik egzersiz eğitimi ile submaksimal sürekli aerobik egzersiz eğitiminin solunum fonksiyonları, egzersiz kapasitesi, stres düzeyi ve benlik saygısı üzerine etkilerinin karşılaştırılması

OpenAIRE

Yalman, Ali

2016-01-01

Bu çalışma iki farklı aerobik egzersiz eğitiminin (yüksek yoğunluklu interval egzersiz ve sürekli submaksimal egzersiz) solunum fonksiyonları, egzersiz kapasitesi, benlik saygısı ve stres düzeyi üzerine etkilerinin karşılaştırılması amacıyla yapılmıştır. Araştırmaya yaş ortalaması 20,83±0,97 yıl olan, 36 sağlıklı katılımcı dahil edildi. Katılımcılar yüksek yoğunluklu interval egzersiz eğitimi (YYİE) grubu (n=19 %52,8) ve sürekli submaksimal egzersiz eğitimi grubu (SSE) (n=17 %47,2) olmak üzer...

In vivo tibiofemoral cartilage-to-cartilage contact area of females with medial osteoarthritis under acute loading using MRI.

Science.gov (United States)

Shin, Choongsoo S; Souza, Richard B; Kumar, Deepak; Link, Thomas M; Wyman, Bradley T; Majumdar, Sharmila

2011-12-01

To investigate the effect of acute loading on in vivo tibiofemoral contact area changes in both compartments, and to determine whether in vivo tibiofemoral contact area differs between subjects with medial knee osteoarthritis (OA) and healthy controls. Ten subjects with medial knee OA (KL3) and 11 control subjects (KL0) were tested. Coronal three-dimensional spoiled gradient-recalled (3D-SPGR) and T(2) -weighted fast spin-echo FSE magnetic resonance imaging (MRI) of the knee were acquired under both unloaded and loaded conditions. Tibiofemoral cartilage contact areas were measured using image-based 3D models. Tibiofemoral contact areas in both compartments significantly increased under loading (P contact area in the medial compartment was significantly larger than in the lateral compartment (P contact area was significantly larger in KL3 subjects than KL0 subjects, both at unloaded and loaded conditions (P Contact areas measured from 3D-SPGR and T(2) -weighted FSE images were strongly correlated (r = 0.904). Females with medial OA increased tibiofemoral contact area in the medial compartment compared to healthy subjects under both unloaded and loaded conditions. The contact area data presented in this study may provide a quantitative reference for further cartilage contact biomechanics such as contact stress analysis and cartilage biomechanical function difference between osteoarthritic and healthy knees. Copyright © 2011 Wiley Periodicals, Inc.

Utilization of municipal wastewater for cooling in thermoelectric power plants: Evaluation of the combined cost of makeup water treatment and increased condenser fouling

Energy Technology Data Exchange (ETDEWEB)

Walker, Michael E. [Illinois Inst. of Technology, Chicago, IL (United States). Dept. of Chemical and Biological Engineering; Theregowda, Ranjani B. [Carnegie Mellon Univ., Pittsburgh, PA (United States). Dept of Civil and Mechanical Engineering; Safari, Iman [Illinois Inst. of Technology, Chicago, IL (United States). Dept. of Chemical and Biological Engineering; Abbasian, Javad [Illinois Inst. of Technology, Chicago, IL (United States). Dept. of Chemical and Biological Engineering; Arastoopour, Hamid [Illinois Inst. of Technology, Chicago, IL (United States). Dept. of Chemical and Biological Engineering; Dzombak, David A. [Carnegie Mellon Univ., Pittsburgh, PA (United States). Dept of Civil and Mechanical Engineering; Hsieh, Ming-Kai [Tamkang Univ., Taipei (Taiwan). Waer Resources Management and Policy Research Center; Miller, David C. [National Energy Technology Lab. (NETL), Morgantown, WV (United States)

2013-10-01

A methodology is presented to calculate the total combined cost (TCC) of water sourcing, water treatment and condenser fouling in the recirculating cooling systems of thermoelectric power plants. The methodology is employed to evaluate the economic viability of using treated municipal wastewater (MWW) to replace the use of freshwater as makeup water to power plant cooling systems. Cost analyses are presented for a reference power plant and five different tertiary treatment scenarios to reduce the scaling tendencies of MWW. Results indicate that a 550 MW sub-critical coal fired power plant with a makeup water requirement of 29.3 ML/day has a TCC of $3.0 - 3.2 million/yr associated with the use of treated MWW for cooling. (All costs USD 2009). This translates to a freshwater conservation cost of $0.29/kL, which is considerably lower than that of dry air cooling technology, $1.5/kL, as well as the 2020 conservation cost target set by the U.S. Department of Energy, $0.74/kL. Results also show that if the available price of freshwater exceeds that of secondary-treated MWW by more than $0.13-0.14/kL, it can be economically advantageous to purchase secondary MWW and treat it for utilization in the recirculating cooling system of a thermoelectric power plant.

Regional new energy vision formulated for Murakami City; 2001 nendo Murakami shi chiiki shin energy vision sakutei tou jigyo. Murakami shi shin energy puran

Energy Technology Data Exchange (ETDEWEB)

NONE

2002-03-01

For promoting the introduction of new energy and for enhancing people's consciousness of such at Murakami City, Niigata Prefecture, surveys and studies were conducted involving energy consumption in the town, the amount of new energy resources in existence, and new energy introduction projects, and a vision was formulated. The annual energy consumption of the city is estimated at 78,000 kL in terms of oil. The residential/commercial sector consumes 24,000 kL, the industrial sector 28,000 kL, and the transportation sector 26,000 kL, with the three sectors demanding similar amounts. The carbon dioxide emitted by the sectors is estimated at 223,000 t-CO2/year. New energy introduction projects were discussed, which included hot water supply, heating, road heating, and power generation, all these utilizing heat from the Senami hot spa; biogas fueled power generation and BDF (bio-diesel) bus operation in the Senami hot spa district; the introduction of a hybrid wind power/photovoltaic power generation system into Ogata Seaside Park; the introduction of a mini-scale hydroelectric power generation system into the Kamikaifu district; a large-scale wind power generation business at the Iwafune district; the introduction of wind power and photovoltaic power generation facilities into primary and junior high schools; the use of clean energy vehicles for official use; and so forth. (NEDO)

Autoselection of cytoplasmic yeast virus like elements encoding toxin/antitoxin systems involves a nuclear barrier for immunity gene expression.

Science.gov (United States)

Kast, Alene; Voges, Raphael; Schroth, Michael; Schaffrath, Raffael; Klassen, Roland; Meinhardt, Friedhelm

2015-05-01

Cytoplasmic virus like elements (VLEs) from Kluyveromyces lactis (Kl), Pichia acaciae (Pa) and Debaryomyces robertsiae (Dr) are extremely A/T-rich (>75%) and encode toxic anticodon nucleases (ACNases) along with specific immunity proteins. Here we show that nuclear, not cytoplasmic expression of either immunity gene (PaORF4, KlORF3 or DrORF5) results in transcript fragmentation and is insufficient to establish immunity to the cognate ACNase. Since rapid amplification of 3' ends (RACE) as well as linker ligation of immunity transcripts expressed in the nucleus revealed polyadenylation to occur along with fragmentation, ORF-internal poly(A) site cleavage due to the high A/T content is likely to prevent functional expression of the immunity genes. Consistently, lowering the A/T content of PaORF4 to 55% and KlORF3 to 46% by gene synthesis entirely prevented transcript cleavage and permitted functional nuclear expression leading to full immunity against the respective ACNase toxin. Consistent with a specific adaptation of the immunity proteins to the cognate ACNases, cross-immunity to non-cognate ACNases is neither conferred by PaOrf4 nor KlOrf3. Thus, the high A/T content of cytoplasmic VLEs minimizes the potential of functional nuclear recruitment of VLE encoded genes, in particular those involved in autoselection of the VLEs via a toxin/antitoxin principle.

Autoselection of cytoplasmic yeast virus like elements encoding toxin/antitoxin systems involves a nuclear barrier for immunity gene expression.

Directory of Open Access Journals (Sweden)

Alene Kast

2015-05-01

Full Text Available Cytoplasmic virus like elements (VLEs from Kluyveromyces lactis (Kl, Pichia acaciae (Pa and Debaryomyces robertsiae (Dr are extremely A/T-rich (>75% and encode toxic anticodon nucleases (ACNases along with specific immunity proteins. Here we show that nuclear, not cytoplasmic expression of either immunity gene (PaORF4, KlORF3 or DrORF5 results in transcript fragmentation and is insufficient to establish immunity to the cognate ACNase. Since rapid amplification of 3' ends (RACE as well as linker ligation of immunity transcripts expressed in the nucleus revealed polyadenylation to occur along with fragmentation, ORF-internal poly(A site cleavage due to the high A/T content is likely to prevent functional expression of the immunity genes. Consistently, lowering the A/T content of PaORF4 to 55% and KlORF3 to 46% by gene synthesis entirely prevented transcript cleavage and permitted functional nuclear expression leading to full immunity against the respective ACNase toxin. Consistent with a specific adaptation of the immunity proteins to the cognate ACNases, cross-immunity to non-cognate ACNases is neither conferred by PaOrf4 nor KlOrf3. Thus, the high A/T content of cytoplasmic VLEs minimizes the potential of functional nuclear recruitment of VLE encoded genes, in particular those involved in autoselection of the VLEs via a toxin/antitoxin principle.

The electron localization as the information content of the conditional pair density

Energy Technology Data Exchange (ETDEWEB)

Urbina, Andres S.; Torres, F. Javier [Universidad San Francisco de Quito (USFQ), Grupo de Química Computacional y Teórica (QCT-USFQ), Departamento de Química e Ingeniería Química, Diego de Robles y Via Interoceanica, Quito 17-1200-841 (Ecuador); Universidad San Francisco de Quito (USFQ), Instituto de Simulación Computacional (ISC-USFQ), Diego de Robles y Via Interoceanica, Quito 17-1200-841 (Ecuador); Rincon, Luis, E-mail: lrincon@usfq.edu.ec, E-mail: lrincon@ula.ve [Universidad San Francisco de Quito (USFQ), Grupo de Química Computacional y Teórica (QCT-USFQ), Departamento de Química e Ingeniería Química, Diego de Robles y Via Interoceanica, Quito 17-1200-841 (Ecuador); Universidad San Francisco de Quito (USFQ), Instituto de Simulación Computacional (ISC-USFQ), Diego de Robles y Via Interoceanica, Quito 17-1200-841 (Ecuador); Departamento de Química, Facultad de Ciencias, Universidad de Los Andes (ULA), La Hechicera, Mérida-5101 (Venezuela, Bolivarian Republic of)

2016-06-28

In the present work, the information gained by an electron for “knowing” about the position of another electron with the same spin is calculated using the Kullback-Leibler divergence (D{sub KL}) between the same-spin conditional pair probability density and the marginal probability. D{sub KL} is proposed as an electron localization measurement, based on the observation that regions of the space with high information gain can be associated with strong correlated localized electrons. Taking into consideration the scaling of D{sub KL} with the number of σ-spin electrons of a system (N{sup σ}), the quantity χ = (N{sup σ} − 1) D{sub KL}f{sub cut} is introduced as a general descriptor that allows the quantification of the electron localization in the space. f{sub cut} is defined such that it goes smoothly to zero for negligible densities. χ is computed for a selection of atomic and molecular systems in order to test its capability to determine the region in space where electrons are localized. As a general conclusion, χ is able to explain the electron structure of molecules on the basis of chemical grounds with a high degree of success and to produce a clear differentiation of the localization of electrons that can be traced to the fluctuation in the average number of electrons in these regions.

A meta-analysis of clinical and radiographic outcomes of posterior horn medial meniscus root repairs.

Science.gov (United States)

Chung, Kyu Sung; Ha, Jeong Ku; Ra, Ho Jong; Kim, Jin Goo

2016-05-01

Although interest in medial meniscus posterior root tear (MMPRT) repair has increased, few case series have been reported. This meta-analysis aimed to examine the clinical and radiological effects of MMPRT repair by pooling pre- and post-operative data from case-series reports. A literature search was performed using MEDLINE/PubMed, the Cochrane Central Register of Controlled Trials, and EMBASE databases. Pre- and post-operative data were pooled to investigate the effects of MMPRT repair, including the Lysholm score improvement, meniscal extrusion (mm) reduction, progression of the Kellgren-Lawrence (K-L) grade, and cartilage status according to the Outerbridge classification. Treatment effects included paired standardized mean differences (difference in the pre- and post-operative mean outcomes divided by the standard deviation) for the Lysholm score and meniscal extrusion, as well as the pooled event rates of progression of K-L grade and cartilage status. As treatment effects, the Lysholm score increased by as much as 3.675 (P meniscus extrusion was not reduced (n.s.). The overall pooled event rates of progression of K-L grade and cartilage status were 10.6 and 17.3 % (P meniscus extrusion was not reduced. Considering the occurrence of progression of K-L grade and cartilage status, it did not prevent the progression of arthrosis completely. Based on these results, repair results in favourable outcomes for MMPRT. Meta-analysis, Level IV.

Smart Water Conservation System for Irrigated Landscape

Science.gov (United States)

2016-05-01

ht ly M or e W or kl oa d; 5 -M or e W or kl oa d; 6 -S ig ni fic an lty M or...install the water harvesting and pump system was captured from the contractor cost proposal. 7.1.3 Water Cost Water purchased from the Port Hueneme Water...818) 737-2734 KDuke@valleycrest.com Contractor Tom Santoianni 1205 Mill Rd. Bldg. 1430 Public Works, Ventura (805) 982-4075 Tom.Santoianni@navy.mil Energy Manager

Re-Engineering the Stomatopod Eye

Science.gov (United States)

2016-09-21

Biology 25: R1-R3. 17. J. Marshall, K.L. Carleton and T. Cronin. 2015. Colour vision in marine organisms. Current Opinion in Neurobiology 34:86-94...20130032. http://dx.doi.org/10.1098/rstb.2013.0032 34. *N.J. Marshall, M.F. Land, and T.W. Cronin. 2014. Shrimps that pay attention : Saccadic...Marshall, K.L. Carleton and T. Cronin. 2015. Colour vision in marine organisms. Current Opinion in Neurobiology 34:86-94. K. Feller, J. Cohen, and T.W

Natural widths of atomic K and L levels, Kα X-ray lines and several KLL Auger lines

International Nuclear Information System (INIS)

Krause, M.O.; Oliver, J.H.

1979-01-01

Semi-empirical values of the natural widths of K, L 1 , L 2 , and L 3 levels, Kα 1 and Kα 2 x-ray lines, and KL 1 L 1 , KL 1 L 2 and KL 2 L 3 Auger lines for the elements 10 1 ,L 2 , L 3 ) is obtained from the relation GAMMA/sub i/=GAMMA/sub R/,i/ω/sub i/, using the theoretical radiative rate GAMMA/sub R/,i from Scofield's relativistic, relaxed Hartree-Fock calculation and the fluorescence yield ω/sub i/ from Krause's evaluation. X-ray and Auger lines widths are calculated as the sums of pertinent level widths. This tabulation of natural level and line widths is internally consistent, and is compatible with all relevant experimental and theoretical information. Present semi-empirical widths, especially those of Kα 1 and Kα 2 x-rays, are compared with measured widths. Uncertainties of semi-empirical values are estimated

Hecke algebras with unequal parameters

CERN Document Server

Lusztig, G

2003-01-01

Hecke algebras arise in representation theory as endomorphism algebras of induced representations. One of the most important classes of Hecke algebras is related to representations of reductive algebraic groups over p-adic or finite fields. In 1979, in the simplest (equal parameter) case of such Hecke algebras, Kazhdan and Lusztig discovered a particular basis (the KL-basis) in a Hecke algebra, which is very important in studying relations between representation theory and geometry of the corresponding flag varieties. It turned out that the elements of the KL-basis also possess very interesting combinatorial properties. In the present book, the author extends the theory of the KL-basis to a more general class of Hecke algebras, the so-called algebras with unequal parameters. In particular, he formulates conjectures describing the properties of Hecke algebras with unequal parameters and presents examples verifying these conjectures in particular cases. Written in the author's precise style, the book gives rese...

Large-scale night soil treatment by membrane filtration. Shipped to Shida administrative associate; Daikibo makubunri shinyoshori shisetsu. Shida koiki jimu kumiai nonyu

Energy Technology Data Exchange (ETDEWEB)

Seki, H [Ebara Corp., Tokyo (Japan)

1995-10-20

Ebara`a UF (Ultra Filtration) Deni-pack Process, featuring night soil treatment by membrane filtration and high load denitrification, was installed at Fujieda Environment Management Center, Shizuoka Prefecture. This UF process is the largest of its kind in Japan-treatment capacity: 58 kl/d of night soil and 102 kl/d of septic tank sludge, total of 160 kl/d. The disposability standards are below 10 mg/l of COD, below 10 mg/l of total nitrogen, and below 20 degrees of Color Unit. Nitrification and denitrification are done in a 10-meter deep vertical reactor. As for membranes for the liquid-solid separation, polyolefine, tubular type array-flow UF membranes, fractional molecular weight of 10,000, are used. Three belt press dehydrators and a fluidized-bed incinerator are used for sludge treatment. Installation of this process was completed in December 1995, and stable operation is being continued after a successful commissioning test. 8 figs., 3 tabs.

New Denipac process. Shipped to Ogawa district sanitation associate; New denipac process. Ogawa chiku eiseikumiai nonyu

Energy Technology Data Exchange (ETDEWEB)

Tsuchihira, S [Ebara Corp., Tokyo (Japan)

1995-10-20

Ebara`s New Denipac Process, featuring night soil treatment by membrane filtration and high load denitrification, was installed at Ikenoiri Environment Center, Saitama Prefecture. This treatment capacity of this process is: 39 kl/d of night soil and 61 kl/d of septic tank sludge, total of 100 kl/d. The septic standards of the effluent water from this process include: below 20 mg/l of COD, below 10 mg/l of total nitrogen, and below 30 degrees of color unit. In particular, the design, construction, and commissioning of this process had to be overall completed within a short time of twenty months. One main feature of this process is the use of an activated carbon recycling system, which is effectively achieving a saving in running cost. The installation of this process was completed in March 1995 and stable operation is being continued ever since. The following outlines the process and introduces operation results. 5 figs., 4 tabs.

A pilot study on the effect of Catha edulis Frosk., (Celastraceae) on metabolic syndrome in WOKW rats.

Science.gov (United States)

Mahmood, Samira Abdulla; Lindequist, Ulrike

2008-04-10

This study investigated the effect of Catha edulis (khat) on some important parameters of the metabolic syndrome in Wistar Ottawa Karlsburg W (WOKW) rat. The animals were fed with the standard chow containing 5% air dried pulverized khat leaves for 14 days; followed by the standard chow for 16 days. The khat leaves were sorted into green (khat light; KL) and crimson (khat dark; KD) leaves. The control rats were fed on standard chow. Blood glucose (G), serum insulin, serum leptin and serum lipids (triglycerides, total cholesterol, HDL-, LDL-, and VLDL cholesterol) were determined. Feeding with khat leaves reduced the body weight and the triglyceride level of the animals. The effect of KD on these parameters was stronger than that of KL. KD lowered the blood glucose concentration and the leptin content whereas KL was inactive. The khat intake had no significant influence on serum insulin, total serum cholesterol, HDL-, LDL- and VLDL-cholesterol.

Standardization of fixation, processing and staining methods for the central nervous system of vertebrates.

Science.gov (United States)

Aldana Marcos, H J; Ferrari, C C; Benitez, I; Affanni, J M

1996-12-01

This paper reports the standardization of methods used for processing and embedding various vertebrate brains of different size in paraffin. Other technical details developed for avoiding frequent difficulties arising during laboratory routine are also reported. Some modifications of the Nissl and Klüver-Barrera staining methods are proposed. These modifications include: 1) a Nissl stain solution with a rapid and efficient action with easier differentiation; 2) the use of a cheap microwave oven for the Klüver-Barrera stain. These procedures have the advantage of permitting Nissl and Klüver-Barrera staining of nervous tissue in about five and fifteen minutes respectively. The proposed procedures have been tested in brains obtained from fish, amphibians, reptiles and mammals of different body sizes. They are the result of our long experience in preparing slides for comparative studies. Serial sections of excellent quality were regularly obtained in all the specimens studied. These standardized methods, being simple and quick, are recommended for routine use in neurobiological laboratories.

A novel biomarker in patients with knee osteoarthritis: adropin.

Science.gov (United States)

Gundogdu, Gulsah; Gundogdu, Koksal

2018-03-16

Adropin is newly discovered peptide hormone. Osteoarthritis (OA) is a kind of joint disease characterized by progressive joint cartilage loss and joint pain. The present study was carried out to investigate adropin and tumor necrosis factor alpha (TNF-α) levels and the relationship between adropin in patients with knee OA classified by Kellgren-Lawrence (KL). A total of 60 knee OA patients and 30 healthy controls were included in this study. KL grading was carried out using the radiographic findings. Demographic characteristics and laboratory parameters were recorded. Adropin and TNF-α levels were determined by using enzyme-linked immunosorbent assay (ELISA). Adropin level was lower in the knee OA patients compared with the healthy controls (p  30 (p < 0.01). Mean NLR of KL grade 4 was significantly increased compared with other grades (p < 0.05). The consequence of the present study suggested that serum adropin level could be used as a new biomarker indicating the early grade of knee OA.

Geleneksel Anlatı Formları Olarak Mesnevîler ve Klâsik Aşk Mesnevîlerinin Motif Yapısı In Traditional Narrative Forms Mathnavies And Structure Motif Of Classic Love Mathnavies

Directory of Open Access Journals (Sweden)

Timuçin AYKANAT

2012-12-01

Full Text Available Text term can be generally described as written or verbal expressions. The texts that have an aesthetic and artistic value are called as literary texts. A literary text, carry its artistic work name in accordance with its artistic value. Artistic works mostly called differently due to creation era and form of creation. Classical mathnavi and modern novels, although they do not overlap exactly, are typical examples of this situation. The common feature of almost all artistic works comes from their being of narrative texts and these texts have fictional-narrative quality. Almost all fictional-narrative texts areconstructed by the knitting of different motifs in the hands of theirauthors. Although a text is knitted with lots of different motifs comingtogether, different works in the same context can use the same commonmotifs. Thus, different works emerge that have similar motif and plotbut different in accordance with their creators’ quantitative andqualitative characteristics. The commonality of this kind of texts,provide them to have an intertextual context. This study, investigateseighteen binary love mathnavi which have satisfied the narrative need ofhumanity for eras and have a place for themselves in the traditionalnarrative forms. Building upon this investigation, this study; has someevaluations on mathnavi as a traditional narrative form, searches formotifs that knit classical love mathnavi for their plot and emphasizesthe context that these texts construct. Metin ifâdesi, genel bir yaklaşımla yazılı ya da sözlü ibâreler şeklinde tanımlanabilir. Estetik beğeni ve sanatsal kaygı taşıyan metinler, edebî metinler olarak yorumlanmaktadır. Bir edebî metin, sanatsal kıymeti nispetinde, sanat yapıtı adını alır. Sanat yapıtları ise, oluşturulduğu çağ ve oluşturulma şekline göre, çoğu defa farklı adlandırılır. Klâsik mesnevîler ve modern romanlar; her ne kadar bire bir örtüşmeseler de bunun en tipik �

AMPHIBIAN COMMUNITIES IN BIOGEOCOENOSIS WITH DIFFERENT STAGES OF ANTHROPOGENIC CLYMAX

Directory of Open Access Journals (Sweden)

Marchenkovskaya А. А.

2013-04-01

Full Text Available We examined the abundance of juvenile (fingerlings and yearlings and sexually mature (3-6 years of various anurans at various biotopes with different degrees of anthropogenic influence. Population analysis has revealed that the number of juveniles in all the habitats are depended on type and level of anthropogenic influence. In all the habitats the most numerous species was synanthropic bufo viridis. In biotopes with high contamination of pollutants, only one species of amphibians - the marsh frog has populations with juveniles migrating here in the early fall. The highest number of mature individuals registered for the population of Bombina bombina, pelobates fuscus and in one biotope for hyla arborea. The populations of pelophylax ridibundus could be considered as the most balanced by number of juvenile and mature individuals.

Amphibians of the “Cilento e Vallo di Diano” National Park (Campania, Southern Italy: updated check list, distribution and conservation notes

Directory of Open Access Journals (Sweden)

Antonio Romano

2010-12-01

Full Text Available In this study, we present the results of our field and bibliographic survey on the amphibians of the “Cilento and Vallo di Diano” National Park (Southern Italy. Two hundred and thirty three spawning sites (167 original and 66 derived from literature, and 11 amphibian species were found. Reproductive activity was recorded for Salamandra salamandra, Salamandrina terdigitata, Triturus carnifex, Lissotriton italicus, Bufo bufo, Hyla intermedia, Rana italica, Rana dalmatina and Pelophylax synkl. hispanica. The distribution record of many species is widely improved with respect to bibliographic data. Our results also suggested that preservation and restoration of small aquatic sites, in particular of the artificial ones, such as stony wells and drinking-troughs, are fundamental for an appropriate conservation management of amphibians in the “Cilento and Vallo di Diano” National Park.

Ranavirus-associated mass mortality in wild amphibians, the Netherlands, 2010: a first report.

Science.gov (United States)

Kik, Marja; Martel, An; Sluijs, Annemarieke Spitzen-van der; Pasmans, Frank; Wohlsein, Peter; Gröne, Andrea; Rijks, Jolianne M

2011-11-01

In 2010, a mass die-off of over 1000 wild water frogs (Pelophylax spp.) and at least 10 common newts (Lissotriton vulgaris) occurred in a pond in The Netherlands. Haemorrhagic disease with hepatomegaly and splenomegaly was evident. Microscopically, multiple organs presented cells with multifocal intracytoplasmic inclusion bodies, in which ranavirus-like particles were demonstrated ultrastructurally. All specimens examined tested positive for ranavirus by PCR. The sequence obtained showed a 100% identity with the one deposited for common midwife toad virus (CMTV). This is the first report of ranavirus-associated mortality in wild amphibian populations in The Netherlands. It is also the first time CMTV or a CMTV-like virus has been reported in these two species in the adult stage and outside of Spain. Copyright © 2011 Elsevier Ltd. All rights reserved.

Correlation of serum cartilage oligomeric matrix protein (COMP) and interleukin-16 (IL-16) levels with disease severity in primary knee osteoarthritis: A pilot study in a Malaysian population.

Science.gov (United States)

Das Gupta, Esha; Ng, Wei Ren; Wong, Shew Fung; Bhurhanudeen, Abdul Kareem; Yeap, Swan Sim

2017-01-01

The aim of this study was to investigate the correlations between serum cartilage oligomeric matrix protein (COMP), interleukin-16 (IL-16) and different grades of knee osteoarthritis (KOA) in Malaysian subjects. Ninety subjects were recruited comprising 30 with Kellgren-Lawrence (K-L) grade 2 KOA, 27 with K-L grade 3 KOA, 7 with grade 4 KOA, and 30 healthy controls. All subjects completed the Western Ontario and McMaster Universities Arthritis Index (WOMAC) questionnaire. Serum COMP and IL-16 levels were measured using ELISA and their values log transformed to ensure a normal distribution. There was no significant differences in levels of log serum COMP and IL-16 between healthy controls and KOA patients. There were no significant differences in the log serum COMP and IL-16 levels within the different K-L grades in the KOA patients. In KOA patients, log serum IL-16 levels significantly correlated with the WOMAC score (p = 0.001) and its subscales, pain (p = 0.005), stiffness (p = 0.019) and physical function (p<0.0001). Serum IL-16 levels were significantly higher in Malaysian Indians compared to Malays and Chinese (p = 0.024). In this multi-ethnic Malaysian population, there was no difference in serum COMP and IL-16 levels between healthy controls and patients with KOA, nor was there any difference in serum COMP or IL-16 levels across the various K-L grades of KOA. However, there were significant inter-racial differences in serum IL-16 levels.

SAIL: Summation-bAsed Incremental Learning for Information-Theoretic Text Clustering.

Science.gov (United States)

Cao, Jie; Wu, Zhiang; Wu, Junjie; Xiong, Hui

2013-04-01

Information-theoretic clustering aims to exploit information-theoretic measures as the clustering criteria. A common practice on this topic is the so-called Info-Kmeans, which performs K-means clustering with KL-divergence as the proximity function. While expert efforts on Info-Kmeans have shown promising results, a remaining challenge is to deal with high-dimensional sparse data such as text corpora. Indeed, it is possible that the centroids contain many zero-value features for high-dimensional text vectors, which leads to infinite KL-divergence values and creates a dilemma in assigning objects to centroids during the iteration process of Info-Kmeans. To meet this challenge, in this paper, we propose a Summation-bAsed Incremental Learning (SAIL) algorithm for Info-Kmeans clustering. Specifically, by using an equivalent objective function, SAIL replaces the computation of KL-divergence by the incremental computation of Shannon entropy. This can avoid the zero-feature dilemma caused by the use of KL-divergence. To improve the clustering quality, we further introduce the variable neighborhood search scheme and propose the V-SAIL algorithm, which is then accelerated by a multithreaded scheme in PV-SAIL. Our experimental results on various real-world text collections have shown that, with SAIL as a booster, the clustering performance of Info-Kmeans can be significantly improved. Also, V-SAIL and PV-SAIL indeed help improve the clustering quality at a lower cost of computation.

Correlation between pretreatment or follow-up CT findings and therapeutic effect of autologous peripheral blood stem cell transplantation for interstitial pneumonia associated with systemic sclerosis

Energy Technology Data Exchange (ETDEWEB)

Yabuuchi, Hidetake, E-mail: yabuuchi@shs.kyushu-u.ac.jp [Department of Clinical Radiology, Graduate School of Medical Sciences, Kyushu University, 3-1-1 Maidashi, Higashi-ku, Fukuoka 812-8582 (Japan); Matsuo, Yoshio [Department of Clinical Radiology, Graduate School of Medical Sciences, Kyushu University, 3-1-1 Maidashi, Higashi-ku, Fukuoka 812-8582 (Japan); Tsukamoto, Hiroshi [Department of Medicine and Biosystemic Science, Graduate School of Medical Sciences, Kyushu University, 3-1-1 Maidashi, Higashi-ku, Fukuoka 812-8582 (Japan); Sunami, Shunya; Kamitani, Takeshi [Department of Clinical Radiology, Graduate School of Medical Sciences, Kyushu University, 3-1-1 Maidashi, Higashi-ku, Fukuoka 812-8582 (Japan); Sakai, Shuji [Department of Health Sciences, Graduate School of Medical Sciences, Kyushu University, 3-1-1 Maidashi, Higashi-ku, Fukuoka 812-8582 (Japan); Hatakenaka, Masamitsu [Department of Clinical Radiology, Graduate School of Medical Sciences, Kyushu University, 3-1-1 Maidashi, Higashi-ku, Fukuoka 812-8582 (Japan); Nagafuji, Koji; Horiuchi, Takahiko; Harada, Mine; Akashi, Koichi [Department of Medicine and Biosystemic Science, Graduate School of Medical Sciences, Kyushu University, 3-1-1 Maidashi, Higashi-ku, Fukuoka 812-8582 (Japan); Honda, Hiroshi [Department of Clinical Radiology, Graduate School of Medical Sciences, Kyushu University, 3-1-1 Maidashi, Higashi-ku, Fukuoka 812-8582 (Japan)

2011-08-15

Purpose: To evaluate what is useful among various parameters including CT findings, laboratory parameters (%VC, %DLco, KL-6), patients related data (age, sex, duration of disease) to discriminate between responder and non-responder in patients who received autologous peripheral blood stem cell transplantation (auto-PBSCT) for interstitial pneumonia (IP) with systemic sclerosis (SSc). Method: Auto-PBSCT and follow-up of at least one year by chest CT, serum KL-6, %VC, and %DLco were performed in 15 patients for IP with SSc. Analyzed CT findings included extent of ground-glass opacity (GGO), intralobular reticular opacity, number of segments that showed traction bronchiectasis, and presence of honeycombing. We regarded the therapeutic response of patients as responders when TLC or VC increase over 10% or DLco increase more than 15%, otherwise we have classified as non-responder. We applied univariate and multivariate analyses to find the significant indicators to discriminate responders from non-responders. P < 0.05 was considered statistically significant. Results: Univariate and multivariate analyses showed that the significant parameter to discriminate responders from non-responders were pretreatment KL-6, presence of honeycombing, extent of GGO, and early change in extent of GGO. Among them, extent of GGO and early change in extent of GGO were the strongest discriminators between responders and non-responders (P = 0.001, 0.001, respectively). Conclusion: Several CT findings and pretreatment KL-6 may be useful to discriminate between responder and non-responder in patients who received auto-PBSCT for IP with SSc.

Recovering Signals from Optical Fiber Interferometric Sensors

Science.gov (United States)

1991-06-01

electronic functions to be combined onto a single -integrated circuit on- a silicon (or other) substrate. These custom -designed circuits are known by...largely unknown to the ordinary :itizen and seldom mentioned in the- popular press. Yet optical fiber sensors have attracted considerable- interest...write the-power in output leg I by performing the same interchange on Equation (95). a3(L) 12 {2B 2B1 -cos(3KL)I + B3B;[5+4cos(3KL)] 2 18 - B2B ;e(4-"?1 +e

Oxidative Lung Injury in Virus-Induced Wheezing

Science.gov (United States)

2015-07-01

respiratory syncytial virus Yashoda M. Hosakote,1 Narayana Komaravelli,1 Nicolas Mautemps,1 Tianshuang Liu,1 Roberto P. Garofalo,1,2,3 and Antonella Casola1,2,3...1097/MNH.0b013e3283430651. 5. Li L, Whiteman M, Guan YY, Neo KL, Cheng Y, Lee SW, Zhao Y, Baskar R, Tan CH, Moore PK. 2008. Characterization of a novel...L, Whiteman M, Guan YY, Neo KL, Cheng Y, Lee SW, Zhao Y, Baskar R, Tan CH, Moore PK. Characterization of a novel, water-soluble hydrogen sulfide

Design Considerations for Large Computer Communication Networks,

Science.gov (United States)

1976-04-01

Differentiating Eq. (4.49a) with respect the PB’ we find BA 157 bV .- • PBH’ I P - 1+11 [1 PB] dPB NA 2 From the definition of H(z), Eq. (A.25) H’(z) = 2 kzk -lP...25), we arrive at p-i Nk k H(z) k N - k k=l z(.0 and from Eq. (A.27), H(Z) = N " Y kzk + p (p k)zk k=l k=(p+l)/2 To evaluate the above summations we

Hvilken organisation arbejder du for?

DEFF Research Database (Denmark)

Obed Madsen, Søren

2014-01-01

Et interview med Michael Ziegler viser at KL og offentlige ansatte medarbejdere ikke har det samme syn på, hvilken organisation, de arbejder for. Hvis det ikke skal føre til konflikter, kræver det oversættelse mellem de to verdener.......Et interview med Michael Ziegler viser at KL og offentlige ansatte medarbejdere ikke har det samme syn på, hvilken organisation, de arbejder for. Hvis det ikke skal føre til konflikter, kræver det oversættelse mellem de to verdener....

Transmission og modulation af kløe

DEFF Research Database (Denmark)

Elberling, Jesper; Arendt-Nielsen, Lars

2014-01-01

Chronic itch is an annoying and disabling symptom that severely affects patients' quality of life in several dermatological as well as non-dermatological disorders. Chronic itch may be maintained and even aggravated by sensitization of peripheral and central neuronal structures. The possibilities...... to effectively relieve chronic itch are often limited and the need of more specific, effective and quick-acting treatment options is huge. This review summarizes the fundamental aspects of itch, the neuronal transmission and modulation of itch, and discusses new treatment opportunities....

Proceedings of the 1981 KL-ONE Workshop,

Science.gov (United States)

1982-06-01

of stereotypical plans and provides friendly truth maintenance and choice generation. Among other facilities, the system responds to questions about...Role3t Relations, which express the interrelations among the [ functional Roles. A superConoept serves as proximate genus , while the internal...structure expresses essential eIifferences, as in classical classificatory definition [Sellars 17]. The sumum genus is represented by the Concept THING. THING

Effects of ambient oxygen concentration on soot temperature and concentration for biodiesel and diesel spray combustion

KAUST Repository

Zhang, Ji

2015-06-01

Ambient oxygen concentration, a key variable directly related to exhaust gas recirculation (EGR) levels in diesel engines, plays a significant role in particulate matter (PM) and nitrogen oxides (NOx) emissions. The utilization of biodiesel in diesel engines has been investigated over the last decades for its renewable characteristics and lower emissions compared to diesel. In an earlier work, we demonstrated that the soot temperature and concentration of biodiesel were lower than diesel under regular diesel engine conditions without EGR. Soot concentration was quantified by a parameter called KL factor. As a continuous effort, this paper presents an experimental investigation of the ambient oxygen concentration on soot temperature and KL factor during biodiesel and diesel spray combustion. The experiment was implemented in a constant volume chamber system, where the ambient oxygen concentration varied from 21 to 10% and the ambient temperature was kept to 1,000 K. A high speed two-color pyrometry technique was used to measure transient soot temperature and the KL factor of the spray flame. The soot temperature of biodiesel is found to be lower than that of diesel under the same conditions, which follows the same trend from our previous results found when the ambient temperature changes to 21% oxygen conditions. A reduction in ambient oxygen concentration generally reduces the soot temperature for both fuels. However, this is a complicated effect on soot processes as the change of oxygen concentration greatly affects the balance between soot formation and oxidation. The KL factor is observed to be the highest at 12% O2 for diesel and 18% O2 for biodiesel, respectively. On the other hand, the 10% O2 condition shows the lowest KL factor for both fuels. These results can provide quantitative experimental evidences to optimize the ambient oxygen concentration for diesel engines using different fuels for better emissions characteristics. © 2014 American Society of

Software for objective comparison of vocal acoustic features over weeks of audio recording: KLFromRecordingDays

Science.gov (United States)

Soderstrom, Ken; Alalawi, Ali

KLFromRecordingDays allows measurement of Kullback-Leibler (KL) distances between 2D probability distributions of vocal acoustic features. Greater KL distance measures reflect increased phonological divergence across the vocalizations compared. The software has been used to compare *.wav file recordings made by Sound Analysis Recorder 2011 of songbird vocalizations pre- and post-drug and surgical manipulations. Recordings from individual animals in *.wav format are first organized into subdirectories by recording day and then segmented into individual syllables uttered and acoustic features of these syllables using Sound Analysis Pro 2011 (SAP). KLFromRecordingDays uses syllable acoustic feature data output by SAP to a MySQL table to generate and compare "template" (typically pre-treatment) and "target" (typically post-treatment) probability distributions. These distributions are a series of virtual 2D plots of the duration of each syllable (as x-axis) to each of 13 other acoustic features measured by SAP for that syllable (as y-axes). Differences between "template" and "target" probability distributions for each acoustic feature are determined by calculating KL distance, a measure of divergence of the target 2D distribution pattern from that of the template. KL distances and the mean KL distance across all acoustic features are calculated for each recording day and output to an Excel spreadsheet. Resulting data for individual subjects may then be pooled across treatment groups and graphically summarized and used for statistical comparisons. Because SAP-generated MySQL files are accessed directly, data limits associated with spreadsheet output are avoided, and the totality of vocal output over weeks may be objectively analyzed all at once. The software has been useful for measuring drug effects on songbird vocalizations and assessing recovery from damage to regions of vocal motor cortex. It may be useful in studies employing other species, and as part of speech

Software for objective comparison of vocal acoustic features over weeks of audio recording: KLFromRecordingDays

Directory of Open Access Journals (Sweden)

Ken Soderstrom

2017-01-01

Full Text Available KLFromRecordingDays allows measurement of Kullback–Leibler (KL distances between 2D probability distributions of vocal acoustic features. Greater KL distance measures reflect increased phonological divergence across the vocalizations compared. The software has been used to compare *.wav file recordings made by Sound Analysis Recorder 2011 of songbird vocalizations pre- and post-drug and surgical manipulations. Recordings from individual animals in *.wav format are first organized into subdirectories by recording day and then segmented into individual syllables uttered and acoustic features of these syllables using Sound Analysis Pro 2011 (SAP. KLFromRecordingDays uses syllable acoustic feature data output by SAP to a MySQL table to generate and compare “template” (typically pre-treatment and “target” (typically post-treatment probability distributions. These distributions are a series of virtual 2D plots of the duration of each syllable (as x-axis to each of 13 other acoustic features measured by SAP for that syllable (as y-axes. Differences between “template” and “target” probability distributions for each acoustic feature are determined by calculating KL distance, a measure of divergence of the target 2D distribution pattern from that of the template. KL distances and the mean KL distance across all acoustic features are calculated for each recording day and output to an Excel spreadsheet. Resulting data for individual subjects may then be pooled across treatment groups and graphically summarized and used for statistical comparisons. Because SAP-generated MySQL files are accessed directly, data limits associated with spreadsheet output are avoided, and the totality of vocal output over weeks may be objectively analyzed all at once. The software has been useful for measuring drug effects on songbird vocalizations and assessing recovery from damage to regions of vocal motor cortex. It may be useful in studies employing other

Genetic structure of the marsh frog (Pelophylax ridibundus) populations in urban landscape

Czech Academy of Sciences Publication Activity Database

Mikulíček, Peter; Pišút, P.

2012-01-01

Roč. 58, č. 5 (2012), s. 833-845 ISSN 1612-4642 Institutional support: RVO:68081766 Keywords : Genetic differentiation * Habitat fragmentation * Microsatellites * Rana ridibunda * Ranidae * Urbanization Subject RIV: EG - Zoology Impact factor: 1.355, year: 2012

SECRETED KLOTHO AND CHRONIC KIDNEY DISEASE

Science.gov (United States)

Hu, Ming Chang; Kuro-o, Makoto; Moe, Orson W.

2013-01-01

Soluble Klotho (sKl) in the circulation can be generated directly by alterative splicing of the Klotho transcript or the extracellular domain of membrane Klotho can be released from membrane-anchored Klotho on the cell surface. Unlike membrane Klotho which functions as a coreceptor for fibroblast growth factor-23 (FGF23), sKl, acts as hormonal factor and plays important roles in anti-aging, anti-oxidation, modulation of ion transport, and Wnt signaling. Emerging evidence reveals that Klotho deficiency is an early biomarker for chronic kidney diseases as well as a pathogenic factor. Klotho deficiency is associated with progression and chronic complications in chronic kidney disease including vascular calcification, cardiac hypertrophy, and secondary hyperparathyroidism. In multiple experimental models, replacement of sKl, or manipulated up-regulation of endogenous Klotho protect the kidney from renal insults, preserve kidney function, and suppress renal fibrosis, in chronic kidney disease. Klotho is a highly promising candidate on the horizon as an early biomarker, and as a novel therapeutic agent for chronic kidney disease. PMID:22396167

Evidence for a rotating helical filament in L1641, part of the Orion cloud complex

International Nuclear Information System (INIS)

Uchida, Y.

1991-01-01

Interstellar cloud structures, typically 10-30 pc long and 3-5 pc wide, are often seen extending outwards from dense clouds that show marked enhancement of star formation within them. We have used the Nagoya 4-m radiotelescope to study one such 'streamer', L1641, a part of the giant molecular-cloud complex in Orion, lying south of the Kleinmann-Low (KL) nebula. Using the 110-GHz line of 13 Co (J=1-0), we have obtained intensity and velocity data, and find within the streamer a dense filament with a helical structure, spinning in the same sense as the gas in the Orion KL region. We propose a model for this structure in which the streamer, through the action of the interstellar magnetic field, acts as an angular-momentum drain on the Orion KL region, allowing it to collapse. In this model, the ∼30-pc-long streamer is essential to the formation of the cloud, as well as the formation of stars within the dense cloud. (author)

Holocene glacier variations and sea level change in Wahlenbergfjorden, Nordaustlandet, Svalbard

Science.gov (United States)

Schomacker, A.; Farnsworth, W. R.; Ingolfsson, O.; Allaart, L.; Håkansson, L.; Retelle, M.

2017-12-01

Here we present preliminary results on the Holocene glacier variations in Wahlenbergfjorden on Nordaustlandet, Svalbard. The reconstructions are based on lake sediment records from Lake Kl\\overbladvatna covering the last 9500 years. This lake captures meltwater from the Etonbreen glacier, a main outlet of the Austfonna ice cap, when the glacier extends further than present. Additionally, Kl\\overbladvatna is an isolation basin capturing the postglacial isolation from the marine to lacustrine environment due to glacioisostatic rebound. The chronology is based on radiocarbon dating of terrestrial and marine macrofossils. The lake sediment record also reveals that glacial meltwater exceeded the threshold into Lake Kl\\overbladvatna during the Little Ice Age as witnessed by glacial meltwater clay in the upper part of the sediment cores. In periods of less advanced glaciers, the lake sediment record is dominated by laminated clayey gyttja. Based on radiocarbon datings of driftwood, whalebone, and marine mollusc shells in raised beaches and marine deposits in Pallanderbukta, south Wahlenbergfjorden, we also present a new postglacial sea level curve from this region.

Structures of three different neutral polysaccharides of Acinetobacter baumannii, NIPH190, NIPH201, and NIPH615, assigned to K30, K45, and K48 capsule types, respectively, based on capsule biosynthesis gene clusters.

Science.gov (United States)

Shashkov, Alexander S; Kenyon, Johanna J; Arbatsky, Nikolay P; Shneider, Mikhail M; Popova, Anastasiya V; Miroshnikov, Konstantin A; Volozhantsev, Nikolay V; Knirel, Yuriy A

2015-11-19

Neutral capsular polysaccharides (CPSs) were isolated from Acinetobacter baumannii NIPH190, NIPH201, and NIPH615. The CPSs were found to contain common monosaccharides only and to be branched with a side-chain 1→3-linked β-d-glucopyranose residue. Structures of the oligosaccharide repeat units (K units) of the CPSs were elucidated by 1D and 2D (1)H and (13)C NMR spectroscopy. Novel CPS biosynthesis gene clusters, designated KL30, KL45, and KL48, were found at the K locus in the genome sequences of NIPH190, NIPH201, and NIPH615, respectively. The genetic content of each gene cluster correlated with the structure of the CPS unit established, and therefore, the capsular types of the strains studied were designated as K30, K45, and K48, respectively. The initiating sugar of each K unit was predicted, and glycosyltransferases encoded by each gene cluster were assigned to the formation of the linkages between sugars in the corresponding K unit. Copyright © 2015 Elsevier Ltd. All rights reserved.

Semi-analytical Karhunen-Loeve representation of irregular waves based on the prolate spheroidal wave functions

Science.gov (United States)

Lee, Gibbeum; Cho, Yeunwoo

2018-01-01

A new semi-analytical approach is presented to solving the matrix eigenvalue problem or the integral equation in Karhunen-Loeve (K-L) representation of random data such as irregular ocean waves. Instead of direct numerical approach to this matrix eigenvalue problem, which may suffer from the computational inaccuracy for big data, a pair of integral and differential equations are considered, which are related to the so-called prolate spheroidal wave functions (PSWF). First, the PSWF is expressed as a summation of a small number of the analytical Legendre functions. After substituting them into the PSWF differential equation, a much smaller size matrix eigenvalue problem is obtained than the direct numerical K-L matrix eigenvalue problem. By solving this with a minimal numerical effort, the PSWF and the associated eigenvalue of the PSWF differential equation are obtained. Then, the eigenvalue of the PSWF integral equation is analytically expressed by the functional values of the PSWF and the eigenvalues obtained in the PSWF differential equation. Finally, the analytically expressed PSWFs and the eigenvalues in the PWSF integral equation are used to form the kernel matrix in the K-L integral equation for the representation of exemplary wave data such as ordinary irregular waves. It is found that, with the same accuracy, the required memory size of the present method is smaller than that of the direct numerical K-L representation and the computation time of the present method is shorter than that of the semi-analytical method based on the sinusoidal functions.

Estado de las poblaciones de anfibios en un parque urbano de Pamplona

Directory of Open Access Journals (Sweden)

Gosá, A., Arias, A.

2009-01-01

Full Text Available Las poblaciones aisladas de tres anfibios (Triturus marmoratus, Alytes obstetricans, Pelophylax perezi han sido muestreadas entre 2005 y 2007, en primavera y finales de verano, en un canal y tres estanques de un parque urbano céntrico de la ciudad de Pamplona. Los 8 adultos censados en 2005 de T. marmoratus han podido desaparecer en los años siguientes, a causa de unas obras urbanas realizadas junto al parque. La estima de la población de A. obstetricans se acerca al millar de adultos. Su periodo reproductor se extiende hasta septiembre, y una parte de la población larvaria inverna sin metamorfosear. El ajardinamiento de la zona, la contaminación del agua y la presencia de depredadores y competidores introducidos, como Procambarus clarkii y Carassius auratus, ponen en peligro la supervivencia de los anfibios.

Kulturel dynamik i oplevelsesbyrummet

DEFF Research Database (Denmark)

Brandrup, Hjørdis Havsteen

2010-01-01

contains a wide range of cultural groups: a Danish cultural elite, immigrants, homeless people and drug addicts. In this cultural multiplicity Brandts Klædefabrik is a cultural cluster and an urban entertainment district which does not include marginalised groups. Paradoxically, the attempt to maintain...... an exclusive order to satisfy an audience with buying power runs against the creative profile of the area, in which cultural and social multiplicity are important values. The area around Brandts Klædefabrik is a public space; but if it is going to be a public domain and the scene of cultural exchanges between...

Evaluation of turbulence models for turbomachinery unsteady three-dimensional flows simulation; Evaluation de modeles de turbulence pour la simulation d'ecoulements tridimensionnels instationnaires en turbomachines

Energy Technology Data Exchange (ETDEWEB)

Dano, C.

2003-01-15

The objective of this thesis is to evaluate k-e, k-l and k-w low Reynolds two equation turbulence models for. A quadratic nonlinear k-l model is also implemented in this study. We analyze the two equation turbulence models capacity to predict the turbomachinery flows and the wakes. We are interested more particularly in the unsteady three dimensional configuration with rotor-stator interactions. A Gaussian distribution reproduces the upstream wake. This analysis is carried out in term of prediction quality but also in term of numerical behavior. Turbines and compressors configurations are tested. (author)

Interchannel interactions in high-energetic radiationless transitions of neon-like ions

International Nuclear Information System (INIS)

Fritzsche, S.; Zschornack, G.; Musiol, G.; Soff, G.

1990-07-01

Relativistic K-LL Auger transition rates in intermediate coupling including interchannel interactions are presented for nine ions in the neon-isoelectronic sequence up to uranium. For neutral neon a comparison with experimental data is given. We demonstrate for the first time, that intercontinuum interactions result in a remarkable redistribution of individual transition rates even in high-energetic transitions. For instance, channel mixing shifts the K-L 1 L 1 rate by about 4% and the K-L 3 L 3 (J = 0) rate by about 11% in neon-like uranium, while total Auger rates are almost not affected. (orig.)

Development and Evaluation of Reproductive and Developmental Toxicity Tests for Assessing the Hazards of Environmental Contaminants

Science.gov (United States)

1997-08-01

diet of the animals, their dret was supplemented wtth Poly Vt vitamins by injecting the worms with vitamins three tunes a week. The weight of the...No Kl K2 K3 Bl B2 B3 Male 18 44 23 26 56 34 Clutch Weight (g) 2.64 14.07 5.07 5.72 14.50 8.94 % Normal 46.00 54.50 75.00 66.50 59.50 70.50...107. FEMALE REPRODUCTIVE TOXICITY EXPERIMENT: FINAL BREEDING AND EGG CLUTCH DATA AFTER DIRECT EXPOSURE TO EGLIN AFB SOIL Frog No. Kl K2 K3 Bl B2 B3

On the use of Kontorovich-Lebedev transform in electromagnetic diffraction by an impedance cone

KAUST Repository

Salem, Mohamed; Kamel, Aladin Hassan; Bagci, Hakan

2012-01-01

We consider the boundary-value problem for the Helmholtz equation connected with an infinite circular cone with an impedance boundary on its face. The scheme of solution includes applying the Kontorovich-Lebedev (KL) transform to reduce the problem to that of a KL spectral amplitude function satisfying a singular integral equation of the non-convolution type with a variable coefficient. The singularities of the spectral function are deduced and representations for the field at the tip of the cone and in the near and far field regions are given together with the conditions of validity of these representations. © 2012 IEEE.

On the use of Kontorovich-Lebedev transform in electromagnetic diffraction by an impedance cone

KAUST Repository

Salem, Mohamed

2012-08-01

We consider the boundary-value problem for the Helmholtz equation connected with an infinite circular cone with an impedance boundary on its face. The scheme of solution includes applying the Kontorovich-Lebedev (KL) transform to reduce the problem to that of a KL spectral amplitude function satisfying a singular integral equation of the non-convolution type with a variable coefficient. The singularities of the spectral function are deduced and representations for the field at the tip of the cone and in the near and far field regions are given together with the conditions of validity of these representations. © 2012 IEEE.

Evolutionary Diversification of Alanine Transaminases in Yeast: Catabolic Specialization and Biosynthetic Redundancy

Directory of Open Access Journals (Sweden)

Ximena Escalera-Fanjul

2017-06-01

Full Text Available Gene duplication is one of the major evolutionary mechanisms providing raw material for the generation of genes with new or modified functions. The yeast Saccharomyces cerevisiae originated after an allopolyploidization event, which involved mating between two different ancestral yeast species. ScALT1 and ScALT2 codify proteins with 65% identity, which were proposed to be paralogous alanine transaminases. Further analysis of their physiological role showed that while ScALT1 encodes an alanine transaminase which constitutes the main pathway for alanine biosynthesis and the sole pathway for alanine catabolism, ScAlt2 does not display alanine transaminase activity and is not involved in alanine metabolism. Moreover, phylogenetic studies have suggested that ScALT1 and ScALT2 come from each one of the two parental strains which gave rise to the ancestral hybrid. The present work has been aimed to the understanding of the properties of the ancestral type Lacchancea kluyveri LkALT1 and Kluyveromyces lactis KlALT1, alanine transaminases in order to better understand the ScALT1 and ScALT2 evolutionary history. These ancestral -type species were chosen since they harbor ALT1 genes, which are related to ScALT2. Presented results show that, although LkALT1 and KlALT1 constitute ScALT1 orthologous genes, encoding alanine transaminases, both yeasts display LkAlt1 and KlAlt1 independent alanine transaminase activity and additional unidentified alanine biosynthetic and catabolic pathway(s. Furthermore, phenotypic analysis of null mutants uncovered the fact that KlAlt1 and LkAlt1 have an additional role, not related to alanine metabolism but is necessary to achieve wild type growth rate. Our study shows that the ancestral alanine transaminase function has been retained by the ScALT1 encoded enzyme, which has specialized its catabolic character, while losing the alanine independent role observed in the ancestral type enzymes. The fact that ScAlt2 conserves 64

Pollution by heavy metals in the Moche River Basin, 1980 - 2010, La Libertad - Peru

Directory of Open Access Journals (Sweden)

Félix Huaranga Moreno

2012-09-01

Full Text Available The pollution of the continental waters is a problem at a world scale, mainly due to the impact of the mining tailings. Using top technologies as neutralization plants of acid waters, many companies are mitigating the impact of this functioning; so taking as a reference the changes in the concentration of heavy metals present in water, soils and cultivations of the high, middle and low basin of the Moche river, samplings of water were obtained at eight stations of the Moche river (Trujillo, Peru, and in four sectors of its margins for soils and cultivations. The most representative heavy metals in water were found in the high basin during the year 1980: iron (557.500 ppm, lead (100.375 ppm, cadmium (4.550 ppm, copper (6.900 ppm, zinc (262.900 ppm and arsenic (9.000 ppm; whereas in the soils the higher concentrations were found on the right margin of median basin in the year 1980: iron (83.400 mg/kg; lead (0.820 mg/kg; cadmium (0.012 mg/kg; copper (1.240 mg/kg; zinc (0.380 mg/kg and arsenic (0.016 mg/kg; in relation to the metal accumulation in the cultivations, iron (0.6525 mg/kg was predominant, being the yucca (Manihot esculentus the most contaminated cultivation. It is concluded that, most contamination level of water analysis was present in the high basin during 1980, whereas the right side of the median basin highest levels of contamination in the samples of soils; relating to the cultives, the yucca (Manihot esculentus was the species most contaminated.

Dicty_cDB: AFJ783 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available lvnfkvvtl*clqtkmkk*rnqflkanthhkgr dyqmltn*iiivkkpiwi*kl*nnnnnnnicklkidinniinnsnnk...ll Frames) Frame A: lvykf*ttkisinnffyi*nltqtlik*ithitpitrell*iiiinitiiitiiiiiiit tiitkellyqihqknpfskmps*psqm

DESENVOLVIMENTO E PRODUÇÃO DO QUIABEIRO EM FUNÇÃO DAS DATAS DE PLANTIO GROWTH AND YIELD OF OKRA AS INFLUENCED BY PLANTING DATES

Directory of Open Access Journals (Sweden)

Peter Ernst Sonnenberg

2007-09-01

Full Text Available

A influência de quatro épocas de plantio (15 de maio, 15 de junho, 15 de julho e 15 de agosto de 1998 no desenvolvimento e na produção do quiabeiro (Abelmoschus esculentus (L Moench (cv. Santa Cruz 47 foi investigada em Goiânia, GO. O experimento foi conduzido na Escola de Agronomia e Engenharia de Alimentos da Universidade Federal de Goiás, em Latossolo Vermelho Amarelo, cultivado há muitos anos. O delineamento experimental foi o de blocos casualizados com quatro repetições. Foram encontradas diferenças significativas (Tukey 5% entre épocas de plantio, para as seguintes características: número de frutos produzidos durante as trinta primeiras colheitas, altura das plantas no início da colheita, número de ramos laterais e número de dias da semeadura ao início do florescimento, ao início da colheita e ao início da colheita em 75% das covas. A temperatura média dos meses seguintes às datas de plantio aumentou de maio para agosto. Observou-se uma redução do período da semeadura até o início do florescimento, até o início da colheita e até o início da colheita em 75% das covas. O número de ramos laterais também foi reduzido no mesmo período. Entretanto verificou-se aumento na altura das plantas e no rendimento das primeiras trinta colheitas.

PALAVRAS-CHAVE: Abelmoschus esculentus; data de plantio; épocas de plantio.

The influence of four sowing dates (May 15th, June 15th, July 15th and August 15th, 1998 on the growth and yield of okra (Abelmoschus

β-1,3 Glucanases e quitinases: aplicação na lise de leveduras e inibição de fungos β-1,3 glucanases and chitinases: application in the yeast cell lysis and fungi inhibition

Directory of Open Access Journals (Sweden)

Luciana Francisco Fleuri

2008-08-01

Full Text Available Objetivou-se, no presente trabalho, a aplicação de β-1,3 glucanases e quitinases da linhagem Cellulosimicrobium cellulans 191 na lise de leveduras e inibição de fungos, respectivamente. O delineamento experimental mostrou que as melhores condições para a lise de Saccharomyces cerevisiae KL-88 pela β-1,3 glucanase foi pH 6,5 e 35ºC. As células de leveduras incubadas por 10 h em frascos sem agitação mostraram-se mais susceptíveis à lise pela ação da enzima. Foi obtido maior lise da levedura quando a suspensão de células foi submetida ao tratamento com β-1,3 glucanase e cisteína 1mM. A enzima invertase intracelular ou ligada à célula de S. cerevisiae KL-88 e K. marxianus NCYC 587 foi extraída após tratamento da suspensão celular com β-1,3 glucanase, sendo que o tratamento prévio das leveduras com a enzima aumentou a susceptibilidade das células à lise com ultra-som. A preparação de quitinase foi capaz de formar halos de inibição de alguns fungos.The aim of this work was the application of β-1,3 glucanases and chitinases by Cellulosimicrobium cellulans 191 strain on yeast cell lysis and fungi inhibition, respectively. The experimental design study showed that the best conditions to Saccharomyces cerevisiae KL-88 lysis by β-1,3 glucanase extract were pH 6,5 and 35ºC. This study also demonstrated that the yeast cells were more susceptible to lysis after 10 h of cultivation in flasks without agitation. Lysis activity was increased when S. cerevisiae KL-88 cell suspension was treated with β-1,3 glucanase and cystein 1mM. The enzyme invertase of S. cerevisiae KL-88 and Kluyveromyces marxianus NCYC 587 was extracted after treatment of cell suspension with β-1,3 glucanase and the previous treatment of yeasts with the enzyme, increased the susceptibility to lysis when ultrasonic treatment was used. The chitinase presented growth inhibition halos for some of the fungi.

Protective Effect of Klotho against Ischemic Brain Injury Is Associated with Inhibition of RIG-I/NF-κB Signaling

Directory of Open Access Journals (Sweden)

Hong-Jing Zhou

2018-01-01

Full Text Available Aging is the greatest independent risk factor for the occurrence of stroke and poor outcomes, at least partially through progressive increases in oxidative stress and inflammation with advanced age. Klotho is an antiaging gene, the expression of which declines with age. Klotho may protect against neuronal oxidative damage that is induced by glutamate. The present study investigated the effects of Klotho overexpression and knockdown by an intracerebroventricular injection of a lentiviral vector that encoded murine Klotho (LV-KL or rat Klotho short-hairpin RNA (LV-KL shRNA on cerebral ischemia injury and the underlying anti-neuroinflammatory mechanism. The overexpression of Klotho induced by LV-KL significantly improved neurobehavioral deficits and increased the number of live neurons in the hippocampal CA1 and caudate putamen subregions 72 h after cerebral hypoperfusion that was induced by transient bilateral common carotid artery occlusion (2VO in mice. The overexpression of Klotho significantly decreased the immunoreactivity of glial fibrillary acidic protein and ionized calcium binding adaptor molecule-1, the expression of retinoic-acid-inducible gene-I, the nuclear translocation of nuclear factor-κB, and the production of proinflammatory cytokines (tumor necrosis factor α and interleukin-6 in 2VO mice. The knockdown of Klotho mediated by LV-KL shRNA in the brain exacerbated neurological dysfunction and cerebral infarct after 22 h of reperfusion following 2 h middle cerebral artery occlusion in rats. These findings suggest that Klotho itself or enhancers of Klotho may compensate for its aging-related decline, thus providing a promising therapeutic approach for acute ischemic stroke during advanced age.

Variations in Hip Shape Are Associated with Radiographic Knee Osteoarthritis: Cross-sectional and Longitudinal Analyses of the Johnston County Osteoarthritis Project.

Science.gov (United States)

Nelson, Amanda E; Golightly, Yvonne M; Renner, Jordan B; Schwartz, Todd A; Liu, Felix; Lynch, John A; Gregory, Jenny S; Aspden, Richard M; Lane, Nancy E; Jordan, Joanne M

2016-02-01

Hip shape by statistical shape modeling (SSM) is associated with hip radiographic osteoarthritis (rOA). We examined associations between hip shape and knee rOA given the biomechanical interrelationships between these joints. Bilateral baseline hip shape assessments [for those with at least 1 hip with a Kellgren-Lawrence arthritis grading scale (KL) 0 or 1] from the Johnston County Osteoarthritis Project were available. Proximal femur shape was defined on baseline pelvis radiographs and evaluated by SSM, producing mean shape and continuous variables representing independent modes of variation (14 modes = 95% of shape variance). Outcomes included prevalent [baseline KL ≥ 2 or total knee replacement (TKR)], incident (baseline KL 0/1 with followup ≥ 2), and progressive knee rOA (KL increase of ≥ 1 or TKR). Limb-based logistic regression models for ipsilateral and contralateral comparisons were adjusted for age, sex, race, body mass index (BMI), and hip rOA, accounting for intraperson correlations. We evaluated 681 hips and 682 knees from 342 individuals (61% women, 83% white, mean age 62 yrs, BMI 29 kg/m(2)). Ninety-nine knees (15%) had prevalent rOA (4 knees with TKR). Lower modes 2 and 3 scores were associated with ipsilateral prevalent knee rOA, and only lower mode 3 scores were associated with contralateral prevalent knee rOA. No statistically significant associations were seen for incident or progressive knee rOA. Variations in hip shape were associated with prevalent, but not incident or progressive, knee rOA in this cohort, and may reflect biomechanical differences between limbs, genetic influences, or common factors related to both hip shape and knee rOA.

Outcomes of total knee arthroplasty in relation to preoperative patient-reported and radiographic measures: data from the osteoarthritis initiative.

Science.gov (United States)

Kahn, Timothy L; Soheili, Aydin; Schwarzkopf, Ran

2013-12-01

Total knee arthroplasty (TKA) is the preferred surgical treatment for end-stage osteoarthritis. However, substantial numbers of patients still experience poor outcomes. Consequently, it is important to identify which patient characteristics are predictive of outcomes in order to guide clinical decisions. Our hypothesis is that preoperative patient-reported outcome measures and radiographic measures may help to predict TKA outcomes. Using cohort data from the Osteoarthritis Initiative, we studied 172 patients who underwent TKA. For each patient, we compiled pre- and postoperative Western Ontario and McMaster University Arthritis Index (WOMAC) scores. Radiographs were measured for knee joint angles, femorotibial angles, anatomical lateral distal femoral angles, and anatomical medial proximal tibial angles; Kellgren and Lawrence (KL) grades were assigned to each compartment of the knee. All studied measurements were compared to WOMAC outcomes. Preoperative WOMAC disability, pain, and total scores were positively associated with postoperative WOMAC total scores (P = .010, P = .010, and P = .009, respectively) and were associated with improvement in WOMAC total scores (P < .001, P < .001, and P < .001, respectively). For radiographic measurements, preoperative joint angles were positively associated with improvements in postoperative WOMAC total scores (P = .044). Combined KL grades (medial and lateral compartments) were negatively correlated with postoperative WOMAC disability and pain scores (P = .045 and P = .044) and were positively correlated with improvements in WOMAC total scores (P = .001). All preoperative WOMAC scores demonstrated positive associations with postoperative WOMAC scores, while among the preoperative radiographic measurements only combined KL grades and joint angles showed any correlation with postoperative WOMAC scores. Higher preoperative KL grades and joint angles were associated with better (lower) postoperative WOMAC scores, demonstrating an

Inhibition of topoisomerase II activity in repair-proficient CHO K1 cells by 2-[(aminopropyl)amino]ethanethiol (WR-1065)

International Nuclear Information System (INIS)

Grdina, D.J.; Constantinou, A.; Shigematsu, N.

1992-09-01

The aminothiol 2-[(aminopropyl)amino]ethanethiol (WR-1065) is the active thiol of the clinically studied radioprotective agent S-2-(3-aminopropylamino) ethylphosphorothioic acid (WR-2721). WR-1065 is an effective radiation protector under in vitro conditions when it is administered 30 min prior to radiation exposure at a concentration of 4 mM to repair-proficient Chinese hamster ovary Kl cells (i.e., a dose modification factor of 1.4). In contrast, the DNA double-strand break, repair-deficient Chinese hamster ovary xrs-5 cell line is not protected under these conditions (i.e., a dose modification factor of 1.0). Topoisomerase (topo) I and II activities and protein contents were measured in both Kl and xrs-5 cell lines and were found to be similar in magnitude. Neither exposure to radiation, to WR-1065, or to both affected these variables in xrs-5 cells. WR 1065 was effective, however, in reducing topo 11 activity by a factor of 2 in the repair-proficient Kl cell line. Topo II protein content, however, was not affected by these exposure conditions. One of several mechanisms of radiation protection attributed to aminothiol compounds has been their ability to affect enzymatic reactions involved in DNA synthesis, repair, and cell cycle progression. These results demonstrate a modifying effect by 2-[(aminopropyl)amino]ethanethiol on a specific nuclear enzyme (i.e., type H topoisomerase), which is involved in DNA synthesis. These results also suggest that differences do exist between the topo 11 enzymes isolated from the parent repair-proficient Kl and the DNA double-strand break, repair-deficient xrs-5 mutant cell lines

Preparation and Characterization of K2CO3-Activated Kraft Lignin Carbon

Directory of Open Access Journals (Sweden)

Xian-fa Li

2016-01-01

Full Text Available A series of activated carbons (ACs were prepared by K2CO3 activation from kraft lignin (KL that was recovered from papermaking black liquor. The effects of process parameters such as the activation temperature (AT, activated period, K2CO3 to KL mass ratio, and N2 flow rate on the characteristics of the final product were determined. The ACs were characterized using nitrogen adsorption, morphology, and fractal dimension analyses. The results showed that the AT was the main factor influencing the yield, surface area, and pore structure. The yield of ACs obviously decreased from 50.6% to 20.5% with increasing AT from 600 °C to 1000 °C, and decreased with increasing K2CO3/KL mass ratio. Activation time and N2 flow rate had slight effect on the yield of ACs. The surface area and total pore volume increased as the AT rose to 900 °C and then decreased with further increases in temperature. The maximum surface area and total pore volume were 1816.3 m2/g and 1.26 cm3/g, respectively, at a K2CO3 to KL mass ratio of 3:1, AT of 900 °C, activation time of 2 h, and N2 flow rate of 70 cm3/min. The pore structure of the ACs could be tailored by controlling the AT. As the AT was increased from 700 to 1000 °C, the mesoporosity increased from 11.6% to 95.9%. SEM images indicated that the morphology of ACs was modified by the AT. The K2CO3 was partially recycled.

Association Between Plasma Beta-endorphin and WOMAC Score in Female Patients with Knee Osteoarthritis

Directory of Open Access Journals (Sweden)

Hori Hariyanto

2012-08-01

Full Text Available BACKGROUND: β-endorphin plays a role in the descending pain control in the central nervous system. Central sensitization may be involved in the generating and maintenance of osteoarthritis (OA pain. However, the correlation between β-endorphin and pain severity in OA has shown conflicting results. The aim of this study was to investigate the association between plasma β-endorphin and the severity of the disease. METHODS: This study was an observational cross-sectional study carried out on 60 female subjects with knee OA who fulfilled the inclusion criteria. Plasma β-endorphin was measured by a commercial enzyme-linked immunosorbent assay (ELISA kit. Osteoarthritis knees were classified by the Kellegren-Lawrence (KL grading (1-4 criteria. The Western Ontario McMaster University Osteoarthritis (WOMAC scoring method was used to assess self-reported physical function, pain and stiffness. RESULTS: The mean of the participants' ages was 58 years old, ranging from 42 to 83 years. Overall, more than 70% of the participants were overweight with a mean of body mass index (BMI of 27.59. More than 54% of the participants were diagnosed of having KL grading 3 or 4. Plasma β-endorphin was correlated inversely with the WOMAC subscale of stiffness (r=-0.286, p=0.0311, but no correlation was noted with the WOMAC subscale of pain and physical activity. There was no significant difference of the mean of plasma β-endorphin among the KL gradings. CONCLUSIONS: Plasma β-endorphin is associated with better WOMAC total score and stiffness subscale, but not associated with KL grading of OA. KEYWORDS: knee osteoarthritis, female, β-endorphin, WOMAC, Kellgren-Lawrence.

Inhibition of topoisomerase II activity in repair-proficient CHO K1 cells by 2-[(aminopropyl)amino]ethanethiol (WR-1065)

Energy Technology Data Exchange (ETDEWEB)

Grdina, D.J.; Constantinou, A.; Shigematsu, N.

1992-09-01

The aminothiol 2-[(aminopropyl)amino]ethanethiol (WR-1065) is the active thiol of the clinically studied radioprotective agent S-2-(3-aminopropylamino) ethylphosphorothioic acid (WR-2721). WR-1065 is an effective radiation protector under in vitro conditions when it is administered 30 min prior to radiation exposure at a concentration of 4 mM to repair-proficient Chinese hamster ovary Kl cells (i.e., a dose modification factor of 1.4). In contrast, the DNA double-strand break, repair-deficient Chinese hamster ovary xrs-5 cell line is not protected under these conditions (i.e., a dose modification factor of 1.0). Topoisomerase (topo) I and II activities and protein contents were measured in both Kl and xrs-5 cell lines and were found to be similar in magnitude. Neither exposure to radiation, to WR-1065, or to both affected these variables in xrs-5 cells. WR 1065 was effective, however, in reducing topo 11 activity by a factor of 2 in the repair-proficient Kl cell line. Topo II protein content, however, was not affected by these exposure conditions. One of several mechanisms of radiation protection attributed to aminothiol compounds has been their ability to affect enzymatic reactions involved in DNA synthesis, repair, and cell cycle progression. These results demonstrate a modifying effect by 2-[(aminopropyl)amino]ethanethiol on a specific nuclear enzyme (i.e., type H topoisomerase), which is involved in DNA synthesis. These results also suggest that differences do exist between the topo 11 enzymes isolated from the parent repair-proficient Kl and the DNA double-strand break, repair-deficient xrs-5 mutant cell lines.

Radiative heat transfer in a heat generating and turbulently convecting fluid layer

International Nuclear Information System (INIS)

Cheung, F.B.; Chan, S.H.; Chawla, T.C.; Cho, D.H.

1980-01-01

The coupled problem of radiative transport and turbulent natural convection in a volumetrically heated, horizontal gray fluid medium, bounded from above by a rigid, isothermal wall and below by a rigid, adiabatic wall, is investigated analytically. An approximate method based upon the boundary layer approach is employed to obtain the dependence of heat transfer at the upper wall on the principal parameters of the problem, which, for moderate Prandtl number, are the Rayleigh number, Ra, the optical thickness, KL, and the conduction-radiation coupling parameter, N. Also obtained in this study is the behaviour of the thermal boundary layer at the upper wall. At large kL, the contribution of thermal radiation to heat transfer in the layer is found to be negligible for N > 10, moderate for N approximately 1, and overwhelming for N < 0.1. However, at small kL, thermal radiation is found to be important only for N < 0.01. While a higher level of turbulence results in a thinner boundary layer, a larger effect of radiation is found to result in a thicker one. Thus, in the presence of strong thermal radiation, a much larger value of Ra is required for the boundary layer approach to remain valid. Under severe radiation conditions, no boundary layer flow regime is found to exist even at very high Rayleigh numbers. Accordingly, the ranges of applicability of the present results are determined and the approximate method justified. In particular, the validity of the present analysis is tested in three limiting cases, ie those of kL → infinity, N → infinity, and Ra → infinity, and is further confirmed by comparison with the numerical solution (author)

GRAVITATIONAL SLINGSHOT OF YOUNG MASSIVE STARS IN ORION

Energy Technology Data Exchange (ETDEWEB)

Chatterjee, Sourav; Tan, Jonathan C., E-mail: s.chatterjee@astro.ufl.edu, E-mail: jt@astro.ufl.edu [Department of Astronomy, University of Florida, Gainesville, FL 32611 (United States)

2012-08-01

The Orion Nebula Cluster (ONC) is the nearest region of massive star formation and thus a crucial testing ground for theoretical models. Of particular interest among the ONC's {approx}1000 members are: {theta}{sup 1} Ori C, the most massive binary in the cluster with stars of masses 38 and 9 M{sub Sun }; the Becklin-Neugebauer (BN) object, a 30 km s{sup -1} runaway star of {approx}8 M{sub Sun }; and the Kleinmann-Low (KL) nebula protostar, a highly obscured, {approx}15 M{sub Sun} object still accreting gas while also driving a powerful, apparently 'explosive' outflow. The unusual behavior of BN and KL is much debated: How did BN acquire its high velocity? How is this related to massive star formation in the KL nebula? Here, we report the results of a systematic survey using {approx}10{sup 7} numerical experiments of gravitational interactions of the {theta}{sup 1}C and BN stars. We show that dynamical ejection of BN from this triple system at its observed velocity leaves behind a binary with total energy and eccentricity matching those observed for {theta}{sup 1}C. Five other observed properties of {theta}{sup 1}C are also consistent with it having ejected BN and altogether we estimate that there is only a {approx}< 10{sup -5} probability that {theta}{sup 1}C has these properties by chance. We conclude that BN was dynamically ejected from the {theta}{sup 1}C system about 4500 years ago. BN then plowed through the KL massive star-forming core within the last 1000 years causing its recently enhanced accretion and outflow activity.

THE ORION FINGERS: NEAR-IR SPECTRAL IMAGING OF AN EXPLOSIVE OUTFLOW

Energy Technology Data Exchange (ETDEWEB)

Youngblood, Allison; Bally, John [Department of Astrophysical and Planetary Sciences, University of Colorado, UCB 389, Boulder, CO 80309 (United States); Ginsburg, Adam, E-mail: allison.youngblood@colorado.edu [ESO Headquarters, Karl-Schwarzschild-Strasse 2, D-85748 Garching bei München (Germany)

2016-06-01

We present near-IR (1.1–2.4 μ m) position–position–velocity cubes of the 500 year old Orion BN/KL explosive outflow with spatial resolution 1″ and spectral resolution 86 km s{sup −1}. We construct integrated intensity maps free of continuum sources of 15 H{sub 2} and [Fe ii] lines while preserving kinematic information of individual outflow features. Included in the detected H{sub 2} lines are the 1-0 S(1) and 1-0 Q(3) transitions, allowing extinction measurements across the outflow. Additionally, we present dereddened flux ratios for over two dozen outflow features to allow for the characterization of the true excitation conditions of the BN/KL outflow. All of the ratios show the dominance of the shock excitation of the H{sub 2} emission, although some features exhibit signs of fluorescent excitation from stellar radiation or J-type shocks. We also detect tracers of the PDR/ionization front north of the Trapezium stars in [O i] and [Fe ii] and analyze other observed outflows not associated with the BN/KL outflow.

Diversity of hydraulic traits in nine Cordia species growing in tropical forests with contrasting precipitation.

Science.gov (United States)

Choat, Brendan; Sack, Lawren; Holbrook, N Michele

2007-01-01

Inter- and intraspecific variation in hydraulic traits was investigated in nine Cordia (Boraginaceae) species growing in three tropical rainforests differing in mean annual precipitation (MAP). Interspecific variation was examined for the different Cordia species found at each site, and intraspecific variation was studied in populations of the widespread species Cordia alliodora across the three sites. Strong intra- and interspecific variation were observed in vulnerability to drought-induced embolism. Species growing at drier sites were more resistant to embolism than those growing at moister sites; the same pattern was observed for populations of C. alliodora. By contrast, traits related to hydraulic capacity, including stem xylem vessel diameter, sapwood specific conductivity (K(s)) and leaf specific conductivity (K(L)), varied strongly but independently of MAP. For C. alliodora, xylem anatomy, K(s), K(L) and Huber value varied little across sites, with K(s) and K(L) being consistently high relative to other Cordia species. A constitutively high hydraulic capacity coupled with plastic or genotypic adjustment in vulnerability to embolism and leaf water relations would contribute to the ability of C. alliodora to establish and compete across a wide precipitation gradient.

Polymerization of Oriental Lacquer (Urushi with Epoxidized Linseed Oil as a New Reactive Diluent

Directory of Open Access Journals (Sweden)

Takahisa Ishimura

2015-01-01

Full Text Available A hybrid lacquer (HBL paint prepared by combining a natural kurome lacquer (KL paint and an amino silane reagent, for example, N-(2-aminoethyl-3-aminopropyl triethoxysilane (AATES, produced a polymerized film faster than the KL paint alone. However, the viscosity of the HBL paint was too viscous for easy handling. Addition of 10 wt% of an epoxidized linseed oil, ELO-6, with 6.4 mol% epoxidation as a reactive diluent to the HBL paint decreased the viscosity by 1/2 from 25476 mPa·s to 12841 mPa·s and improved the ease of coatability. The polymerization mechanism was elucidated by NMR measurements of extracts from the resulting polymerization films, suggesting that amino groups in the HBL paint reacted with epoxy groups of ELO-6 in the lacquer matrix, and then the complex reacted with double bonds of the urushiol side-chain by autooxidation and cross-linking reactions to give a hard polymerized film with a high quality of color and gloss. These results indicate that the addition of ELO-6 improved the polymerizability of both KL and HBL paints without decreasing the quality of the resulting films.

Acinetobacter baumannii isolate BAL_212 from Vietnam produces the K57 capsular polysaccharide containing a rarely occurring amino sugar N-acetylviosamine.

Science.gov (United States)

Kenyon, Johanna J; Kasimova, Anastasiya A; Shashkov, Alexander S; Hall, Ruth M; Knirel, Yuriy A

2018-02-01

The structures of capsular polysaccharides (CPSs) produced by different Acinetobacter baumannii strains have proven to be invaluable in confirming the role of specific genes in the synthesis of rare sugars through the correlation of genetic content at the CPS biosynthesis locus with sugars found in corresponding CPS structures. A module of four genes (rmlA, rmlB, vioA and vioB) was identified in the KL57 capsule biosynthesis gene cluster of A. baumannii isolate BAL_212 from Vietnam. These genes were predicted to direct the synthesis of 4-acetamido-4,6-dideoxy-d-glucose (N-acetylviosamine, d-Qui4NAc) and the K57 CPS was found to contain this monosaccharide. The K57 structure was determined and, in addition to d-Qui4NAc, included three N-acetylgalactosamine residues in the main chain, with a single glucose side branch. The KL57 gene cluster has not been found in any other A. baumannii genomes, but the rmlA-rmlB-vioA-vioB module is present in the KL119 gene cluster that would likely produce a d-Qui4NAc-containing CPS.

Polarization of far-infrared radiation from molecular clouds

Science.gov (United States)

Novak, G.; Gonatas, D. P.; Hildebrand, R. H.; Platt, S. R.; Dragovan, M.

1989-01-01

The paper reports measurements of the polarization of far-infrared emission from dust in nine molecular clouds. Detections were obtained in Mon R2, in the Kleinmann-Low (KL) nebula in Orion, and in Sgr A. Upper limits were set for six other clouds. A comparison of the 100 micron polarization of KL with that previously measured at 270 microns provides new evidence that the polarization is due to emission from magnetically aligned dust grains. Comparing the results for Orion with measurements at optical wavelengths, it is inferred that the magnetic field direction in the outer parts of the Orion cloud is the same as that in the dense core. This direction is nearly perpendicular to the ridge of molecular emission and is parallel to both the molecular outflow in KL and the axis of rotation of the cloud core. In Mon R2, the field direction which the measurements imply does not agree withthat derived from 0.9-2.2 micron polarimetry. The discrepancy is attributed to scattering in the near-infrared. In Orion and Sgr A, where comparisons are possible, the measurements are in good agreement with 10 micron polarization measurements.

Interim Research Performance Report (Contract N00014-11-1-0752, The University of Mississippi)

Science.gov (United States)

2013-06-18

CONSIDERED • let Nozzle - CiHiic Section Convecging-Diveigiog Nozzle: Design Mach, Alj = 1.74. - Exil Diamcler. I), - 5II.X nun • Pressure Matched...waveform analysis (wavelet based) to study spectral properties a tl •;■ " i 0. ,\\IK",V"is||<s \\£j-r+ru^^ SlUOXK kl NIMM: E3ÜÜ3«. UKC Annual Rait...R.lii« R|! 74 CATALOG OF RUN CONDITIONS l- «(MiHiiivpi -V /- AU",V’».^1K’> t4-. vT.: T,r^4j>- 201» (INK kl Nun « ki’duiluNi IIRC AIUHMI Hii\\i«w

Whitefly population dynamics in okra plantations Dinâmica populacional de mosca-branca em quiabo

Directory of Open Access Journals (Sweden)

Germano Leão Demolin Leite

2005-01-01

Full Text Available The control of whitefly Bemisia tabaci (Gennadius biotype B (Hemiptera: Aleyrodidae on okra (Abelmoschus esculentus L. consists primarily in the use of insecticides, due to the lack of information on other mortality factors. The objective of this study was to evaluate the spatial and temporal population dynamics of the whitefly B. tabaci biotype B on two successive A. esculentus var. "Santa Cruz" plantations. Leaf chemical composition, leaf nitrogen and potassium contents, trichome density, canopy height, plant age, predators, parasitoids, total rainfall and median temperature were evaluated and their relationships with whitefly on okra were determined. Monthly number estimates of whitefly adults, nymphs (visual inspection and eggs (magnifying lens occurred on bottom, middle and apical parts of 30 plants/plantation (one leaf/plant. Plants senescence and natural enemies, mainly Encarsia sp., Chrysoperla spp. and Coccinellidae, were some of the factors that most contributed to whitefly reduction. The second okra plantation, 50 m apart from the first, was strongly attacked by whitefly, probably because of the insect migration from the first to the second plantation. No significant effects of the plant canopy on whitefly eggs and adults distribution were found. A higher number of whitefly nymphs was found on the medium part than on the bottom part.O controle da mosca-branca Bemisia tabaci (Gennadius biótipo B (Hemiptera: Aleyrodidae em quiabeiro (Abelmoschus esculentus L. consiste principalmente no uso de inseticidas, em virtude da falta de informação sobre outros fatores de mortalidade. O objetivo deste trabalho foi compreender a dinâmica populacional, espacial e temporal da mosca-branca em dois cultivos sucessivos de quiabeiro "Santa Cruz". Avaliaram-se a composição química foliar, os níveis foliares de nitrogênio e de potássio, a densidade de tricomas, a altura de dossel, a idade de planta, predadores, parasitóides, pluviosidade total

Clinical Impact and Relevance of Antiganglioside Antibodies Test Results / Antigangliozīdu Antivielu Testa Rezultātu Klīniskā Ietekme un Nozīme Pacientam

Directory of Open Access Journals (Sweden)

Ķēniņa Viktorija

2015-09-01

Full Text Available Visbiežāk atrastās autoantivielas asociācijā ar perifērām neiropātijām ir pret gangliozīdiem GM1, GQ1b, asialo-GM1, GM2, GD1a un GD1b. Atzīta diagnostiska vērtība ir divām no tām - anti-GM1 un anti-GQ1b. Tika veikts retrospektīvs pētījums ar mērķi izvērtēt antigangliozīdu antivielu noteikšanas nozīmi pacientiem ar iespējamu autoimūnu neiropātiju. Pētījumā tika iekļauti 85 pacienti, kuri bija stacionēti Paula Stradiņa Klīniskajā universitātes slimnīcā laika posmā no 2013. gada janvāra līdz 2014. gada decembrim un kuru perifērajās asinīs tika noteiktas antigangliozīdu antivielas. Tika reģistrēti un analizēti arī pacientu demogrāfiskie dati, iepriekšējas un esošas saslimšanas, paraklīnisko izmeklējumu dati, t.sk. cerebrospinālā šķidruma atradne un elektrofizioloģiskās izmeklēšanas rezultāti. Mūsu pētījumā 27 pacienti (32% bija seropozitīvi attiecībā vismaz uz vienu no antigangliozīdu grupas antivielām. Visbiežāk atrastās antivielas bija pret asialo-GM1 (n = 13 un GM1 (n = 10 gangliozīdiem. Astoņu pacientu diagnozes sakrita ar slimībām, kur antigangliozīdu antivielām ir atzīta diagnostiska marķiera vērtība: pieciem pacientiem - Gijēna-Barē sindroms (GBS, vienam pacientam - Millera-Fišera sindroms (MFS, diviem pacientiem - multifokāla motora neiropātija (MMN. Trīs no pieciem pacientiem, kuriem bija diagnosticēts GBS, un viens no diviem pacientiem, kuriem bija diagnosticēta MMN, bija seronegatīvi. Akūta slimības gaita, pozitīvas antigangliozīdu antivielas un citoalbumināra disasociācija cerebrospinālajā šķidrumā bija faktori, kas noteica pacientam nepieciešamu specifisku imūnterapiju. Mūsu pētījuma rezultāti atbilst iepriekš aprakstītām novērotām asociācijam starp antigangliozīdu grupas antivielām un GBS, MFS un MMN.

Differentiating inflamed and normal lungs by the apparent reaction rate constants of lactate dehydrogenase probed by hyperpolarized (13)C labeled pyruvate.

Science.gov (United States)

Xu, He N; Kadlececk, Stephen; Shaghaghi, Hoora; Zhao, Huaqing; Profka, Harilla; Pourfathi, Mehrdad; Rizi, Rahim; Li, Lin Z

2016-02-01

Clinically translatable hyperpolarized (HP) (13)C-NMR can probe in vivo enzymatic reactions, e.g., lactate dehydrogenase (LDH)-catalyzed reaction by injecting HP (13)C-pyruvate into the subject, which is converted to (13)C labeled lactate by the enzyme. Parameters such as (13)C-lactate signals and lactate-to-pyruvate signal ratio are commonly used for analyzing the HP (13)C-NMR data. However, the biochemical/biological meaning of these parameters remains either unclear or dependent on experimental settings. It is preferable to quantify the reaction rate constants with a clearer physical meaning. Here we report the extraction of the kinetic parameters of the LDH reaction from HP (13)C-NMR data and investigate if they can be potential predictors of lung inflammation. Male Sprague-Dawley rats (12 controls, 14 treated) were used. One dose of bleomycin (2.5 U/kg) was administered intratracheally to the treatment group. The lungs were removed, perfused, and observed by the HP-NMR technique, where a HyperSense dynamic nuclear polarization system was used to generate the HP (13)C-pyruvate for injecting into the lungs. A 20 mm (1)H/(13)C dual-tuned coil in a 9.4-T Varian vertical bore NMR spectrometer was employed to acquire the (13)C spectral data every 1 s over a time period of 300 s using a non-selective, 15-degree radiofrequency pulse. The apparent rate constants of the LDH reaction and their ratio were quantified by applying ratiometric fitting analysis to the time series data of (13)C labeled pyruvate and lactate. The apparent forward rate constant kp =(3.67±3.31)×10(-4) s(-1), reverse rate constant kl =(4.95±2.90)×10(-2) s(-1), rate constant ratio kp /kl =(7.53±5.75)×10(-3) for the control lungs; kp =(11.71±4.35)×10(-4) s(-1), kl =(9.89±3.89)×10(-2) s(-1), and kp /kl =(12.39±4.18)×10(-3) for the inflamed lungs at the 7(th) day post treatment. Wilcoxon rank-sum test showed that the medians of these kinetic parameters of the 7-day cohort were significantly

Klõps ja topeltklõps / Ahto Külvet

Index Scriptorium Estoniae

Külvet, Ahto

2006-01-01

Fotonäitusest "Click doubleclick - the documentary factor" Müncheni Kunsthalles 08.02-23.04 2006 ja 21.06-27.08 2006 Brüsselis, mis sümboliseerib üleminekuperioodi fotograafias - analoogtehnikalt digitaalsele. Näituse kuraatoriks on Thomas Wesk. Lisatud lühiintervjuud fotograafidega, näitamaks nende suhtumist fakti ja lavastuse vahekorda fotograafias

What are the anti-particles of KL,S

International Nuclear Information System (INIS)

Mathur, V.S.; Rajeev, S.G.

1991-01-01

The authors study the consequences of an anti-unitary symmetry such as CPT for an unstable quantum system described by a non-self-adjoint Hamiltonian. In this paper it is shown that CPT invariance by itself does not imply that every particle has an anti-particle of equal mass and life-time. In particular, the neutral kaons K L and K S do not have anti-particles even when CPT is conserved

Alpha Matting with KL-Divergence Based Sparse Sampling.

Science.gov (United States)

Karacan, Levent; Erdem, Aykut; Erdem, Erkut

2017-06-22

In this paper, we present a new sampling-based alpha matting approach for the accurate estimation of foreground and background layers of an image. Previous sampling-based methods typically rely on certain heuristics in collecting representative samples from known regions, and thus their performance deteriorates if the underlying assumptions are not satisfied. To alleviate this, we take an entirely new approach and formulate sampling as a sparse subset selection problem where we propose to pick a small set of candidate samples that best explains the unknown pixels. Moreover, we describe a new dissimilarity measure for comparing two samples which is based on KLdivergence between the distributions of features extracted in the vicinity of the samples. The proposed framework is general and could be easily extended to video matting by additionally taking temporal information into account in the sampling process. Evaluation on standard benchmark datasets for image and video matting demonstrates that our approach provides more accurate results compared to the state-of-the-art methods.

Osmanlı Dönemi Başlıklı Ortakent Mezar Taşları Ottoman Period Headed Gravestones of Ortakent

Directory of Open Access Journals (Sweden)

H.Kamil BİÇİCİ

2012-12-01

Full Text Available This concerns, “Ortakent Gravestones.”. Among the cemetery of Ortakent, The dates of the gravestones are between 18.th-20.th centuries and 20 samples of 30 are from 18.th. century, 9 are from 19.th., 1 is from 20.th. century. Gravestones were of marble. The lenghts of the stones are between 140 cm.-45 cm., their widths are between 36 cm.-14 cm., their thicknesses are between 14 cm.-3.5 cm. Most of the samples are in rectangular and shapes and some are rectangular-prizmal. 3 of them have Foot gravestones. 30 head gravestones have large wadded turban (kavuk, turban (sarık, fez (fes and kerchief. All of the gravestones have inscriptions. 5 of them are without inscriptions. Inscriptions on 3 samples were laid diagonal, and 27 of them were laid in a linear system, 30 of head ve foot gravesones are in good condition. 3 samples are broken. 19 of 30 gravestones are men’s and 11 are of women’s. While scarping was used for making gravestones are scarping, and painting were used as the maindecoration tecnique is seen on foot stone with the painting technique,inscriptions of stones were coloured. Most of the inscriptions anddecorations are relieved. Decoration subjects seen on gravestones arephytomorphic, geometric, objective and calligraphic. “Osmanlı Dönemi Başlıklı Ortakent Mezar Taşları” konulu bu incelemede Ortakent Mezarlığında bulunan 30 mezar taşı araştırılarak, çalışmamızda yer almıştır. Mezar taşlarında tarihi bilinen bütün örnekler XVII. yy. ikinci çeyreği ile XX. yy. ilk çeyreği arasındadır. 30 örnekten 20 tanesi XVIII. yy., 9 tanesi XIX. yy., 1 tanesi XX. yy.dır. Mezar taşlarının hepsi mermer malzemeden yapılmıştır. Mezar taşlarının büyükten küçüğe doğru boyları 140 cm. ile 45 cm., genişlikleri 36 cm. ile 14 cm., kalınlıkları ise 14 ile 3.5 cm. arasında değişmektedir. Ortakent’te bulunan mezar taşları şahideli tiptedir. Örneklerin çoğu dikdörtgen gövdelidir. 3

Measurements of Branching Fractions, Rate Asymmetries, and Angular Distributions in the Rare Decays B -> Kl+l- and B -> K*l+ l-

Energy Technology Data Exchange (ETDEWEB)

Aubert, B.

2006-04-07

We present measurements of the flavor-changing neutral current decays B {yields} K{ell}{sup +}{ell}{sup -} and B {yields} K*{ell}{sup +}{ell}{sup -}, where {ell}{sup +}{ell}{sup -} is either an e{sup +}e{sup -} or {mu}{sup +}{mu}{sup -} pair. The data sample comprises 229 x 10{sup 6} {Upsilon}(4S) {yields} B{bar B} decays collected with the BABAR detector at the PEP-II e{sup +}e{sup -} storage ring. Flavor-changing neutral current decays are highly suppressed in the Standard Model and their predicted properties could be significantly modified by new physics at the electroweak scale. We measure the branching fractions {Beta}(B {yields} K{ell}{sup +}{ell}{sup -}) = (0.34 {+-} 0.07 {+-} 0.02) x 10{sup -6}, {Beta}(B {yields} K*{ell}{sup +}{ell}{sup -}) = (0.78{sub -0.17}{sup +0.19} {+-} 0.11) x 10{sup -6}, the direct CP asymmetries of these decays, and the relative abundances of decays to electrons and muons. For two regions in {ell}{sup +}{ell}{sup -} mass, above and below m{sub J/{psi}}, we measure partial branching fractions and the forward-backward angular asymmetry of the lepton pair. In these same regions we also measure the K* longitudinal polarization in B {yields} K*{ell}{sup +}{ell}{sup -} decays. Upper limits are obtained for the lepton flavor-violating decays B {yields} Ke{mu} and B {yields} K*e{mu}. All measurements are consistent with Standard Model expectations.

Analysis of heterosis and quantitative trait loci for kernel shape related traits using triple testcross population in maize.

Directory of Open Access Journals (Sweden)

Lu Jiang

Full Text Available Kernel shape related traits (KSRTs have been shown to have important influences on grain yield. The previous studies that emphasize kernel length (KL and kernel width (KW lack a comprehensive evaluation of characters affecting kernel shape. In this study, materials of the basic generations (B73, Mo17, and B73 × Mo17, 82 intermated B73 × Mo17 (IBM individuals, and the corresponding triple testcross (TTC populations were used to evaluate heterosis, investigate correlations, and characterize the quantitative trait loci (QTL for six KSRTs: KL, KW, length to width ratio (LWR, perimeter length (PL, kernel area (KA, and circularity (CS. The results showed that the mid-parent heterosis (MPH for most of the KSRTs was moderate. The performance of KL, KW, PL, and KA exhibited significant positive correlation with heterozygosity but their Pearson's R values were low. Among KSRTs, the strongest significant correlation was found between PL and KA with R values was up to 0.964. In addition, KW, PL, KA, and CS were shown to be significant positive correlation with 100-kernel weight (HKW. 28 QTLs were detected for KSRTs in which nine were augmented additive, 13 were augmented dominant, and six were dominance × additive epistatic. The contribution of a single QTL to total phenotypic variation ranged from 2.1% to 32.9%. Furthermore, 19 additive × additive digenic epistatic interactions were detected for all KSRTs with the highest total R2 for KW (78.8%, and nine dominance × dominance digenic epistatic interactions detected for KL, LWR, and CS with the highest total R2 (55.3%. Among significant digenic interactions, most occurred between genomic regions not mapped with main-effect QTLs. These findings display the complexity of the genetic basis for KSRTs and enhance our understanding on heterosis of KSRTs from the quantitative genetic perspective.

The Effect of Glucosamine and/or Chondroitin Sulfate on the Progression of Knee Osteoarthritis: A GAIT Report

Science.gov (United States)

Sawitzke, Allen D; Shi, Helen; Finco, Martha; Dunlop, Dorothy D; Bingham, Clifton O; Harris, Crystal L; Singer, Nora G; Bradley, John D; Silver, David; Jackson, Christopher G; Lane, Nancy E; Oddis, Chester V; Wolfe, Fred; Lisse, Jeffrey; Furst, Daniel E; Reda, Domenic J; Moskowitz, Roland W; Williams, H James; Clegg, Daniel O

2010-01-01

Objective Osteoarthritis of the knee causes significant morbidity and current medical treatment is limited to symptom relief, as therapies able to slow structural damage remain elusive. This study sought to evaluate the effect of glucosamine hydrochloride (glucosamine, G), sodium chondroitin sulfate (chondroitin sulfate, CS) (alone and in combination), celecoxib and placebo on progressive loss of joint space width (JSW). Methods A double-blind twenty-four month placebo-controlled study conducted at nine sites in the United States enrolled 572 participants from Glucosamine/chondroitin Arthritis Intervention Trial (GAIT) who satisfied radiographic criteria (Kellgren and Lawrence (K&L) Grade 2 or 3 changes and JSW of at least 2mm at baseline). Persons with primarily lateral compartment narrowing at any time point were excluded. Patients continued G 500mg three times daily, CS 400mg three times daily, the combination, celecoxib 200mg daily or placebo as randomized for GAIT. Minimum medial tibiofemoral JSW was measured at baseline, 12 and 24 months. The primary outcome measure was JSW change from baseline. Results The average JSW loss at 2 years for placebo, adjusted for design and clinical factors, was 0.16mm. No statistically significant difference for any treatment group compared to the placebo group was observed. Treatment effects for K&L Grade 2 knees, but not K&L Grade 3 knees showed a trend toward improvement relative to placebo. The study’s power was diminished by sample size, variance of JSW measurement and a smaller than expected loss in JSW. Conclusions At two years, no treatment achieved a predefined clinically important difference in JSW loss compared to placebo. However, patients with K&L Grade 2 osteoarthritis appear to have the greatest potential for modification by these treatments (ClinicalTrials.gov number, NCT00032890). PMID:18821708

Chlamydia trachomatis Frequency in a Cohort of HPV-Infected Colombian Women.

Directory of Open Access Journals (Sweden)

Edith Margarita Quinónez-Calvache

Full Text Available Chlamydia trachomatis (C. trachomatis, an obligate intracellular bacterium, is the commonest infectious bacterial agent of sexual transmission throughout the world. It has been shown that the presence of this bacteria in the cervix represents a risk regarding HPV persistence and, thereafter, in developing cervical cancer (CC. Prevalence rates may vary from 2% to 17% in asymptomatic females, depending on the population being analysed. This study reports the identification of C. trachomatis in a cohort of 219 HPV-infected Colombian females.C. trachomatis infection frequency was determined during each of the study's follow-up visits; it was detected by amplifying the cryptic plasmid sequence by polymerase chain reaction (PCR using two sets of primers: KL5/KL6 and KL1/KL2. Infection was defined as a positive PCR result using either set of primers at any time during the study. Cox proportional risk models were used for evaluating the association between the appearance of infection and a group of independent variables.Base line C. trachomatis infection frequency was 28% (n = 61. Most females infected by C. trachomatis were infected by multiple types of HPV (77.42%, greater prevalence occurring in females infected with HPV-16 (19.18%, followed by HPV-58 (17.81%. It was observed that females having had the most sexual partners (HR = 6.44: 1.59-26.05 95%CI or infection with multiple types of HPV (HR = 2.85: 1.22-6.63 95%CI had the greatest risk of developing C. trachomatis.The study provides data regarding the epidemiology of C. trachomatis /HPV coinfection in different population groups of Colombian females and contributes towards understanding the natural history of C. trachomatis infection.

β-Klotho as a Negative Regulator of the Peptide Transporters PEPT1 and PEPT2

Directory of Open Access Journals (Sweden)

Abeer Abousaab

2016-12-01

Full Text Available Background/Aims: β-Klotho, a transmembrane protein expressed in several tissues including the brain and the kidney, is critically important for inhibition of 1,25(OH2D3 formation by FGF23. The extracellular domain of Klotho protein could be cleaved off, thus being released into blood or cerebrospinal fluid. Soluble klotho is a β-glucuronidase participating in the regulation of several ion channels and carriers. The present study explored the effect of β-Klotho protein on the peptide transporters PEPT1 and PEPT2. Methods: cRNA encoding PEPT1 or PEPT2 was injected into Xenopus laevis oocytes and glycine-glycine (2 mM-induced inward current (IGly taken as measure of glycine-glycine transport. Measurements were made without or with prior 24 h treatment with soluble β-Klotho protein (30 ng/ml in the absence and presence of β-glucuronidase inhibitor D-saccharic acid 1,4-lactone monohydrate (DSAL,10 µM. Ussing chamber experiments were employed to determine electrogenic peptide transport across intestinal epithelia of klotho deficient (kl-/- and corresponding wild type (kl+/+ mice. Results: IGly was observed in PEPT1 and in PEPT2 expressing oocytes but not in water injected oocytes. In both, PEPT1 and PEPT2 expressing oocytes IGly was significantly decreased by treatment with soluble β-Klotho protein. As shown for PEPT1, β-klotho protein decreased significantly the maximal transport rate without significantly modifying the affinity of the carrier. The effect of β-Klotho on PEPT1 was reversed by DSAL. Intestinal IGly was significantly larger in kl-/- than in kl+/+ mice. Conclusion: β-Klotho participates in the regulation of the peptide transporters PEPT1 and PEPT2.

Methanol fractionations of Catha edulis Frosk (Celastraceae) contracted Lewis rat aorta in vitro: a comparison between crimson and green leaves.

Science.gov (United States)

Mahmood, Samira Abdulla; Pavlovic, Dragan; Hoffmann, Ulrich

2009-05-07

The study investigated the effect of methanol extract and its fractionations obtained from Yemeni khat on the smooth muscle isometric tension in Lewis rat aortal ring preparations and compared the effects of the crimson and green leaves. Khat leaves were sorted into green (khat Light; KL) and crimson (khat Dark; KD) leaves, extracted with methanol, followed with solvent-solvent extraction (benzene, chloroform and ethylacetate). The contractile activity of the fractions was tested using aortal ring preparations. The control (phenylepherine contraction) methanol extracts contracted aortas at concentrations 250, 125 and 67.5 microg/ml buffer by 80.2%, 57.3%, 26.4% and 81.5%, 65.6%, 24.6% for KL and KD, respectively. Fractions of benzene (BF) and ethylacetate (EaF) contracted the aorta with 2 microgm, whereas, chloroform (ChF) with 1 microgm/1 ml buffer was less potent. The shape of contraction curve produced by EaF differed from that of ChF and BF of both (KL and KD). The EaF induced-contraction peaked after 3.3 +/- 0.94 mins, whereas those of BF and CHF peaked after 18.0 +/- 2.2, 19.7 +/- 0.94 mins, respectively. Pre-incubation with nifedipine (10(-6) M) insignificantly reduced the contraction induced by all fractionations, but prazosin (10(-6) M) reduced the contraction by 81.9%, 63.1%, 71.8% with p = 0.23, 0.09, 0.15 for BF, ChF and EaF of KL, respectively. It significantly reduced contraction of ChF, 64.1%; p = 0.02, and of EaF, 73.5%; p = 0.04 of KD, while the reduction in contraction of BF was 63.1%; p = 0.06. In conclusion, fractions of green and crimson Yemeni khat leaves contracted aortas of Lewis rats. Both leaves behave almost similarly. Contraction induced by chloroform fraction produced alpha-sympathetic activity.

Penicillium sp. strain that efficiently adsorbs lignosulfonate in the presence of sulfate ion.

Science.gov (United States)

Aoyama, Akihisa; Kurane, Ryuichiro; Nagai, Kazuo

2013-03-01

Lignin is one of the major water insoluble substances that support the physical properties of plants and can be solubilized by sulfite or alkaline treatment in accordance with pulpification. The lignin derivatives produced by both the sulfite and the kraft processes are called lignosulfonate (LS) and kraft lignin (KL), respectively, and both derivatives show a broad spectrum of optical absorbance from ultraviolet to visible light. When the spore suspension of an isolated Penicillium sp., Penicillium sp. A, was inoculated to a medium containing 0.1% commercial LS, absorbance at 480 nm (A480) almost completely disappeared after 5 days of cultivation. Maximum decolorization of the culture broth was observed when the microbe was cultured in the 0.8% LS medium reaching 88%, and the amount of LS removed was calculated to be 7 g/L. In a similar assay with the dark-liquid containing KL, 80% of the A480 of a 20% (v/v) dark-liquid medium disappeared after 5 days of culturing and the amount of KL removed was calculated to be 2.9 g/L. These values significantly exceeded the previously reported amounts with respect to substrate concentration and decolorization. Furthermore, since similar results were obtained in the cases of both LS and KL, it is expected that the present strain is able to non-specifically adsorb a wide range of lignin derivatives, because most of the colored substances were recovered in the culture sediments. Thus, the strain can be used to clean up waste fluids containing water soluble lignin derivatives, adsorb lignin derivatives in waste fluids before dehydration. Copyright © 2012 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

S-36: Aynı Kronolojik Yaştaki Erkek Futbolcuların Antropometrik ve Performans Değişimleri

Directory of Open Access Journals (Sweden)

Mustafa Şahi̇n

2017-03-01

Full Text Available GİRİŞ: Adolesan dönemde özellikle büyüme ve maturasyonda belirgin farklılıklar meydana gelmektedir. Aynı kronolojik yaş grubundaki erkeklerde biyolojik maturasyon çeşitliliği sporcularda kas gücünü, dayanıklılığı, hızı, performansı etkilemektedir. Bu etkinin gösterilebilmesi, ölçülebilmesi için minimum-maksimum ne kadar zamana ihtiyaç olduğu net değildir.AMAÇ: Aynı kronolojik yaş grubunda orta ergenlik döneminde olan erkek futbolcularda belirli bir zaman süresinde biyolojik maturasyonlarındaki değişiklilikleri ve performans sonuçlarına etkisini göstermektir.Gereç ve YÖNTEMLER: 2003 doğumlu milli takım seçmelerine davet edilen 169 erkek futbol oyuncusunun 2016 10.ay ve 2017 1.ay antropometrik ölçümlerinin değişimlerini, fizik performans test çeviklik, dayanıklık, sürat, dikey sıçrama sonuçları ile karşılaştırdık. Gruplar arası farklılıkların saptanmasında paired-samples t-test kullanıldı. P0,05. Akademi lig futbolcularında çeviklik (p<0,01, sürat 10m süre azalışı ve dayanıklılıkta artış (p<0,05 düzeyindeydi. Amatör lig sporcularında ise çeviklik ve dayanıklılıkta artış, sürat 10m, 20m, 30m.de süre azalışı (p<0,01 saptandı. Kalecilerde çeviklik ve dayanıklılık artışı (p<0,01, defans oyuncularında boy, kilo, çeviklik ve dayanıklılık artışı (p<0,01 düzeyinde, orta saha oyuncularında boy, çeviklik artışı (p<0,01, sürat 10 ve 30m süre azalışı (p<0,05, forvet oyuncularında ise sadece çeviklik parametresinde artış (p<0,01 gözlemlendi.SONUÇ: U-14 yaş kategorisinde mücadele eden futbolcuların dört aylık dönem içerisinde atletik performans göstergelerinin olumlu yönde geliştiği saptandı. Adolesan dönemde aynı kronolojik yaş grubundaki futbolcularda erken maturasyon kas gücü, dayanıklılık, performans ve yeteneğin geliştirilmesinde avantajdır. Fiziksel değişimin performansa kısa sürede ve doğru yans

Determination of sorption of seventy five pharmaceuticals in sewage sludge

DEFF Research Database (Denmark)

Hörsing, Maritha; Ledin, Anna; Grabic, Roman

2011-01-01

concentrations to water containing 1 g of sludge. The range of APIs concentrations was between ng L1 to mg L1 which are found in the wastewater effluents. Isotherms were obtained for approximately 45 of the APIs, providing distribution coefficients for linear (Kd), Freundlich (Kf) and Langmuir (KL) isotherms. Kd......, Kf and KL ranging between 7.1 104 and 3.8 107, 1.1 102 and 6.1 104 and 9.2 103 and 1.1 L kg1, respectively. The obtained coefficients were applied to estimate the fraction of APIs in the water phase (see Abstract Graphic). For 37 of the 75 APIs, the predicted presence in the liquid phase...

Værsgo' ta' en tablet. Om brugen af tablets i dansk

DEFF Research Database (Denmark)

Lorentzen, Rasmus Fink

2014-01-01

Hvordan kan vi udvikle elevernes faglighed ved hjælp af it? Hvad er det i det hele taget vigtigt at lære i en tidssvarende folkeskole, så eleverne bliver klædt på til fremtidens samfund? Og kan iPads bruges til dette? Dette kapitel handler om fagdidaktik og tablets i undervisningen.......Hvordan kan vi udvikle elevernes faglighed ved hjælp af it? Hvad er det i det hele taget vigtigt at lære i en tidssvarende folkeskole, så eleverne bliver klædt på til fremtidens samfund? Og kan iPads bruges til dette? Dette kapitel handler om fagdidaktik og tablets i undervisningen....

Influence of velocity shear on the Rayleigh-Taylor instability

International Nuclear Information System (INIS)

Guzdar, P.N.; Satyanarayana, P.; Huba, J.D.; Ossakow, S.L.

1982-01-01

The influence of a transverse velocity shear on the Rayleigh-Taylor instability is investigated. It is found that a sheared velocity flow can substantially reduce the growth rate of the Rayleigh-Taylor instability in short wavelength regime (i.e., kL>1 where L is the scale length of the density inhomogeneity), and causes the growth rate to maximize at kL<1.0. Applications of this result to ionospheric phenomena [equatorial spread F (ESF) and ionospheric plasma clouds] are discussed. In particular, the effect of shear could account for, at times, the 100's of km modulation observed on the bottomside of the ESF ionosphere and the km scale size wavelengths observed in barium cloud prompt striation phenomena