WorldWideScience

Sample records for pelophylax kl esculentus

  1. First case report on pathogenic fungus Fonsecaea sp. Negroni from skin of Pelophylax kl. esculentus L. in Serbia

    Directory of Open Access Journals (Sweden)

    Stupar Miloš Č.

    2017-01-01

    Full Text Available Non-harmful adhesive tape method was applied directly on the skin surface of edible frog (Pelophylax kl. esculentus, captured in vernal ponds on the locality “Stevanove ravnice” within the Special Nature Reserve „Deliblatska peščara“, in order to detect fungal dwellers of frogs’ skin. Light microscopy analyses of Lactophenol Cotton Blue mounted adhesive tape samples taken from frog’s ventrum revealed the presence of melanized septate hyphae, branched conidiophores with chains of single-celled ovoid conidia, arising directly from the skin, which corresponds to morphological features of dematiaceous hyphomycete - Fonsecaea sp. Since members of genus Fonsecaea are frequently cited as causative agents of chromomycosis in amphibians, as well as human phaeohyphomycosis, world­wide, it is of great significance to study the presence of this fungal pathogen on amphibians in Serbia in order to make the basic reference data of the incidence of these pathogens in this region. [Project of the Serbian Ministry of Education, Science and Technological Development, Grant no. 173032

  2. Genomic Sequencing of Ranaviruses Isolated from Edible Frogs (Pelophylax esculentus)

    DEFF Research Database (Denmark)

    Ariel, Ellen; Subramaniam, Kuttichantran; Imnoi, Kamonchai

    2017-01-01

    Ranaviruses were isolated from wild edible frogs (Pelophylax esculentus) during epizootics in Denmark and Italy. Phylogenomic analyses revealed that these isolates are closely related and belong to a clade of ranaviruses that includes the Andrias davidianus ranavirus (ADRV), common midwife toad r...

  3. Pecular Features of Hematopoiesis in the Liver of Mature and Immature Green Frogs (Pelophylax Esculentus Complex

    Directory of Open Access Journals (Sweden)

    Akulenko N. M.

    2016-12-01

    Full Text Available The article describes characteristic features of the hematopoiesis in mature and immature green frogs (Pelophylax esculentus complex. Quantitative differences in liver myelograms were insignificant. However, in a sample of mature animals numerous significant correlations between the number of pigment inclusions in the liver and indicators of erythropoiesis and myelopoiesis were observed. Those correlations were absent in the immature frogs. We concluded that aft er the frogs’ breeding a lack of plastic resources, in particular, hemosiderin remains up to the hibernation.

  4. Variability of Structural and Biomechanical Parameters of Pelophylax Esculentus (Amphibia, Anura Limb Bones

    Directory of Open Access Journals (Sweden)

    Broshko Ye. O.

    2014-07-01

    Full Text Available Variability of Structural and Biomechanical Prameters of Pelophylax esculentus (Amphibia, Anura Limb Bones. Broshko Ye. O. — Structural and biomechanical parameters of Edible Frog, Pelophylax esculentus (Linnaeus, 1758, limb bones, namely, mass, linear dimensions, parameters of the shaft’s cross-sectional shape (cross-sectional area, moments of inertia, radiuses of inertia were investigated. Some coefficients were also estimated: diameters ratio (df/ds, cross-sectional index (ik, principal moments of inertia ratio (Imax/Imin.. Coefficients of variation of linear dimensions (11.9-20.0 % anrelative bone mass (22-35 % were established. Moments of inertia of various bones are more variable (CV = 41.67-56.35 % in relation to radii of inertia (CV = 9.68-14.67 %. Shaft’s cross-sectional shape is invariable in all cases. However, there is high individual variability of structural and biomechanical parameters of P. esculentus limb bones. Variability of parameters was limited by the certain range. We suggest the presence of stable norm in bone structure. Stylopodium bones have the primary biomechanical function among the elements of limb skeleton, because their parameters most clearly responsive to changes in body mass.

  5. Identification of parental chromosomes in hybridogenetic water frog Pelophylax esculentus (Rana esculenta) by genomic in situ hybridization (GISH)

    Czech Academy of Sciences Publication Activity Database

    Zalésna, A.; Choleva, Lukáš; Ogielska, M.; Rábová, Marie; Marec, František; Ráb, Petr

    2010-01-01

    Roč. 18, č. 16 (2010), s. 754-755 ISSN 0967-3849. [19th International Colloquium on animal cytogenetics and gene mapping. 06.06.-09.06.2010, Krakow] Institutional research plan: CEZ:AV0Z50450515; CEZ:AV0Z50070508 Keywords : parental chromosomes * Pelophylax esculentus * hybridization Subject RIV: EB - Genetics ; Molecular Biology

  6. Ranavirus in wild edible frogs Pelophylax kl. esculentus in Denmark

    DEFF Research Database (Denmark)

    Ariel, Ellen; Kielgast, Jos; Svart, Hans Erik

    2009-01-01

    interviewed by phone and 10 cases were examined on suspicion of diseaseinduced mortality. All samples were negative for Bd. Ranavirus was isolated from 2 samples of recently dead frogs collected during a mass mortality event in an artificial pond near Slagelse, Denmark. The identity of the virus was confirmed...

  7. Cytological maps of lampbrush chromosomes of European water frogs (Pelophylax esculentus complex) from the Eastern Ukraine

    Science.gov (United States)

    2013-01-01

    Background Hybridogenesis (hemiclonal inheritance) is a kind of clonal reproduction in which hybrids between parental species are reproduced by crossing with one of the parental species. European water frogs (Pelophylax esculentus complex) represent an appropriate model for studying interspecies hybridization, processes of hemiclonal inheritance and polyploidization. P. esculentus complex consists of two parental species, P. ridibundus (the lake frog) and P. lessonae (the pool frog), and their hybridogenetic hybrid – P. esculentus (the edible frog). Parental and hybrid frogs can reproduce syntopically and form hemiclonal population systems. For studying mechanisms underlying the maintenance of water frog population systems it is required to characterize the karyotypes transmitted in gametes of parental and different hybrid animals of both sexes. Results In order to obtain an instrument for characterization of oocyte karyotypes in hybrid female frogs, we constructed cytological maps of lampbrush chromosomes from oocytes of both parental species originating in Eastern Ukraine. We further identified certain molecular components of chromosomal marker structures and mapped coilin-rich spheres and granules, chromosome associated nucleoli and special loops accumulating splicing factors. We recorded the dissimilarities between P. ridibundus and P. lessonae lampbrush chromosomes in the length of orthologous chromosomes, number and location of marker structures and interstitial (TTAGGG)n-repeat sites as well as activity of nucleolus organizer. Satellite repeat RrS1 was mapped in centromere regions of lampbrush chromosomes of the both species. Additionally, we discovered transcripts of RrS1 repeat in oocytes of P. ridibundus and P. lessonae. Moreover, G-rich transcripts of telomere repeat were revealed in association with terminal regions of P. ridibundus and P. lessonae lampbrush chromosomes. Conclusions The constructed cytological maps of lampbrush chromosomes of P

  8. Genomic effects on advertisement call structure in diploid and triploid hybrid waterfrogs (Anura, Pelophylax esculentus).

    Science.gov (United States)

    Hoffmann, Alexandra; Reyer, Heinz-Ulrich

    2013-12-04

    In anurans, differences in male mating calls have intensively been studied with respect to taxonomic classification, phylogeographic comparisons among different populations and sexual selection. Although overall successful, there is often much unexplained variation in these studies. Potential causes for such variation include differences among genotypes and breeding systems, as well as differences between populations. We investigated how these three factors affect call properties in male water frogs of Pelophylax lessonae (genotype LL), P. ridibundus (RR) and their interspecific hybrid P. esculentus which comes in diploid (LR) and triploid types (LLR, LRR). We investigated five call parameters that all showed a genomic dosage effect, i.e. they either decreased or increased with the L/R ratio in the order LL-LLR-LR-LRR-RR. Not all parameters differentiated equally well between the five genotypes, but combined they provided a good separation. Two of the five call parameters were also affected by the breeding system. Calls of diploid LR males varied, depending on whether these males mated with one or both of the parental species (diploid systems) or triploid hybrids (mixed ploidy systems). With the exception of the northernmost mixed-ploidy population, call differences were not related to the geographic location of the population and they were not correlated with genetic distances in the R and L genomes. We found an influence of all three tested factors on call parameters, with the effect size decreasing from genotype through breeding system to geographic location of the population. Overall, results were in line with predictions from a dosage effect in L/R ratios, but in three call parameters all three hybrid types were more similar to one or the other parental species. Also calls of diploid hybrids varied between breeding systems in agreement with the sexual host required for successful reproduction. The lack of hybrid call differences in a mixed-ploidy population at

  9. All-male hybrids of a tetrapod Pelophylax esculentus share its origin and genetics of maintenance

    Czech Academy of Sciences Publication Activity Database

    Doležálková-Kaštánková, Marie; Pruvost, N. B. M.; Plötner, J.; Reyer, H. U.; Janko, Karel; Choleva, Lukáš

    2018-01-01

    Roč. 9, č. 1 (2018), č. článku 13. ISSN 2042-6410 R&D Projects: GA MŠk EF15_003/0000460; GA ČR GJ15-19947Y; GA ČR GA13-12580S Institutional support: RVO:67985904 Keywords : Pelophylax * water frog * hemiclone Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Genetics and heredity (medical genetics to be 3) Impact factor: 3.635, year: 2016

  10. Gamete types, sex determination and stable equilibria of all-hybrid populations of diploid and triploid edible frogs (Pelophylax esculentus

    Directory of Open Access Journals (Sweden)

    Christiansen Ditte G

    2009-06-01

    Full Text Available Abstract Background Triploid individuals often play a key role in speciation by hybridization. An understanding of the gamete types (ploidy and genomic content and stability of hybrid populations with triploid individuals is therefore of importance for exploring the role of hybridization in evolution. The all-hybrid populations of the edible frog, Pelophylax esculentus, are unique in their composition and genetic dynamics: Diploid (genotype LR and triploid (LLR and LRR hybrids depend on each other's different gamete contributions for successful reproduction and maintenance of the populations, as the parental genotypes P. lessonae (LL and P. ridibundus (RR are absent among adults. This study provides data and interpretations on gamete types and sex determination that are essential for understanding the function, evolutionary potential and threats of this intriguing system. Results Dissection of metamorphs from a crossing experiment confirmed that sex determination is an XX-XY system with the Y confined to the L genome. From microsatellite analysis of parents and offspring from the crossings, gamete frequencies could be deduced: Triploids of both sexes mostly made haploid gametes with the genome they had in double dose, however LLR females also made approximately 10% LL gametes by automixis. LR frogs showed much variation in their gamete production. In LRR-rich populations, their LR sperm production was sufficiently high (22% to explain the observed proportion of LRR males, the formation of which has not previously been understood. A model was constructed to calculate equilibrium genotype proportions for different population types on the basis of the gamete proportions found. These equilibria agreed well with empirical literature data. Conclusion If population differentiation with respect to genotype proportions is really driven by gamete patterns, as strongly suggested by the present study, all-hybrid populations constitute not one, but several

  11. High levels of prevalence related to age and body condition: host-parasite interactions in a water frog Pelophylax kl hispanicus

    Directory of Open Access Journals (Sweden)

    Mar Comas

    2014-06-01

    Full Text Available Host traits can significantly influence patterns of infection and disease. Here, we studied the helminths parasitizing the Italian edible frog Pelophylax kl. hispanicus, giving special attention to the relationship between parasites and host traits such as sex, snout vent length, weight and body condition. The helminth community was composed of seven species: three trematode species (Diplodiscus subclavatus, Gorgodera cygnoides, Pleurogenes claviger, three nematode species (Icosiella neglecta, Oswaldocruzia filiformis, Rhabdias sp. and one acanthocephalan species (Pomphorhychus laevis. We found that prevalence was positively correlated with snout-vent length and weight, but did not differ with body condition or sex. We found that prevalence and mean species richness increased with age. Our results show that abundance of Icosiella neglecta was positively correlated with higher values for host body condition. In fact, we found that high prevalence and mean species richness do not necessarily imply poorer body condition in the parasitized host. In conclusion, our results show that the helminth community in this taxon has great diversity, and this host-parasite system seems to be evolved to low levels of virulence, helminths maintaining a commensal relationship with this frog.

  12. Abelmoschus esculentus

    African Journals Online (AJOL)

    Pedro

    2015-02-16

    Feb 16, 2015 ... Author(s) agree that this article remains permanently open access under the terms of the Creative Commons .... assumptions of parametric tests and obtain consistent results, the .... Ladies Finger (Abelmoschus esculentus L.) in Mice. Sci. ... and okra mosaic viral diseases, under field conditions in South.

  13. TOLERANCE OF Abelmoschus esculentus (L

    African Journals Online (AJOL)

    Cletus

    Key word: - Tolerance, diesel oil, polluted soil, Abelmoschus esculentus. INTRODUCTION ... errors -of the mean values were calculated for the replicate readings and data .... African Schools and Colleges, 2nd Ed. University Press Limited ...

  14. TIGER NUT (CYPERUS ESCULENTUS): COMPOSITION ...

    African Journals Online (AJOL)

    DR. AMINU

    This paper is a review on little history and the composition of Tigernut ranging from proximate, mineral and amino ..... thought to be beneficial to diabetics and those seeking to reduce ... (Cyperus esculentus) souced from a market in Ogbomoso ...

  15. SEEDS AND Abelmoschus esculentus (OKRA)

    African Journals Online (AJOL)

    user

    Department of Chemistry, Federal University of Technology, Minna, Nigeria. 2. Science Laboratory Technology, Federal Polytechnic Bida, Niger State. * email: johntsadom@gmail. ... Abelmoschus esculentus pods was carried out using standard methods. The results of the ..... plants make to food security? Acta. Horticulture.

  16. Composition and age structure of the Pelophylax esculentus complex (Anura; Ranidae) population in inland Croatia

    Czech Academy of Sciences Publication Activity Database

    Čavlovič, K.; Buj, I.; Karaica, D.; Jelič, D.; Choleva, Lukáš

    2018-01-01

    Roč. 54, č. 1 (2018), s. 11-20 ISSN 0036-3375 R&D Projects: GA ČR GJ15-19947Y Institutional support: RVO:67985904 Keywords : hybridogenesis * population composition * allozyme markers Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 1.250, year: 2016

  17. Regeneration of okra ( Abelmoschus esculentus L.) via apical shoot ...

    African Journals Online (AJOL)

    Abelmoschus esculentus L. Monech) via apical shoot culture system. The study of apical shoot culture system was found effective for regeneration of apical shoots. The okra (A. esculentus L. Monech) N-550 line evolved at R&D, Nirmal Seeds Pvt. Ltd., ...

  18. Evidence for Integrity of Parental Genomes in the Diploid Hybridogenetic Water Frog Pelophylax esculentus by Genomic in situ Hybridization

    Czech Academy of Sciences Publication Activity Database

    Zalésna, A.; Choleva, Lukáš; Ogielska, M.; Rábová, Marie; Marec, František; Ráb, Petr

    2011-01-01

    Roč. 134, č. 3 (2011), s. 206-212 ISSN 1424-8581 R&D Projects: GA MŠk LC06073; GA ČR GA523/09/2106 Institutional research plan: CEZ:AV0Z50450515; CEZ:AV0Z50070508 Keywords : Amphibia * Chromosomes * Genomic in situ hybridization (GISH) Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.533, year: 2011

  19. Genetic diversity and distribution patterns of diploid and polyploid hybrid water frog populations (Pelophylax esculentus complex) across Europe

    Czech Academy of Sciences Publication Activity Database

    Hoffmann, A.; Plötner, J.; Pruvost, N. B. M.; Christiansen, D. G.; Röthlisberger, S.; Choleva, Lukáš; Mikulíček, P.; Cogalniceanu, D.; Sas-Kovács, I.; Shabanov, D.; Morozov-Leonov, S.; Reyer, H. U.

    2015-01-01

    Roč. 24, č. 17 (2015), s. 4371-4391 ISSN 0962-1083 R&D Projects: GA ČR(CZ) GJ15-19947Y Institutional support: RVO:67985904 Keywords : all-hybrids populations * founder effects * geographic distribution Subject RIV: EG - Zoology Impact factor: 5.947, year: 2015

  20. Regeneration of okra (Abelmoschus esculentus L.) via apical shoot ...

    African Journals Online (AJOL)

    USER

    2012-10-25

    Oct 25, 2012 ... esculentus L. Monech) N-550 line evolved at R&D, Nirmal Seeds Pvt. Ltd., was used as basic material ... Therefore, development of tissue culture protocols to induce .... Department of Botany, Rajshahi University, Bangladesh.

  1. An extinct vertebrate preserved by its living hybridogenetic descendant.

    OpenAIRE

    Dubey, S.; Dufresnes, C.

    2017-01-01

    Hybridogenesis is a special mode of hybrid reproduction where one parental genome is eliminated and the other is transmitted clonally. We propose that this mechanism can perpetuate the genome of extinct species, based on new genetic data from Pelophylax water frogs. We characterized the genetic makeup of Italian hybridogenetic hybrids (P. kl. hispanicus and esculentus) and identified a new endemic lineage of Eastern-Mediterranean origin as one parental ancestor of P. kl. hispanicus. This taxo...

  2. NMR study of Albemoschus esculentus characterization

    International Nuclear Information System (INIS)

    Bathista, A.L.B.S; Silva, E.O.; Nogueira, Jose de S.; Tavares, M.I.B.

    2001-01-01

    The investigation of the main compounds presented in the Albemoschus esculentus has been carried out employing nuclear magnetic resonance spectroscopy (NMR), using solution and solid state NMR when it one was necessary. The evaluation of NMR data allowed us to characterize the main type of components presented in this kind of sample. It was necessary to use a total information from solid state NMR and also the solution response. From these information we could get that four main components were presented in this sample. One in the shell, that is cellulose, another one between the shell and seeds that is a polysaccharide and in the seed two components were found one is a starch and the second one is an oil, a triacylglycerol. These components are responsible by its physical chemistry properties. (author)

  3. Helminth parasites of the levantine frog (Pelophylax bedriagae Camerano, 1882 from the western part of Turkey

    Directory of Open Access Journals (Sweden)

    Demır S.

    2015-02-01

    Full Text Available Fifty-four Pelophylax bedriagae (Levantine Frog from Turkey (İzmir and Manisa Provinces were examined for helminth parasites. The frogs were collected between 2012 and 2014 years. Eight species of helminth parasites were recorded: 3 species of Nematoda (Rhabdias bufonis, Cosmocerca ornata, Oswaldocruzia filiformis, 3 species of Digenea (Diplodiscus subclavatus, Haematoloechus bre-viansa, Gorgoderina vitelliloba, 1 species of Acanthocephala (Acanthocephalus ranae and 1 species of Hirudinea (Hirudo medicinalis. Pelophylax bedriagae is a new host record for these parasite species.

  4. Study of the hibiscus esculentus mucilage coagulation–flocculation ...

    African Journals Online (AJOL)

    The flocculent activity of Hibiscus esculentus (gombo) mucilage traditionally used for a local beer (Tchapalo) clarification in Côte d\\'Ivoire was studied using the method of the experimental designs. Of the three factors selected that are the volume of mucilage (X1), the temperature (X2) and the pH (X3), sole X1 and X3 ...

  5. Tien jaar Knolcyperus (Cyperus esculentus L.) in Nederland

    NARCIS (Netherlands)

    Rotteveel, A.J.W.

    1993-01-01

    Yellow nutsedge ( Cyperus esculentus L.) was first recorded in 1981 as an agricultural pest. A considerable number of fields was found to be infested. Because the species is very damaging to agriculture legal measures were taken to restrict the dispersion and promote the control of the weed. During

  6. A baseline survey of tiger nut ( Cyperus esculentus ) production in ...

    African Journals Online (AJOL)

    Tiger nut (Cyperus esculentus) is a minor but important crop in Ghana. In a survey conducted on the production and marketing of the crop at Aduamoa in the Kwahu South District of Ghana, it was observed that tiger nut production was predominantly the work of women, with 70 per cent of farmers being women and 30 per ...

  7. Purification and characterization of a novel plantaricin, KL-1Y, from Lactobacillus plantarum KL-1.

    Science.gov (United States)

    Rumjuankiat, Kittaporn; Perez, Rodney Horanda; Pilasombut, Komkhae; Keawsompong, Suttipun; Zendo, Takeshi; Sonomoto, Kenji; Nitisinprasert, Sunee

    2015-06-01

    Three bacteriocins from Lactobacillus plantarum KL-1 were successfully purified using ammonium sulfate precipitation, cation-exchange chromatography and reverse-phase HPLC. The bacteriocin peptides KL-1X, -1Y and -1Z had molecular masses of 3053.82, 3498.16 and 3533.16 Da, respectively. All three peptides were stable at pH 2-12 and 25 °C and at high temperatures of 80 and 100 °C for 30 min and 121 °C for 15 min. However, they differed in their susceptibility to proteolytic enzymes and their inhibition spectra. KL-1Y showed broad inhibitory activities against Gram-positive and Gram-negative bacteria, including Salmonella enterica serovar Enteritidis DMST 17368, Pseudomonas aeruginosa ATCC 15442, P. aeruginosa ATCC 9027, Escherichia coli O157:H7 and E. coli ATCC 8739. KL-1X and -1Z inhibited only Gram-positive bacteria. KL-1X, KL-1Y and KL-1Z exhibited synergistic activity. The successful amino acid sequencing of KL-1Y had a hydrophobicity of approximately 30 % and no cysteine residues suggested its novelty, and it was designated "plantaricin KL-1Y". Plantaricin KL-1Y exhibited bactericidal activity against Bacillus cereus JCM 2152(T). Compared to nisin, KL-1Y displayed broad inhibitory activities of 200, 800, 1600, 800, 400 and 400 AU/mL against the growth of Bacillus coagulans JCM 2257(T), B. cereus JCM 2152(T), Listeria innocua ATCC 33090(T), Staphylococcus aureus TISTR 118, E. coli O157:H7 and E. coli ATCC 8739, respectively, whereas nisin had similar activities against only B. coagulans JCM 2257(T) and B. cereus JCM 2152(T). Therefore, the novel plantaricin KL-1Y is a promising antimicrobial substance for food safety uses in the future.

  8. Karkaisulaitos KL12 karkaisupuhaltimien Online- kunnonvalvonnan suunnitelma

    OpenAIRE

    Sällinen, Tuomas

    2016-01-01

    Tämän opinnäytetyön tavoitteena oli tutkia Cosmos-värähtelyjärjestelmän sopivuutta karkaisulaitos KL12:n karkaisupuhaltimille. Työ suoritettiin toimeksiantona Pilkington yritykselle, mutta itse työ suoritettiin itsenäisesti. Työni tarkoituksena oli perehtyä lasin valmistukseen, lasin karkaisuprosessiin ja siihen, kuinka karkaisupuhaltimien kunnonvalvonta tulevaisuudessa hoidetaan. Karkaisupuhaltimet ovat hyvin kriittisiä linjan toiminnan kannalta. Karkaisulaitos KL12:n karkaisupuhaltimille ei...

  9. First bioacoustic and morphological data for the presence of Pelophylax bedriagae in Bulgaria

    Directory of Open Access Journals (Sweden)

    Lukanov Simeon

    2018-03-01

    Full Text Available Water frog mating calls from two localities were studied and analyzed. Recordings were made in the summer of 2010 at the Arkutino swamp near the town of Primorsko and at the Vurbitza River near the town of Momchilgrad. A total of 154 calls were analyzed and the results suggested the presence of both the Marsh frog (Pelophylax ridibundus and the Levant frog (Pelophylax bedriagae in both sites, with the former being more frequent in Vurbitza River, and the latter – in Arkutino. At Vurbitza, we also captured and measured 2 specimens, which morphological characteristics differed from P. ridibundus and matched those of P. bedriagae. These are the first localities for P. bedriagae in Bulgaria.

  10. On the feeding ecology of Pelophylax saharicus (Boulenger 1913) from Morocco

    OpenAIRE

    Zaida Ortega; Valentín Pérez-Mellado; Pilar Navarro; Javier Lluch

    2016-01-01

    The Sahara frog is the most common amphibian found in North Africa. However, the knowledge of its natural history is rather fragmentary. In the present work we studied the trophic ecology of Pelophylax saharicus at some areas of Morocco through the analysis of 130 gastric contents. We did not find any significant sexual dimorphism in body size of adult individuals. Consumed prey show similar sizes in both sexes, while bigger frogs normally eat larger prey. As in other Palearctic frogs, the di...

  11. Afyon-Sandıklı

    Indian Academy of Sciences (India)

    δ18O and δD isotope ratios of the Sandıklı waters plot along the continental meteoric water line ... and district heating. Several studies on geology, hydrogeology along ..... precipitation; In: Handbook of Environmental Isotope. Geochemistry ...

  12. Discovery of alien water frogs (gen. Pelophylax in Umbria, with first report of P. shqipericus for Italy

    Directory of Open Access Journals (Sweden)

    Dario Domeneghetti

    2013-12-01

    Full Text Available Allochthonous water frogs (gen. Pelophylax have been repeatedly introduced in several European countries, causing dramatic consequences for the conservation of indigenous taxa. In Italy, invasive populations are known for northern regions, where they were introduced mainly for edible and scientific purposes. Here, we report the first detection of an alien population of water frogs in Central Italy, along the Resina valley (Umbria. Genetic analysis of the mitochondrial ND3 gene polymorphism assigned some specimens to two different Pelophylax ridibundus clades widespread in Central and Eastern Europe. By contrast, two samples matched the mitochondrial DNA (mtDNA sequence of Pelophylax lessonae bergeri, an autochthonous taxon widespread in Central Italy, suggesting possible hybridization between alien and indigenous frogs. Finally, the specific haplotype of Pelophylax shqipericus, the Albanian Pool Frog, was also identified according to mtDNA polymorphism. This record, firstly reported for Italy, poses concerns for the conservation of this cryptic taxon, suggesting that international water frog trade may involve also particularly endangered species.

  13. Use of the crop maize to reduce yellow nutsedge (Cyperus esculentus L. pressure in highly infested fields in Switzerland

    Directory of Open Access Journals (Sweden)

    Keller, Martina

    2014-02-01

    Full Text Available Cyperus esculentus L. causes high yield losses in many crops worldwide. In Switzerland it was observed for the first time about 30 years ago. Since then it has become a serious weed in several regions - especially where vegetables are produced. Growing vegetables in heavily infested fields should be abandoned due to their low competitiveness and the lack of available, effective herbicides. Contrarily, in maize several herbicides with a partial effect on C. esculentus are registered. Thus, continuous cultivation of maize including the use of the most effective herbicides against C. esculentus could help reducing infestation levels in heavily infested fields. Field trials were carried out at two sites in maize during 2011 and 2012. Different herbicide combinations, hoeing and herbicide applications combined with hoeing were the applied treatments. Split application was compared with one single application of the same amount of product. The effect of an additional, late under leaf herbicide application was determined as well. Cyperus esculentus coverage was estimated in the fields in 2011. Plots were sampled in spring 2011, autumn 2011 and autumn 2012. The Number of C. esculentus sprouts germinated from the soil samples was determined under greenhouse conditions. The most effective herbicide combination of registered active ingredients was rimsulfuron and mesotrione. Smetolachlor was effective as well, especially if combined with mechanical weed control. Halosulfuron-methyl applied twice provided the best C. esculentus control. Split application tended to be more effective than a single application. Control of C. esculentus could be improved considerably with an additional herbicide application in late June (under leaf. The treatments with highest C. esculentus control determined in the field trials and combinations thereof are effective treatment options for C. esculentus control in maize. These findings indicate and confirm that maize cropped for

  14. Related structures of neutral capsular polysaccharides of Acinetobacter baumannii isolates that carry related capsule gene clusters KL43, KL47, and KL88.

    Science.gov (United States)

    Shashkov, Alexander S; Kenyon, Johanna J; Arbatsky, Nikolay P; Shneider, Mikhail M; Popova, Anastasiya V; Miroshnikov, Konstantin A; Hall, Ruth M; Knirel, Yuriy A

    2016-11-29

    Capsular polysaccharides were recovered from four Acinetobacter baumannii isolates, and the following related structures of oligosaccharide repeating units were established by sugar analyses along with 1D and 2D 1 H and 13 C NMR spectroscopy: NIPH 60 and LUH5544 (K43) NIPH 601 (K47) The K locus for capsule biosynthesis in the genome sequences available for NIPH 60 and LUH5544, designated KL43, was found to be related to gene clusters KL47 in NIPH 601 and KL88 in LUH5548. The three clusters share most gene content differing in only a small portion that includes an additional glycosyltransferase genes in KL47 and KL88, as well as genes encoding distinct Wzy polymerases that were found to form the same α-d-GlcpNAc-(1 → 6)-α-d-GlcpNAc linkage in K43 and K47. Copyright © 2016 Elsevier Ltd. All rights reserved.

  15. Okra (Hibiscus esculentus) seed oil for biodiesel production

    Energy Technology Data Exchange (ETDEWEB)

    Anwar, Farooq; Nadeem, Muhammad [Department of Chemistry and Biochemistry, University of Agriculture, Faisalabad 38040 (Pakistan); Rashid, Umer [Department of Chemistry and Biochemistry, University of Agriculture, Faisalabad 38040 (Pakistan); Department of Industrial Chemistry, Government College University, Faisalabad 38000 (Pakistan); Ashraf, Muhammad [Department of Botany, University of Agriculture, Faisalabad 38040 (Pakistan)

    2010-03-15

    Biodiesel was derived from okra (Hibiscus esculentus) seed oil by methanol-induced transesterification using an alkali catalyst. Transesterification of the tested okra seed oil under optimum conditions: 7:1 methanol to oil molar ratio, 1.00% (w/w) NaOCH{sub 3} catalyst, temperature 65 C and 600 rpm agitation intensity exhibited 96.8% of okra oil methyl esters (OOMEs) yield. The OOMEs/biodiesel produced was analyzed by GC/MS, which showed that it mainly consisted of four fatty acids: linoleic (30.31%), palmitic (30.23%), oleic (29.09%) and stearic (4.93%). A small amount of 2-octyl cyclopropaneoctanoic acid with contribution 1.92% was also established. Fuel properties of OOMEs such as density, kinematic viscosity, cetane number, oxidative stability, lubricity, flash point, cold flow properties, sulfur contents and acid value were comparable with those of ASTM D 6751 and EN 14214, where applicable. It was concluded that okra seed oil is an acceptable feedstock for biodiesel production. (author)

  16. Optimization of batch alcoholic fermentation of Cyperus esculentus

    Energy Technology Data Exchange (ETDEWEB)

    Esuoso, K O [Dept. of Chemistry, Federal Univ. of Technology, Akure (Nigeria); Oderinde, R A [Dept. of Chemistry, Ibadan Univ. (Nigeria); Vega-Catalan, F J [Dept. of Computer Science, Ibadan Univ. (Nigeria); Bamiro, F O [Dept. of Chemical Sciences, Univ. of Agriculture, Abeokuta (Nigeria)

    1993-01-01

    In our earlier work carried out on alcoholic fermentation of molasses the optimum sugar concentration was between 14.0 and 17.0% w/v sugars, beyond which ethanol content decreased drastically. However in the present work, ethanol concentration was still high at 20% w/v sugars. This suggested that the strain had enhanced tolerance to the adverse effects of C. esculentus medium than molasses. Substituting the calculated parameter values (a[sub 1]-a[sub 10]) and optimal conditions of pH, S and T into equation, the calculated yield equals 92.7%. We again tried to verify experimentally the reliability of the theoretical optimal values obtained. The concentration of ethanol obtained was 9.2 [+-] 0.2% v/v. This was higher than the maximum concentration recorded before simulation (8.9% v/v). The experimental yield obtained was 90.3 [+-] 1.6% which is in close agreement with the simulated value of 92.7%. (orig.)

  17. Anti hypoxic and antioxidant activity of Hibiscus esculentus seeds

    Energy Technology Data Exchange (ETDEWEB)

    Ebrahimzadeh, M. A.; Nabavi, S. F.; Nabavi, S. M.; Eslami, B.

    2010-07-01

    The anti hypoxic and antioxidant activities of Hibiscus esculentus seeds were investigated employing eight in vitro assay systems. Anti hypoxic activity was investigated in two models, haemic and circulatory. The effects were pronounced in both models of hypoxia. The anti hypoxic effects were dose-dependent. The results indicated that the extracts have a protective effect against hypoxia induced lethality in mice. The extracts showed antioxidant activity in some models. IC{sub 5}0 for DPPH radical-scavenging activity was 234 {+-} 8.9 {mu}g ml{sup 1}. The extracts showed weak nitric oxide-scavenging activity between 0.1 and 1.6 mg ml{sup -}1. The extracts showed weak Fe{sup 2}+ chelating ability. IC{sub 5}0 were 150 {+-} 13 {mu}g ml{sup -}1. The extracts also exhibited low antioxidant activity in the linoleic acid model but were capable of scavenging hydrogen peroxide in a concentration dependent manner. The total amount of phenolic compounds in each extract was determined as gallic acid equivalents and total flavonoid contents were calculated as quercetin equivalents from a calibration curve. Pharmacological effects may be attributed, at least in part, to the presence of phenols and flavonoids in the extracts. (Author) 40 refs.

  18. Fossil DCN in Orion-KL

    International Nuclear Information System (INIS)

    Mangum, J.G.; Plambeck, R.L.; Wootten, A.

    1991-01-01

    The J = 1 - 0 transition of DCN was mapped toward Orion-KL with the BIMA array. With a synthesized beam width of 7.6 arcsec, emission from the hot core, compact ridge, and northern cloud regions was identified. Over half of the integrated DCN emission detected originates from the hot core component, with progressively smaller contributions from the compact ridge and northern cloud. The DCN fractional abundance is 10 to the -9th in the hot core, 4 x 10 to the -10th in the compact ridge, and 2 x 10 to the -10th in the northern cloud; it is estimated that the corresponding DCN/HCN ratios are about 0.005, 0.02, and 0.02. Chemical models suggest that such high DCN/HCN abundance ratios are produced only in clouds colder than about 20 K. Since the present temperatures near Orion-KL are 50-275 K, it is evident that most of the DCN formed before this region was heated by massive star formation. Much of the fossil DCN which is now observed may have sublimated from icy grain mantles. 32 refs

  19. On the feeding ecology of Pelophylax saharicus (Boulenger 1913 from Morocco

    Directory of Open Access Journals (Sweden)

    Zaida Ortega

    2016-12-01

    Full Text Available The Sahara frog is the most common amphibian found in North Africa. However, the knowledge of its natural history is rather fragmentary. In the present work we studied the trophic ecology of Pelophylax saharicus at some areas of Morocco through the analysis of 130 gastric contents. We did not find any significant sexual dimorphism in body size of adult individuals. Consumed prey show similar sizes in both sexes, while bigger frogs normally eat larger prey. As in other Palearctic frogs, the diet is basically insectivorous, including terrestrial and aquatic prey. We found some differences in the diet of juveniles, with a higher proportion of flying prey, probably indicating a foraging strategy closer to ambush hunting. In the Atlas region, the high consumption of slow-moving terrestrial prey, as Gastropoda, stands out. Only in the Atlas region, the diet was similar to that described from other areas of North Africa, as Tunisia.

  20. Antihypoxic and antioxidant activity of Hibiscus esculentus seeds

    Directory of Open Access Journals (Sweden)

    Eslami, Bahman

    2010-03-01

    Full Text Available The antihypoxic and antioxidant activities of Hibiscus esculentus seeds were investigated employing eight in vitro assay systems. Antihypoxic activity was investigated in two models, haemic and circulatory. The effects were pronounced in both models of hypoxia. The antihypoxic effects were dose-dependent. The results indicated that the extracts have a protective effect against hypoxia induced lethality in mice. The extracts showed antioxidant activity in some models. IC50 for DPPH radical-scavenging activity was 234 ± 8.9 μg ml-1. The extracts showed weak nitric oxide-scavenging activity between 0.1 and 1.6 mg ml-1. The extracts showed weak Fe2+ chelating ability. IC50 were 150 ± 13 μg ml-1. The extracts also exhibited low antioxidant activity in the linoleic acid model but were capable of scavenging hydrogen peroxide in a concentration dependent manner. The total amount of phenolic compounds in each extract was determined as gallic acid equivalents and total flavonoid contents were calculated as quercetin equivalents from a calibration curve. Pharmacological effects may be attributed, at least in part, to the presence of phenols and flavonoids in the extracts.La actividad antihipóxica y antioxidante de semillas de Hibiscus esculentus fue investigada empleando ocho ensayos in vitro. La actividad antihipóxica fue investigada en dos modelos, uno de caracter hemínico y otro circulatorio. Los efectos fueron pronunciados en ambos modelos de hipoxia. Los efectos antihipóxicos fueron dependientes de la dosis. Los resultados indican que los extractos tienen un efecto protector contra la letabilidad inducida por hipoxia en ratones. Los extractos mostraron actividad antioxidante en algunos modelos. El IC50 para la actividad captadora de radicales fue 234 ± 8.9 μg ml-1. Los extractos muestran una débil actividad captadora de óxido nítrico comprendida entre 0.1 y 1.6 mg ml-1. Los extractos muestran una débil capacidad quelatante de Fe2+. El IC

  1. the effect of aqueous extract of cyperus esculentus on some liver ...

    African Journals Online (AJOL)

    honey

    2014-03-31

    Mar 31, 2014 ... Cyperus esculentus is valued for the highly nutritional starch content, dietary fibre and digestible carbohydrate of monosaccharides, disaccharides and polysaccharides ..... Comparative physicochemical evaluation of tigernut, soyabean and coconut milk sources. Int. J. Agric. Biol. 5: 785-787. Burn, M.K. ...

  2. Kinetics of modulatory role of Cyperus esculentus L. on the specific ...

    African Journals Online (AJOL)

    Background: The continuous search for new lead compounds as viable inhibitors of specific enzymes linked to carbohydrate metabolism has intensified. Cyperus esculentus L. is one of the therapeutically implicated botanicals against several degenerative diseases including diabetes mellitus. Materials and Methods: This ...

  3. Spreading and germination of yellow nutsedge (Cyperus esculentus L.) in Hungary.

    Science.gov (United States)

    Hoffmann, Z P; Buzsáki, K; Béres, I

    2006-01-01

    Yellow nutsedge (Cyperus esculentus) is a cosmopolitan, tropical, subtropical plant. On the basis of Ujvarosi life-form it is a G2 perennial plant, overwintering with tubers in the soil. It occurs in all continents: along Eastern and Western coastlines of Africa and even in South-Africa, North and South America, Japan, India, Near-Eastern countries, Western, Southern and Eastern Europe. It has been spread since the 70's in Europe, but its remarkable occurrence was between 1980 and 1995 years. Nowadays it occurs in Germany, the Netherlands, Belgium, France, Portugal, Austria, Croatia, Switzerland, Italy and Hungary among the European countries. The first occurrence of C. esculentus was observed in Hungary in 1993, at the surroundings of Keszthely and H&viz towns in a maize-ecosystem (Dancza 1994). It can be presumed, that its import happened with Gladiolus tubers and seed-grain of maize. At present C. esculentus occurs in four regions and surroundings of 20 habitations of Hungary. Somogy county is the most infected area, where it occurs on 10,000 hectares. C. esculentus took the 16th place in the important order of weeds of the world in the 70's. On the basis of EPPO IAS Panel at present this weed specics is considered as one of the most harmful invasive species of the world, due to its severe economic injury. Most harmful effect of C. esculentus is expressed in spring-sown hoed cultures, mainly in maize. Beside this it also occurs in sunflower, potato and sugarbeet cultures. C. esculentus has a good competitive ability by reducing crop quality and quantity. Vegetative reproduction is dominant in spreading but its propagation by seeds is also presumed in Hungary. Cool, rainy weather favours for the vegetative reproduction, while warm, dry one for the flowering. It has a 1-1.5 mm long fruit with one seed. One clustering can contain 600 seeds. According to Lapham (1985) there are areas in Zimbabwe where one can find 100 million C. esculentus seeds in a hectare. At a 1

  4. Adaptation to osmotic stress provides protection against ammonium nitrate in Pelophylax perezi embryos

    International Nuclear Information System (INIS)

    Ortiz-Santaliestra, Manuel E.; Fernandez-Beneitez, Maria Jose; Lizana, Miguel; Marco, Adolfo

    2010-01-01

    The negative effects of pollution on amphibians are especially high when animals are additionally stressed by other environmental factors such as water salinity. However, the stress provoked by salinity may vary among populations because of adaptation processes. We tested the combined effect of a common fertilizer, ammonium nitrate (0-90.3 mg N-NO 3 NH 4 /L), and water salinity (0-2 per mille ) on embryos of two Pelophylax perezi populations from ponds with different salinity concentrations. Embryos exposed to the fertilizer were up to 17% smaller than controls. Survival rates of embryos exposed to a single stressor were always below 10%. The exposure to both stressors concurrently increased mortality rate (>95%) of embryos from freshwater. Since the fertilizer was lethal only when individuals were stressed by the salinity, it did not cause lethal effects on embryos naturally adapted to saline environments. Our results underscore the importance of testing multiple stressors when analyzing amphibian sensitivity to environmental pollution. - Natural resistance to salinity minimizes the impact of chemical fertilizers on amphibian embryos.

  5. A preliminary study on micronucleus analysis and nuclear anomalies in Pelophylax ridibundus (Pallas,

    Directory of Open Access Journals (Sweden)

    Mert Gürkan

    2015-12-01

    Full Text Available Bu çalışmada Vize (Kırklareli ve Kazdağı (Yenice, Çanakkale civarında toplanan Pelophylax ridibundus örneklerine ait eritrositlerde mikronukleus analizi yapıldı ve nuklear anomaliler tespit edildi. Bu amaçla Nisan 2011’de Vize’den 9 (5♂♂, 4♀♀, Mayıs 2011’de Kazdağı’ndan 5 (3♂♂, 2♀♀ adet P. ridibundus örneği toplandı. Vize’den toplanan örneklerde ortalama mikronukleus sayısı 6±4,17, frekans % 0,3; Kazdağı’ndan toplanan örneklerde ise 0,6±0,43, frekans % 0,03 olarak hesaplandı. İstatistiksel analizler neticesinde iki lokalite arasında toplam mikronukleus sayısı bakımından önemli fark bulunduğu belirlendi (p≤0,05. Çalışmada binuklear, çentikli, tomurcuklu ve küçük loplu olmak üzere 4 tip nuklear anomali saptandı. Vize ve Kazdağı örnekleri arasında toplam nuklear anomali sayısı bakımından fark tespit edilmedi (p=0,31. Araştırmamız sonunda elde edilen bulgulara göre, Vize örneklerinde mikronukleus frekansının daha yüksek bulunması, bölgedeki yoğun tarımsal faaliyetlerde kullanılan genotoksik pestisitlere maruz kalınmayla ilişkilendirilebilir

  6. Klõsheiko, Mare Vint, effid / Harry Liivrand

    Index Scriptorium Estoniae

    Liivrand, Harry, 1961-

    2005-01-01

    Tallinna Kinomajas esilinastusid 28. okt. kolm uut dokumentaalfilmi eesti kunstnikest : "F.F.F.F. läheb laiali" (Kuukulgur Film 2005, rezh. Marko Raat, "Mare Vint" (Exitfilm 2005, rezh. Anri Rulkov) ja "Jaan Klõsheiko" (Estonia Film 2005, rezh.-d Eve Ester, Igor Ruus)

  7. Exposure to lead in water and cysteine non-oxidative metabolism in Pelophylax ridibundus tissues

    International Nuclear Information System (INIS)

    Kaczor, Marta; Sura, Piotr; Bronowicka-Adamska, Patrycja; Wróbel, Maria

    2013-01-01

    Chronic, low-level exposure to metals is an increasing global problem. Lead is an environmentally persistent toxin that causes many lead-related pathologies, directly affects tissues and cellular components or exerts an effect of the generation of reactive oxygen species causing a diminished level of available sulfhydryl antioxidant reserves. Cysteine is one of substrates in the synthesis of glutathione – the most important cellular antioxidant, and it may also undergo non-oxidative desulfuration that produces compounds containing sulfane sulfur atoms. The aim of the experiment was to examine changes of the non-oxidative metabolism of cysteine and the levels of cysteine and glutathione in the kidneys, heart, brain, liver and muscle of Marsh frogs (Pelophylax ridibundus) exposed to 28 mg/L Pb(NO 3 ) 2 for 10 days. The activities of sulfurtransferases, enzymes related to the sulfane sulfur metabolism – 3-mercaptopyruvate sulfurtransfearse, γ-cystathionase and rhodanese – were detected in tissue homogenates. The activity of sulfurtransferases was much higher in the kidneys of frogs exposed to lead in comparison to control frogs, not exposed to lead. The level of sulfane sulfur remained unchanged. Similarly, the total level of cysteine did not change significantly. The total levels of glutathione and the cysteine/cystine and GSH/GSSG ratios were elevated. Thus, it seems that the exposure to lead intensified the metabolism of sulfane sulfur and glutathione synthesis in the kidneys. The results presented in this work not only confirm the participation of GSH in the detoxification of lead ions and/or products appearing in response to their presence, such as reactive oxygen species, but also indicate the involvement of sulfane sulfur and rhodanese in this process (e.g. brain). As long as the expression of enzymatic proteins (rhodanese, MPST and CST) is not examined, no answer will be provided to the question whether changes in their activity are due to differences

  8. Exposure to lead in water and cysteine non-oxidative metabolism in Pelophylax ridibundus tissues

    Energy Technology Data Exchange (ETDEWEB)

    Kaczor, Marta [Jagiellonian University Medical College, Kopernika 7, 31-034 Krakow (Poland); Sura, Piotr [Department of Human Developmental Biology, Jagiellonian University Medical College, Kopernika 7, 31-034 Krakow (Poland); Bronowicka-Adamska, Patrycja [Jagiellonian University Medical College, Kopernika 7, 31-034 Krakow (Poland); Wrobel, Maria, E-mail: mbwrobel@cyf-kr.edu.pl [Jagiellonian University Medical College, Kopernika 7, 31-034 Krakow (Poland)

    2013-02-15

    Chronic, low-level exposure to metals is an increasing global problem. Lead is an environmentally persistent toxin that causes many lead-related pathologies, directly affects tissues and cellular components or exerts an effect of the generation of reactive oxygen species causing a diminished level of available sulfhydryl antioxidant reserves. Cysteine is one of substrates in the synthesis of glutathione - the most important cellular antioxidant, and it may also undergo non-oxidative desulfuration that produces compounds containing sulfane sulfur atoms. The aim of the experiment was to examine changes of the non-oxidative metabolism of cysteine and the levels of cysteine and glutathione in the kidneys, heart, brain, liver and muscle of Marsh frogs (Pelophylax ridibundus) exposed to 28 mg/L Pb(NO{sub 3}){sub 2} for 10 days. The activities of sulfurtransferases, enzymes related to the sulfane sulfur metabolism - 3-mercaptopyruvate sulfurtransfearse, {gamma}-cystathionase and rhodanese - were detected in tissue homogenates. The activity of sulfurtransferases was much higher in the kidneys of frogs exposed to lead in comparison to control frogs, not exposed to lead. The level of sulfane sulfur remained unchanged. Similarly, the total level of cysteine did not change significantly. The total levels of glutathione and the cysteine/cystine and GSH/GSSG ratios were elevated. Thus, it seems that the exposure to lead intensified the metabolism of sulfane sulfur and glutathione synthesis in the kidneys. The results presented in this work not only confirm the participation of GSH in the detoxification of lead ions and/or products appearing in response to their presence, such as reactive oxygen species, but also indicate the involvement of sulfane sulfur and rhodanese in this process (e.g. brain). As long as the expression of enzymatic proteins (rhodanese, MPST and CST) is not examined, no answer will be provided to the question whether changes in their activity are due to

  9. The well-known unknown photographer Jaan Klõšeiko / Ellu Maar

    Index Scriptorium Estoniae

    Maar, Ellu, 1982-

    2010-01-01

    Graafik ja fotograaf Jaan Klõšeikost, kes on 45 aastat jäädvustanud kunsti- ja kultuurisündmusi. Galerii Vaal kodulehel ilmunud J. Klõšeiko fotoseeriatest (12), fotod valis ja saatesõnad kirjutas J. Klõšeiko

  10. Effect of gamma rays on fruit weight and number of seeds in Abelmoschus esculentus (L.) Moench and Momordica charantia L

    International Nuclear Information System (INIS)

    Jha, B.K.

    1994-01-01

    Among 5,15,30,60,90 and 120 kR doses of gamma rays, lower doses showed stimulatory effects on fresh and dry weight of fruit, while higher doses proved inhibitory in Abelmoschus esculentus and Momordica charantia. Abortion of mature seeds was also higher at 30 kR and above doses. (author). 12 refs., 2 tabs

  11. Competição inicial entre Cyperus esculentus e arroz irrigado em condições de casa-de-vegetação Competition between Cyperus esculentus and irrigated rice under green house conditions

    Directory of Open Access Journals (Sweden)

    E. A. L. Erasmo

    2000-08-01

    Full Text Available Com o objetivo de avaliar o efeito competitivo de Cyperus esculentus sobre o crescimento inicial da cultura do arroz irrigado, foi instalado um experimento em casa-devegetação, na Estação Experimental da Faculdade de Agronomia - UNITINS, no munícipio de Gurupi-TO. O delineamento estatístico utilizado foi um fatorial 5x4 com três repetições completamente casualizado. Os tratamentos constaram de cinco períodos de convivência do arroz com C. esculentus (15, 25, 35, 45 e 60 dias após a emergência da cultura e quatro densidades de C. esculentus (0, 2, 4 e 8 tubérculos/vaso, correspondentes a 0; 71; 142 e 286 plantas de C. esculentus por m2, respectivamente. No final de cada período foram avaliados na cultura do arroz os seguintes parâmetros: matéria seca de plantas/vaso; área foliar/planta; matéria seca de perfilhos/vaso; n.º de perfilhos/vaso e altura média de plantas. Os resultados mostraram que o efeito da presença de C. esculentus foi mais marcante nas densidades de quatro e oito tubérculos/vaso a partir dos 35 dias de convivência. O parâmetro mais afetado foi a matéria seca de plantas/vaso, como resultado do decréscimo do número de perfilhos/vaso. A altura das plantas de arroz irrigado não foi afetada pela presença da planta daninha em nenhum período de convivência.With the objective of evaluating the competitive effect of Cyperus esculentus on the growth and production of the culture of irrigated rice, experiments were installed in green house, in the Experimental Station of the School of Agronomy - UNITINS, in Gurupi, State of Tocantins, Brazil. The statistical design used in the experiments was a factorial plot 5x4 with three replications, completely randomized. The treatments consisted of five periods of coexistence of the rice with Cyperus esculentus (15, 25, 35, 45 and 60 days after the emergency - D.A.E, of the rice and four densities of C. esculentus (0, 2, 4 and 8 tuber/pots corresponding to 0; 71; 142 e

  12. Role of square root threshold singularity in current algebra and chiral symmetry breaking calculations of Kl3, Kl4 and tau → πKν decays

    International Nuclear Information System (INIS)

    Truong, T.N.

    1981-01-01

    It is shown that discrepancies between soft pion current algebra (or chiral symmetry) calculations in Kl 4 and experiments are mostly due to the square root threshold singularity of the pion-pion interaction. For the same reason, chiral symmetry breaking calculations of the scalar Kl 3 form factor cannot be extended to the threshold of tau → Kπν decay. (orig.)

  13. KL-6, a human MUC1 mucin, promotes proliferation and survival of lung fibroblasts

    International Nuclear Information System (INIS)

    Ohshimo, Shinichiro; Yokoyama, Akihito; Hattori, Noboru; Ishikawa, Nobuhisa; Hirasawa, Yutaka; Kohno, Nobuoki

    2005-01-01

    The serum level of KL-6, a MUC1 mucin, is a clinically useful marker for various interstitial lung diseases. Previous studies demonstrated that KL-6 promotes chemotaxis of human fibroblasts. However, the pathophysiological role of KL-6 remains poorly understood. Here, we further investigate the functional aspects of KL-6 in proliferation and apoptosis of lung fibroblasts. KL-6 accelerated the proliferation and inhibited the apoptosis of all human lung fibroblasts examined. An anti-KL-6 monoclonal antibody counteracted both of these effects induced by KL-6 on human lung fibroblasts. The pro-fibroproliferative and anti-apoptotic effects of KL-6 are greater than and additive to those of the maximum effective concentrations of platelet-derived growth factor, basic fibroblast growth factor, and transforming growth factor-β. These findings indicate that increased levels of KL-6 in the epithelial lining fluid may stimulate fibrotic processes in interstitial lung diseases and raise the possibility of applying an anti-KL-6 antibody to treat interstitial lung diseases

  14. An extinct vertebrate preserved by its living hybridogenetic descendant.

    Science.gov (United States)

    Dubey, Sylvain; Dufresnes, Christophe

    2017-10-06

    Hybridogenesis is a special mode of hybrid reproduction where one parental genome is eliminated and the other is transmitted clonally. We propose that this mechanism can perpetuate the genome of extinct species, based on new genetic data from Pelophylax water frogs. We characterized the genetic makeup of Italian hybridogenetic hybrids (P. kl. hispanicus and esculentus) and identified a new endemic lineage of Eastern-Mediterranean origin as one parental ancestor of P. kl. hispanicus. This taxon is nowadays extinct in the wild but its germline subsists through its hybridogenetic descendant, which can thus be considered as a "semi living fossil". Such rare situation calls for realistic efforts of de-extinction through selective breeding without genetic engineering, and fuels the topical controversy of reviving long extinct species. "Ghost" species hidden by taxa of hybrid origin may be more frequent than suspected in vertebrate groups that experienced a strong history of hybridization and semi-sexual reproduction.

  15. TIGER NUT (CYPERUS ESCULENTUS: SOURCE OF NATURAL ANTICANCER DRUG? BRIEF REVIEW OF EXISTING LITERATURE.

    Directory of Open Access Journals (Sweden)

    Elom Seyram Achoribo

    2017-07-01

    Full Text Available In some parts of the world, Cyperus esculentus L. is widely used as a healthy food for both humans and animals due to their nutritional and functional properties. Current research and reviews on this plant have focused mainly on organoleptic properties, phytochemical compositions, oil content, biochemical activities, and nutritional values. The medicinal properties of Tiger nut are seldom discussed, although its medicinal use is well known in folklore activities. To explore the medicinal properties of Tiger nut, This review tries to investigate the potential anticancer properties of components issued from Tiger nut by reviewing the existing literature in the field. Based on the evidence from the review, it is recommended that there is a need for further investigation into the proposed anticancer properties of Tiger nut.

  16. Effect of polyamines on biochemical properties in gamma irradiated Okra (Abelmoschus esculentus L.) varieties

    International Nuclear Information System (INIS)

    Bhushan, Himanshu; Shukla, Pradeep K.; Ramteke, Pramod W.; Misra, Pragati

    2014-01-01

    Gamma rays are electromagnetic radiations and can be useful for the alteration of physiological characters. In plant systems, gamma ray induced free radicals can damage or modify important components of plant cells and also modulate the morphological, anatomical and biochemical characters of the cell and the plant therein. Polyamine possesses protective role against unfavorable conditions because of its highest positive charge due to presence of amine groups. In plants polyamines are involved in organ development, flowering, fruit ripening, and senescence and stress responses. Okra (Abelmoschus esculentus L.) has captured a prominent position among vegetables and in India; it is grown on an area of 3.6 lakh hectares with a production of 34.2 lakh tones. Keeping these facts in mind, an experiment was conducted to study the effect of polyamines on biochemical properties in gamma irradiated Okra (Abelmoschus esculentus L.) varieties. Seeds of four Okra varieties (namely Kaveri 49, Kaveri 54, Deepika and OH2324) were expose to different levels of gamma radiation (T 1 = 200 Gy, T 2 = 400 Gy, T 3 = 600 Gy, and T 4 = 800 Gy) using 60 Co as source at National Botanical Research Institute (NBRI) research institute of CSIR at Lucknow. These plants were also subjected to an exogenous application of 1 mM spermine and 1 mM spermidineas foliar spray. The results showed that application of Polyamines (spermine and spermidine) increased Chlorophyll α content, Chlorophyll b content (mg/g fresh weight) in gamma treated plants as compared to control. Application of polyamines also increased enzymatic and non-enzymatic antioxidants (proline, ascorbte peroxidase and glutathione reductase) level in gamma treated plants as compared to control. Carotenoid and protein content showed variations under polyamine treatment. In general, variety Deepika was relatively tolerant to gamma radiation among all the varieties, whereas, Kaveri 49 and Kaveri 54 were relatively sensitive to gamma

  17. IDENTIFICATION OF BURSTING WATER MASER FEATURES IN ORION KL

    International Nuclear Information System (INIS)

    Hirota, Tomoya; Honma, Mareki; Kim, Mi Kyoung; Kobayashi, Hideyuki; Shibata, Katsunori M.; Tsuboi, Masato; Fujisawa, Kenta; Kawaguchi, Noriyuki; Imai, Hiroshi; Omodaka, Toshihiro; Shimoikura, Tomomi; Yonekura, Yoshinori

    2011-01-01

    In 2011 February, a burst event of the H 2 O maser in Orion KL (Kleinmann-Low object) has started after a 13 year silence. This is the third time such phenomena has been detected in Orion KL, followed by the events in 1979-1985 and 1998. We have carried out astrometric observations of the bursting H 2 O maser features in Orion KL with the VLBI Exploration of Radio Astrometry (VERA), a Japanese very long baseline interferometry network dedicated for astrometry. The total flux of the bursting feature at the local standard of rest (LSR) velocity of 7.58 km s -1 reaches 4.4 x 10 4 Jy in 2011 March. The intensity of the bursting feature is three orders of magnitude larger than that of the same velocity feature in the quiescent phase in 2006. Two months later, another new feature appears at the LSR velocity of 6.95 km s -1 in 2011 May, separated by 12 mas north of the 7.58 km s -1 feature. Thus, the current burst occurs at two spatially different features. The bursting masers are elongated along the northwest-southeast direction as reported in the previous burst in 1998. We determine the absolute positions of the bursting features for the first time ever with a submilliarcsecond (mas) accuracy. Their positions are coincident with the shocked molecular gas called the Orion Compact Ridge. We tentatively detect the absolute proper motions of the bursting features toward the southwest direction. It is most likely that the outflow from the radio source I or another young stellar object interacting with the Compact Ridge is a possible origin of the H 2 O maser burst.

  18. Transcription factor organic cation transporter 1 (OCT-1 affects the expression of porcine Klotho (KL gene

    Directory of Open Access Journals (Sweden)

    Yan Li

    2016-07-01

    Full Text Available Klotho (KL, originally discovered as an aging suppressor, is a membrane protein that shares sequence similarity with the β-glucosidase enzymes. Recent reports showed Klotho might play a role in adipocyte maturation and systemic glucose metabolism. However, little is known about the transcription factors involved in regulating the expression of porcine KL gene. Deletion fragment analysis identified KL-D2 (−418 bp to −3 bp as the porcine KL core promoter. MARC0022311SNP (A or G in KL intron 1 was detected in Landrace × DIV pigs using the Porcine SNP60 BeadChip. The pGL-D2-A and pGL-D2-G were constructed with KL-D2 and the intron fragment of different alleles and relative luciferase activity of pGL3-D2-G was significantly higher than that of pGL3-D2-A in the PK cells and ST cells. This was possibly the result of a change in KL binding ability with transcription factor organic cation transporter 1 (OCT-1, which was confirmed using electrophoretic mobility shift assays (EMSA and chromatin immune-precipitation (ChIP. Moreover, OCT-1 regulated endogenous KL expression by RNA interference experiments. Our study indicates SNP MARC0022311 affects porcine KL expression by regulating its promoter activity via OCT-1.

  19. Seasonal variations of cellular stress response in the heart and gastrocnemius muscle of the water frog (Pelophylax ridibundus).

    Science.gov (United States)

    Feidantsis, Konstantinos; Anestis, Andreas; Vasara, Eleni; Kyriakopoulou-Sklavounou, Pasqualina; Michaelidis, Basile

    2012-08-01

    The present study aimed to investigate the seasonal cellular stress response in the heart and the gastrocnemius muscle of the amphibian Pelophylax ridibundus (former name Rana ridibunda) during an 8 month acclimatization period in the field. Processes studied included heat shock protein expression and protein kinase activation. The cellular stress response was addressed through the expression of Hsp70 and Hsp90 and the phosphorylation of stress-activated protein kinases and particularly p38 mitogen-activated protein kinase (p38 MAPK), the extracellular signal-regulated kinases (ERK-1/2) and c-Jun N-terminal kinases (JNK1/2/3). Due to a general metabolic depression during winter hibernation, the induction of Hsp70 and Hsp90 and the phosphorylation of p38 MAPK, JNKs and ERKs are retained at low levels of expression in the examined tissues of P. ridibundus. Recovery from hibernation induces increased levels of the specific proteins, probably providing stamina to the animals during their arousal. Copyright © 2012 Elsevier Inc. All rights reserved.

  20. Redescription of Protoopalina pingi Nie, 1935 inhabiting the recta of Hylarana guentheri and Pelophylax nigromaculatus in China

    Directory of Open Access Journals (Sweden)

    Li Weidong

    2014-01-01

    Full Text Available A redescription of Protoopalina pingi Nie, 1935 is presented in this paper to complete Nie’s description at both light and scanning electron microscope levels. These organisms were collected from the recta of the frogs Hylarana guentheri Boulenger, 1882 and Pelophylax nigromaculatus Hallowell, 1861 from Jialing River, Sichuan Province and Honghu Lake, Hubei Province, respectively, in China. This is the first record of its occurrence in H. guentheri and P. nigromaculatus. The body of P. pingi is elongated and somewhat spindle-like in shape, slightly narrowed and bluntly rounded at the anterior extremity, while the posterior end is tapering or sharply pointed. The body surface is thickly flagellated, with the caudal tip being barren. The falx, located at the margin of the anterior end, is composed of a narrow band of kinetosomes. Four round or oval-shaped nuclei, usually arranged in a straight line, are situated in the middle region of the body. Comparisons are made between P. pingi and its congeners.

  1. Total sialic acid profile in regressing and remodelling organs during the metamorphosis of marsh frog (Pelophylax ridibundus Pallas 1771).

    Science.gov (United States)

    Kaptan, Engin; Bas, Serap Sancar; Inceli, Meliha Sengezer

    2013-03-01

    This study aimed to investigate the functional relationship of sialic acid in regressing and remodelling organs such as the tail, small intestine and liver during the metamorphosis of Pelophylax ridibundus. For this purpose, four groups were composed according to developmental periods by considering Gosner's criteria (1964). Our findings showed that the sialic acid content of the larval tail has an opposite profile to cell death process. Although the sialic acid content of the small intestine and liver did not change evidently during metamorphosis, it increased after the completion of metamorphosis. Frog tail extensively exhibited cell death process and decreased proliferative activity and underwent complete degeneration during metamorphic climax. In spite of increased apoptotic index, a decreased sialic acid level in the tail tissues during climax can be the indication of a death cell removal process. However, the intestine and the liver included both cell death and proliferative process and remodelling in their adult forms. Thus, their sialic acid profiles during metamorphosis were different from the tail's profile. These data show that sialic acid may be an indicator of the presence of some cellular events during metamorphosis and that it can have different roles in the developmental process depending on the organ's fate throughout metamorphosis. Copyright © 2012 John Wiley & Sons, Ltd.

  2. Abelmoschus esculentus

    African Journals Online (AJOL)

    Pedro

    2015-02-16

    Doreddula et al., 2014). World ... sense, in order to introduce the market a new plant product, a study on the nutritional quality and ..... For some derivatives of phenolic acids, antioxidant activity has been reported, except for those of ...

  3. Oreochromis esculentus

    African Journals Online (AJOL)

    Prof. Adipala Ekwamu

    Displacement of the two LVR indigenous tilapiines was .... potential contamination of reaction conditions were ... populations was taken as a single locus. ... Table 1. Microsatellite primer sequences and reaction conditions for 10 loci used for.

  4. Responses of growth of lady's fingers (Abelmoschus esculentus L.) to different treatments methods of dairy wastewater.

    Science.gov (United States)

    Al-Dulaimi, Rana Ibrahim; Ismail, Norli; Ibrahim, Mahamad H

    2014-01-01

    Water is one of the most important precious resources found on the earth, and are most often affected by anthropogenic activities and by industry. Pollution caused by human beings and industries is a serious concern throughout the world. Population growth, massive urbanization, rapid rate of industrialization and modern techniques in agriculture have accelerated water pollution and led to the gradual deterioration of its quality. A large quantity of waste water disposed of at sea or on land has caused environmental problems which have led to environmental pollution, economic losses and chemical risks caused by the wastewater, and its impact on agriculture. However, waste water which contain nutrients and organic matter has possible advantages for agricultural purposes. Therefore, the presented study was undertaken to assess the impact of Dairy Effluent (treated and untreated waste water) on seed germination, seedling growth, dry matter production and the biochemical parameters of lady's fingers (Abelmoschus esculentus L.). A field experiment in a green house was conducted to use raw and treated dairy wastewater for watering lady's fingers (Abelmoschus esculentus L.). The plants were watered using (WW) raw dairy wastewater, (T1) chemicals treatment, (T2) physical treatment, (T3) dilution method treatment and tap water (TW) in pot experiments. Ten plants of each treatment /3 replicate were randomly selected and labelled for the collection of data. The data was collected sequentially, starting with chlorophyll content pre-harvest, vegetative qualities (shoot, root and seedling length) and dry matter quality (shoot and root dry matter) pos-tharvest. The effect was seen on the germination seed and growth of the plant. The results showed inhibitory effect from dairy effluent (WW) on seed germination and plant growth. Treatment with chemicals showed statistically significant differences with other treatments. Chemical treatment (TC2) at 20 mg/L Al2(SO4)3 and pH 6

  5. Carma 1 CM Line Survey of Orion-Kl

    Science.gov (United States)

    Friedel, Douglas; Looney, Leslie; Corby, Joanna F.; Remijan, Anthony

    2015-06-01

    We have conducted the first 1 cm (27-35 GHz) line survey of the Orion-KL region by an array. With a primary beam of ˜4.5 arcminutes, the survey looks at a region ˜166,000 AU (0.56 pc) across. The data have a resolution of ˜6 arcseconds on the sky and 97.6 kHz(1.07-0.84 km/s) in frequency. This region of frequency space is much less crowded than at 3mm or 1mm frequencies and contains the fundamental transitions of several complex molecular species, allowing us to probe the largest extent of the molecular emission. We present the initial results, and comparison to 3mm results, from several species including, dimethyl ether [(CH_3)_2O], ethyl cyanide [C_2H_5CN], acetone [(CH_3)_2CO], SO, and SO_2.

  6. Phytochemical analysis, antioxidant, antistress, and nootropic activities of aqueous and methanolic seed extracts of ladies finger (Abelmoschus esculentus L.) in mice.

    Science.gov (United States)

    Doreddula, Sathish Kumar; Bonam, Srinivasa Reddy; Gaddam, Durga Prasad; Desu, Brahma Srinivasa Rao; Ramarao, Nadendla; Pandy, Vijayapandi

    2014-01-01

    Abelmoschus esculentus L. (ladies finger, okra) is a well-known tropical vegetable, widely planted from Africa to Asia and from South Europe to America. In the present study, we investigated the in vitro antioxidant capacity and in vivo protective effect of the aqueous and methanolic seed extracts of Abelmoschus esculentus against scopolamine-induced cognitive impairment using passive avoidance task and acute restraining stress-induced behavioural and biochemical changes using elevated plus maze (EPM) and forced swimming test (FST) in mice. Our results demonstrated that the pretreatment of mice with aqueous and methanolic seed extracts of Abelmoschus esculentus (200 mg/kg, p.o.) for seven days significantly (P nootropic activities which promisingly support the medicinal values of ladies finger as a vegetable.

  7. Antioxidant response and metal accumulation in tissues of Iberian green frogs (Pelophylax perezi) inhabiting a deactivated uranium mine.

    Science.gov (United States)

    Marques, Sérgio M; Antunes, Sara C; Nunes, Bruno; Gonçalves, Fernando; Pereira, Ruth

    2011-08-01

    Human mining activities tend often to generate greatly impacted areas which remain contaminated for long periods of time, giving rise to extreme habitats. Mining sites are usually characterized for the production of metal rich effluents with very low pH. In this work we analyzed physical and chemical parameters of water from a deactivated uranium mine pond (M) and a reference site (REF) as well as their metal content. Furthermore, we determined and compared metal accumulation in liver, kidney, bones, muscle and skin of Pelophylax perezi from REF with P. perezi from M. We also determined the enzymatic activities of glutathione-S-transferases (GSTs), catalase (CAT), glutathione reductase (Gred), and glutathione peroxidase (GPx; both selenium-dependent and selenium-independent) in liver, kidney, lung and heart. Additionally, lipoperoxidation (LPO) was also assessed in the same tissues via thiobarbituric acid reactive substances (TBARS) assay and lactate dehydrogenase (LDH) activity was determined in muscle. Our results revealed that the majority of metals were in higher concentrations in tissues of organisms from M. This trend was especially evident for U whose content reached a difference of 1350 fold between REF and M organisms. None of the organs tested for antioxidant defenses revealed LPO, nonetheless, with exception for liver, all organs from the M frogs presented increased total GPx activity and selenium-dependent GPx. However, this response was significant only for the lung, probably as a consequence of the significant inhibition of CAT upstream and to cope with the subsequent increase in H(2)O(2). Lungs were the organs displaying greater responsiveness of the anti-oxidant stress system in frogs from the uranium mine area.

  8. Genetic relationships among okra (Abelmoschus esculentus (L. Moench cultivars in Nigeria

    Directory of Open Access Journals (Sweden)

    Bashir O. Bello

    2017-09-01

    Full Text Available This study was conducted on okra (Abelmoschus esculentus (L. Moench cultivars at the Teaching and Research Farm, University of Maiduguri, Nigeria. The objective was to evaluate the level of genetic divergence and heritability of eight characters in 2015 and 2016 dry seasons using irrigation. The results showed highly significant (p<0.01 differences in the ten okra cultivars for days to anthesis, plant height, fresh capsule length, fresh mass per capsule and fresh capsule diameter across the two years. A high genotypic coefficient of variation, heritability, and genetic advance were detected in all the characters except for days to anthesis and fresh capsule diameter. This implied that different genetic constitution and preponderance of additive effects governed these characters, thus presenting a significant opportunity for selection. The Mahanalobis D2 analysis allotted the ten cultivars into four clusters. The highest was cluster I comprising four cultivars, followed by cluster II containing three cultivars, cluster III consisting two cultivars, and cluster IV with mono genotypic. The three most superior okra cultivars (Salkade, Y’ar gagure and Kwadag for yield and related characters could be exploited directly or introgressed with other promising ones in future breeding programs.

  9. Physicochemical Characteristics and Composition of Three Morphotypes of Cyperus esculentus Tubers and Tuber Oils

    Directory of Open Access Journals (Sweden)

    Souleymane Bado

    2015-01-01

    Full Text Available Tuber characteristics and nutrient composition of three morphotypes of Cyperus esculentus tubers and tuber oils were determined. The mean value for length and width of the tuber and one thousand dried tuber weights ranged from 0.98 to 1.31 cm, 0.90 to 1.19 cm, and 598 to 1044 g, respectively. Tubers displayed high level of starch (30.54–33.21 g 100 g−1, lipid (24.91–28.94 g 100 g−1, and sucrose (17.98–20.39 g 100 g−1. The yellow tubers had significantly higher content in lipid compared to black ones. Levels of ascorbic acid, tocopherol, and β-carotene of the three morphotypes differed significantly. Yellow ones (morphotypes 1 and 2 were the richest in tocopherol and the poorest in β-carotene. Saturated fatty acid content of morphotype 2 was significantly lower than that of morphotypes 1 and 3. Morphotype 3 had the significantly lowest PUFA content compared to morphotypes 1 and 2. Morphotype 1 was found to be richer in Ca, Cu, and Mn contents. Al, Mg, P, S, and Si were most abundant in morphotype 2. Morphotype 3 had the highest content of Cl, K, and Zn.

  10. Physicochemical, functional and sensory attributes of milk prepared from irradiated tiger nut (Cyperus esculentus L.

    Directory of Open Access Journals (Sweden)

    Abenaa A. Okyere

    2014-10-01

    Full Text Available Five tiger nut (Cyperus esculentus L. cultivars were collected from four different regions of Ghana and irradiated. The aim of this study was to evaluate some physicochemical, functional and sensory qualities of milk produced from irradiated tiger nut samples. Analysis was carried out for pH, total solids, moisture, sugar brix and viscosity. Finally the consumer acceptability of the milk prepared from the nuts was determined by a taste panel using the parameters of colour, taste, aroma, mouth feel and overall acceptability. The sugar content varied from 6.0 ± 0.3% (Techiman to 15.00 ± 1.00% (Asebu Ekroful depending on the irradiation dose applied. Generally, increase in dose increased the sugar availability but decreased viscosity of the milk prepared from the nuts. The milk with the highest viscosity was from Kwahu Aduamoa and Techiman with the least viscosity from Bawjiase. Generally, no significant difference was detected by the sensory panellists with regard to mouth feel and taste among the milk samples prepared from the various tiger nut cultivars.

  11. Preparation and Characterization of Polyelectrolyte Complexes of Hibiscus esculentus (Okra Gum and Chitosan

    Directory of Open Access Journals (Sweden)

    Vivekjot Brar

    2018-01-01

    Full Text Available Polyelectrolyte complexes (PECs of Okra gum (OKG extracted from fruits of Hibiscus esculentus (Malvaceae and chitosan (CH were prepared using ionic gelation technique. The PECs were insoluble and maximum yield was obtained at weight ratio of 7 : 3. The supernatant obtained after extracting PECs was clearly representing complete conversion of polysaccharides into PECs. Complexation was also evaluated by measuring the viscosity of supernatant after precipitation of PECs. The dried PECs were characterized using FTIR, DSC, zeta potential, water uptake, and SEM studies. Thermal analysis of PECs prepared at all ratios (10 : 90, 20 : 80, 30 : 70, 40 : 60, 50 : 50, 60 : 40, 70 : 30, 80 : 20, and 90 : 10; OKG : CH depicted an endothermic peak at approximately 240°C representing cleavage of electrostatic bond between OKG and CH. The optimized ratio (7 : 3 exhibited a zeta potential of −0.434 mV and displayed a porous structure in SEM analysis. These OKG-CH PECs can be further employed as promising carrier for drug delivery.

  12. A Novel Natural Product, KL-21, Inhibits Proliferation and Induces Apoptosis in Chronic Lymphocytic Leukemia Cells

    Directory of Open Access Journals (Sweden)

    Aysun Adan Gökbulut

    2015-06-01

    Full Text Available INTRODUCTION: The aims of this study were to examine the cytotoxic and apoptotic effects of KL-21, a novel plant product (produced by Naturin Natural Products, İzmir, Turkey, on 232B4 chronic lymphocytic leukemia (CLL cells and to determine the cytotoxic effects on healthy BEAS-2B human bronchial epithelial cells. METHODS: The cytotoxic effect of KL-21 was determined by MTT cell proliferation assay. Changes in caspase-3 enzyme activity were measured using the caspase-3 colorimetric assay. Changes in mitochondrial membrane potential were determined using the JC-1 dye-based method. Annexin V-FITC/PI double staining was performed to measure the apoptotic cell population. Effects of KL-21 on cell cycle profiles of CLL cells were investigated by flow cytometry. RESULTS: We detected time- and concentration-dependent increases in the cytotoxic effect of KL-21 on 232B4 CLL cells. However, we also showed that, especially at higher concentrations, KL-21 was less cytotoxic towards BEAS-2B healthy cells than towards CLL cells. Annexin-V/PI double staining results showed that the apoptotic cell population increased in 232B4 cells. Increasing concentrations of KL-21 increased caspase-3 enzyme activity and induced loss of mitochondrial membrane potential. KL-21 administration resulted in small increases in the percentage of the cells in the G0/G1 phase while it decreased the S phase cell population up to 1 mg/mL. At the highest concentration, most of the cells accumulated in the G0/G1 phase. DISCUSSION AND CONCLUSION: KL-21 has a growth-inhibitory effect on 232B4 CLL cells. KL-21 causes apoptosis and cell cycle arrest at G0/G1.

  13. Usefulness of serum KL-6 and SP-D in the diagnosis of radiation pneumonitis

    International Nuclear Information System (INIS)

    Saika, Yoshinori; Doi, Kenji; Misaki, Toshimasa; Tatsumi, Tomoaki; Komori, Tsuyoshi; Narabayashi, Isamu

    2004-01-01

    The objective of this study was to investigate the usefulness of serum KL-6 and SP-D in the diagnosis of radiation pneumonitis. We measured serum KL-6 and SP-D in patients undergoing radiation therapy of the chest, primarily for lung cancer, in the Department of Radiology, Osaka Medical College and compared the results with the findings on plain chest X-ray films and thoracic computed tomography conducted at the same time. The sensitivity of serum KL-6 and SP-D for diagnosing radiation pneumonitis were 68.2% and 70.0%, respectively, the specificity were 86.6% and 80.0%, and the accuracy were 82.0% and 77.8%. Examination of the relationship between lesion extent and activity and serum KL-6 showed that serum KL-6 values were higher when the lesion extended beyond the irradiation field than when the lesion was confined to within the irradiation field and that the value tended to be lower for old lesions than for active lesions. In patients with radiation pneumonitis in whom serum KL-6 and SP-D could be measured over time, KL-6 tended to increase after the lesion was discovered by imaging, whereas SP-D increased prior to this in many cases. Examination of the comparison between before radiotherapy and just after radiotherapy in the patients with radiation pneumonitis showed that SP-D had a consistent tendency to increase. Both serum KL-6 and SP-D had a satisfactory degree of sensitivity and specificity for diagnosing radiation pneumonitis. Serum KL-6 correlated with the extent and activity of the lesions. The results suggested that serum SP-D may be helpful for the early detection of radiation pneumonitis. (author)

  14. Segmentectomy for giant pulmonary sclerosing haemangiomas with high serum KL-6 levels

    Science.gov (United States)

    Kuroda, Hiroaki; Mun, Mingyon; Okumura, Sakae; Nakagawa, Ken

    2012-01-01

    We describe a 61-year old female patient with a giant pulmonary sclerosing haemangioma (PSH) and an extremely high preoperative serum KL-6 level. During an annual health screening, the patient showed a posterior mediastinal mass on chest radiography. Chest computed tomography and magnetic resonance imaging revealed a well-circumscribed 60 mm diameter nodule with a marked contrast enhancement in the left lower lobe. The preoperative serum KL-6 level was elevated to 8204 U/ml. We performed a four-port thoracoscopic basal segmentectomy and lymph node sampling for diagnosis and therapy. The postoperative diagnosis showed PSH. The serum KL-6 level decreased dramatically with tumour resection. To the best of our knowledge, this is the first report of a patient with PSH showing a high serum KL-6 level. PMID:22454483

  15. Physicochemical, functional and pasting properties of flour produced from gamma irradiated tiger nut (Cyperus esculentus L.)

    International Nuclear Information System (INIS)

    Ocloo, Fidelis C.K.; Okyere, Abenaa A.; Asare, Isaac K.

    2014-01-01

    Tiger nut (Cyperus esculentus L.) has been recognised as one of the best nutritional crops that can be used to augment the Ghanaian diet. The application of gamma irradiation as means of preserving tiger nut could modify the characteristics of resultant flour. The purpose of this study was to determine the physicochemical, functional and pasting characteristics of flour from gamma irradiated tiger nut. The yellow and black types of tiger nut were sorted, washed and dried in an air-oven at 60 o C for 24 h. The dried tiger nut samples were irradiated at 0.0, 2.5, 5.0 and 10.0 kGy and then flours produced from them. Moisture, ash, pH, titratable acidity, water and oil absorption capacities, swelling power, solubility, bulk density and pasting properties of the flours were determined using appropriate analytical methods. Results showed that irradiation did not significantly (P>0.05) affect the moisture and ash contents of the resultant flours. Gamma irradiation significantly (P≤0.05) increased titratable acidity with concomitant decrease in pH of the flours. No significant differences were observed for water and oil absorption capacities, swelling power as well as bulk density. Solubility significantly (P≤0.05) increased generally with irradiation dose. Peak viscosity, viscosities at 92 °C and 55 °C, breakdown and setback viscosities decreased significantly with irradiation dose. Flour produced from irradiated tiger nut has a potential in complementary food formulations due to its low viscosity and increased solubility values. - Highlights: • Physicochemical, functional and pasting characteristics of flour from gamma irradiated tiger nut were studied. • Irradiation did not affect the moisture and ash contents of the resultant flours. • Titratable acidity increased with decrease in pH of the flours from the irradiated tiger nut. • Solubility increased whereas peak viscosity decreased with irradiation dose. • Flour produced from irradiated tiger nut has a

  16. Antiadhesive Properties of Abelmoschus esculentus (Okra) Immature Fruit Extract against Helicobacter pylori Adhesion

    Science.gov (United States)

    Shevtsova, Anna; Glocker, Erik; Borén, Thomas; Hensel, Andreas

    2014-01-01

    Background Traditional Asian and African medicine use immature okra fruits (Abelmoschus esculentus) as mucilaginous food to combat gastritis. Its effectiveness is due to polysaccharides that inhibit the adhesion of Helicobacter pylori to stomach tissue. The present study investigates the antiadhesive effect in mechanistic detail. Methodology A standardized aqueous fresh extract (Okra FE) from immature okra fruits was used for a quantitative in vitro adhesion assay with FITC-labled H. pylori J99, 2 clinical isolates, AGS cells, and fluorescence-activated cell sorting. Bacterial adhesins affected by FE were pinpointed using a dot-blot overlay assay with immobilized Lewisb, sialyl-Lewisa, H-1, laminin, and fibronectin. 125I-radiolabeled Okra FE polymer served for binding studies to different H. pylori strains and interaction experiments with BabA and SabA. Iron nanoparticles with different coatings were used to investigate the influence of the charge-dependence of an interaction on the H. pylori surface. Principal findings Okra FE dose-dependently (0.2 to 2 mg/mL) inhibited H. pylori binding to AGS cells. FE inhibited the adhesive binding of membrane proteins BabA, SabA, and HpA to its specific ligands. Radiolabeled compounds from FE bound non-specifically to different strains of H. pylori, as well as to BabA/SabA deficient mutants, indicating an interaction with a still-unknown membrane structure in the vicinity of the adhesins. The binding depended on the charge of the inhibitors. Okra FE did not lead to subsequent feedback regulation or increased expression of adhesins or virulence factors. Conclusion Non-specific interactions between high molecular compounds from okra fruits and the H. pylori surface lead to strong antiadhesive effects. PMID:24416297

  17. Segmentectomy for giant pulmonary sclerosing haemangiomas with high serum KL-6 levels

    OpenAIRE

    Kuroda, Hiroaki; Mun, Mingyon; Okumura, Sakae; Nakagawa, Ken

    2012-01-01

    We describe a 61-year old female patient with a giant pulmonary sclerosing haemangioma (PSH) and an extremely high preoperative serum KL-6 level. During an annual health screening, the patient showed a posterior mediastinal mass on chest radiography. Chest computed tomography and magnetic resonance imaging revealed a well-circumscribed 60 mm diameter nodule with a marked contrast enhancement in the left lower lobe. The preoperative serum KL-6 level was elevated to 8204 U/ml. We performed a fo...

  18. KINETICS OF MODULATORY ROLE OF Cyperus esculentus L. ON THE SPECIFIC ACTIVITY OF KEY CARBOHYDRATE METABOLIZING ENZYMES.

    Science.gov (United States)

    Sabiu, Saheed; Ajani, Emmanuel Oladipo; Sunmonu, Taofik Olatunde; Ashafa, Anofi Omotayo Tom

    2017-01-01

    The continuous search for new lead compounds as viable inhibitors of specific enzymes linked to carbohydrate metabolism has intensified. Cyperus esculentus L. is one of the therapeutically implicated botanicals against several degenerative diseases including diabetes mellitus. This study evaluated the antioxidant and mechanism(s) of inhibitory potential of aqueous extract of C. esculentus on α-amylase and α-glucosidase in vitro . The extract was investigated for its radical scavenging and hypoglycaemic potentials using standard experimental procedures. Lineweaver-Burke plot was used to predict the manner in which the enzymes were inhibited. The data obtained revealed that the extract moderately and potently inhibited the specific activities of α -amylase and α -glucosidase, respectively. The inhibition was concentration-related with respective IC 50 values of 5.19 and 0.78 mg/mL relative to that of the control (3.72 and 3.55 mg/mL). The extract also significantly scavenged free radicals and the effects elicited could be ascribed to its phytoconstituents. The respective competitive and non-competitive mode of action of the extract is due to its inhibitory potentials on the activities of α -amylase and α -glucosidase. Going forward, in addition to completely characterize the exact compound(s) responsible for the elicited activity in this study, pertinent attention will be given to the in vivo evaluation of the identified constituents.

  19. Potential of Soil Amendments (Biochar and Gypsum in increasing Water Use Efficiency of Abelmoschus esculentus L. Moench

    Directory of Open Access Journals (Sweden)

    Aniqa eBatool

    2015-09-01

    Full Text Available Water being an essential component for plant growth and development, its scarcity poses serious threat to crops around the world. Climate changes and global warming are increasing the temperature of earth hence becoming an ultimate cause of water scarcity. It is need of the day to use potential soil amendments that could increase the plants’ resistance under such situations. Biochar and gypsum were used in the present study to improve the water use efficiency and growth of Abelmoschus esculentus L. Moench (Lady’s Finger. A six weeks experiment was conducted under greenhouse conditions. Stress treatments were applied after thirty days of sowing. Plant height, leaf area, photosynthesis, transpiration rate, stomatal conductance and water use efficiency were determined weekly under stressed (60% field capacity and non-stressed (100% field capacity conditions. Stomatal conductance and transpiration rate decreased and reached near to zero in stressed plants. Stressed plants also showed resistance to water stress upto five weeks and gradually perished at sixth week. On the other hand, water use efficiency improved in stressed plants containing biochar and gypsum as compared to untreated plants. Biochar alone is a better strategy to promote plant growth and WUE specifically of Abelmoschus esculentus, compared to its application in combination with gypsum.

  20. Searching for trans ethyl methyl ether in Orion KL.

    Science.gov (United States)

    Tercero, B; Cernicharo, J; López, A; Brouillet, N; Kolesniková, L; Motiyenko, R A; Margulès, L; Alonso, J L; Guillemin, J-C

    2015-10-01

    We report on the tentative detection of trans ethyl methyl ether (tEME), t-CH 3 CH 2 OCH 3 , through the identification of a large number of rotational lines from each one of the spin states of the molecule towards Orion KL. We also search for gauche-trans-n-propanol, Gt-n-CH 3 CH 2 CH 2 OH, an isomer of tEME in the same source. We have identified lines of both species in the IRAM 30 m line survey and in the ALMA Science Verification data. We have obtained ALMA maps to establish the spatial distribution of these species. Whereas tEME mainly arises from the compact ridge component of Orion, Gt-n-propanol appears at the emission peak of ethanol (south hot core). The derived column densities of these species at the location of their emission peaks are ≤(4.0 ± 0.8) × 10 15 cm -2 and ≤(1.0 ± 0.2)× 10 15 cm -2 for tEME and Gt-n-propanol, respectively. The rotational temperature is ~100 K for both molecules. We also provide maps of CH 3 OCOH, CH 3 CH 2 OCOH, CH 3 OCH 3 , CH 3 OH, and CH 3 CH 2 OH to compare the distribution of these organic saturated O-bearing species containing methyl and ethyl groups in this region. Abundance ratios of related species and upper limits to the abundances of non-detected ethers are provided. We derive an abundance ratio N (CH 3 OCH 3 )/ N (tEME) ≥ 150 in the compact ridge of Orion.

  1. The nutraceutical benefits of subfractions of Abelmoschus esculentus in treating type 2 diabetes mellitus.

    Directory of Open Access Journals (Sweden)

    Chien-Ning Huang

    Full Text Available Abelmoschus esculentus (AE, a commonly consumed vegetable, is well-known for its anti-hyperglycemic effects. However, few scientific reports have identified its targets because mucilage increases the difficulty of manipulation. We recently reported extraction steps to obtain subfractions of AE, which were found to attenuate the adverse effects of high glucose and fatty acid in vitro. In this study, we used modified extraction steps and type 2 diabetic rats to explore whether AE subfractions can improve the metabolic disturbances caused by insulin resistance in vivo. AE subfractions (F1, F2, and FR were prepared. The type 2 diabetes model was induced by feeding male Sprague-Dawley rats with a high-fat diet and injecting them with 35 mg/kgbw streptozotocin when their body weight reached 475 ± 15 g. After a hyperglycemic status had been confirmed, the rats were tube-fed with or without different doses of AE subfractions. Serum glucose, lipid markers, insulin, HbA1c and HOMA-IR were measured in the following 12 weeks. Serum glucose promptly increased and insulin resistance was noted in the diabetic rats (glucose: 360-500 mg/dl, HOMA-IR 9.8-13.8. F2, rich in polysaccharides and carbohydrates, was most effective in attenuating hyperglycemia and insulin resistance (glucose: 200 mg/dl; HOMA-IR: 5.3 and especially HbA1C (from 8.0% to 6.5%. All of the AE subfractions lowered the level of triglycerides and free fatty acid, but not the level of total cholesterol. FR significantly increased the high-density lipoprotein/low-density lipoprotein ratio, indicating its benefits for lipoprotein profiles. While F2 and FR were associated with weight gain, F1 possessed an anti-obese effect. In conclusion, whether it is consumed as a vegetable or as a nutraceutical, AE has the potential to be an adjuvant therapy for diabetes. AE subfractions could be developed individually and deserve further investigation.

  2. Penalty-rewards contrast analysis (PRCA) on the KL monorail services

    Science.gov (United States)

    Muda, Nora; Suradi, Nur Riza; Mat Roji, Noor Sulawati

    2013-04-01

    Changes in living standards, tastes, views and education has changed the lifestyles where people are more emphasizing on quality and satisfaction with public amenities provided. One of the services provided is the KL Monorail; a public transport service which is based on a single beam track in the city that connects the north and center of Kuala Lumpur. Therefore, this study measures the customer satisfaction on the KL Monorail services and to identify the factors that should be given priority in improving their service levels. There were seven attributes being studied, namely the informations, the situation at the station, the situation in the KL Monorail, customer service, safety, efficiency and other aspects. The analysis found that the overall customer satisfactionis mean is 4.86. Based on the measurement of Penalty-Reward Contrast Analysis (PRCA), most of the KL Monorail service attribute are at moderate level of satisfaction except for the attributes at the station that have lower level of satisfaction. Therefore, a remedial actions or planning is needed to improve the customer satisfaction on the KL Monorail services.

  3. Influence of seaweed liquid fertilizer of ulva lactuca on the seed germination, growth, productivity of Abelmoschus esculentus (L.

    Directory of Open Access Journals (Sweden)

    Kaisarla Divya

    2015-12-01

    Full Text Available The present investigation is an attempt to study the influence of seaweed liquid fertiliger (SLF extracted from the marine green algae ulva lactuca on the growth parameters of Abelmoschus esculentus (l medikus. The seeds were soaked in different concentrations of SLF viz., 2.5%, 5%, 10%, 20% and control for 6h. The foliar spry was applied twice at four concentrations of seaweed extract. The maximum growth was recorded at 5% concentration viz., seed germination, shoot length, root length, no. of flowers, no. of fruits, fresh weight and dry weight when compare to control and remaining concentrations of seaweed extract. The seaweed extract are found effective in increasing the growth parameters.

  4. Modified k-l model and its ability to simulate supersonic axisymmetric turbulent flows

    International Nuclear Information System (INIS)

    Ahmadikia, H.; Shirani, E.

    2001-05-01

    The k-l turbulence model is a promising two-equation model. In this paper, the k and l model equations were derived from k-kl incompressible and one-equation turbulent models. Then the model was modified for compressible and transitional flows, and was applied to simulate supersonic axisymmetric flows over Hollow cylinder flare an hyperboloid flare bodies. The results were compared with the results obtained for the same flows experimentally as well as k-ε, k-ω and Baldwin-Lomax models. It was shown that the k-l model produces good results compared with experimental data and numerical data obtained when other turbulence models were used. It gives better results than k-ω and k-ε models in some cases. (author)

  5. Melatonin ve Bağışıklık Sistemi

    OpenAIRE

    ÇETİN, E.

    2005-01-01

    Melatonin, pineal bezin beta adrenerjik reseptörlerinin aktivasyonu ile triptofandan sentezlenen bir hormondur.Üretim ve salınımı karanlık ile başlar ve aydınlıkla sona erer. Melatonin, birçok biyolojik fonksiyonun düzenlenmesinderol oynar. Bu derlemede melatonin hakkında genel bilgiler verilerek, melatoninin lenfoid dokular, humoral bağışıklık,hücresel bağışıklık ve kanser üzerine etkileri tartışılmıştır

  6. Er Trump som kejseren i "Kejserens nye klæder"?

    DEFF Research Database (Denmark)

    Ritter, Thomas; Lund Pedersen, Carsten

    2017-01-01

    Den tilbagevendende sag om Trumps dekret vedrørende indrejseforbud har givet os et indblik i dette klassiske ledelsesdilemma, der trækker tråde tilbage til eventyret om Kejserens nye Klæder. H. C. Andersens berømte fortælling om Kejserens nye klæder indeholder tre vigtige ledelsesmæssige pointer......, der netop har bevist dets relevans i sagen om Trumps indrejseforbud. Ligesom kejseren i fortællingen, så udviser Trump generelt en alternativ virkelighedsopfattelse....

  7. Workshop on Physics with Neutral Kaon Beam at JLab (KL2016) Mini-Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Strakovsky, Igor I. [George Washington Univ., Washington, DC (United States); Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Amaryan, Moskov [Old Dominion Univ., Norfolk, VA (United States); Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Chudakov, Eugene A. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Meyer, Curtis A. [Carnegie Mellon Univ., Pittsburgh, PA (United States); Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Pennington, Michael R. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Ritman, James L. [Forschungszentrum Juelich Institut fuer Kernphysik

    2016-05-01

    The KL2016 Workshop is following the Letter of Intent LoI12-15-001 "Physics Opportunities with Secondary KL beam at JLab" submitted to PAC43 with the main focus on the physics of excited hyperons produced by the Kaon beam on unpolarized and polarized targets with GlueX setup in Hall D. Such studies will broaden a physics program of hadron spectroscopy extending it to the strange sector. The Workshop was organized to get a feedback from the community to strengthen physics motivation of the LoI and prepare a full proposal.

  8. Flavonoids derived from Abelmoschus esculentus attenuatesUV-B Induced cell damage in human dermal fibroblasts throughNrf2-ARE pathway

    OpenAIRE

    Juilee Patwardhan; Purvi Bhatt

    2016-01-01

    Background: Ultraviolet-B (UV-B) radiation is a smaller fraction of the total radiation reaching the Earth but leads to extensive damage to the deoxyribonucleic acid (DNA) and other biomolecules through formation of free radicals altering redox homeostasis of the cell. Abelmoschus esculentus (okra) has been known in Ayurveda as antidiabetic, hypolipidemic, demulscent, antispasmodic, diuretic, purgative, etc. Objective: The aim of this study is to evaluate the protective effect of flavonoids f...

  9. The Preotective effects of Okra Powder (Abelmoschus esculentus on Histological and Histochemical Changes of Pancreatic Beta Cells and Liver Tissue of Diabetic Rat

    Directory of Open Access Journals (Sweden)

    Naeim Erfani Majd

    2017-04-01

    Full Text Available Background and Objective: Since Abelmoschus esculentus plant has many medical benefits, the present study aimed to investigate the therapeutic effects of Okra Powder (Abelmoschus esculentus against high-fat diet fed-streptozotocin (HFD/STZ-induced diabetic rats. Methods: In this experimental study, 25 Wistar Albino female rats were randomly divided into 5 groups: I: control group; II: healthy rats receiving A. esculentus (200 mg/kg; III (HFD/STZ group: Rats fed with high-fat diet (HFD (60% fat for 4 weeks and then injected low-dose STZ (35 mg/kg; IV: diabetic rats receiving A. esculentus (200mg/kg and V: diabetic rats receiving metformin (200 mg/kg. At the end of experiment, biochemical parameters, including Fasting Blood Glucose (FBG, insulin levels, Homa-IR index, ALT, AST and lipid profile were measured. Pancreas and Liver samples were removed, and 5-6 µ sections were prepared and stained by H&E and aldehyde fuchsin staining. Results: All the biochemical parameters, except HDL-C and insulin, were increased in diabetic rats, while these parameters were decreased in Okra supplementation group compared to diabetic rats (p<0.05. Furthermore, Okra improved the histological impairments of pancreas and liver, including vacuolization, and decrease of β-cells as well as hypertrophy and vacuolization of hepatocytes in diabetic rats. Conclusion: Okra powder improved biochemical parameters, liver structure and restoration of beta cells of pancreas in diabetic rats. Thus, it can be considered a complementary therapy to improve diabetic patients.

  10. Patogeneze klíšťové encefalitidy a možnosti antivirové terapie

    Czech Academy of Sciences Publication Activity Database

    Růžek, Daniel

    2015-01-01

    Roč. 64, č. 4 (2015), s. 204-209 ISSN 1210-7913 Institutional support: RVO:60077344 Keywords : virus klíšťové encefalitidy * klíšťová encefalitida * antivirová terapie * patogeneze Subject RIV: EC - Immunology Impact factor: 0.268, year: 2015

  11. KINETIC TEMPERATURES OF THE DENSE GAS CLUMPS IN THE ORION KL MOLECULAR CORE

    International Nuclear Information System (INIS)

    Wang, K.-S.; Kuan, Y.-J.; Liu, S.-Y.; Charnley, Steven B.

    2010-01-01

    High angular-resolution images of the J = 18 K -17 K emission of CH 3 CN in the Orion KL molecular core were observed with the Submillimeter Array (SMA). Our high-resolution observations clearly reveal that CH 3 CN emission originates mainly from the Orion Hot Core and the Compact Ridge, both within ∼15'' of the warm and dense part of Orion KL. The clumpy nature of the molecular gas in Orion KL can also be readily seen from our high-resolution SMA images. In addition, a semi-open cavity-like kinematic structure is evident at the location between the Hot Core and the Compact Ridge. We performed excitation analysis with the 'population diagram' method toward the Hot Core, IRc7, and the northern part of the Compact Ridge. Our results disclose a non-uniform temperature structure on small scales in Orion KL, with a range of temperatures from 190-620 K in the Hot Core. Near the Compact Ridge, the temperatures are found to be 170-280 K. Comparable CH 3 CN fractional abundances of 10 -8 to 10 -7 are found around both in the Hot Core and the Compact Ridge. Such high abundances require that a hot gas phase chemistry, probably involving ammonia released from grain mantles, plays an important role in forming these CH 3 CN molecules.

  12. Aperture synthesis observations of NH3 in OMC-1 - Filamentary structures around Orion-KL

    International Nuclear Information System (INIS)

    Murata, Yasuhiro; Kawabe, Ryohei; Ishiguro, Masato; Morita, Kohichiro; Kasuga, Takashi

    1990-01-01

    Aperture synthesis observations of the Orion molecular cloud 1 (OMC-1) have been made in NH 3 (1, 1) and (2, 2) emission at 23.7 GHz, using the Nobeyama Millimeter Array (NMA), and obtained 16 arcsec resolution maps for OMC-1 and 8 arcsec resolution maps for the Orion-KL region. Filamentary structures extending over 0.5 pc from the Orion-KL region to the north and northwest directions were found. These structures are associated with the H2 finger structures and Herbig-Haro objects which are located at the blue-shifted side of the bipolar molecular outflow. The results suggest that these filaments are ambient molecular cloudlets with shocked surfaces caused by the strong stellar wind from the Orion-KL region. The 8 arcsec resolution NH 3 (2, 2) maps show the extended features around the hot core of Orion-KL. These extended features correspond to the rotating disk and shocked shell associated with the bipolar molecular outflow. 37 refs

  13. Observations of far-infrared line profiles in the Orion-KL region

    International Nuclear Information System (INIS)

    Crawford, M.K.; Lugten, J.B.; Fitelson, W.; Genzel, R.; Melnick, G.; Harvard-Smithsonian Center for Astrophysics, Cambridge, MA)

    1986-01-01

    Measurements of several far-infrared emission line profiles in the Orion-KL region are reported. The emission from the CO, OH, and forbidden O I emission lines toward the BN-KL and H2 peak 1 positions probably comes from dense, hot molecular gas in the Orion-KL shock. The CO and forbidden O I lines have similar profiles, suggesting that the high-velocity forbidden O I emission also arises in magnetohydrodynamic cloud shocks. The velocity centroids of the lines are somewhat blueshifted. The far-infrared data thus support the interpretation that the blue asymmetry of the H2 2 micron lines is not mainly due to differential dust extinction, but rather to the kinematics and geometry of the shocked gas in the Orion-KL outflow. The forbidden O I and CO lines, however, have significantly less extreme blueshifted emission than the H2 lines. Both the forbidden O I 63 micron and forbidden C II 158 micron lines have features strongly supporting a common origin near the surface of the Orion molecular cloud. 28 references

  14. Mosaiigitükid vajavad uut moodi kokkupanekut / Martin Klöker ; intervjueerinud Katrin Kaugver

    Index Scriptorium Estoniae

    Klöker, Martin, 1966-

    2012-01-01

    Intervjuu kirjandus- ja kultuuriloolase Martin Klökeriga, kes viibis TLÜAR-i kutsel 2012. a märtsis Tallinnas ning pidas avaliku loengu "Ebatäielik pilt: trükitud raamat ja käsikiri kultuuride uurimises" ning kokkuvõte loengust

  15. Seasonal variations of anti-/apoptotic and antioxidant proteins in the heart and gastrocnemius muscle of the water frog Pelophylax ridibundus.

    Science.gov (United States)

    Feidantsis, Konstantinos; Anestis, Andreas; Michaelidis, Basile

    2013-10-01

    In the present work we investigated the seasonal variations of apoptotic and antioxidant proteins in the heart and gastrocnemius muscle of the amphibian Pelophylax ridibundus. Particularly processes studied included the evaluation of hypoxia through the levels of transcriptional factor Hif-1α, of apoptosis through the determination of Bcl-2 and Bax, ubiquitin conjugates levels and the antioxidant defense through the determination of the activity of enzymes such as superoxide dismutase, catalase and glutathione peroxidase. Due to a general metabolic depression during overwintering, levels of the above mentioned proteins and enzymes are generally retained at low levels of expression and activity in the examined tissues of P. ridibundus. On the other hand recovery from overwintering induces oxidative stress, followed by increased levels of the specific proteins and enzymes. A milder up-regulation of antioxidant enzymes during overwintering probably prepares P. ridibundus for oxidative stress during arousal. The seasonal activation of these mechanisms seems to protect this species from these unfavourable conditions. Copyright © 2013 Elsevier Inc. All rights reserved.

  16. Is trace element concentration correlated to parasite abundance? A case study in a population of the green frog Pelophylax synkl. hispanicus from the Neto River (Calabria, southern Italy).

    Science.gov (United States)

    De Donato, Carlo; Barca, Donatella; Milazzo, Concetta; Santoro, Raffaella; Giglio, Gianni; Tripepi, Sandro; Sperone, Emilio

    2017-06-01

    Bioaccumulation of 13 trace elements in the livers of 38 Pelophylax sinkl. hispanicus (Ranidae) and its helminth communities were studied and compared among three sites, each with a different degree of pollution along River Neto (south Italy) during September, 2014. Trace element concentrations in water and liver were measured using inductively coupled plasma mass spectrometry. For most elements, the highest concentration was recorded in the frogs inhabiting the third site, the one with the highest degree of pollution. The trend of trace element concentration in the liver can be represented as follows: Cu > Zn > Mn > Se > Cr. Concentrations of some elements in water and liver samples were significantly different among the three sites and this is evidenced by the bioaccumulation in the frogs. Four species of helminths, all belonging to Nematoda, were found: Rhabdias sp., Oswaldocruzia filiformis (Goeze, 1782), Cosmocerca ornata (Dujarden, 1845), Seuratascaris numidica (Seurat, 1917). The parasite survey presents an important difference of prevalence and average number of helminths in frogs between the three sites. Correlating parasitological and ecotoxicological data showed a strong positive correlation between prevalence and number of parasites with some trace elements such as Mn, Co, Ni, As, Se, and Cd.

  17. Combined effects of Psoralens and ultraviolet-B on growth, pigmentation and biochemical parameters of Abelmoschus esculentus L.

    Science.gov (United States)

    Kumari, Rima; Singh, Suruchi; Agrawal, S B

    2009-05-01

    The effects of pre-treatment of Psoralens (furocoumarin compounds) and supplemental ultraviolet-B (sUV-B) were studied on plant growth, photosynthetic and non-photosynthetic pigments, protein, phenylalanine ammonia lyase (PAL) activity and antioxidative defense potential as well as their ultimate effects on biomass production in Abelmoschus esculentus L. (Okra) plants. Psoralens are capable of absorbing radiant energy and stimulating the pigmentation of human skin when photo-activated in presence of UV-A or UV-B making them beneficial in the treatment of vitilago. Pre-treatment of Psoralens against sUV-B (pUV-B), stimulates higher production of UV-B protective pigments (flavonoids and carotenoids) and helps in maintaining its biomass against UV-B stress. Antioxidative defense system in the test plant was activated by combined treatment of Psoralens and sUV-B as evidenced by the enhanced activity of enzymatic (ascorbate peroxidase-APX, superoxide dismutase-SOD, POX) and non-enzymatic (ascorbic acid and phenol) antioxidants. Individual treatments of Psoralens and sUV-B showed inhibitory effect on various morphological traits i.e. reduction in plant height, leaf area and ultimately on biomass production. Our results clearly indicated that adverse effect of sUV-B on biomass production was ameliorated by pre- treatment with Psoralens.

  18. De Novo Transcriptome Assembly and Characterization of the Synthesis Genes of Bioactive Constituents in Abelmoschus esculentus (L.) Moench

    Science.gov (United States)

    Zhang, Chenghao; Dong, Wenqi; Gen, Wei; Xu, Baoyu; Shen, Chenjia

    2018-01-01

    Abelmoschus esculentus (okra or lady’s fingers) is a vegetable with high nutritional value, as well as having certain medicinal effects. It is widely used as food, in the food industry, and in herbal medicinal products, but also as an ornamental, in animal feed, and in other commercial sectors. Okra is rich in bioactive compounds, such as flavonoids, polysaccharides, polyphenols, caffeine, and pectin. In the present study, the concentrations of total flavonoids and polysaccharides in five organs of okra were determined and compared. Transcriptome sequencing was used to explore the biosynthesis pathways associated with the active constituents in okra. Transcriptome sequencing of five organs (roots, stem, leaves, flowers, and fruits) of okra enabled us to obtain 293,971 unigenes, of which 232,490 were annotated. Unigenes related to the enzymes involved in the flavonoid biosynthetic pathway or in fructose and mannose metabolism were identified, based on Kyoto Encyclopedia of Genes and Genomes (KEGG) pathway analysis. All of the transcriptional datasets were uploaded to Sequence Read Archive (SRA). In summary, our comprehensive analysis provides important information at the molecular level about the flavonoid and polysaccharide biosynthesis pathways in okra. PMID:29495525

  19. Mid-IR Imaging of Orion BN/KL: Modeling of Physical Conditions and Energy Balance

    Science.gov (United States)

    Gezari, Daniel; Varosi, Frank; Dwek, Eli; Danchi, William C.; Tan, Jonathan; Okumura, Shin-ichiro

    2016-01-01

    We have modeled two mid-infrared imaging photometry data sets to determine the spatial distribution of physical conditions in the BN/KL (Becklin-Neugebauer / Kleinmann-Low) infrared complex. We observed the BN/KL region using the 10-meter Keck I telescope and the LWS (Living With a Star) in the direct imaging mode, over a 13 inch by 19 inch field . We also modeled images obtained with COMICS (Cooled Mid-Infrared Camera and Spectrometer, Kataza et al. 2000) at the 8.2-meter SUBARU telescope, over a total field of view [which] is 31 inches by 41 inches in a total of nine bands: 7.8, 8.8, 9.7, 10.5, 11.7, 12.4, 18.5, 20.8 and 24.8 microns with 1-micron bandwidth interference filters.

  20. Interpretation of rotationally excited far-infrared OH emission in Orion-KL

    International Nuclear Information System (INIS)

    Melnick, G.J.; Genzel, R.; Lugten, J.B.; California Univ., Berkeley; Max-Planck-Institut fuer Physik und Astrophysik, Garching, Germany, F.R.)

    1987-01-01

    The 2Pi(1/2) OH 163-micron J = 3/2-1/2 rotational transitions in Orion-KL were observed and an upper limit was set to the line strength of the 2II(1/2) OH 56-micron J = 9/2-7/2 doublet in this source. The 163-micron line intensities were modeled, along with the previously measured 2II(3/2) 119 and 84-micron rotational line emission and it is found that the gas in the Orion-KL postshocked region can produce OH 119-micron line emission of the same strength as measured; however, the resultant 84 and 163-micron line intensities would be weaker than observed. Shocked gas plus a second component which experiences strong radiative excitation can reproduce the observations. 35 references

  1. Evidence for methane in orion KL: A search for the 4.6 Gigahertz line

    International Nuclear Information System (INIS)

    Wilson, T.L.; Snyder, L.E.

    1985-01-01

    A sensitive search for the J = 11 E(2)-E(1) transition of interstellar methane (CH 4 ) has resulted in a peak upper limit which is much less than the value reported by Fox and Jennings in 1978. When combined with the negative results reported by Ellder et al. in 1980, these data rule out the detection of CH 4 in Orion KL previously claimed by Fox and Jennings

  2. Observation of the Decay $\\K_{L}^{0}\\rightarrow\\mu^{+}\\mu^{-}

    CERN Document Server

    Carithers, W C; Nygren, D R; Pun, T P; Schwartz, E L; Sticker, H; Steinberger, J; Weilhammer, P; Christenson, J H

    1973-01-01

    An experiment performed at the Brookhaven National Laboratory alternating-gradient synchrotron has yielded six events above negligible background which satisfy criteria for the decay K L0 -->µ+µ-. The K L0 flux, measured by means of the decay K L0 --> pi + pi -, leads to a value for the branching ratio Gamma (K L0 -->µ+µ-) / Gamma (KL-->all)=11 x 10-9.

  3. THE GBT 67–93.6 GHz SPECTRAL LINE SURVEY OF ORION-KL

    International Nuclear Information System (INIS)

    Frayer, D. T.; Maddalena, Ronald J.; Meijer, M.; Hough, L.; White, S.; Norrod, R.; Watts, G.; Stennes, M.; Simon, R.; Woody, D.; Whitehead, M.; Ford, P.; Mello, M.; Bloss, M.; Srikanth, S.; Pospieszalski, M.; Bryerton, E.

    2015-01-01

    We present a 67–93.6 GHz spectral line survey of Orion-KL with the new 4 mm Receiver on the Green Bank Telescope (GBT). The survey reaches unprecedented depths and covers the low-frequency end of the 3 mm atmospheric window which has been relatively unexplored previously. The entire spectral-line survey is published electronically for general use by the astronomical community. The calibration and performance of the 4 mm Receiver on the GBT is also summarized

  4. Evidence for methane in Orion KL - a search for the 4.6 gigahertz line

    International Nuclear Information System (INIS)

    Wilson, T.L.; Snyder, L.E.

    1985-01-01

    A sensitive search for J = 11 E(2)-E(1) transition of interstellar methane (CH4) has resulted in a peak upper limit which is much less than the value reported by Fox and Jennings (1978). When combined with the negative results reported by Ellder et al. (1980), these data rule out the detection of CH4 in Orion KL previously claimed by Fox and Jennings. 7 references

  5. ALMA Observations of the Archetypal “Hot Core” That Is Not: Orion-KL

    Energy Technology Data Exchange (ETDEWEB)

    Orozco-Aguilera, M. T. [Instituto Nacional de Astrofísica, Óptica y Electrónica, Luis Enrique Erro 1, Tonantzintla, Puebla, México (Mexico); Zapata, Luis A. [Instituto de Radioastronomía y Astrofísica, UNAM, Apdo. Postal 3-72 (Xangari), 58089 Morelia, Michoacán, México (Mexico); Hirota, Tomoya [Mizusawa VLBI Observatory, National Astronomical Observatory of Japan, Osawa 2-21-1, Mitaka-shi, Tokyo 181-8588 (Japan); Qin, Sheng-Li [Department of Astronomy, Yunnan University, and Key Laboratory of Astroparticle Physics of Yunnan Province, Kunming 650091 (China); Masqué, Josep M, E-mail: lzapata@crya.unam.mx [Departamento de Astronomía, Universidad de Guanajuato, Apdo. Postal 144, 36000 Guanajuato, México (Mexico)

    2017-09-20

    We present sensitive high angular resolution (∼0.″1–0.″3) continuum Atacama Large Millimeter/Submillimeter Array (ALMA) observations of the archetypal hot core located in the Orion Kleinmann-Low (KL) region. The observations were made in five different spectral bands (bands 3, 6, 7, 8, and 9) covering a very broad range of frequencies (149–658 GHz). Apart from the well-known millimeter emitting objects located in this region (Orion Source I and BN), we report the first submillimeter detection of three compact continuum sources (ALMA1–3) in the vicinities of the Orion-KL hot molecular core. These three continuum objects have spectral indices between 1.47 and 1.56, and brightness temperatures between 100 and 200 K at 658 GHz, suggesting that we are seeing moderate, optically thick dust emission with possible grain growth. However, as these objects are not associated with warm molecular gas, and some of them are farther out from the molecular core, we thus conclude that they cannot heat the molecular core. This result favors the hypothesis that the hot molecular core in Orion-KL core is heated externally.

  6. ALMA Observations of the Archetypal “Hot Core” That Is Not: Orion-KL

    International Nuclear Information System (INIS)

    Orozco-Aguilera, M. T.; Zapata, Luis A.; Hirota, Tomoya; Qin, Sheng-Li; Masqué, Josep M

    2017-01-01

    We present sensitive high angular resolution (∼0.″1–0.″3) continuum Atacama Large Millimeter/Submillimeter Array (ALMA) observations of the archetypal hot core located in the Orion Kleinmann-Low (KL) region. The observations were made in five different spectral bands (bands 3, 6, 7, 8, and 9) covering a very broad range of frequencies (149–658 GHz). Apart from the well-known millimeter emitting objects located in this region (Orion Source I and BN), we report the first submillimeter detection of three compact continuum sources (ALMA1–3) in the vicinities of the Orion-KL hot molecular core. These three continuum objects have spectral indices between 1.47 and 1.56, and brightness temperatures between 100 and 200 K at 658 GHz, suggesting that we are seeing moderate, optically thick dust emission with possible grain growth. However, as these objects are not associated with warm molecular gas, and some of them are farther out from the molecular core, we thus conclude that they cannot heat the molecular core. This result favors the hypothesis that the hot molecular core in Orion-KL core is heated externally.

  7. B → Kl{sup +}l{sup -} decay at large hadronic recoil

    Energy Technology Data Exchange (ETDEWEB)

    Khodjamirian, Alexander; Mannel, Thomas [Siegen University (Germany); Wang, Yuming [TUM (Germany)

    2013-07-01

    We predict the amplitude of the B → Kl{sup +}l{sup -} decay in the region of the dilepton invariant mass squared 0 < q{sup 2}≤ m{sup 2}{sub J/ψ}, that is, at large hadronic recoil. The B → K form factors entering the factorizable part of the decay amplitude are obtained from QCD light-cone sum rules. The nonlocal effects, generated by the four-quark and penguin operators combined with the electromagnetic interaction, are calculated at q{sup 2}<0, far below the hadronic thresholds. For hard-gluon contributions we employ the QCD factorization approach. The soft-gluon nonfactorizable contributions are estimated from QCD light-cone sum rules. The result of the calculation is matched to the hadronic dispersion relation in the variable q{sup 2}, which is then continued to the kinematical region of the decay. The overall effect of nonlocal contributions in B → Kl{sup +}l{sup -} at large hadronic recoil is moderate. The main uncertainty of the predicted B → Kl{sup +}l{sup -} partial width is caused by the B → K form factors. Furthermore, the isospin asymmetry in this decay is expected to be very small. We investigate the deviation of the observables from the Standard Model predictions by introducing a generic new physics contribution to the effective Hamiltonian.

  8. Structure of the neutral capsular polysaccharide of Acinetobacter baumannii NIPH146 that carries the KL37 capsule gene cluster.

    Science.gov (United States)

    Arbatsky, Nikolay P; Shneider, Mikhail M; Kenyon, Johanna J; Shashkov, Alexander S; Popova, Anastasiya V; Miroshnikov, Konstantin A; Volozhantsev, Nikolay V; Knirel, Yuriy A

    2015-09-02

    Capsular polysaccharide (CPS) was isolated from Acinetobacter baumannii NIPH146, and the following structure of branched pentasaccharide repeating unit was established by sugar analyses along with 1D and 2D NMR spectroscopy: In comparison to most other known capsular polysaccharides of A. baumannii, the CPS studied is neutral and lacks any specific monosaccharide component. The synthesis, assembly and export of this structure could be attributed to genes in a novel capsule biosynthesis gene cluster, designated KL37, which was found in the NIPH146 genome. The CPS of A. baumannii NIPH146 shares the α-d-Galp-(1→6)-β-d-Glcp-(1→3)-d-GalpNAc-(1→ trisaccharide fragment with the CPS units of several A. baumannii strains, including ATCC 17978 and LUH 5537 that carry the KL3 and KL22 gene clusters, respectively. KL37 contains two genes for glycosyltransferases that are related to two glycosyltransferase genes present in both KL3 and KL22, and the encoded proteins could be tentatively assigned to linkages between sugars in the CPS repeat. Copyright © 2015 Elsevier Ltd. All rights reserved.

  9. Tolerance of chufa (Cyperus esculentus) as a vegetation unit's representative of bioregenerative life support systems to elevated temperatures

    Science.gov (United States)

    Shklavtsova, Ekaterina; Ushakova, Sofya; Shikhov, Valentin; Kudenko, Yurii

    Plants inclusion in the photosynthesizing unit of bioregenerative life support systems (BLSS) expects knowledge of both production characteristics of plants cultivated under optimal condi-tions and their tolerance to stress-factors' effect caused by contingency origination in a system. The work was aimed at investigation of chufa (Cyperus esculentus) tolerance to the effect of super optimal air temperature of 44 subject to PAR intensity and exposure duration. Chufa was grown in light culture conditions by hydroponics method on expanded clay aggregate. The Knop solution was used as nutrition medium. Up to 30 days the plants were cultivated at the intensity of 690 micromole*m-2*s*-1 and air temperature of 25. Heat shock was employed at the age of 30 days under the air temperature of 44 during 7, 20 and 44 hours at two different PAR intensities of 690 and 1150 micromole*m-2*s*-1. Chufa heat tolerance was estimated by intensity of external 2 gas exchange and by state of leaves' photosynthetic apparatus (PSA). Effect of disturbing temperature during 44 hours at PAR intensity of 690 micromole*m-2*s*-1 resulted in frozen-in damage of PSA-leaves' die-off. Chufa plants exposed to heat stress at PAR intensity of 690 micromole*m-2*s*-1 during both 7 and 20-hours demonstrated respiration dominance over photosynthesis; and 2 emission was observed by light. Functional activity of photosynthetic apparatus estimated with respect to parameters of pulse-amplitude-modulated chlorophyll fluorescence of photosystem 2 (PS 2) decreased on 40

  10. Processing Effects on the Antioxidant Activities of Beverage Blends Developed from Cyperus esculentus, Hibiscus sabdariffa, and Moringa oleifera Extracts.

    Science.gov (United States)

    Badejo, Adebanjo A; Damilare, Akintoroye; Ojuade, Temitope D

    2014-09-01

    The discovery of bioactive compounds in foods has changed the dietary lifestyle of many people. Cyperus esculentus (tigernut) is highly underutilized in Africa, yet tigernut extract is highly profitable in Europe. This study aims to add value to tigernut extract by revealing its health benefits and food value. In this study, tigernut tubers were germinated or roasted and the extracts were combined with Moringa oleifera extract (MOE) or Hibiscus sabdariffa extract (HSE) and spiced with ginger to produce functional drinks. The drinks were evaluated for physicochemical characteristics, sensory parameters, and antioxidant potentials. The total phenolic content of each beverage was measured by the Folin-Ciocalteu method, and the antioxidant activity of each beverage was determined by the 2,2-diphenyl-1-picrylhydrazyl and 2,2'-azino-bis-3-ethylbenzothiazoline-6-sulphonic acid assays. The beverages from the germinated tigernut extracts had the highest titratable acidity and the lowest pH, while beverages containing the roasted tigernut extract had the highest ∘Brix. Germination and roasting significantly enhanced the total phenolic content of the drinks. The beverage containing HSE and germinated tigernut extract had a total phenolic content of 45.67 mg/100 mL gallic acid equivalents, which was significantly higher than the total phenolic content of all other samples. The DPPH inhibition activity of the beverages prepared with germinated tigernut extracts was significantly higher than the DPPH inhibition activity of the beverages prepared with fresh tigernut extract. The taste and overall acceptability of drinks containing the roasted tigernut extract were preferred, while the color and appearance of drinks with the germinated samples were preferred. Roasting or germinating tigernuts before extraction and addition of MOE or HSE extracts is another way to add value and enhance the utilization of tigernuts.

  11. Processing Effects on the Antioxidant Activities of Beverage Blends Developed from Cyperus esculentus, Hibiscus sabdariffa, and Moringa oleifera Extracts

    Science.gov (United States)

    Badejo, Adebanjo A.; Damilare, Akintoroye; Ojuade, Temitope D.

    2014-01-01

    The discovery of bioactive compounds in foods has changed the dietary lifestyle of many people. Cyperus esculentus (tigernut) is highly underutilized in Africa, yet tigernut extract is highly profitable in Europe. This study aims to add value to tigernut extract by revealing its health benefits and food value. In this study, tigernut tubers were germinated or roasted and the extracts were combined with Moringa oleifera extract (MOE) or Hibiscus sabdariffa extract (HSE) and spiced with ginger to produce functional drinks. The drinks were evaluated for physicochemical characteristics, sensory parameters, and antioxidant potentials. The total phenolic content of each beverage was measured by the Folin-Ciocalteu method, and the antioxidant activity of each beverage was determined by the 2,2-diphenyl-1-picrylhydrazyl and 2,2′-azino-bis-3-ethylbenzothiazoline-6-sulphonic acid assays. The beverages from the germinated tigernut extracts had the highest titratable acidity and the lowest pH, while beverages containing the roasted tigernut extract had the highest ∘Brix. Germination and roasting significantly enhanced the total phenolic content of the drinks. The beverage containing HSE and germinated tigernut extract had a total phenolic content of 45.67 mg/100 mL gallic acid equivalents, which was significantly higher than the total phenolic content of all other samples. The DPPH inhibition activity of the beverages prepared with germinated tigernut extracts was significantly higher than the DPPH inhibition activity of the beverages prepared with fresh tigernut extract. The taste and overall acceptability of drinks containing the roasted tigernut extract were preferred, while the color and appearance of drinks with the germinated samples were preferred. Roasting or germinating tigernuts before extraction and addition of MOE or HSE extracts is another way to add value and enhance the utilization of tigernuts. PMID:25320721

  12. ANALISA FLAVONOID DARI EKSTRAK ETANOL 96% KULIT BUAH OKRA MERAH (Abelmoschus esculentus L. Moench SECARA KROMATOGRAFI LAPIS TIPIS DAN SPEKTROFOTOMETRI UV-VIS

    Directory of Open Access Journals (Sweden)

    Nia Lisnawati

    2016-03-01

    Full Text Available Has done research on flavonoids Analysis of Ethanol Extract 96% Fruit Leather Red Okra In Thin Layer Chromatography and Spectrophotometer UV-Vis. The purpose of this study was to analyze the content of the fruit skin red okra (Abelmoschus esculentus L. Moench by using the method of thin layer chromatography (TLC under UV light and spectrophotometry UV-Vis. Reference standards used in this study is the Standard Solution Routine Quercetin. The results of the research that has been done by the method of thin layer chromatography obtained Rf values of 0.81 and produces the color orange. And the results of research conducted by spectrophotometry UV-Vis method obtained 333,117 mg.L-1 or 421,629 mg.kg-1 or 0,84339 %. The conclusion from this study is that the 96% ethanol extract of the fruit leather red okra (Abelmoschus esculentus L. Moench positive (+ contains flavonoids with levels of 0,84339 %.

  13. Flavonoids Derived from Abelmoschus esculentus Attenuates UV-B Induced Cell Damage in Human Dermal Fibroblasts Through Nrf2-ARE Pathway.

    Science.gov (United States)

    Patwardhan, Juilee; Bhatt, Purvi

    2016-05-01

    Ultraviolet-B (UV-B) radiation is a smaller fraction of the total radiation reaching the Earth but leads to extensive damage to the deoxyribonucleic acid (DNA) and other biomolecules through formation of free radicals altering redox homeostasis of the cell. Abelmoschus esculentus (okra) has been known in Ayurveda as antidiabetic, hypolipidemic, demulscent, antispasmodic, diuretic, purgative, etc. The aim of this study is to evaluate the protective effect of flavonoids from A. esculentus against UV-B-induced cell damage in human dermal fibroblasts. UV-B protective activity of ethyl acetate (EA) fraction of okra was studied against UV-B-induced cytotoxicity, antioxidant regulation, oxidative DNA damage, intracellular reactive oxygen species (ROS) generation, apoptotic morphological changes, and regulation of heme oxygenase-1 (HO-1) gene through nuclear factor E2-related factor 2-antioxidant response element (Nrf2-ARE) pathway. Flavonoid-rich EA fraction depicted a significant antioxidant potential also showing presence of rutin. Pretreatment of cells with EA fraction (10-30 μg/ml) prevented UV-B-induced cytotoxicity, depletion of endogenous enzymatic antioxidants, oxidative DNA damage, intracellular ROS production, apoptotic changes, and overexpression of Nrf2 and HO-1. Our study demonstrated for the 1(st) time that EA fraction of okra may reduce oxidative stress through Nrf2-ARE pathway as well as through endogenous enzymatic antioxidant system. These results suggested that flavonoids from okra may be considered as potential UV-B protective agents and may also be formulated into herbal sunscreen for topical application. Flavonoid-enriched ethyl acetate (EA) fraction from A. esculentus protected against ultraviolet-B (UV-B)-induced oxidative DNA damageEA fraction prevented UV-B-induced cytotoxicity, depletion of endogenous enzymatic antioxidants, and intracellular reactive oxygen species productionEA fraction could reduce oxidative stress through the Nrf2-ARE

  14. A spectroscopic survey of Orion KL between 41.5 and 50 GHz.

    Science.gov (United States)

    Rizzo, J R; Tercero, B; Cernicharo, J

    2017-09-01

    The nearby massive star-forming region Orion KL is one of the richest molecular reservoirs known in our Galaxy. The region hosts newly formed protostars, and the strong interaction between their radiation and their outflows with the environment results in a series of complex chemical processes leading to a high diversity of interstellar tracers. The region is therefore one of the most frequently observed sources, and the site where many molecular species have been discovered for the first time. With the availability of powerful wideband backends, it is nowadays possible to complete spectral surveys in the entire mm-range to obtain a spectroscopically unbiased chemical picture of the region. In this paper we present a sensitive spectral survey of Orion KL, made with one of the 34 m antennas of the Madrid Deep Space Communications Complex in Robledo de Chavela, Spain. The spectral range surveyed is from 41.5 to 50 GHz, with a frequency spacing of 180 kHz (equivalent to ≈ 1.2 km s -1 , depending on the exact frequency). The rms achieved ranges from 8 to 12 mK. The spectrum is dominated by the J = 1 → 0 SiO maser lines and by radio recombination lines (RRLs), which were detected up to Δ n = 11. Above a 3 σ level, we identified 66 RRLs and 161 molecular lines corresponding to 39 isotopologues from 20 molecules; a total of 18 lines remain unidentified, two of them above a 5 σ level. Results of radiative modelling of the detected molecular lines (excluding masers) are presented. At this frequency range, this is the most sensitive survey and also the one with the widest band. Although some complex molecules like CH 3 CH 2 CN and CH 2 CHCN arise from the hot core, most of the detected molecules originate from the low temperature components in Orion KL.

  15. Phylogeography and Demographic History of Chinese Black-Spotted Frog Populations (Pelophylax nigromaculata: Evidence for Independent Refugia Expansion and Secondary Contact

    Directory of Open Access Journals (Sweden)

    Zhou Kaiya

    2008-01-01

    Full Text Available Abstract Background Pleistocene glaciations had considerable impact on phylogeographic patterns within and among closely related species of many vertebrates. Compared to Europe and North America, research on the phylogeography of vertebrates in East Asia, particularly in China, remains limited. The black-spotted frog (Pelophylax nigromaculata is a widespread species in East Asia. The wide distribution of this species in China makes it an ideal model for the study of palaeoclimatic effects on vertebrates in East Asia. Our previous studies of P. nigromaculata revealed significant subdivisions between the northeast China populations and populations in other regions of the mainland. In the present study, we aim to see whether the deepest splits among lineages and perhaps subsequent genealogical divisions are temporally consistent with a Pleistocene origin and whether clade geographic distributions, with insight into expansion patterns, are similarly spatially consistent with this model. Results Using 1143 nucleotides of the mitochondrial cytochrome b gene from 262 individuals sampled from 28 localities, two main clades (clade A and clade B differing by c. 7.72% sequence divergence were defined from parsimony analyses. The corresponding timing of lineage divergence, 0.92 Mya, indicates a most likely Pleistocene split. The A clade is further subdivided into two sub-clades, A1 and A2 with 1.22% sequence divergence. Nested clade phylogeographical and population demographic analyses suggested that the current distribution of this frog species was the result of range expansion from two independent refugia during the last interglacial period. We discovered a population within which haplotype lineages A and B of P. nigromaculata coexist in the Dongliao area of China by nucleotide sequences, PCR-RFLP and ISSR (inter simple sequence repeat patterns. The ISSR result in particular supported divergence between the mitochondrial clades A and B and implied

  16. Evaluation of growth, biochemical and bioaccumulation parameters in Pelophylax perezi tadpoles, following an in-situ acute exposure to three different effluent ponds from a uranium mine

    Energy Technology Data Exchange (ETDEWEB)

    Marques, Sérgio M., E-mail: s.reis.marques@gmail.com [Departamento de Biologia da Universidade de Aveiro, Campus de Santiago, 3810-193 Aveiro (Portugal); CESAM (Centro de Estudos do Ambiente e do Mar), Universidade de Aveiro, Campus de Santiago, 3810-193 Aveiro (Portugal); Chaves, Sandra [Universidade de Lisboa, Faculdade de Ciências, Centro de Biodiversidade, Genómica Integrativa e Funcional (BioFIG), Edifício ICAT, Campus da FCUL Campo Grande, Lisboa (Portugal); Gonçalves, Fernando [Departamento de Biologia da Universidade de Aveiro, Campus de Santiago, 3810-193 Aveiro (Portugal); CESAM (Centro de Estudos do Ambiente e do Mar), Universidade de Aveiro, Campus de Santiago, 3810-193 Aveiro (Portugal); Pereira, Ruth [CESAM (Centro de Estudos do Ambiente e do Mar), Universidade de Aveiro, Campus de Santiago, 3810-193 Aveiro (Portugal); Departamento de Biologia da Faculdade de Ciências da Universidade do Porto, Rua do Campo Alegre, 4169-007 Porto (Portugal)

    2013-02-15

    Mining activities invariably produce metal contaminated effluents. Depending on factors such as pH and metal concentration the toxicity of the effluent may vary. To assess the effects of three characteristically different effluent ponds from a deactivated uranium mine, with toxicologically relevant data, an in situ exposure with Pelophylax perezi tadpoles, was conducted. Tadpoles were exposed to the three effluent ponds, ranked by increasing order of metals concentrations (REF, M1, M2). Survival, growth, metal accumulation, antioxidant enzymes (catalase, glutathione peroxidase and glutathione reductase) and lipid peroxidation (LPO) were determined in tadpoles. As well, physical and chemical variables of the effluents were measured. Death percentage in the effluents was 3.17 (REF), 9.84 (M1) and 42.86% (M2) and was not coincident with metal accumulation which was highest in tadpoles exposed to M1, while metal contents in M2 tadpoles were quite similar to those recorded in REF tadpoles. However, high mortality in M2 was attributed to the extremely low pH (≈ 3.77). From the three effluents M2 tadpoles had the lowest growth and the antioxidant enzymatic activity was only affected in the case glutathione peroxidase (GPx) with significantly higher activity in M1, being in accordance with the highest accumulation of metals. LPO, usually associated with metal accumulation, had the following pattern M1 > REF > M2. Overall, effluent toxicity in tadpoles exposed to M2 effluent seems to be primarily an effect of pH while in M1 toxicity is mainly owed to high metal concentrations. The effluent acidity seems to reduce metal accumulation probably due to damage in the integument, affecting ion uptake. The results obtained bring a better understanding of the toxicological processes that local P. perezi population is subjected to, mainly in the early life stages. Furthermore this study highlights the influence of pH in the toxicity of metal rich effluents. - Highlights:

  17. Contrasting effects of nitrogenous pollution on fitness and swimming performance of Iberian waterfrog, Pelophylax perezi (Seoane, 1885), larvae in mesocosms and field enclosures.

    Science.gov (United States)

    Egea-Serrano, A; Tejedo, M

    2014-01-01

    Amphibians are declining worldwide and pollutants have been implicated as a major contributor to these declines. To understand these declines, many studies have assessed the impact of pollutants on amphibian behaviour. However, information regarding their effect on locomotor abilities, as well as the intra-specific variation of the tolerance to pollutants, is extremely rare. Further, the majority of studies examining the impact of pollutants on amphibians have been conducted in simplified laboratory settings. Given the complexity of natural systems, determining whether amphibian responses in laboratory studies can be generalized to more realistic natural scenarios is critical. Towards this goal, this study assessed the impact of nitrogenous pollution on survival and fitness-related larval traits (growth, mass and swimming performance) for three populations of the frog Pelophylax perezi, exposed to different degrees of eutrophication in two different and complementary experiments: (1) pond mesocosms, with NH4Cl isolated or combined with NaNO2 and NaNO3, and (2) field enclosures placed in natural streams differing in their degree of pollution. For both mesocosm and field enclosure experiments, larval mortality was unaffected by nitrogenous pollution. However, in the mesocosm experiment, exposure to nitrogenous compounds reduced final larvae mass and growth. In contrast, in the enclosure experiment, polluted locations facilitated final mass and growth of surviving tadpoles. Population-level variation in the effect of pollution was observed for final larval mass in the mesocosm but not in the field enclosure experiment. In addition, although nitrogenous compounds in both mesocosm and natural conditions had no direct effect on absolute larval swimming performance, they may impact the viability of larvae by affecting the relationships between growth and the swimming abilities. The differential pattern found in the impacts of nitrogenous compounds on larvae of P. perezi

  18. Evaluation of growth, biochemical and bioaccumulation parameters in Pelophylax perezi tadpoles, following an in-situ acute exposure to three different effluent ponds from a uranium mine

    International Nuclear Information System (INIS)

    Marques, Sérgio M.; Chaves, Sandra; Gonçalves, Fernando; Pereira, Ruth

    2013-01-01

    Mining activities invariably produce metal contaminated effluents. Depending on factors such as pH and metal concentration the toxicity of the effluent may vary. To assess the effects of three characteristically different effluent ponds from a deactivated uranium mine, with toxicologically relevant data, an in situ exposure with Pelophylax perezi tadpoles, was conducted. Tadpoles were exposed to the three effluent ponds, ranked by increasing order of metals concentrations (REF, M1, M2). Survival, growth, metal accumulation, antioxidant enzymes (catalase, glutathione peroxidase and glutathione reductase) and lipid peroxidation (LPO) were determined in tadpoles. As well, physical and chemical variables of the effluents were measured. Death percentage in the effluents was 3.17 (REF), 9.84 (M1) and 42.86% (M2) and was not coincident with metal accumulation which was highest in tadpoles exposed to M1, while metal contents in M2 tadpoles were quite similar to those recorded in REF tadpoles. However, high mortality in M2 was attributed to the extremely low pH (≈ 3.77). From the three effluents M2 tadpoles had the lowest growth and the antioxidant enzymatic activity was only affected in the case glutathione peroxidase (GPx) with significantly higher activity in M1, being in accordance with the highest accumulation of metals. LPO, usually associated with metal accumulation, had the following pattern M1 > REF > M2. Overall, effluent toxicity in tadpoles exposed to M2 effluent seems to be primarily an effect of pH while in M1 toxicity is mainly owed to high metal concentrations. The effluent acidity seems to reduce metal accumulation probably due to damage in the integument, affecting ion uptake. The results obtained bring a better understanding of the toxicological processes that local P. perezi population is subjected to, mainly in the early life stages. Furthermore this study highlights the influence of pH in the toxicity of metal rich effluents. - Highlights:

  19. Tracing the Origins of Nitrogen Bearing Organics Toward Orion KL with Alma

    Science.gov (United States)

    Carroll, Brandon; Crockett, Nathan; Wilkins, Olivia H.; Bergin, Edwin; Blake, Geoffrey

    2017-06-01

    A comprehensive analysis of a broadband 1.2 THz wide spectral survey of the Orion Kleinmann-Low nebula (Orion KL) has shown that nitrogen bearing complex organics trace systematically hotter gas than O-bearing organics toward this source. The origin of this O/N dichotomy remains a mystery. If complex molecules originate from grain surfaces, N-bearing species may be more difficult to remove from grain surfaces than O-bearing organics. Theoretical studies, however, have shown that hot (T=300 K) gas phase chemistry can produce high abundances of N-bearing organics while suppressing the formation of O-bearing complex molecules. In order to distinguish these distinct formation pathways we have obtained extremely high angular resolution observations of methyl cyanide (CH_3CN) using the Atacama Large Millimeter/Submillimeter Array (ALMA) toward Orion KL. By simultaneously imaging ^{13}CH_3CN and CH_2DCN we map the temperature structure and D/H ratio of CH_3CN. We will present updated results of these observations and discuss their implications for the formation of N-bearing organics in the interstellar medium.

  20. The neuropsychology of the Klüver-Bucy syndrome in children.

    Science.gov (United States)

    Lippe, S; Gonin-Flambois, C; Jambaqué, I

    2013-01-01

    The Klüver-Bucy syndrome (KBS) is characterized by a number of peculiar behavioral symptoms. The syndrome was first observed in 1939 by Heinrich Klüver and Paul Bucy in the rhesus monkey following removal of the greater portion of the monkey's temporal lobes and rhinencephalon. The animal showed (a) visual agnosia (inability to recognize objects without general loss of visual discrimination), (b) excessive oral tendency (oral exploration of objects), (c) hypermetamorphosis (excessive visual attentiveness), (d) placidity with loss of normal fear and anger responses, (e) altered sexual behavior manifesting mainly as marked and indiscriminate hypersexuality, and (f) changes in eating behavior. In humans, KBS can be complete or incomplete. It occurs as a consequence of neurological disorders that essentially cause destruction or dysfunction of bilateral mesial temporal lobe structures (i.e., Pick disease, Alzheimer disease, cerebral trauma, cerebrovascular accidents, temporal lobe epilepsy, herpetic encephalopathy, heat stroke). As for epilepsy, complete and incomplete KBS are well documented in temporal lobe epilepsy, temporal lobectomy, and partial status epilepticus. KBS can occur at any age. Children seem to show similar symptoms to adults, although some differences in the manifestations of symptoms may be related to the fact that children have not yet learned certain behaviors. Copyright © 2013 Elsevier B.V. All rights reserved.

  1. Review of Formen des Klärens by Christian Erbacher

    Directory of Open Access Journals (Sweden)

    Tea Jankovic

    2016-06-01

    Full Text Available Book review of Christian Erbacher's Formen des Klärens, Literarisch-Philosophische Darstellungsmittel in Wittgensteins Schriften, Münster: mentis 2015. *** Christian Erbacher’s Formen des Klärens, Literarisch-Philosophische Darstellungsmittel in Wittgensteins Schriften, which I would translate as Forms of Elucidating, Literary-Philosophical Means of Presentation in Wittgenstein’s Works, comprises and critically analyzes the most important phases of almost a hundred years of both English and German speaking Wittgenstein scholarship on the form of his literary-philosophical presentation. Furthermore, Erbacher demonstrates a thorough first hand knowledge of Wittgenstein’s manuscripts and manner of work, while at the same time offering an interpretation of the Tractatus logico-philosophicus, as well as later works, that is capable of comprehending both Wittgenstein’s serious and intense ethical and aesthetic preoccupations, as well as his significant contributions to logic and philosophy of language. Furthermore, despite its density, Erbacher’s slender book admirably achieves an elegant lucidity. Thus it performatively shows the unity of aesthetic-rhetorical form and philosophical content, as well as the ethical ideal of clarity at the core of Wittgenstein’s concerns.

  2. Laboratory characterization and astrophysical detection of vibrationally excited states of vinyl cyanide in Orion-KL

    Science.gov (United States)

    López, A.; Tercero, B.; Kisiel, Z.; Daly, A. M.; Bermúdez, C.; Calcutt, H.; Marcelino, N.; Viti, S.; Drouin, B. J.; Medvedev, I. R.; Neese, C. F.; Pszczółkowski, L.; Alonso, J. L.; Cernicharo, J.

    2014-12-01

    Context. We perform a laboratory characterization in the 18-1893 GHz range and astronomical detection between 80-280 GHz in Orion-KL with IRAM-30 m of CH2CHCN (vinyl cyanide) in its ground and vibrationally excited states. Aims: Our aim is to improve the understanding of rotational spectra of vibrationally excited vinyl cyanide with new laboratory data and analysis. The laboratory results allow searching for these excited state transitions in the Orion-KL line survey. Furthermore, rotational lines of CH2CHCN contribute to the understanding of the physical and chemical properties of the cloud. Methods: Laboratory measurements of CH2CHCN made on several different frequency-modulated spectrometers were combined into a single broadband 50-1900 GHz spectrum and its assignment was confirmed by Stark modulation spectra recorded in the 18-40 GHz region and by ab-initio anharmonic force field calculations. For analyzing the emission lines of vinyl cyanide detected in Orion-KL we used the excitation and radiative transfer code (MADEX) at LTE conditions. Results: Detailed characterization of laboratory spectra of CH2CHCN in nine different excited vibrational states: ν11 = 1, ν15 = 1, ν11 = 2, ν10 = 1 ⇔ (ν11 = 1,ν15 = 1), ν11 = 3/ν15 = 2/ν14 = 1, (ν11 = 1,ν10 = 1) ⇔ (ν11 = 2,ν15 = 1), ν9 = 1, (ν11 = 1,ν15 = 2) ⇔ (ν10 = 1,ν15 = 1) ⇔ (ν11 = 1,ν14 = 1), and ν11 = 4 are determined, as well as the detection of transitions in the ν11 = 2 and ν11 = 3 states for the first time in Orion-KL and of those in the ν10 = 1 ⇔ (ν11 = 1,ν15 = 1) dyad of states for the first time in space. The rotational transitions of the ground state of this molecule emerge from four cloud components of hot core nature, which trace the physical and chemical conditions of high mass star forming regions in the Orion-KL Nebula. The lowest energy vibrationally excited states of vinyl cyanide, such as ν11 = 1 (at 328.5 K), ν15 = 1 (at 478.6 K), ν11 = 2 (at 657.8 K), the ν10

  3. International Conference in Honour of L. Bittner and R. Klötzler

    CERN Document Server

    Heier, Knut; Bittner, Leonhard; Bulirsch, Roland

    1998-01-01

    The 12th conference on "Variational Calculus, Optimal Control and Applications" took place September 23-27, 1996, in Trassenheide on the Baltic Sea island of Use­ dom. Seventy mathematicians from ten countries participated. The preceding eleven conferences, too, were held in places of natural beauty throughout West Pomerania; the first time, in 1972, in Zinnowitz, which is in the immediate area of Trassenheide. The conferences were founded, and led ten times, by Professor Bittner (Greifswald) and Professor KlCitzler (Leipzig), who both celebrated their 65th birthdays in 1996. The 12th conference in Trassenheide, was, therefore, also dedicated to L. Bittner and R. Klotzler. Both scientists made a lasting impression on control theory in the former GDR. Originally, the conferences served to promote the exchange of research results. In the first years, most of the lectures were theoretical, but in the last few conferences practical applications have been given more attention. Besides their pioneering theoretical...

  4. Multiple ionization effects in atomic collisions in the K-L matching region

    International Nuclear Information System (INIS)

    Piticu, I.; Ciortea, C.; Dumitriu, D.; Enulescu, A.; Fluerasu, D.; Szilagyi, S.Z.; Zoran, V.; Bucur, B.I.

    1994-01-01

    The multiple ionization effect in the determination of 3dσ vacancy production cross sections and sharing probabilities in asymmetric quasimolecular collisions near K-L level matching, for the collision systems Fe, Co, Ni, and Cu + Bi in the energy range 0.25 - 1.75 MeV/u have been studied. The experimental energy and intensity shifts of some projectile and target X-ray lines, as well as Dirac-Hartree-Fock calculations, have been used to estimate average single particle probabilities for multiple ionization of projectile L- and target M-shells. Using these estimates and a standard procedure, the experimental 3dσ vacancy production cross sections and sharing probabilities have been corrected for multiple ionization. The influence of the multiple ionization-induced increase in binding energy of the molecular orbitals implied in vacancy sharing is discussed. (Author)

  5. Three-dimensional Shock Structure of the Orion KL Outflow with IGRINS

    Science.gov (United States)

    Oh, Heeyoung; Pyo, Tae-Soo; Kaplan, Kyle; Yuk, In-Soo; Park, Byeong-Gon; Mace, Gregory; Park, Chan; Chun, Moo-Young; Pak, Soojong; Kim, Kang-Min; Sok Oh, Jae; Jeong, Ueejeong; Yu, Young Sam; Lee, Jae-Joon; Kim, Hwihyun; Hwang, Narae; Lee, Hye-In; Nguyen Le, Huynh Anh; Lee, Sungho; Jaffe, Daniel T.

    2016-12-01

    We report a study of the three-dimensional (3D) outflow structure of a 15″ × 13″ area around the H2 peak 1 in Orion KL with slit-scan observations (13 slits) using the Immersion Grating Infrared Spectrograph. The datacubes have a high-velocity resolution (˜7.5 km s-1), provide high-contrast imaging within ultra-narrow bands, and enable the detection of the main stream of the previously reported H2 outflow fingers. We identified 31 distinct fingers in the H2 1-0 S(1) λ2.122 μm emission. The line profile at each finger shows multiple-velocity peaks with a strong low-velocity component around the systemic velocity at {V}{LSR} = +8 km s-1 and high-velocity emission (| {V}{LSR}| = 45-135 km s-1), indicating a typical bow-shock. The observed radial velocity gradients of ˜4 km s-1 arcsec-1 agree well with the velocities inferred from large-scale proper motions, where the projected motion is proportional to the distance from a common origin. We construct a conceptual 3D map of the fingers with estimated inclination angles of 57°-74°. The extinction difference (ΔA v > 10 mag) between blueshifted and redshifted fingers indicates high internal extinction. The extinction, the overall angular spread, and the scale of the flow argue for an ambient medium with a very high density (105-106 cm-3), consistent with molecular line observations of the Orion Molecular Cloud core. The radial velocity gradients and the 3D distributions of the fingers together support the hypothesis of a simultaneous radial explosion of the Orion KL outflow. This paper includes data taken at The McDonald Observatory of The University of Texas at Austin.

  6. Correlation of serum KL-6 and CC16 levels with neurodevelopmental outcome in premature infants at 12 months corrected age

    Science.gov (United States)

    Zhang, Zhiqun; Lu, Hui; Zhu, Yunxia; Xiang, Junhua; Huang, Xianmei

    2015-01-01

    The aim of this study was to evaluate KL-6 and CC16 levels and their correlation with neurodevelopmental outcome among very low birth weight pre-term infants at 12 months corrected age. This prospective cohort study was performed from 2011 to 2013 by enrolling pre-term neonates of gestational age ≤ 32 weeks and birth weight ≤ 1500 g. Serum KL-6 and CC16 levels were determined 7 days after birth and their correlation with neurodevelopment was evaluated using Gesell Mental Developmental Scales. Of the 86 eligible pre-term infants, 63 completed follow-up, of which 15 had bronchopulmonary dysplasia. At 12 months corrected age, 49 infants had favorable outcomes and 14 infants had poor neurodevelopmental outcome. KL-6 levels were higher and CC16 levels were lower in infants with poor neurodevelopmental outcome compared with those infants who had favourable neurodevelopmental outcome. Serum KL-6 levels less than 90.0 ng/ml and CC16 levels greater than 320.0 pg/ml at 7 days of life were found to be predictive of a favourable outcome at 12 months corrected age. These biological markers could predict neurodevelopmental outcome at 12 months corrected age in very low birth weight premature infants, and help the clinician plan early therapeutic interventions to minimize or avoid poor neurodevelopmental outcome. PMID:25631862

  7. Soot temperature and KL factor for biodiesel and diesel spray combustion in a constant volume combustion chamber

    KAUST Repository

    Zhang, Ji; Jing, Wei; Roberts, William L.; Fang, Tiegang

    2013-01-01

    This paper presents measurements of the soot temperature and KL factor for biodiesel and diesel combustion in a constant volume chamber using a two-color technique. This technique uses a high-speed camera coupled with two narrowband filters (550. nm

  8. Association of serum KL-6 levels with interstitial lung disease in patients with connective tissue disease: a cross-sectional study.

    Science.gov (United States)

    Oguz, Ekin Oktay; Kucuksahin, Orhan; Turgay, Murat; Yildizgoren, Mustafa Turgut; Ates, Askin; Demir, Nalan; Kumbasar, Ozlem Ozdemir; Kinikli, Gulay; Duzgun, Nursen

    2016-03-01

    It was aimed to evaluate KL-6 glycoprotein levels to determine if it may be a diagnostic marker for the connective tissue diseases (CTDs) predicting CTD-related interstitial lung diseases (ILDs) (CTD-ILD) development and to examine if there was a difference between patients and healthy controls. The study included 113 patients with CTD (45 CTD without lung involvement, 68 CTD-ILD) and 45 healthy control subjects. KL-6 glycoprotein levels were analyzed with ELISA in patients and the control group. The relationship between KL-6 glycoprotein levels and CTD-ILD was assessed. In the comparison of all the groups in the study, significantly higher levels of KL-6 were determined in the CTD-ILD group than in either the CTD without pulmonary involvement group or the healthy control group (p connective tissue diseases in the diagnostic groups (systemic lupus erythematosus, Sjögren's syndrome, rheumatoid arthritis, mixed connective tissue disease, scleroderma, polymyositis/ dermatomyositis). In the healthy control group, there was a statistically significant difference between KL-6 levels in smokers and non-smokers. Smokers had significantly higher serum KL-6 levels compared with non-smokers (p < 0.05). There was no statistically significant difference between smoking status (pack-year) and serum KL-6 levels. There was no statistically significant correlation between serum KL-6 levels and time since diagnosis of CTD and CTD-ILD. The level of KL-6 as a predictive factor could be used to identify the clinical development of ILD before it is detected on imaging modality. Further prospective clinical studies are needed to define whether levels of KL-6 might have prognostic value or might predict progressive ILD.

  9. (Abelmoschus esculentus (L.) Moench)

    Indian Academy of Sciences (India)

    Kundapura V. Ravishankar

    as okra, is one of the important pod vegetable crops in tropics and subtropics .... study. Genotypes/accession number. 1. Kashi Vibhuti. 2. Komal 2486. 3. Kashi Lalima. 4 ..... the microsatellite-enriched library method (Phuekvilai and. Wolff 2013 ...

  10. Scholarly productivity and professional advancement of junior researchers receiving KL2, K23, or K08 awards at a large public research institution.

    Science.gov (United States)

    Amory, John K; Louden, Diana K N; McKinney, Christy; Rich, Joanne; Long-Genovese, Stacy; Disis, Mary L

    2017-04-01

    How the productivity and careers of KL2 scholars compare with scholars receiving individual K-awards is unknown. The productivity of KL2 scholars (n=21) at our institution was compared with that of K08 (n=34) and K23 (n=26) scholars. KL2 and K23 scholars had greater productivity than K08 scholars ( p =0.01). Professional advancement was similar among groups. At our institution, scholarly productivity and professional advancement did not differ by type of K-award.

  11. Herschel CHESS discovery of the fossil cloud that gave birth to the Trapezium and Orion KL

    Science.gov (United States)

    López-Sepulcre, A.; Kama, M.; Ceccarelli, C.; Dominik, C.; Caux, E.; Fuente, A.; Alonso-Albi, T.

    2013-01-01

    Context. The Orion A molecular complex is a nearby (420 pc), very well studied stellar nursery that is believed to contain examples of triggered star formation. Aims: As part of the Herschel guaranteed time key programme CHESS, we present the discovery of a diffuse gas component in the foreground of the intermediate-mass protostar OMC-2 FIR 4, located in the Orion A region. Methods: Making use of the full HIFI spectrum of OMC-2 FIR 4 obtained in CHESS, we detected several ground-state lines from OH+, H2O+, HF, and CH+, all of them seen in absorption against the dust continuum emission of the protostar's envelope. We derived column densities for each species, as well as an upper limit to the column density of the undetected H3O+. In order to model and characterise the foreground cloud, we used the Meudon PDR code to run a homogeneous grid of models that spans a reasonable range of densities, visual extinctions, cosmic ray ionisation rates and far-ultraviolet (FUV) radiation fields, and studied the implications of adopting the Orion Nebula extinction properties instead of the standard interstellar medium ones. Results: The detected absorption lines peak at a velocity of 9 km s-1, which is blue-shifted by 2 km s-1 with respect to the systemic velocity of OMC-2 FIR 4 (VLSR = 11.4 km s-1). The results of our modelling indicate that the foreground cloud is composed of predominantly neutral diffuse gas (nH = 100 cm-3) and is heavily irradiated by an external source of FUV that most likely arises from the nearby Trapezium OB association. The cloud is 6 pc thick and bears many similarities with the so-called C+ interface between Orion-KL and the Trapezium cluster, 2 pc south of OMC-2 FIR 4. Conclusions: We conclude that the foreground cloud we detected is an extension of the C+ interface seen in the direction of Orion KL, and interpret it to be the remains of the parental cloud of OMC-1, which extends from OMC-1 up to OMC-2.

  12. PENERAPAN STRATEGI PERMAINAN CATALISTING YANG BERORIENTASI PADA KECERDASAN LINGUISTIK (PC-KL DALAM PEMBELAJARAN MENULIS ESAI

    Directory of Open Access Journals (Sweden)

    Nofiyanti Nofiyanti

    2018-01-01

    Full Text Available Penelitian ini bertujuan untuk menjelaskan perbedaan hasil menulis esai antara kelas kontrol dengan kelas eksperimen melalui strategi permainan catalisting yang berorientasi pada kecerdasan linguistik pada mahasiswa tingkat III di STKIP Siliwangi Bandung. Desain penelitian ini adalah kuasi eksperimen (Quasi Experimental Design dengan menggunakan bentuk nonequivalent control group design. Teknik pengumpulan data meliputi observasi, angket dan tes. Hasil penelitian menunjukan bahwa strategi permainan catalisting yang berorientasi pada kecerdasan linguistik pada mahasiswa tingkat III di STKIP Siliwangi Bandung terbukti efektif, baik dari segi pembelajaran maupun proses pembelajaran. Secara rinci dijelaskan sebagai berikut, (1 Nilai rata-rata kelas eksperimen adalah 76,39 sedangkan kelas kontrol nilai rata-ratanya adalah 70,31. Hasil uji statistik menunjukan nilai signifikasi pada uji independent t test nilai sig. 0, 03 < 0,05 maka ada perbedaan di antara nilai kelas eksperimen dengan kelas kontrol. Dengan kata lain Ho ditolak, Ha diterima. Maka dapat disimpulkan adanya perbedaan yang signifikan pada hasil belajar menuls esai antara kelas kontrol dan kelas eksperimen. (2 Hasil respons tanggapan mahasiswa terhadap penggunaan strategi permainan catalisting yang berorientasi pada kecerdasan linguistik dalam pembelajaran menulis esai menunjukkan respons yang baik, yaitu sebanyak 91,81% (32 mahasiswa memberikan respons positif sedangkan 8,19% (3 mahasiswa memberikan respons negatif. (3 pembelajaran menulis esai dengan strategi PC-KL lebih menyenangkan dan memudahkan mahasiswa dalam mencari ide sebuah tulisan. Kata kunci: Strategi catalisting, kecerdasan linguistik, pembelajaran, menulis esai

  13. THE PROPER MOTIONS OF THE DOUBLE RADIO SOURCE n IN THE ORION BN/KL REGION

    International Nuclear Information System (INIS)

    Rodríguez, Luis F.; Loinard, Laurent; Zapata, Luis; Lizano, Susana; Dzib, Sergio A.; Menten, Karl M.; Gómez, Laura

    2017-01-01

    We have extended the time baseline for observations of the proper motions of radio sources in the Orion BN/KL region from 14.7 to 22.5 years. We present improved determinations for the sources BN and I. In addition, we address the proper motions of the double radio source n, that have been questioned in the literature. We confirm that all three sources are moving away at transverse velocities of tens of kilometers per second from a region in-between them, where they were located about 500 years ago. Source n exhibits a new component that we interpret as due to a one-sided ejection of free–free emitting plasma that took place after 2006.36. We used the highly accurate relative proper motions between sources BN and I to determine that their closest separation took place in the year 1475 ± 6, when they were within ∼100 au or less from each other in the plane of the sky.

  14. THE PROPER MOTIONS OF THE DOUBLE RADIO SOURCE n IN THE ORION BN/KL REGION

    Energy Technology Data Exchange (ETDEWEB)

    Rodríguez, Luis F.; Loinard, Laurent; Zapata, Luis; Lizano, Susana [Instituto de Radioastronomía y Astrofísica, UNAM, Apdo. Postal 3-72 (Xangari), 58089 Morelia, Michoacán, México (Mexico); Dzib, Sergio A.; Menten, Karl M. [Max Planck Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Gómez, Laura, E-mail: l.rodriguez@crya.unam.mx [Joint ALMA Observatory, Alonso de Córdoba 3107, Vitacura, Santiago (Chile)

    2017-01-10

    We have extended the time baseline for observations of the proper motions of radio sources in the Orion BN/KL region from 14.7 to 22.5 years. We present improved determinations for the sources BN and I. In addition, we address the proper motions of the double radio source n, that have been questioned in the literature. We confirm that all three sources are moving away at transverse velocities of tens of kilometers per second from a region in-between them, where they were located about 500 years ago. Source n exhibits a new component that we interpret as due to a one-sided ejection of free–free emitting plasma that took place after 2006.36. We used the highly accurate relative proper motions between sources BN and I to determine that their closest separation took place in the year 1475 ± 6, when they were within ∼100 au or less from each other in the plane of the sky.

  15. Analysis of WBV on standing and seated passengers during off-peak operation in KL monorail

    Science.gov (United States)

    Hasnan, K.; Bakhsh, Q.; Ahmed, A.; Ali, D.; Jamali, A. R.

    2018-03-01

    In this study, the Whole-Body Vibration (WBV) was analyzed on the standing and seated passenger during off-peak operating hours when train was on the track. The experiments were conducted on two car train at one constant location (bogie-1, which is near to driver’s cabin) during downward direction from KL sentral station towards Titiwangsa station. The aim of this study was to analyze that, in which posture of passenger’s exposures the maximum level of WBV. Since, one passenger was performed the whole journey in standing posture whereas, the other passenger was in seated posture. The result obtained from experiments for the RMS accelerations (Arms), maximum acceleration (Amax) and minimum acceleration (Amin) during the trip. As per standard ISO 2631-1, the daily vibration exposure (A8), Vibration Dose value (VDV) and Crest Factor (CF) of this trip for both standing and sitting orientations were calculated. Results shows that the seated passenger was exposed to longer periods of continuous vibration as compared to the standing passenger. Whereas, the Vibration Dose value (VDV) value was greater than the action value as per ISO 2631-1 and within the limit values. The study concluded that whole body vibration transmitted towards both passengers either standing or seated during their journey. But in overall results comparison of both orientations, the seated passengers gained higher vibration than the standing one.

  16. SIA “Doktora Mileika Klīnika" mārketinga kompleksa analīze.

    OpenAIRE

    Mileika, Nadežda

    2013-01-01

    Bakalaura darbs veltīts „Doktora Mileika klīnikas” „7P” modeļa marketinga kompleksa analīzei. Bakalaura darba mērķis ir, pamatojoties uz teorijas atziņām par mārketinga kompleksu pakalpojuma sfērā, uz intervijas un klientu aptaujas rezultātiem, izanalizēt „Doktora Mileika klīnika” mārketinga kompleksa elementu priekšrocības un trūkumus, kā arī izvirzīt priekšlikumus mārketinga kompleksa pilnveidošanai uzņēmumā. Pirmajā nodaļā izskatīti mārketinga kompleksa „7P” elementi ar medicīnas ...

  17. Decontamination of sliced and powdered okra (Abelmoschus esculentus) and some aspects of nutrient quality before and after gamma irradiation

    International Nuclear Information System (INIS)

    Ofori-Appiah, D.

    2012-01-01

    Food security in Africa is crucial for survival of the increasing population. However, agricultural produce in the field are drastically reduced along the food pipeline (from farm gate to the consumer's table) by bioderioagents including microorganisms. Okra (Abelmoschus esculentus (L) Moench) is one such farm produce of economic importance in Ghana with a great potential of providing essential nutrients and vitamins in our diet. The high moisture content of the fresh fruit makes it susceptible to microbial deterioration in a short time. Dehydration methods (sun-drying and solar drying) are practiced worldwide but in Africa, this is attended by contamination by aeromycoflora and other agents such as insect eggs and larvae. In addition are physical and chemical contaminants. In this thesis, the mycoflora and Total Aerobic Bacteria load of market samples and solar-dried okra (Clemson spineless and Legon Finger) chips and powder were ascertained with the view to documenting toxin-producing fungal species and update the resident mycoflora and bacteria load. Insects resident in the samples were detected by the hidden infestation technique; mycoflora was determined by the decimal serial dilution method on different media and Total Aerobic Bacteria population was determined on Plate Count Agar at 320C for 48hr. In order to establish storage stability of the okra, the chips and powdered samples were placed in glass desiccators with glycerol: water mixtures providing Environmental Relative Humidities of 20, 55, 65, 75, 85 and 95% representative of the Ghanaian Tropic Conditions to undergo sorption at the same temperature. Gamma irradiation doses (0, 5, 10, 20kGy) were used as a preservation process to decontaminate resident mycoflora and total aerobic bacteria. This was supplemented by an in vitro study in the radio-resistance of six selected resident fungi (Aspergillus; Penicllium spp). The veracity of the dry okra supporting growth of selected Aspergillus and Penicillium

  18. The Deletion of the Succinate Dehydrogenase Gene KlSDH1 in Kluyveromyces lactis Does Not Lead to Respiratory Deficiency

    Science.gov (United States)

    Saliola, Michele; Bartoccioni, Paola Chiara; De Maria, Ilaria; Lodi, Tiziana; Falcone, Claudio

    2004-01-01

    We have isolated a Kluyveromyces lactis mutant unable to grow on all respiratory carbon sources with the exception of lactate. Functional complementation of this mutant led to the isolation of KlSDH1, the gene encoding the flavoprotein subunit of the succinate dehydrogenase (SDH) complex, which is essential for the aerobic utilization of carbon sources. Despite the high sequence conservation of the SDH genes in Saccharomyces cerevisiae and K. lactis, they do not have the same relevance in the metabolism of the two yeasts. In fact, unlike SDH1, KlSDH1 was highly expressed under both fermentative and nonfermentative conditions. In addition to this, but in contrast with S. cerevisiae, K. lactis strains lacking KlSDH1 were still able to grow in the presence of lactate. In these mutants, oxygen consumption was one-eighth that of the wild type in the presence of lactate and was normal with glucose and ethanol, indicating that the respiratory chain was fully functional. Northern analysis suggested that alternative pathway(s), which involves pyruvate decarboxylase and the glyoxylate cycle, could overcome the absence of SDH and allow (i) lactate utilization and (ii) the accumulation of succinate instead of ethanol during growth on glucose. PMID:15189981

  19. Metakognisjon om språk og språklæring i et flerspråklighetsperspektiv

    Directory of Open Access Journals (Sweden)

    Åsta Haukås

    2014-09-01

    Full Text Available I denne artikkelen drøfter jeg betydningen av elevers refleksjon om språk og språklæring. Artikkelens første del gir en kort introduksjon til forskningsfeltet metakognisjon. Deretter presenterer jeg to underkategorier av metakognisjon som er særlig relevante i språkundervisningen, metalingvistisk bevissthet og bevissthet om språklæringsstrategier. I artikkelens andre del introduserer jeg hovedprinsippene i flerspråklighetsdidaktikken, gir eksempler på hvordan elevene kan reflektere over språk og språklæring i språkfagene og argumenterer for at økt vekt på metakognisjon i og på tvers av språkfagene er en nøkkel til bedre språkkompetanse hos fremtidige elever. Dette krever imidlertid et sterkere samarbeid mellom språkfagene i skole, lærerutdanning og forskning.

  20. An Empiric Linear Formula between the Internal Tetrahedron Symmetric Stretch Frequency and the Al Content in the Framework of KL Molecular Sieves

    Institute of Scientific and Technical Information of China (English)

    Nong Yue HE; Chun YANG; Jian Xin TANG; Peng Feng XIAO; Hong CHEN

    2003-01-01

    KL molecular sieves with different framework compositions were secondarily synthesized by substituting Si for Al with a solution of (NH4)2SiF6. The internal tetrahedron symmetric stretch frequency, at ν770 cm-1, is linear with the molar fraction of Al (XAl= Al/(Si+Al)) in the framework of KL samples: XAl = -7.309×10-3 (υ770-760) + 0.3242.

  1. Meningoencefalite a vírus e síndrome de Klüver-Bucy: relato de dois casos

    Directory of Open Access Journals (Sweden)

    Eleonora V. dos Santos Montanha

    1986-12-01

    Full Text Available São apresentados dois casos de meningoencefalite viral, de provável etiologia herpética, que desenvolveram síndrome de Klüver-Bucy parcial. Aspectos clinicopatológicos, diagnósticos e terapêuticos da meningoencefalite herpética são discutidos revisando-se também conceitos acerca da síndrome de Klüver-Bucy.

  2. Molecular analysis of UAS(E), a cis element containing stress response elements responsible for ethanol induction of the KlADH4 gene of Kluyveromyces lactis.

    Science.gov (United States)

    Mazzoni, C; Santori, F; Saliola, M; Falcone, C

    2000-01-01

    KlADH4 is a gene of Kluyveromyces lactis encoding a mitochondrial alcohol dehydrogenase activity, which is specifically induced by ethanol and insensitive to glucose repression. In this work, we report the molecular analysis of UAS(E), an element of the KlADH4 promoter which is essential for the induction of KlADH4 in the presence of ethanol. UAS(E) contains five stress response elements (STREs), which have been found in many genes of Saccharomyces cerevisiae involved in the response of cells to conditions of stress. Whereas KlADH4 is not responsive to stress conditions, the STREs present in UAS(E) seem to play a key role in the induction of the gene by ethanol, a situation that has not been observed in the related yeast S. cerevisiae. Gel retardation experiments showed that STREs in the KlADH4 promoter can bind factor(s) under non-inducing conditions. Moreover, we observed that the RAP1 binding site present in UAS(E) binds KlRap1p.

  3. Ranakinestatin-PPF from the skin secretion of the Fukien gold-striped pond frog, Pelophylax plancyi fukienensis: a prototype of a novel class of bradykinin B2 receptor antagonist peptide from ranid frogs.

    Science.gov (United States)

    Ma, Jie; Luo, Yu; Ge, Lilin; Wang, Lei; Zhou, Mei; Zhang, Yingqi; Duan, Jinao; Chen, Tianbao; Shaw, Chris

    2014-01-01

    The defensive skin secretions of many amphibians are a rich source of bradykinins and bradykinin-related peptides (BRPs). Members of this peptide group are also common components of reptile and arthropod venoms due to their multiple biological functions that include induction of pain, effects on many smooth muscle types, and lowering systemic blood pressure. While most BRPs are bradykinin receptor agonists, some have curiously been found to be exquisite antagonists, such as the maximakinin gene-related peptide, kinestatin-a specific bradykinin B2-receptor antagonist from the skin of the giant fire-bellied toad, Bombina maxima. Here, we describe the identification, structural and functional characterization of a heptadecapeptide (DYTIRTRLHQGLSRKIV), named ranakinestatin-PPF, from the skin of the Chinese ranid frog, Pelophylax plancyi fukienensis, representing a prototype of a novel class of bradykinin B2-receptor specific antagonist. Using a preconstricted preparation of rat tail arterial smooth muscle, a single dose of 10(-6)M of the peptide effectively inhibited the dose-dependent relaxation effect of bradykinin between 10(-11)M and 10(-5)M and subsequently, this effect was pharmacologically-characterized using specific bradykinin B1- (desArg-HOE140) and B2-receptor (HOE140) antagonists; the data from which demonstrated that the antagonism of the novel peptide was mediated through B2-receptors. Ranakinestatin-PPF-thus represents a prototype of an amphibian skin peptide family that functions as a bradykinin B2-receptor antagonist herein demonstrated using mammalian vascular smooth muscle.

  4. Amino acid, mineral and fatty acid content of pumpkin seeds (Cucurbita spp) and Cyperus esculentus nuts in the Republic of Niger.

    Science.gov (United States)

    Glew, R H; Glew, R S; Chuang, L-T; Huang, Y-S; Millson, M; Constans, D; Vanderjagt, D J

    2006-06-01

    Dried seeds and nuts are widely consumed by indigenous populations of the western Sahel, especially those who inhabit rural areas. In light of the need for quantitative information regarding the content of particular nutrients in these plant foods, we collected dried pumpkin (Cucurbita spp) seeds and nuts of Cyperus esculentus in the Republic of Niger and analyzed them for their content of essential amino acids, minerals and trace elements, and fatty acids. On a dry weight basis, pumpkin seed contained 58.8% protein and 29.8% fat. However, the lysine score of the protein was only 65% relative to the FAO/WHO protein standard. The pumpkin seed contained useful amounts of linoleic (92 microg/g dry weight) and the following elements (on a microg per g dry weight basis): potassium (5,790), magnesium (5,690), manganese (49.3), zinc (113), selenium (1.29), copper (15.4), chromium (2.84), and molybdenum (0.81), but low amounts of calcium and iron. Except for potassium (5,573 microg/g dry weight) and chromium (2.88 microg/g dry weight), the C. esculentis nuts contained much less of these same nutrients compared to pumpkin seeds. In conclusion, pumpkin seeds represent a useful source of many nutrients essential to humans. The data in this report should of practical value to public health officials in rural areas of sub-Saharan Africa.

  5. Acetylated Rhamnogalacturonans from Immature Fruits of Abelmoschus esculentus Inhibit the Adhesion of Helicobacter pylori to Human Gastric Cells by Interaction with Outer Membrane Proteins

    Directory of Open Access Journals (Sweden)

    Christian Thöle

    2015-09-01

    Full Text Available Polysaccharide containing extracts from immature fruits of okra (Abelmoschus esculentus are known to exhibit antiadhesive effects against bacterial adhesion of Helicobacter pylori (H. pylori to stomach tissue. The present study investigates structural and functional features of polymers responsible for this inhibition of bacterial attachment to host cells. Ammonium sulfate precipitation of an aqueous extract yielded two fractions at 60% and 90% saturation with significant antiadhesive effects against H. pylori, strain J99, (FE60% 68% ± 15%; FE90% 75% ± 11% inhibition rates after preincubation of the bacteria at 1 mg/mL. Sequential extraction of okra fruits yielded hot buffer soluble solids (HBSS with dose dependent antiadhesive effects against strain J99 and three clinical isolates. Preincubation of H. pylori with HBSS (1 mg/mL led to reduced binding to 3ʹ-sialyl lactose, sialylated Lea and Lex. A reduction of bacterial binding to ligands complementary to BabA and SabA was observed when bacteria were pretreated with FE90%. Structural analysis of the antiadhesive polysaccharides (molecular weight, monomer composition, linkage analysis, stereochemistry, and acetylation indicated the presence of acetylated rhamnogalacturonan-I polymers, decorated with short galactose side chains. Deacetylation of HBSS and FE90% resulted in loss of the antiadhesive activity, indicating esterification being a prerequisite for antiadhesive activity.

  6. Form factors for semileptonic Bs→Klν decays in lattice QCD

    International Nuclear Information System (INIS)

    Bahr, Felix Tobias

    2015-01-01

    We present an exploratory study of the calculation of the form factor f + (q 2 ) for the semileptonic decay B s →Klν in large-volume lattice QCD simulations with two dynamical sea quark flavours using O(a) improved Wilson fermions. We discuss the computation of relevant two- and three-point functions and consider complementary methods how these can be combined to obtain the form factor. In particular, we put forward the strategy of a combined fit in which data of all correlators enter and which has as fit parameters energies and amplitudes of the correlators and the form factor. The b quark is treated in HQET; our present analysis focuses on the static limit. Meanwhile, we have developed the code and performed the measurements of all needed O(1/m h ) corrections which will be used as soon as their coefficients will have been computed by the ALPHA collaboration. In order to be able to measure the form factor at the same value of the momentum transfer q 2 on all ensembles, we impose twisted boundary conditions on the s and b quarks that allow for a free tuning of the quark momenta and thus of q 2 . We perform measurements on a subset of N f =2 CLS gauge configurations, obtaining the form factor at three different lattice spacings and roughly the same pion mass of about 330 MeV. Using these, we carry out a continuum extrapolation and observe that it is relatively flat in a 2 . A measurement at a different pion mass indicates that quark mass effects are small. We compare our continuum value of the form factor with recently published results of other collaborations and observe a good agreement.

  7. K19 capsular polysaccharide of Acinetobacter baumannii is produced via a Wzy polymerase encoded in a small genomic island rather than the KL19 capsule gene cluster.

    Science.gov (United States)

    Kenyon, Johanna J; Shneider, Mikhail M; Senchenkova, Sofya N; Shashkov, Alexander S; Siniagina, Maria N; Malanin, Sergey Y; Popova, Anastasiya V; Miroshnikov, Konstantin A; Hall, Ruth M; Knirel, Yuriy A

    2016-08-01

    Polymerization of the oligosaccharides (K units) of complex capsular polysaccharides (CPSs) requires a Wzy polymerase, which is usually encoded in the gene cluster that directs K unit synthesis. Here, a gene cluster at the Acinetobacter K locus (KL) that lacks a wzy gene, KL19, was found in Acinetobacter baumannii ST111 isolates 28 and RBH2 recovered from hospitals in the Russian Federation and Australia, respectively. However, these isolates produced long-chain capsule, and a wzy gene was found in a 6.1 kb genomic island (GI) located adjacent to the cpn60 gene. The GI also includes an acetyltransferase gene, atr25, which is interrupted by an insertion sequence (IS) in RBH2. The capsule structure from both strains was →3)-α-d-GalpNAc-(1→4)-α-d-GalpNAcA-(1→3)-β-d-QuipNAc4NAc-(1→, determined using NMR spectroscopy. Biosynthesis of the K unit was inferred to be initiated with QuiNAc4NAc, and hence the Wzy forms the β-(1→3) linkage between QuipNAc4NAc and GalpNAc. The GalpNAc residue is 6-O-acetylated in isolate 28 only, showing that atr25 is responsible for this acetylation. The same GI with or without an IS in atr25 was found in draft genomes of other KL19 isolates, as well as ones carrying a closely related CPS gene cluster, KL39, which differs from KL19 only in a gene for an acyltransferase in the QuiNAc4NR synthesis pathway. Isolates carrying a KL1 variant with the wzy and atr genes each interrupted by an ISAba125 also have this GI. To our knowledge, this study is the first report of genes involved in capsule biosynthesis normally found at the KL located elsewhere in A. baumannii genomes.

  8. Interaction between Galactomyces geotrichum KL20B, Lactobacillus plantarum LAT3 and Enterococcus faecalis KE06 during Milk Fermentation

    Directory of Open Access Journals (Sweden)

    Clemencia Chaves-López

    2017-10-01

    Full Text Available Microbial interactions are fundamental during milk fermentation, determining the product final characteristics. Galactomyces geotrichum, Lactobacillus plantarum and Enterococcus faecalis are among the most common microorganisms in the Colombian Kumis. The aim of the research was to evaluate the yeast–bacteria interactions in milk fermentation at 28 °C. UHT (Ultra-High Temperature milk was inoculated with single- or multiple-strains associations and analysed periodically to determine the microbial counts, organic acids and total free amino acids (FAA. The results evidenced different growth performance of the strains in single or co-culture, with a positive effect of G. geotrichum KL20B on the lactic acid bacteria (LAB growth performance. All the strains consumed citric acid after 6 h of incubation with E. faecalis KE06 as the major consumer; however, all the co-cultures showed an early metabolism of citrate but with a low intake rate. In addition, the interaction between G. geotrichum KL20B and E. faecalis KE06 led to a low accumulation of acetic acid. Formic acid fluctuated during fermentation. The strains interaction also led to an increase in ethanol content and a lower accumulation of FAA. In conclusion, the three strains co-culture enhances the LAB viability, with high production of lactic acid and ethanol, as a consequence of adaptation to the environment and substrate exploitation. To our knowledge, this is the first time in which it is showed that G. geotrichum KL20B could be used to compensate for the slow acid-producing ability of Lb. plantarum and E. faecalis in milk, underlining that this consortium applies some mechanisms to regulate the growth and milk composition in acids and ethanol content.

  9. Soot temperature and KL factor for biodiesel and diesel spray combustion in a constant volume combustion chamber

    KAUST Repository

    Zhang, Ji

    2013-07-01

    This paper presents measurements of the soot temperature and KL factor for biodiesel and diesel combustion in a constant volume chamber using a two-color technique. This technique uses a high-speed camera coupled with two narrowband filters (550. nm and 650. nm, 10. nm FWHM). After calibration, statistical analysis shows that the uncertainty of the two-color temperature is less than 5%, while it is about 50% for the KL factor. This technique is then applied to the spray combustion of biodiesel and diesel fuels under an ambient oxygen concentration of 21% and ambient temperatures of 800, 1000 and 1200. K. The heat release result shows higher energy utilization efficiency for biodiesel compared to diesel under all conditions; meanwhile, diesel shows a higher pressure increase due to its higher heating value. Biodiesel yields a lower temperature inside the flame area, a longer soot lift-off length, and a smaller soot area compared to diesel. Both the KL factor and the total soot with biodiesel are lower than with diesel throughout the entire combustion process, and this difference becomes larger as the ambient temperature decreases. Biodiesel shows approximately 50-100. K lower temperatures than diesel at the quasi-steady stage for 1000 and 1200. K ambient temperature, while diesel shows a lower temperature than biodiesel at 800. K ambient. This result may raise the question of how important the flame temperature is in explaining the higher NO. x emissions often observed during biodiesel combustion. Other factors may also play an important role in controlling NO. x emissions. Both biodiesel and diesel temperature measurements show a monotonic dependence on the ambient temperature. However, the ambient temperature appears to have a more significant effect on the soot formation and oxidation in diesel combustion, while biodiesel combustion soot characteristics shows relative insensitivity to the ambient temperature. © 2013 Elsevier Ltd.

  10. Hexadactyly case at a Rana kl. esculenta sample from the north-western part of Romania (Short Notes

    Directory of Open Access Journals (Sweden)

    Istvan SAS

    2006-05-01

    Full Text Available At 17 June 2006, in a habitat close to Gherta Mica locality (47°56'0'' N, 23°14'0'' E, Satu-Mare County, Romania we had found a sample of Rana kl. esculenta which presented hexadactyly at both of its posterior feet. The captured sample of edible frog had fully formed extra (sixth toes, with phalanges (bones. The hexadactyly was perfectly symmetrical at both of the posterior feet. At this individual we did not discovered any other malformations, the biometrical characters situating in the variations limits of the other green frogs from the studied habitat. A symmetric hexadacytly can be a result of atavism.

  11. Responses of growth of lady’s fingers ([i]Abelmoschus esculentus [/i]L. to different treatments methods of dairy wastewater

    Directory of Open Access Journals (Sweden)

    Rana Ibrahim Al-Dulaimi

    2014-03-01

    Full Text Available Introduction and objective. Water is one of the most important precious resources found on the earth, and are most often affected by anthropogenic activities and by industry. Pollution caused by human beings and industries is a serious concern throughout the world. Population growth, massive urbanization, rapid rate of industrialization and modern techniques in agriculture have accelerated water pollution and led to the gradual deterioration of its quality. A large quantity of waste water disposed of at sea or on land has caused environmental problems which have led to environmental pollution, economic losses and chemical risks caused by the wastewater, and its impact on agriculture. However, waste water which contain nutrients and organic matter has possible advantages for agricultural purposes. Therefore, the presented study was undertaken to assess the impact of Dairy Effluent (treated and untreated waste water on seed germination, seedling growth, dry matter production and the biochemical parameters of lady’s fingers ([i]Abelmoschus esculentus[/i] L.. Materials and methods. A field experiment in a green house was conducted to use raw and treated dairy wastewater for watering lady’s fingers (Abelmoschus esculentus L.. The plants were watered using (WW raw dairy wastewater, (T1 chemicals treatment, (T2 physical treatment, (T3 dilution method treatment and tap water (TW in pot experiments. Ten plants of each treatment /3 replicate were randomly selected and labelled for the collection of data. The data was collected sequentially, starting with chlorophyll content pre-harvest, vegetative qualities (shoot, root and seedling length and dry matter quality (shoot and root dry matter pos-tharvest. Results. The effect was seen on the germination seed and growth of the plant. The results showed inhibitory effect from dairy effluent (WW on seed germination and plant growth. Treatment with chemicals showed statistically significant differences with

  12. Is elevated CO2 in space really harmful to growth and development? A case study of Chufa (Cyperus esculentus L.) in Lunar Palace-1

    Science.gov (United States)

    Liu, Guanghui; Dong, Chen; Fu, Yuming; Wang, Minjuan; Shao, Lingzhi; Yu, Juan; Liu, Hong

    2018-05-01

    CO2 concentration [CO2] level in artificial ecosystems such as greenhouse agriculture and space farming can easily exceed 1000 μmol mol-1 (or ppm). In order to understand how the growth and development in crop plants may respond to elevated CO2, it is necessary to determine if crop leaves in the closed artificial ecosystem have a fully developed photosynthetic apparatus, and whether or not photosynthesis in these leaves is more responsive to elevated CO2 concentration. To address this issue, we evaluated the response of photosynthetic characteristics, leaf water status and antioxidant capacity of Chufa (Cyperus esculentus L.), which is a sedge-like plant with 1-2 cm small sweet tubers in length, under elevated CO2 concentrations in an artificial closed ecosystem. The results showed that Chufa plants cultivated in the elevated CO2 environment from the seedling stage to the maturity stage were characterized by more appropriate chlorophyll content and photosynthetic rate. The photosynthetic rate of Chufa plants in the 1000 and 3000 ppm treatments was no significant difference with that in 500 ppm CO2 condition both at seedling stage and rapid growth stage. All the treatments had a high relative water content (RWC) about 60% at the maturity stage. However, there was no significant difference in membrane stability index (MSI) at the rapid growth stage. The antioxidase enzymes activities experienced a rise and a drop and reached the peak at the rapid growth stage. Elevated CO2, especially more than 1000 ppm conditions, may accelerant Chufa plants aging process.

  13. Ranakinestatin-PPF from the Skin Secretion of the Fukien Gold-Striped Pond Frog, Pelophylax plancyi fukienensis: A Prototype of a Novel Class of Bradykinin B2 Receptor Antagonist Peptide from Ranid Frogs

    Directory of Open Access Journals (Sweden)

    Jie Ma

    2014-01-01

    Full Text Available The defensive skin secretions of many amphibians are a rich source of bradykinins and bradykinin-related peptides (BRPs. Members of this peptide group are also common components of reptile and arthropod venoms due to their multiple biological functions that include induction of pain, effects on many smooth muscle types, and lowering systemic blood pressure. While most BRPs are bradykinin receptor agonists, some have curiously been found to be exquisite antagonists, such as the maximakinin gene-related peptide, kinestatin—a specific bradykinin B2-receptor antagonist from the skin of the giant fire-bellied toad, Bombina maxima. Here, we describe the identification, structural and functional characterization of a heptadecapeptide (DYTIRTRLHQGLSRKIV, named ranakinestatin-PPF, from the skin of the Chinese ranid frog, Pelophylax plancyi fukienensis, representing a prototype of a novel class of bradykinin B2-receptor specific antagonist. Using a preconstricted preparation of rat tail arterial smooth muscle, a single dose of 10−6 M of the peptide effectively inhibited the dose-dependent relaxation effect of bradykinin between 10−11 M and 10−5 M and subsequently, this effect was pharmacologically-characterized using specific bradykinin B1- (desArg-HOE140 and B2-receptor (HOE140 antagonists; the data from which demonstrated that the antagonism of the novel peptide was mediated through B2-receptors. Ranakinestatin—PPF—thus represents a prototype of an amphibian skin peptide family that functions as a bradykinin B2-receptor antagonist herein demonstrated using mammalian vascular smooth muscle.

  14. Oprava klínovitosti vzorků pro měření v laserové spektroskopii

    OpenAIRE

    Schiffer, Štěpán

    2016-01-01

    Jednou z oblastí využití metody LIBS je tvorba chemických map zkoumaných vzorků. Významný vliv na přesnost měření touto metodou má vzdálenost mezi čočkou a povrchem vzorku. U klínovitých vzorků se tato vzdálenost v průběhu experimentu mění a výrazně tak snižuje kvalitu vytvořených chemických map. V této bakalářské práci je navržena a experimentálně ověřena metoda, kterou je možné klínovitost vzorku kompenzovat. Součástí práce je popis teoretických základů laserové spektroskopie a přehled někt...

  15. Biological removal of nickel (II by Bacillus sp. KL1 in different conditions: optimization by Taguchi statistical approach

    Directory of Open Access Journals (Sweden)

    Taran Mojtaba

    2015-09-01

    Full Text Available Bioremediation is the removal of heavy-metals such as nickel (Ni using microorganisms and has been considered as an important field in the biotechnology. Isolation and characterization of microorganisms exhibiting bioremediation activities and their optimization to treat polluted wastewaters is a vital and difficult task in remediation technologies. In this study, investigation was carried out to isolate Ni (II remediating microbial strains from soils contaminated with municipal solid waste leachate. Furthermore, Taguchi design of experiments were used to evaluate the influence of concentration, pH, temperature, and time on bioremediation of Ni (II using isolated bacteria. This study concluded that Bacillus sp. KL1 is a Ni (II-resistant strain and had Ni (II bioremediation activity. The highest bioremediation of Ni (II was observed as 55.06% after 24 h at 30ºC, pH 7, and 100 ppm concentration. Moreover, it was also observed that concentration is the most effective factor in the bioremediation process. In conclusion, we have demonstrated that bacteria isolated from soils contaminated with garbage leachate have the Bacillus sp. KL1 bacteria which can efficiently uptake and eliminate Ni (II from contaminated sites and thus makes it possible to treat heavy-metal containing wastewaters in industry by using this microorganism at optimized conditions.

  16. THE BLACK HOLE CENTRAL ENGINE FOR ULTRA-LONG GAMMA-RAY BURST 111209A AND ITS ASSOCIATED SUPERNOVA 2011KL

    Energy Technology Data Exchange (ETDEWEB)

    Gao, He; You, Zhi-Qiang [Department of Astronomy, Beijing Normal University, Beijing 100875 (China); Lei, Wei-Hua; Xie, Wei, E-mail: gaohe@bnu.edu.cn, E-mail: leiwh@hust.edu.cn [School of Physics, Huazhong University of Science and Technology, Wuhan, 430074 (China)

    2016-08-01

    Recently, the first association between an ultra-long gamma-ray burst (GRB) and a supernova was reported, i.e., GRB 111209A/SN 2011kl, enabling us to investigate the physics of central engines or even progenitors for ultra-long GRBs. In this paper, we inspect the broadband data of GRB 111209A/SN 2011kl. The late-time X-ray light curve exhibits a GRB 121027A-like fallback bump, suggesting a black hole (BH) central engine. We thus propose a collapsar model with fallback accretion for GRB 111209A/SN 2011kl. The required model parameters, such as the total mass and radius of the progenitor star, suggest that the progenitor of GRB 111209A is more likely a Wolf–Rayet star instead of a blue supergiant, and the central engine of this ultra-long burst is a BH. The implications of our results are discussed.

  17. Gambaran Pasien Tuli Mendadak di Bagian THT-KL RSUP Dr. M. Djamil Padang

    Directory of Open Access Journals (Sweden)

    Hedo Hidayat

    2016-08-01

    Full Text Available AbstrakTuli mendadak adalah penurunan pendengaran sensorineural yang berlangsung dalam waktu kurang dari 72 jam. Penyakit ini merupakan salah satu kegawatdaruratan neurotologi dan memerlukan penatalaksanaan dini untuk menghindari kecacatan yang dapat ditimbulkan. Tujuan penelitian ini adalah melihat gambaran kejadian tuli mendadak di Bagian THT-KL RSUP Dr. M.Djamil. Ini merupakan penelititan deskriptif retrospektif dengan menggunakan data rekam medik di RSUP Dr. M. Djamil Padang selama tahun 2010 sampai tahun 2013. Didapatkan hasil sebanyak 26 kasus yang masuk kriteria inklusi pada periode tersebut. Sebaran umur penderita dari 8 sampai 79 tahun, dengan distribusi terbanyak pada usia 40 – 60 tahun. Faktor resiko yang ditemukan berupa hipertensi dan diabetes melitus sama besar yaitu 11,54%. Gejala klinis terdiri atas tinitus (76,92%, diikuti vertigo (38,46%, dan rasa penuh di telinga (15,38%. Pasien terbanyak pada derajat ketulian sangat berat (38,46%, kemudian derajat sedang berat dan berat (23,08%, diikuti derajat ringan (11,54% dan sedang (3,85%. Distribusi onset terapi terbanyak pada 0 – 7 hari (50,00%, kemudian onset > 14 hari (30,77% dan onset 8 – 14 hari (19,23%. Perbaikan pendengaran ditemukan sama banyak pada kategori sangat baik dan baik sebanyak 6 kasus dan diikuti kategori sembuh satu kasus. Dari penelitian ini dapat dikatakan tidak hanya satu faktor yang menentukan perbaikan tuli mendadak.Kata kunci: tuli mendadak, retrospektif, gejala klinis1Mahasiswa FK Unand, 2Bagian Pulmonologi FK Unand, 3Bagian Patologi Anatomi FK UnandAbstractSudden deafness is a sensorineural hearing loss  in less than 72 hours. Sudden deafness is a neurotological emergency and requiring an early management to avoid the defects that can be caused. The objective of  this study was to see cases of sudden deafness in Dr. M. Djamil General Hospital. This was a descriptive research with retrospective design using medical record data in Dr. M. Djamil General

  18. Klärung des urheberrechtlichen Status: Wege und Perspektiven in der Deutschen Nationalbibliothek

    Directory of Open Access Journals (Sweden)

    Kathrin Jockel

    2015-12-01

    Full Text Available In welcher Weise ein Digitalisat den Nutzerinnen und Nutzern zur Verfügung gestellt werden darf, ist abhängig vom urheberrechtlichen Status des zugrunde liegenden analogen Werks. Dieses kann gemeinfrei sein, weil Urheberrechte erloschen sind, was nach deutschem Recht 70 Jahre nach dem Tod des Urhebers der Fall ist, oder es kann urheberrechtlich geschützt sein, weil der Urheber oder dessen Erben noch Rechte daran halten. Grundsätzlich gilt: Je älter ein Werk, desto wahrscheinlicher ist seine Gemeinfreiheit. Aufgrund des historisch eher jungen Bestandes der Deutschen Nationalbibliothek, deren Sammlung mit dem Erscheinungsjahr 1913 einsetzt, fallen gegenwärtig weit über 90% der Publikationen in den urheberrechtlich geschützten Bereich. Die Deutsche Nationalbibliothek hat 2013 im Rahmen ihrer Digitalisierungsaktivitäten ein Verfahren zur Klärung des Rechtestatus von Werken aufgebaut. Dabei mussten verschiedene Aspekte berücksichtigt werden: neben den rechtlichen Voraussetzungen auch die Wirtschaftlichkeit und die Skalierbarkeit des Arbeitsablaufs auf größere Stückzahlen sowie die Handhabbarkeit der Dokumentation und der Verzeichnung von urheberrechtlich relevanten Informationen im Bibliothekskatalog. Der Workflow kam inzwischen bei mehreren Digitalisierungsprojekten zum Einsatz, unter anderem wurden 22.275 digitalisierte Monografien der Exilsammlungen der Deutschen Nationalbibliothek bearbeitet. Der Vortrag stellt den Workflow zur Rechteklärung anhand des Exil-Projektes vor und gibt einen Ausblick auf die Erweiterungen beispielsweise für andere Medienarten. The way in which a digital copy can be made available to users depends on the copyright status of the original analogue work. It may be public domain because the copyright has expired. Under German law this happens 70 years after the originator’s death. Or it may be copyright-protected because its originator, or his or her heirs, still holds the rights. Basically, the older a

  19. Field efficacy of azadirachtin-A, tetrahydroazadirachtin-A, NeemAzal and endosulfan against key pests of okra (Abelmoschus esculentus).

    Science.gov (United States)

    Dhingra, Swaran; Walia, Suresh; Kumar, Jitendra; Singh, Shivendra; Singh, Gyanendra; Parmar, Balraj S

    2008-11-01

    BACKGROUND Unlike synthetic pesticides, azadirachtin-based neem pesticides are environmentally friendly and are well known for their diverse pest control properties. Their use is, however, limited by the instability of azadirachtin, necessitating application at short intervals. The efficacy of relatively stable tetrahydroazadirachtin-A, therefore, needed to be established under field conditions. Azadirachtin-A (Aza-A), its stable derivative tetrahydroazadirachtin-A (THA) and other neem pesticides have been evaluated for their field efficacy against major insect pests of okra, Abelmoschus esculentus (L.) Moench., during summer (kharif) 2003 and 2004. The optimum doses of Aza-A and THA against the fruit borer, Earias vittella F., were also established. Reductions in population of whitefly, Bemisia tabaci (Genn.), and leafhopper (jassid), Amrasca biguttulla biguttulla Ishida, after application of THA or endosulfan was evident up to 10 days after treatment (DAT), whereas with Aza-A and NeemAzal (NZ) the effect was observed up to 7 DAT only. Endosulfan and THA also caused higher reduction in the larvae of shoot and fruit borer E. vittella and E. insulana Boisd., and recorded the highest yields of 4600 and 4180 kg ha(-1). The efficacy of THA (0.05 g L(-1) emulsion) was comparable with that of 0.5 g L(-1) endosulfan emulsion in reducing fruit borer infestation, the reduction over the control being 86.0 and 87.3%, 84.9 and 94.1% and 90.2 and 92.6% at first, second and third picking. THA 0.02 g L(-1) and Aza-A 0.05 g L(-1) were on a par. Laboratory-made neem oil emulsifiable concentrate was the least effective, but was superior to untreated check. Three consecutive sprays of THA, a neem-based biopesticide, and endosulfan have been found to be superior in controlling field pests of okra to Aza-A and NZ, which were on a par. THA thus holds potential as a component of pest management strategies against okra pests. Copyright (c) 2008 Society of Chemical Industry.

  20. Digital Clubbing Is Associated with Higher Serum KL-6 Levels and Lower Pulmonary Function in Patients with Interstitial Lung Disease

    Directory of Open Access Journals (Sweden)

    Kazushige Shiraishi

    2018-01-01

    Full Text Available Background. Although digital clubbing is a common presentation in patients with interstitial lung disease (ILD, little has been reported regarding its role in assessing patients with ILD. This study evaluated patients with ILD for the presence of clubbing and investigated its association with clinical data. Methods. We evaluated patients with ILD who visited the teaching hospital at which the study was conducted, between October 2014 and January 2015. Clubbing, evaluated using a Vernier caliper for individual patients, was defined as a phalangeal depth ratio > 1. We examined the association of clubbing with clinical data. Results. Of 102 patients with ILD, we identified 17 (16.7% with clubbing. The partial pressure of oxygen in arterial blood was lower (65.2 ± 5.9 mmHg versus 80.2 ± 3.1 mmHg; p=0.03, serum Krebs von den Lugen-6 (KL-6 levels were higher (1495.0 ± 277.4 U/mL versus 839.1 ± 70.2 U/mL; p=0.001, and the percent predicted diffusing capacity of carbon monoxide was lower (50.0 ± 6.0 versus 73.5 ± 3.1; p=0.002 in these patients with clubbing. Conclusions. Patients with clubbing had lower oxygen levels, higher serum KL-6 levels, and lower pulmonary function than those without clubbing.

  1. Carly L. Crouch & Jonathan Stökl (eds.: In the Name of God. The Bible in the Colonial Discourse of Empire

    Directory of Open Access Journals (Sweden)

    Judith Becker

    2015-11-01

    Full Text Available This contribution offers a review of Carly L. Crouch & Jonathan Stökl (eds.: In the Name of God. The Bible in the Colonial Discourse of Empire, Biblical Interpretation Series 126. Leiden: Brill, 2014. viii and 192 pages, € 98, ISBN 978-900-425-8334.

  2. Herschel Observations of Extraordinary Sources: Analysis of the HIFI 1.2 THz Wide Spectral Survey toward Orion KL. I. Methods

    NARCIS (Netherlands)

    Crockett, Nathan R.; Bergin, Edwin A.; Neill, Justin L.; Favre, Cécile; Schilke, Peter; Lis, Dariusz C.; Bell, Tom A.; Blake, Geoffrey; Cernicharo, José; Emprechtinger, Martin; Esplugues, Gisela B.; Gupta, Harshal; Kleshcheva, Maria; Lord, Steven; Marcelino, Nuria; McGuire, Brett A.; Pearson, John; Phillips, Thomas G.; Plume, Rene; van der Tak, Floris; Tercero, Belén; Yu, Shanshan

    We present a comprehensive analysis of a broadband spectral line survey of the Orion Kleinmann-Low nebula (Orion KL), one of the most chemically rich regions in the Galaxy, using the HIFI instrument on board the Herschel Space Observatory. This survey spans a frequency range from 480 to 1907 GHz at

  3. Legionella dumoffii Tex-KL Mutated in an Operon Homologous to traC-traD is Defective in Epithelial Cell Invasion.

    Science.gov (United States)

    Qin, Tian; Ken-Ichiro, Iida; Ren, Hong Yu; Zhou, Hai Jian; Yoshida, Shin-Ichi

    2016-06-01

    To understand the mechanism of invasion by Legionella dumoffii. The L. dumoffii strain Tex-KL was mutated using the Tn903 derivative, Tn903dIIlacZ. After screening 799 transposon insertion mutants, we isolated one defective mutant. We then constructed the gene-disrupted mutant, KL16, and studied its invasion of and intracellular growth in HeLa and A549 cells, and in A/J mice survival experiments. The structure of traC-traD operon was analyzed by RT-PCR. The transposon insertion was in a gene homologous to Salmonella typhi traC, which is required for the assembly of F pilin into the mature F pilus structure and for conjugal DNA transmission. Results from RT-PCR suggested that the traC-traD region formed an operon. We found that when the traC gene was disrupted, invasion and intracellular growth of L. dumoffii Tex-KL were impaired in human epithelial cells. When mice were infected by intranasal inoculation with a traC deficient mutant, their survival significantly increased when compared to mice infected with the wild-type strain.. Our results indicated that the traC-traD operon is required for the invasion and intracellular growth abilities of L. dumoffii Tex-KL in epithelial cells. Copyright © 2016 The Editorial Board of Biomedical and Environmental Sciences. Published by China CDC. All rights reserved.

  4. On the occurrence and identity of triploids of Rana kl. esculenta Linnaeus and R. lessonae Camerano in The Netherlands (Anura: Ranidae)

    NARCIS (Netherlands)

    Blommers-Schlösser, Rose M.A.

    1990-01-01

    According to electrophoresis and erythrocyte size the genotypes of 756 waterfrogs, collected during 1986—1988 in 54 localities in The Netherlands, were classified as belonging to 5 different genotypes: 331 diploid R. lessonae (LL), 5 triploid R. lessonae (LLL), 250 diploid R. kl. esculenta (LR), 133

  5. Inhibiton of Yellow Nutsedge (Cyperus esculentus L. and Bermudagrass (Cynodon dactylon (L. Pers by a Mulch Derived from Rye (Secale cereale L. in grapevines Inhibición del Crecimiento de Chufa (Cyperus esculentus L. y Pasto Bermuda (Cynodon dactylon (L. Pers. con mulch Vegetal Proveniente de Centeno (Secale cereale L. en Vides

    Directory of Open Access Journals (Sweden)

    Juan Ormeño-Núñez

    2008-09-01

    Full Text Available Two field trials (Los Andes 1998-1999 and Santiago 2004-2005 were carried out to determine growth inhibition of yellow nutsedge (Cyperus esculentus L. and bermudagrass (Cynodon dactylon (L. Pers., growing on the plantation row, by mulch derived from a rye (Secale cereale L. cover crop established between grapevine (Vitis vinifera L. rows on overhead (cv. Flame Seedless and vertical (cv. Cabernet Sauvignon training. Spring mowing of the rye sown in the fall allowed for developing a thick and long lasting mulch along the grape rows. Nutsedge and bermudagrass control was 81 and 82%, respectively, and was more effective than conventional chemical (in the row + mechanical (between rows control. Glyphosate at 2% for nutsedge and 1% for bermudagrass control, applied twice (October and December, was insufficient to control either perennial weed adequately. Total broadleaved and grass/sedge weed control was 67.3 and 43.0% more effective with the rye mulch than with conventional treatments at Los Andes and Santiago, respectively. Perennial weed control levels could be explained as the new foliage of yellow nutsedge and bermudagrass was particularly susceptible to the shading provided by the rye mulch assembled prior to mid spring shoot emergence, and this effect remained active up until the beginning of autumn. The subsequent rye foliage mowing at the vegetative stage fully expressed the allelopathic effect produced by this local rye cultivar. The use of rye cover crop management and mulch could be applied as an effective weed control technique in conventional, as well as organic deciduous tree orchards.En dos ensayos de campo (Los Andes 1998-1999 y Santiago 2004-2005 se determinó el efecto inhibitorio sobre chufa (Cyperus esculentus L. y pasto bermuda (Cynodon dactylon (L. Pers. de residuos de centeno (Secale cereale L. establecido en otoño entre las hileras de vides (Vitis vinifera L. en parronal (cv. Flame Seedless y espaldera (cv. Cabernet Sauvignon

  6. Temporal changes of aquatic macrophytes vegetation in a Iowland groundwater feed eutrophic course (Klátovské rameno, Slovakia

    Directory of Open Access Journals (Sweden)

    Helena Oťahel'ová

    2011-01-01

    Full Text Available Klátovské rameno is the lowland slow-flowing groundwater feed eutrophic tributary of the Malý Dunaj River (Danube Plain, where our study of temporal changes of aquatic macrophytes vegetation was realised in 1999 and 2005. For survey of aquatic vascular macrophytes the Kohler’s method (Janauer 2003 was used, which is compliant with European standard EN 14184. Altogether 35 aquatic macrophyte species were recorded during the survey. Nuphar lutea persisted as the most dominant species in 1996 and 2005. Species diversity increased slightly after the nine years: ten species immigrated to the watercourse. The changes in species abundance have shown weak differences, however the abundance of Sparganium emersum has increased markedly. Alien species Elodea canadensis and both S. emersum and Hydrocharis morsus-ranae significantly enlarged their distribution in the stream. The ecological quality of the river, based on the aquatic macrophytes assessment criteria, was slightly impaired after nine years, but still 90% of its studied course has a high or good ecological status.

  7. KL Estimation of the Power Spectrum Parameters from the Angular Distribution of Galaxies in Early SDSS Data

    CERN Document Server

    Szalay, Alexander S.; Matsubara, Takahiko; Scranton, Ryan; Vogeley, Michael S.; Connolly, Andrew; Dodelson, Scott; Eisenstein, Daniel; Frieman, Joshua A.; Gunn, James E.; Hui, Lam; Johnston, David; Kent, Stephen M.; Kerscher, Martin; Loveday, Jon; Meiksin, Avery; Narayanan, Vijay; Nichol, Robert C.; O'Connell, Liam; Pope, Adrian; Scoccimarro, Roman; Sheth, Ravi K.; Stebbins, Albert; Strauss, Michael A.; Szapudi, Istvan; Tegmark, Max; Zehavi, Idit; Annis, James; Bahcall, Neta A.; Brinkmann, Jon; Csabai, Istvan; Fukugita, Masataka; Hennessy, Greg; Hogg, David W.; Ivezic, Zeljko; Knapp, Gillian R.; Kunszt, Peter Z.; Lamb, Don Q.; Lee, Brian C.; Lupton, Robert H.; Munn, Jeffrey R.; Peoples, John; Pier, Jeffrey R.; Rockosi, Constance; Schlegel, David; Stoughton, Christopher; Tucker, Douglas L.; Yanny, Brian; York, Donald G.; Szalay, Alexander S.; Jain, Bhuvnesh; Matsubara, Takahiko; Scranton, Ryan; Vogeley, Michael S.; Connolly, Andrew; Dodelson, Scott; Eisenstein, Daniel; Frieman, Joshua A.; Gunn, James E.; Hui, Lam; Johnston, David; Kent, Stephen; Kerscher, Martin; Loveday, Jon; Meiksin, Avery; Narayanan, Vijay; Nichol, Robert C.; Connell, Liam O'; Pope, Adrian; Scoccimarro, Roman; Sheth, Ravi K.; Stebbins, Albert; Strauss, Michael A.; Szapudi, Istvan; Tegmark, Max; Zehavi, Idit

    2002-01-01

    We present measurements of parameters of the 3-dimensional power spectrum of galaxy clustering from 222 square degrees of early imaging data in the Sloan Digital Sky Survey. The projected galaxy distribution on the sky is expanded over a set of Karhunen-Loeve eigenfunctions, which optimize the signal-to-noise ratio in our analysis. A maximum likelihood analysis is used to estimate parameters that set the shape and amplitude of the 3-dimensional power spectrum. Our best estimates are Gamma=0.188 +/- 0.04 and sigma_8L = 0.915 +/- 0.06 (statistical errors only), for a flat Universe with a cosmological constant. We demonstrate that our measurements contain signal from scales at or beyond the peak of the 3D power spectrum. We discuss how the results scale with systematic uncertainties, like the radial selection function. We find that the central values satisfy the analytically estimated scaling relation. We have also explored the effects of evolutionary corrections, various truncations of the KL basis, seeing, sam...

  8. S počítačem bez myši a klávesnice

    OpenAIRE

    Jaroň, Lukáš

    2010-01-01

    V této bakalářské práci jsou popsány návrhy způsobů, jakými lze ovládat počítač bez myši a klávesnice, pouhým pohybem ruky, a uživatelských rozhraní. Dále je zde popsána teorie nástrojů použitých k vytvoření experimentálních aplikací, které simulují navržená rozhraní. A celý vývojový cyklus od analýzy problému, specifikace a implementace, až k testování vytvořené aplikace. Výsledek této práce je rozhraní, které dokáže rozpoznat osm různých pohybů ruky a použít je jako vstup do systému. In ...

  9. Klüver–Bucy syndrome associated with a recessive variant in HGSNAT in two siblings with Mucopolysaccharidosis type IIIC (Sanfilippo C)

    OpenAIRE

    Hu, Hao; Hübner, Christoph; Lukacs, Zoltan; Musante, Luciana; Gill, Esther; Wienker, Thomas F; Ropers, Hans-Hilger; Knierim, Ellen; Schuelke, Markus

    2016-01-01

    Klüver–Bucy syndrome (KBS) comprises a set of neurobehavioral symptoms with psychic blindness, hypersexuality, disinhibition, hyperorality, and hypermetamorphosis that were originally observed after bilateral lobectomy in Rhesus monkeys. We investigated two siblings with KBS from a consanguineous family by whole-exome sequencing and autozygosity mapping. We detected a homozygous variant in the heparan-α-glucosaminidase-N-acetyltransferase gene (HGSNAT; c.518G>A, p.(G173D), NCBI ClinVar RCV000...

  10. Podnikatelský plán lyžařské školy na Klínovci

    OpenAIRE

    Ketner, Robert

    2016-01-01

    The goal of the thesis is a business plan that will be used for presentation to shareholders in the company Skiareál Klínovec, s. r. o. and later for communication with the external environment. Content of business plan is marketing, operational and financial plan, personal plan and management organization of the proposed company. Powered by TCPDF (www.tcpdf.org)

  11. Prescreening based on the presence of CT-scan abnormalities and biomarkers (KL-6 and SP-D may reduce severe radiation pneumonitis after stereotactic radiotherapy

    Directory of Open Access Journals (Sweden)

    Wakui Reiko

    2010-05-01

    Full Text Available Abstract Purpose To determine the risk factors of severe radiation pneumonitis (RP after stereotactic body radiation therapy (SBRT for primary or secondary lung tumors. Materials and methods From January 2003 to March 2009, SBRT was performed on 117 patients (32 patients before 2005 and 85 patients after 2006 with lung tumors (primary = 74 patients and metastatic/recurrent = 43 patients in our institution. In the current study, the results on cases with severe RP (grades 4-5 were evaluated. Serum Krebs von den Lungen-6 (KL-6 and serum Surfactant protein-D (SP-D were used to predict the incidence of RP. A shadow of interstitial pneumonitis (IP on the CT image before performing SBRT was also used as an indicator for RP. Since 2006, patients have been prescreened for biological markers (KL-6 & SP-D as well as checking for an IP-shadow in CT. Results Grades 4-5 RP was observed in nine patients (7.7% after SBRT and seven of these cases (6.0% were grade 5 in our institution. A correlation was found between the incidence of RP and higher serum KL-6 & SP-D levels. IP-shadow in patient's CT was also found to correlate well with the severe RP. Severe RP was reduced from 18.8% before 2005 to 3.5% after 2006 (p = 0.042. There was no correlation between the dose volume histogram parameters and these severe RP patients. Conclusion Patients presenting with an IP shadow in the CT and a high value of the serum KL-6 & SP-D before SBRT treatment developed severe radiation pneumonitis at a high rate. The reduction of RP incidence in patients treated after 2006 may have been attributed to prescreening of the patients. Therefore, pre-screening before SBRT for an IP shadow in CT and serum KL-6 & SP-D is recommended in the management and treatment of patients with primary or secondary lung tumors.

  12. Characterization of antimicrobial substance from Lactobacillus salivarius KL-D4 and its application as biopreservative for creamy filling.

    Science.gov (United States)

    Therdtatha, Phatthanaphong; Tandumrongpong, Chanabhorn; Pilasombut, Komkhae; Matsusaki, Hiromi; Keawsompong, Suttipun; Nitisinprasert, Sunee

    2016-01-01

    Lactobacillus salivarius KL-D4 isolated from duck intestine produced bacteriocin which was stable at high temperature and a wide pH range of 3-10. Its cell free supernatant at pH 5.5 exhibited wide inhibitory spectrum against both G+ and G- bacteria. The highest bacteriocin production was obtained in MRS broth supplemented with 0.5 % (w/v) CaCO3 at 6 h by gentle shaking. PCR walking using specific primers at the conserved region of class-II bacteriocin resulted in 4 known genes of kld1, kld2, kld3 and kld4 with 100 % similarity to genes encoding for salivaricin α, β, induction peptide and histidine protein kinase of Lb. salivarius GJ-24 which did not previously report for bacteriocin characterization, while showing 94, 93, 59 and 62 % to other salivaricin gene cluster, respectively. The high activities of 25,600 AU/ml indicated a strong induction peptide expressed by kld3 which has low similarity to previous inducer reported. Based on operon analysis, only kld1, kld3 and kld4 could be expressed and subsequently elucidated that only salivaricin α like bacteriocin was produced and secreted out of the cells. Using protein purification, only a single peptide band obtained showed that this strain produced one bacteriocin which could be salivaricin α namely salivaricin KLD showing about 4.3 kDa on SDS-PAGE. Partial purification by 20 % ammonium sulfate precipitation of the product was tested on the artificial contamination of creamy filling by Bacillus cereus, Enterococcus faecalis, Pseudomonas stutzeri, Staphylococcus sp. and Stenotrophomonas sp. resulting the growth inhibitory efficiency of 4.45-66.9, 11.5-100, 100, 0-28.1 and 5-100 % respectively. Therefore, salivaricin KLD can be a tentative biopreservative for food industry in the future.

  13. KL63 METAR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...

  14. KL38 METAR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...

  15. KOKO KL.xps

    African Journals Online (AJOL)

    HP Pro 2000

    En Côte d'Ivoire, le cacaoyer (Theobroma cacao L.) est traditionnellement cultivé selon un système extensif et itinérant, utilisant du matériel végétal peu performant. Les rendements en cacao sont donc faible (260 à 600 kg·ha-1·an-1). Pour améliorer la productivité des cacaoyères, les chercheurs ivoiriens ont mis au point.

  16. Işıklı Gölü ve Kaynaklarının (Çivril-Denizli Crustacea Faunası.

    Directory of Open Access Journals (Sweden)

    Cem Aygen

    2015-12-01

    Full Text Available Bu çalışmada, Işıklı Gölü Crustacea faunasının taksonomik açıdan incelenmesi hedeflenmiştir. Bu amaçla Şubat 1998-Ocak 1999 ayları arasında, gölde ve göle akan kaynak bölgesinde belirlenen 6 istasyondan aylık periyotlarla biyolojik örnekler ve su örnekleri alınmıştır. Araştırma sonunda Işıklı Gölü ve Kaynağı’nda bulunan Crustacea faunasının başlıca Cladocera (16 tür, Copepoda (12 tür, Ostracoda (1 tür, Amphipoda (2 tür, Isopoda (1 tür, Mysidacea (1 tür ve Decapoda (1 tür gruplarından oluştuğu saptanmıştır. Tespit edilen türlerden Cladocera grubundan Diaphanosoma brachyurum, Diaphanosoma mongolianum, Ceriodaphnia pulchella, Simocephalus vetulus, Macrothrix laticornis, Alona rectangula, Alona guttata, Graptoleberis testudinaria, Leydigia leydigi, Biapertura affinis, Chydorus sphaericus, Pleuroxus aduncus ve Disparalona rostrata; Copepoda grubundan Macrocyclops albidus, Eucyclops serrulatus, Eucyclops speratus, Eucyclops macruroides, Metacyclops gracilis, Mesocyclops leuckarti, Cyclops vicinus, Cyclops abyssorum, Cyclops strenuus, Megacyclops viridis, Acanthocyclops robustus, Canthocamptus staphylinus; Ostracoda grubundan Psychrodromus olivaceus; Amphipoda grubundan Gammarus balcanicus, Gammarus obnixus; Isopoda grubundan Asellus aquaticus türleri Işıklı Gölü’nden ilk kez bildirilmektedir

  17. {sup 13}C-METHYL FORMATE: OBSERVATIONS OF A SAMPLE OF HIGH-MASS STAR-FORMING REGIONS INCLUDING ORION-KL AND SPECTROSCOPIC CHARACTERIZATION

    Energy Technology Data Exchange (ETDEWEB)

    Favre, Cécile; Bergin, Edwin A.; Crockett, Nathan R.; Neill, Justin L. [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48109 (United States); Carvajal, Miguel [Dpto. Física Aplicada, Unidad Asociada CSIC, Facultad de Ciencias Experimentales, Universidad de Huelva, E-21071 Huelva (Spain); Field, David [Department of Physics and Astronomy, University of Aarhus, Ny Munkegade 120, DK-8000 Aarhus C (Denmark); Jørgensen, Jes K.; Bisschop, Suzanne E. [Centre for Star and Planet Formation, Niels Bohr Institute, University of Copenhagen, Juliane Maries Vej 30, DK-2100 Copenhagen Ø (Denmark); Brouillet, Nathalie; Despois, Didier; Baudry, Alain [Univ. Bordeaux, LAB, UMR 5804, F-33270, Floirac (France); Kleiner, Isabelle [Laboratoire Interuniversitaire des Systèmes Atmosphériques (LISA), CNRS, UMR 7583, Université de Paris-Est et Paris Diderot, 61, Av. du Général de Gaulle, F-94010 Créteil Cedex (France); Margulès, Laurent; Huet, Thérèse R.; Demaison, Jean, E-mail: cfavre@umich.edu, E-mail: miguel.carvajal@dfa.uhu.es [Laboratoire de Physique des Lasers, Atomes et Molécules, UMR CNRS 8523, Université Lille I, F-59655 Villeneuve d' Ascq Cedex (France)

    2015-01-01

    We have surveyed a sample of massive star-forming regions located over a range of distances from the Galactic center for methyl formate, HCOOCH{sub 3}, and its isotopologues H{sup 13}COOCH{sub 3} and HCOO{sup 13}CH{sub 3}. The observations were carried out with the APEX telescope in the frequency range 283.4-287.4 GHz. Based on the APEX observations, we report tentative detections of the {sup 13}C-methyl formate isotopologue HCOO{sup 13}CH{sub 3} toward the following four massive star-forming regions: Sgr B2(N-LMH), NGC 6334 IRS 1, W51 e2, and G19.61-0.23. In addition, we have used the 1 mm ALMA science verification observations of Orion-KL and confirm the detection of the {sup 13}C-methyl formate species in Orion-KL and image its spatial distribution. Our analysis shows that the {sup 12}C/{sup 13}C isotope ratio in methyl formate toward the Orion-KL Compact Ridge and Hot Core-SW components (68.4 ± 10.1 and 71.4 ± 7.8, respectively) are, for both the {sup 13}C-methyl formate isotopologues, commensurate with the average {sup 12}C/{sup 13}C ratio of CO derived toward Orion-KL. Likewise, regarding the other sources, our results are consistent with the {sup 12}C/{sup 13}C in CO. We also report the spectroscopic characterization, which includes a complete partition function, of the complex H{sup 13}COOCH{sub 3} and HCOO{sup 13}CH{sub 3} species. New spectroscopic data for both isotopomers H{sup 13}COOCH{sub 3} and HCOO{sup 13}CH{sub 3}, presented in this study, have made it possible to measure this fundamentally important isotope ratio in a large organic molecule for the first time.

  18. Deletion of the Glucose-6-Phosphate Dehydrogenase Gene KlZWF1 Affects both Fermentative and Respiratory Metabolism in Kluyveromyces lactis▿

    Science.gov (United States)

    Saliola, Michele; Scappucci, Gina; De Maria, Ilaria; Lodi, Tiziana; Mancini, Patrizia; Falcone, Claudio

    2007-01-01

    In Kluyveromyces lactis, the pentose phosphate pathway is an alternative route for the dissimilation of glucose. The first enzyme of the pathway is the glucose-6-phosphate dehydrogenase (G6PDH), encoded by KlZWF1. We isolated this gene and examined its role. Like ZWF1 of Saccharomyces cerevisiae, KlZWF1 was constitutively expressed, and its deletion led to increased sensitivity to hydrogen peroxide on glucose, but unlike the case for S. cerevisiae, the Klzwf1Δ strain had a reduced biomass yield on fermentative carbon sources as well as on lactate and glycerol. In addition, the reduced yield on glucose was associated with low ethanol production and decreased oxygen consumption, indicating that this gene is required for both fermentation and respiration. On ethanol, however, the mutant showed an increased biomass yield. Moreover, on this substrate, wild-type cells showed an additional band of activity that might correspond to a dimeric form of G6PDH. The partial dimerization of the G6PDH tetramer on ethanol suggested the production of an NADPH excess that was negative for biomass yield. PMID:17085636

  19. FT-IR spectroscopic and thermodynamic study on the adsorption of carbon dioxide and dinitrogen in the alkaline zeolite K-L

    International Nuclear Information System (INIS)

    Arean, C.O.; Bibiloni, G.F.; Delgado, M.R.

    2012-01-01

    Highlights: ► Variable temperature IR spectroscopy is used to study adsorption of CO 2 and N 2 in the alkaline zeolite K-L. ► By simultaneously recording IR absorbance, temperature and equilibrium pressure, standard adsorption enthalpy and entropy for each gas was determined. ► The results are discussed in the broader context of gas separation using zeolites; focusing on carbon dioxide capture. - Abstract: The thermodynamics of carbon dioxide and dinitrogen adsorption on the zeolite K-L was investigated by means of variable temperature IR spectroscopy, a technique that affords determination of standard adsorption enthalpy (ΔH°) and entropy (ΔS°) from analysis of IR spectra recorded over a temperature range while simultaneously measuring equilibrium pressure inside a closed IR cell. ΔH° resulted to be −42.5 and −20.6 kJ mol −1 for CO 2 and N 2 , respectively. Corresponding values of ΔS° were found to be −182 and −151 J mol −1 K −1 . The obtained adsorption enthalpy values are discussed in the context of carbon dioxide capture and sequestration.

  20. Lactococcus lactis Subsp. Lactis Suşlarında Yüksek Sıklıkta Konjugal Transfer Sistemlerinin Analizi

    Directory of Open Access Journals (Sweden)

    Çağla Tükel

    2015-02-01

    Full Text Available Bu çalışmada L. lactis subsp. lactis suşlarında laktoz fermentasyonu özelliğini kodlayan altı farklı plazmidin yüksek sıklıkta konjugal aktarım yeteneği araştırıldı. Bu plazmidlerin konjugal transfer sıklıkları; iki seks faktörünün interaksiyonuna bağlı olarak (Clu ve Agg, Clu-/Agg-, Agg+ x Clu-/Agg+, Agg- ya da Clu+/Agg- x Clu-/Agg- konjugasyon eşleri için 1.5x10-5–1.0x10-7 ve Clu+/Agg- x Clu-/Agg+ konjugasyon eşleri için 7.1x10-2-2.7x10-3 oranlarında değişim gösterdi. Laktoz plazmidlerinin stabiliteleri ise; doğal suşlarda %82-96, MG1390 alıcı suşu için tanımlanan konjugantlarda %77-98 ve MCL8060 alıcı suşu için tanımlanan konjugantlarda ise %44-67 arasında saptandı.

  1. Vzpomínky prof. Arnošta Klímy na Mezinárodní kongres historiků ve Stockholmu v roce 1960 (Fragment z dosud nepublikovaných vzpomínek historika)

    OpenAIRE

    Myška, Milan

    2013-01-01

    The edition of the fragment of the reminiscences of the Czech economic historian Prof. Arnošt Klíma about the participation of Czech and Slovak historians at the World Economic History Congress in Stockholm in 1960. Within the frame of the so-called great themes, an only major report entrusted to East European historians was presented by Macůrek and Klíma – a report about the transition from feudalism to capitalism. On the eve of the congress was held the first international meeting of econom...

  2. Novel Antimicrobial Peptides EeCentrocins 1, 2 and EeStrongylocin 2 from the Edible Sea Urchin Echinus esculentus Have 6-Br-Trp Post-Translational Modifications.

    Directory of Open Access Journals (Sweden)

    Runar Gjerp Solstad

    Full Text Available The global problem of microbial resistance to antibiotics has resulted in an urgent need to develop new antimicrobial agents. Natural antimicrobial peptides are considered promising candidates for drug development. Echinoderms, which rely on innate immunity factors in the defence against harmful microorganisms, are sources of novel antimicrobial peptides. This study aimed to isolate and characterise antimicrobial peptides from the Edible sea urchin Echinus esculentus. Using bioassay-guided purification and cDNA cloning, three antimicrobial peptides were characterised from the haemocytes of the sea urchin; two heterodimeric peptides and a cysteine-rich peptide. The peptides were named EeCentrocin 1 and 2 and EeStrongylocin 2, respectively, due to their apparent homology to the published centrocins and strongylocins isolated from the green sea urchin Strongylocentrotus droebachiensis. The two centrocin-like peptides EeCentrocin 1 and 2 are intramolecularly connected via a disulphide bond to form a heterodimeric structure, containing a cationic heavy chain of 30 and 32 amino acids and a light chain of 13 amino acids. Additionally, the light chain of EeCentrocin 2 seems to be N-terminally blocked by a pyroglutamic acid residue. The heavy chains of EeCentrocins 1 and 2 were synthesised and shown to be responsible for the antimicrobial activity of the natural peptides. EeStrongylocin 2 contains 6 cysteines engaged in 3 disulphide bonds. A fourth peptide (Ee4635 was also discovered but not fully characterised. Using mass spectrometric and NMR analyses, EeCentrocins 1 and 2, EeStrongylocin 2 and Ee4635 were all shown to contain post-translationally brominated Trp residues in the 6 position of the indole ring.

  3. Klīnisko atradņu salīdzinājums FemtoLASIK un LASIK metodēs

    OpenAIRE

    Bistere, Aivija

    2010-01-01

    Maģistra darbs ir uzrakstīts latviešu valodā uz 60 lpp. Tas satur 36 att., 1 tab., 4 pielikumus. Izmantoti 57 literatūras avoti. Darba mērķis:Novērtēt un salīdzināt klīniskos rezultātus starp metodēm, kur radzenes vāciņš lāzerķirurģijas laikā veidots ar VisuMax femtosekunžu lāzeri(FemtoLASIK metode) un ar mehānisko mikrokeratomu(LASIK metode). Metodika:Pētījumā tika analizēti 84 miopi pacienti(154 acis)-LASIK metodē-59 pacienti,FemtoLASIK-25. Vidējais vecums 29±8 gadi. Pirms operācijas subjek...

  4. A comparative study of track registration response of Makrofol-(KG, KL and N) polycarbonate to sup 4 sup 0 Ar ions

    CERN Document Server

    Kumar, A

    1999-01-01

    In the present work a comparative study of track registration response of sup 4 sup 0 Ar ions in different types of Makrofol polycarbonates viz. Makrofol-KG, KL and N have been done. The etched track parameters viz. bulk etch rate, track etch rate, etch rate ratio, cone angle and etching efficiency were calculated. The variation of etching rates with temperature were found to be exponential and follow the Arrhenius equation. The values of activation energy for bulk and track etching were also calculated. Maximum etchable track length/range were also obtained and compared with the theoretical values obtained from computer program RANGE. From the results it is found that the polycarbonates having same chemical composition manufactured by different chemical processes have slightly different behavior

  5. Kløvergræs på økologiske kvægbrug. OrgGrass 2007-2010

    DEFF Research Database (Denmark)

    Eriksen, Jørgen; Hansen, Lars Monrad; Askegaard, Margrethe

    2009-01-01

    På økologiske brug er kløvergræs essentiel for dyrevelfærd, foderforsyning og opbygning af jordens frugtbarhed. Det er i stigende grad store bedrifter med mange køer, som præger billedet i økologisk mælkeproduktion. Det fører til meget græs i sædskiftet tæt på stalden for at reducere den afstand,...... problemstillinger. I markforsøg undersøges strategier for sammensætning af sædskifter og management i græsmarker. Helt konkret arbejdes der med ind- og udmarkssædskifter. Udgivelsesdato: 2008-10-29...

  6. Herschel Observations of Extraordinary Sources: Analysi sof the HIFI 1.2 THz Wide Spectral Survey toward Orion KL II. Chemical Implications

    Science.gov (United States)

    Crockett, N. R.; Bergin, E. A.; Neill, J. L.; Favre, C.; Blake, G. A.; Herbst, E.; Anderson, D. E.; Hassel, G. E.

    2015-06-01

    We present chemical implications arising from spectral models fit to the Herschel/HIFI spectral survey toward the Orion Kleinmann-Low nebula (Orion KL). We focus our discussion on the eight complex organics detected within the HIFI survey utilizing a novel technique to identify those molecules emitting in the hottest gas. In particular, we find the complex nitrogen bearing species CH3CN, C2H3CN, C2H5CN, and NH2CHO systematically trace hotter gas than the oxygen bearing organics CH3OH, C2H5OH, CH3OCH3, and CH3OCHO, which do not contain nitrogen. If these complex species form predominantly on grain surfaces, this may indicate N-bearing organics are more difficult to remove from grain surfaces than O-bearing species. Another possibility is that hot (Tkin ∼ 300 K) gas phase chemistry naturally produces higher complex cyanide abundances while suppressing the formation of O-bearing complex organics. We compare our derived rotation temperatures and molecular abundances to chemical models, which include gas-phase and grain surface pathways. Abundances for a majority of the detected complex organics can be reproduced over timescales ≳105 years, with several species being underpredicted by less than 3σ. Derived rotation temperatures for most organics, furthermore, agree reasonably well with the predicted temperatures at peak abundance. We also find that sulfur bearing molecules that also contain oxygen (i.e., SO, SO2, and OCS) tend to probe the hottest gas toward Orion KL, indicating the formation pathways for these species are most efficient at high temperatures. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.

  7. Karyotype characteristics and polymorphism peculiarities of Chironomus bernensis Wülker & Klötzli, 1973 (Diptera, Chironomidae) from the Central Caucasus and Ciscaucasia

    Science.gov (United States)

    Karmokov, Mukhamed Kh.; Polukonova, Natalia V.; Sinichkina, Olga V.

    2015-01-01

    Abstract Data about the karyotype characteristics, features of chromosomal polymorphism and larval morphology of populations of Chironomus bernensis Wülker & Klötzli, 1973 (Diptera, Chironomidae) from the Central Caucasus (the northern macroslope) and Ciscaucasia are presented. The characteristics of the pericentromeric regions of the long chromosomes of this species from Caucasian populations were very similar to the ones from some European populations (from Poland and Italy), but differed from Swiss and Siberian populations. In the North Caucasian populations 10 banding sequences were found: two in arms A, C, and E, and one in arms B, D, F, and G. Nine of them were already known for this species, and one, berC2, is described for the first time. Cytogenetic distances between all the studied populations of Chironomus bernensis show that close geographical location of all studied populations from the Central Caucasus and Ciscaucasia is reflected in their similar cytogenetic structure, but on the other hand, that they are more closely related to populations from Europe than to populations from Western Siberia. At the same time, all studied larvae from Caucasian populations have a four-bladed premandible, instead of a two-bladed one, as in the description of Chironomus bernensis from Switzerland (Wülker and Klötzli 1973, Polukonova 2005c). These peculiarities may indicate the relative isolation of the Caucasus from the viewpoint of microevolution. Further research on karyological and morphological characteristics of Chironomus bernensis from geographically distant regions is necessary as there is a possibility that the presently known species is actually polytypic and consists of several sibling species. PMID:26312128

  8. Karyotype characteristics and polymorphism peculiarities of Chironomus bernensis Wülker & Klötzli, 1973 (Diptera, Chironomidae from the Central Caucasus and Ciscaucasia

    Directory of Open Access Journals (Sweden)

    Mukhamed Kh. Karmokov

    2015-06-01

    Full Text Available Data about the karyotype characteristics, features of chromosomal polymorphism and larval morphology of populations of Chironomus bernensis Wülker & Klötzli, 1973 (Diptera, Chironomidae from the Central Caucasus (the northern macroslope and Ciscaucasia are presented. The characteristics of the pericentromeric regions of the long chromosomes of this species from Caucasian populations were very similar to the ones from some European populations (from Poland and Italy, but differed from Swiss and Siberian populations. In the North Caucasian populations 10 banding sequences were found: two in arms A, C, and E, and one in arms B, D, F, and G. Nine of them were already known for this species, and one, berC2, is described for the first time. Cytogenetic distances between all the studied populations of Ch. bernensis show that close geographical location of all studied populations from the Central Caucasus and Ciscaucasia is reflected in their similar cytogenetic structure, but on the other hand, that they are more closely related to populations from Europe than to populations from Western Siberia. At the same time, all studied larvae from Caucasian populations have a four-bladed premandible, instead of a two-bladed one, as in the description of Ch. bernensis from Switzerland (Wülker and Klötzli 1973, Polukonova 2005c. These peculiarities may indicate the relative isolation of the Caucasus from the viewpoint of microevolution. Further research on karyological and morphological characteristics of Chironomus bernensis from geographically distant regions is necessary as there is a possibility that the presently known species is actually polytypic and consists of several sibling species.

  9. The exposure assessment of airborne particulates matter (PM10 and PM2.5) towards building occupants: A case study at KL Sentral, Kuala Lumpur, Malaysia

    International Nuclear Information System (INIS)

    Mohddin, S A; Aminuddin, N M

    2014-01-01

    Airborne particulates have been recognized as a crucial pollutant of indoor air. These pollutants can contribute towards poor indoor air quality (IAQ), which may affect human health in immediate or long term. This study aims to determine the level of IAQ and the effects of particulate towards occupants of office buildings (the office buildings selected for the case study are SSM, KTMB and MRCB at KL Sentral). The objectives of study are (i) to measure the level of airborne particulates that contribute to the IAQ during working hours, (ii) to compare the level of airborne particulates with the existing guidelines and standards of IAQ in Malaysia and other Asian countries and (iii) to assess the symptoms associated with airborne particulates among the building occupants, which were achieved through primary data collection (case study or site survey, structured interview and questionnaire survey) and supported by literature reviews. The results showed that the mass concentration level of airborne particulates within the areas has exceeded the allowable limit of 0.15mg/m 3 by IAQ Code of Practice, 2005 of the Department of Safety and Health (DOSH), Malaysia and 0.05mg/m 3 by the Department of Environmental (DOE) (outdoor) of 8 hours continuous sampling. Based on the findings, the highest mass concentration values measured is 2.581 mg/m 3 at lobby of SSM building which is the highest recorded 17 times higher from the maximum limit recommended by DOSH than the others. This is due to the nearby construction works and the high numbers of particulates are generated from various types of vehicles for transportation surrounding KL Sentral. Therefore, the development of Malaysian Ambient Air Quality Guidelines on PM 2.5 as one of the crucial parameters is highly recommended

  10. The exposure assessment of airborne particulates matter (PM10 & PM2.5) towards building occupants: A case study at KL Sentral, Kuala Lumpur, Malaysia

    Science.gov (United States)

    Mohddin, S. A.; Aminuddin, N. M.

    2014-02-01

    Airborne particulates have been recognized as a crucial pollutant of indoor air. These pollutants can contribute towards poor indoor air quality (IAQ), which may affect human health in immediate or long term. This study aims to determine the level of IAQ and the effects of particulate towards occupants of office buildings (the office buildings selected for the case study are SSM, KTMB and MRCB at KL Sentral). The objectives of study are (i) to measure the level of airborne particulates that contribute to the IAQ during working hours, (ii) to compare the level of airborne particulates with the existing guidelines and standards of IAQ in Malaysia and other Asian countries and (iii) to assess the symptoms associated with airborne particulates among the building occupants, which were achieved through primary data collection (case study or site survey, structured interview and questionnaire survey) and supported by literature reviews. The results showed that the mass concentration level of airborne particulates within the areas has exceeded the allowable limit of 0.15mg/m3 by IAQ Code of Practice, 2005 of the Department of Safety and Health (DOSH), Malaysia and 0.05mg/m3 by the Department of Environmental (DOE) (outdoor) of 8 hours continuous sampling. Based on the findings, the highest mass concentration values measured is 2.581 mg/m3 at lobby of SSM building which is the highest recorded 17 times higher from the maximum limit recommended by DOSH than the others. This is due to the nearby construction works and the high numbers of particulates are generated from various types of vehicles for transportation surrounding KL Sentral. Therefore, the development of Malaysian Ambient Air Quality Guidelines on PM2.5 as one of the crucial parameters is highly recommended.

  11. Toros sedirinde yetiştirme sıklığının fidan morfolojik özellikleri ve beslenme durumuna etkisi

    Directory of Open Access Journals (Sweden)

    Dr. Şükrü Teoman GÜNER

    2018-03-01

    Full Text Available Bu çalışmanın amacı, fidanlık koşullarında yetiştirme sıklığının 2+0 yaşlı Toros sediri (Cedrus libani fidanlarının bazı morfolojik özellikleri ile beslenme durumu üzerine etkisini araştırmaktır. Araştırmada, Isparta-Kapıdağ orijinli tohumlar kullanılmıştır. Eskişehir Orman Fidanlığı’nda 1,2 m genişliğindeki yüksek yastıklara, 15 cm aralıklarla oluşturulan 7 ekim çizgisinde, kontrol ( ̴ 1,5; 2,5; 5,0; 7,5; 10,0 cm mesafe ile yetiştirilen fidanların bazı morfolojik özellikleri ile ibre, gövde ve kök besin elementi içerikleri belirlenmiştir. Denemede rastlantı parselleri deneme deseni kullanılmıştır. Veriler varyans analizi, Duncan testi ve korelasyon analizi ile değerlendirilmiştir. Yetiştirme sıklığı fidan boyu (FB, kök boğazı çapı (KBÇ, FB/KBÇ oranı, sak taze ağırlığı, kök taze ağırlığı, fidan taze ağırlığı, sak kuru ağırlığı (SKA, kök kuru ağırlığı (KKA, fidan kuru ağırlığı (FKA, SKA/KKA oranı ve kök yüzdesini (KKA/FKA oranı önemli derecede etkilemiştir. İncelenen fidan morfolojik özellikleri arasında önemli ilişkiler belirlenmiştir. Fidanların sahip olduğu toplam N, P, K, Ca, Mg, Na, Fe, Zn, Cu ve Mn içeriği bakımından yetiştirme sıklıkları arasındaki farklılıklar önemli (P<0,001 bulunmuştur. Yetiştirme sıklığı azaldıkça fidanların toplam besin elementi içeriği artmıştır. Farklı sıklık derecelerinde yetiştirilen fidanların topraktan kaldırdığı besin stokları arasında anlamlı farklılıklar belirlenmiş, sıklığının azalması ile fidanların birim alandan kaldırdığı besin stokları azalmıştır. Bütün bulgular birlikte değerlendirildiğinde, kurak-yarı kurak alan ağaçlandırmalarında fidanlıkta 2,5 cm mesafeyle (232 fidan/m2; yarı nemli-nemli alan ağaçlandırmalarında ise 7,5 cm mesafeyle (77 fidan/m2 fidan yetiştirmenin uygun olacağı düşünülmektedir.

  12. The KL24 gene cluster and a genomic island encoding a Wzy polymerase contribute genes needed for synthesis of the K24 capsular polysaccharide by the multiply antibiotic resistant Acinetobacter baumannii isolate RCH51.

    Science.gov (United States)

    Kenyon, Johanna J; Kasimova, Anastasiya A; Shneider, Mikhail M; Shashkov, Alexander S; Arbatsky, Nikolay P; Popova, Anastasiya V; Miroshnikov, Konstantin A; Hall, Ruth M; Knirel, Yuriy A

    2017-03-01

    The whole-genome sequence of the multiply antibiotic resistant Acinetobacter baumannii isolate RCH51 belonging to sequence type ST103 (Institut Pasteur scheme) revealed that the set of genes at the capsule locus, KL24, includes four genes predicted to direct the synthesis of 3-acetamido-3,6-dideoxy-d-galactose (d-Fuc3NAc), and this sugar was found in the capsular polysaccharide (CPS). One of these genes, fdtE, encodes a novel bifunctional protein with an N-terminal FdtA 3,4-ketoisomerase domain and a C-terminal acetyltransferase domain. KL24 lacks a gene encoding a Wzy polymerase to link the oligosaccharide K units to form the CPS found associated with isolate RCH51, and a wzy gene was found in a small genomic island (GI) near the cpn60 gene. This GI is in precisely the same location as another GI carrying wzy and atr genes recently found in several A. baumannii isolates, but it does not otherwise resemble it. The CPS isolated from RCH51, studied by sugar analysis and 1D and 2D 1H and 13C NMR spectroscopy, revealed that the K unit has a branched pentasaccharide structure made up of Gal, GalNAc and GlcNAc residues with d-Fuc3NAc as a side branch, and the K units are linked via a β-d-GlcpNAc-(1→3)-β-d-Galp linkage formed by the Wzy encoded by the GI. The functions of the glycosyltransferases encoded by KL24 were assigned to formation of specific bonds. A correspondence between the order of the genes in KL24 and other KL and the order of the linkages they form was noted, and this may be useful in future predictions of glycosyltransferase specificities.

  13. Herschel Observations of EXtra-Ordinary Sources: H2S as a Probe of Dense Gas and Possibly Hidden Luminosity Toward the Orion KL Hot Core

    Science.gov (United States)

    Crockett, N. R.; Bergin, E. A.; Neill, J. L.; Black, J. H.; Blake, G. A.; Kleshcheva, M.

    2014-02-01

    We present Herschel/HIFI observations of the light hydride H2S obtained from the full spectral scan of the Orion Kleinmann-Low nebula (Orion KL) taken as part of the Herschel Observations of EXtra-Ordinary Sources GT (guaranteed time) key program. In total, we observe 52, 24, and 8 unblended or slightly blended features from H2 32S, H2 34S, and H2 33S, respectively. We only analyze emission from the so-called hot core, but emission from the plateau, extended ridge, and/or compact ridge are also detected. Rotation diagrams for ortho and para H2S follow straight lines given the uncertainties and yield T rot = 141 ± 12 K. This indicates H2S is in local thermodynamic equilibrium and is well characterized by a single kinetic temperature or an intense far-IR radiation field is redistributing the population to produce the observed trend. We argue the latter scenario is more probable and find that the most highly excited states (E up >~ 1000 K) are likely populated primarily by radiation pumping. We derive a column density, N tot(H2 32S) = 9.5 ± 1.9 × 1017 cm-2, gas kinetic temperature, T kin = 120+/- ^{13}_{10} K, and constrain the H2 volume density, n_H_2 >~ 9 × 10 7 cm-3, for the H2S emitting gas. These results point to an H2S origin in markedly dense, heavily embedded gas, possibly in close proximity to a hidden self-luminous source (or sources), which are conceivably responsible for Orion KL's high luminosity. We also derive an H2S ortho/para ratio of 1.7 ± 0.8 and set an upper limit for HDS/H2S of <4.9 × 10 -3. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.

  14. Klüver-Bucy syndrome associated with a recessive variant in HGSNAT in two siblings with Mucopolysaccharidosis type IIIC (Sanfilippo C).

    Science.gov (United States)

    Hu, Hao; Hübner, Christoph; Lukacs, Zoltan; Musante, Luciana; Gill, Esther; Wienker, Thomas F; Ropers, Hans-Hilger; Knierim, Ellen; Schuelke, Markus

    2017-02-01

    Klüver-Bucy syndrome (KBS) comprises a set of neurobehavioral symptoms with psychic blindness, hypersexuality, disinhibition, hyperorality, and hypermetamorphosis that were originally observed after bilateral lobectomy in Rhesus monkeys. We investigated two siblings with KBS from a consanguineous family by whole-exome sequencing and autozygosity mapping. We detected a homozygous variant in the heparan-α-glucosaminidase-N-acetyltransferase gene (HGSNAT; c.518G>A, p.(G173D), NCBI ClinVar RCV000239404.1), which segregated with the phenotype. Disease-causing variants in this gene are known to be associated with autosomal recessive Mucopolysaccharidosis type IIIC (MPSIIIC, Sanfilippo C). This lysosomal storage disease is due to deficiency of the acetyl-CoA:α-glucosaminidase-N-acetyltransferase, which was shown to be reduced in patient fibroblasts. Our report extends the phenotype associated with MPSIIIC. Besides MPSIIIA and MPSIIIB, due to variants in SGSH and NAGLU, this is the third subtype of Sanfilippo disease to be associated with KBS. MPSIII should be included in the differential diagnosis of young patients with KBS.

  15. Klüver–Bucy syndrome associated with a recessive variant in HGSNAT in two siblings with Mucopolysaccharidosis type IIIC (Sanfilippo C)

    Science.gov (United States)

    Hu, Hao; Hübner, Christoph; Lukacs, Zoltan; Musante, Luciana; Gill, Esther; Wienker, Thomas F; Ropers, Hans-Hilger; Knierim, Ellen; Schuelke, Markus

    2017-01-01

    Klüver–Bucy syndrome (KBS) comprises a set of neurobehavioral symptoms with psychic blindness, hypersexuality, disinhibition, hyperorality, and hypermetamorphosis that were originally observed after bilateral lobectomy in Rhesus monkeys. We investigated two siblings with KBS from a consanguineous family by whole-exome sequencing and autozygosity mapping. We detected a homozygous variant in the heparan-α-glucosaminidase-N-acetyltransferase gene (HGSNAT; c.518G>A, p.(G173D), NCBI ClinVar RCV000239404.1), which segregated with the phenotype. Disease-causing variants in this gene are known to be associated with autosomal recessive Mucopolysaccharidosis type IIIC (MPSIIIC, Sanfilippo C). This lysosomal storage disease is due to deficiency of the acetyl-CoA:α-glucosaminidase-N-acetyltransferase, which was shown to be reduced in patient fibroblasts. Our report extends the phenotype associated with MPSIIIC. Besides MPSIIIA and MPSIIIB, due to variants in SGSH and NAGLU, this is the third subtype of Sanfilippo disease to be associated with KBS. MPSIII should be included in the differential diagnosis of young patients with KBS. PMID:27827379

  16. "KinLeaves" reklāmas aktivitātes sociālajā tīklā “Facebook” 2016. gadā

    OpenAIRE

    Mandrika, Dana

    2017-01-01

    Bakalaura darba mērķis ir izpētīt, kādas reklāmas aktivitātes uzņēmums ir veicis un noskaidrot, vai sociālajā tīklā “Facebook” ar reklāmas aktivitātēm ir iespējams sasniegt mērķauditoriju. Darbs sastāv no trīs daļām – teorētiskās, metodoloģiskās un empīriskās. Teorētisko daļu veido nodaļas par reklāmu, sociālo tīklu vietnēm, sociālo tīklu „Facebook” un reklāmu sociālo tīklu vietnēs. Metodoloģiskajā daļā apskatītas pētījumā izmantotās metodes - kontentanalīze, intervija, anketēšana. Empīrisk...

  17. Polarized and unpolarized lepton pair forward-backward asymmetries in B → K{sub 0}{sup *}(1430)l{sup +}l{sup -} and B → Kl{sup +}l{sup -} decays in two-Higgs-doublet model

    Energy Technology Data Exchange (ETDEWEB)

    Falahati, F.; Abbasi, H. [Shiraz University, Physics Department and Biruni Observatory, College of Sciences, Shiraz (Iran, Islamic Republic of)

    2016-08-15

    In this paper we shall focus on the effects of concrete models such as the SM and 2HDM of type III on the polarized and unpolarized forward.backward asymmetries of B → K{sub 0}{sup *}(1430)l{sup +}l{sup -} and B → Kl{sup +}l{sup -} decays. The obtained results of these decay modes are compared to each other. Also, we obtain the minimum required number of events for detecting each asymmetry and compare it with the number of produced B anti B pairs at the LHC or supposed to be produced at the Super-LHC. At the end, we conclude that the study of these asymmetries for B → K{sub 0}{sup *}(1430)l{sup +}l{sup -} and B → Kl{sup +}l{sup -} processes are very effective tools for establishing new physics in the future B-physics experiments. (orig.)

  18. Eğirdir orman fidanlığı’nda diken ardıcı (Juniperus oxycedrus fidan yetiştirme sıklığının fidan morfolojisine etkileri

    Directory of Open Access Journals (Sweden)

    Esra ALIM

    2017-07-01

    Full Text Available Bu çalışmada, farklı yetiştirme sıklıklarının diken ardıcı (Juniperus oxycedrus L. subsp. oxycedrus’nın (1+0 çıplak köklü fidanlarının morfolojik özellikleri üzerindeki etkilerini ortaya koymak amaçlanmıştır. Araştırma Eğirdir Orman Fidanlığında kurulan deneme alanlarında yürütülmüştür. Denemede; 1.5 cm, 3 cm, 6 cm ve 9 cm mesafe olacak şekilde kontrol dâhil 5 farklı yetiştirme sıklığı uygulanmıştır. Araştırma sonuçlarına göre diken ardıcı fidanlarının morfolojik özellikleri (kök boğazı çapı, yan kök sayısı, gürbüzlük indisi, kalite indisi, fidan, gövde ve kök taze ağırlıkları ile fidan, gövde ve kök kuru ağırlıkları üzerine yetiştirme sıklığının önemli etkilerinin olduğu belirlenmiştir. Ekim yastıklarında yetiştirme sıklığı azaldıkça daha kalın çaplı, gövde taze ve kuru ağırlığı daha fazla ve daha çok yan kök sayısına sahip olan fidanlar elde edilmiştir. Çalışmada, elde edilen fidanlar arasında en yüksek kök boğazı çapı ve yan kök sayısı kontrol dışındaki ekim sıklıklarından elde edilen fidanlarda olduğu tespit edilmiştir. Fidan ağırlıkları bakımından ise en iyi sonucu 3 cm ekim sıklığı verirken, en düşük sonuç kontrol fidanlarında meydana gelmiştir. Eğirdir Orman Fidanlığı koşullarında 3 cm ekim sıklığının uygulanmasının kaliteli diken ardıcı fidan üretimi için yeterli olacağı düşünülmektedir.

  19. A direct test of time-reversal symmetry in the neutral K meson system with KS → πℓν and KL → 3π0 at KLOE-2

    Directory of Open Access Journals (Sweden)

    Gajos Aleksander

    2014-01-01

    Full Text Available Quantum entanglement of K and B mesons allows for a direct experimental test of time-reversal symmetry independent of CP violation. The T symmetry can be probed by exchange of initial and final states in the reversible transitions between flavor and CP- definite states of the mesons which are only connected by the T conjugation. While such a test was successfully performed by the BaBar experiment with neutral B mesons, the KLOE-2 detector can probe T -violation in the neutral kaons system by investigating the process with KS → π±l∓νl and KL → 3π0 decays. Analysis of the latter is facilitated by a novel reconstruction method for the vertex of KL → 3π0 decay which only involves neutral particles. Details of this new vertex reconstruction technique are presented as well as prospects for conducting the direct T symmetry test at the KLOE-2 experiment.

  20. Ulrike Klöppel: XX0XY ungelöst. Hermaphroditismus, Sex und Gender in der deutschen Medizin. Eine historische Studie zur Intersexualität. Bielefeld: transcript Verlag 2010.

    OpenAIRE

    Sarah Radtke

    2010-01-01

    Ulrike Klöppel führt in ihrer materialreichen Studie vor, dass Hermaphroditismus für die Medizin immer wieder Anlass war, sich mit der Vielfalt der das Geschlecht bestimmenden Faktoren – Gestalt und Form der Genitalien, Chromosomengeschlecht, Keimdrüsengeschlecht (Hoden vs. Eierstöcke), Hormonhaushalt, Geschlechtsrolle und Geschlechtsidentität – zu befassen und zu versuchen, Geschlechtszugehörigkeiten verbindlich festzulegen. Neben einem historis...

  1. Use of the KlADH3 promoter for the quantitative production of the murine PDE5A isoforms in the yeast Kluyveromyces lactis.

    Science.gov (United States)

    Cardarelli, Silvia; Giorgi, Mauro; Naro, Fabio; Malatesta, Francesco; Biagioni, Stefano; Saliola, Michele

    2017-09-22

    Phosphodiesterases (PDE) are a superfamily of enzymes that hydrolyse cyclic nucleotides (cAMP/cGMP), signal molecules in transduction pathways regulating crucial aspects of cell life. PDEs regulate the intensity and duration of the cyclic nucleotides signal modulating the downstream biological effect. Due to this critical role associated with the extensive distribution and multiplicity of isozymes, the 11 mammalian families (PDE1 to PDE11) constitute key therapeutic targets. PDE5, one of these cGMP-specific hydrolysing families, is the molecular target of several well known drugs used to treat erectile dysfunction and pulmonary hypertension. Kluyveromyces lactis, one of the few yeasts capable of utilizing lactose, is an attractive host alternative to Saccharomyces cerevisiae for heterologous protein production. Here we established K. lactis as a powerful host for the quantitative production of the murine PDE5 isoforms. Using the promoter of the highly expressed KlADH3 gene, multicopy plasmids were engineered to produce the native and recombinant Mus musculus PDE5 in K. lactis. Yeast cells produced large amounts of the purified A1, A2 and A3 isoforms displaying K m , V max and Sildenafil inhibition values similar to those of the native murine enzymes. PDE5 whose yield was nearly 1 mg/g wet weight biomass for all three isozymes (30 mg/L culture), is well tolerated by K. lactis cells without major growth deficiencies and interferences with the endogenous cAMP/cGMP signal transduction pathways. To our knowledge, this is the first time that the entire PDE5 isozymes family containing both regulatory and catalytic domains has been produced at high levels in a heterologous eukaryotic organism. K. lactis has been shown to be a very promising host platform for large scale production of mammalian PDEs for biochemical and structural studies and for the development of new specific PDE inhibitors for therapeutic applications in many pathologies.

  2. Herschel observations of extraordinary sources: Analysis of the HIFI 1.2 THz wide spectral survey toward orion KL. I. method

    Energy Technology Data Exchange (ETDEWEB)

    Crockett, Nathan R.; Bergin, Edwin A.; Neill, Justin L.; Favre, Cécile [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48109 (United States); Schilke, Peter [Physikalisches Institut, Universität zu Köln, Zülpicher Str. 77, D-50937 Köln (Germany); Lis, Dariusz C.; Emprechtinger, Martin; Phillips, Thomas G. [Cahill Center for Astronomy and Astrophysics 301-17, California Institute of Technology, Pasadena, CA 91125 (United States); Bell, Tom A.; Cernicharo, José; Esplugues, Gisela B. [Centro de Astrobiología (CSIC/INTA), Laboratiorio de Astrofísica Molecular, Ctra. de Torrejón a Ajalvir, km 4, E-28850 Torrejón de Ardoz, Madrid (Spain); Blake, Geoffrey; Kleshcheva, Maria [Division of Geological and Planetary Sciences, California Institute of Technology, MS 150-21, Pasadena, CA 91125 (United States); Gupta, Harshal; Pearson, John [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States); Lord, Steven [Infrared Processing and Analysis Center, California Institute of Technology, MS 100-22, Pasadena, CA 91125 (United States); Marcelino, Nuria [National Radio Astronomy Observatory, 520 Edgemont Road, Charlottesville, VA 22903 (United States); McGuire, Brett A. [Division of Chemistry and Chemical Engineering, California Institute of Technology Pasadena, CA 91125 (United States); Plume, Rene [Department of Physics and Astronomy, University of Calgary, 2500 University Drive NW, Calgary, AB T2N 1N4 (Canada); Van der Tak, Floris [SRON Netherlands Institute for Space Research, P.O. Box 800, 9700 AV Groningen (Netherlands); and others

    2014-06-01

    We present a comprehensive analysis of a broadband spectral line survey of the Orion Kleinmann-Low nebula (Orion KL), one of the most chemically rich regions in the Galaxy, using the HIFI instrument on board the Herschel Space Observatory. This survey spans a frequency range from 480 to 1907 GHz at a resolution of 1.1 MHz. These observations thus encompass the largest spectral coverage ever obtained toward this high-mass star-forming region in the submillimeter with high spectral resolution and include frequencies >1 THz, where the Earth's atmosphere prevents observations from the ground. In all, we detect emission from 39 molecules (79 isotopologues). Combining this data set with ground-based millimeter spectroscopy obtained with the IRAM 30 m telescope, we model the molecular emission from the millimeter to the far-IR using the XCLASS program, which assumes local thermodynamic equilibrium (LTE). Several molecules are also modeled with the MADEX non-LTE code. Because of the wide frequency coverage, our models are constrained by transitions over an unprecedented range in excitation energy. A reduced χ{sup 2} analysis indicates that models for most species reproduce the observed emission well. In particular, most complex organics are well fit by LTE implying gas densities are high (>10{sup 6} cm{sup –3}) and excitation temperatures and column densities are well constrained. Molecular abundances are computed using H{sub 2} column densities also derived from the HIFI survey. The distribution of rotation temperatures, T {sub rot}, for molecules detected toward the hot core is significantly wider than the compact ridge, plateau, and extended ridge T {sub rot} distributions, indicating the hot core has the most complex thermal structure.

  3. Distúrbios neuropsiquiátricos por lesões bilaterais do lobo temporal: síndrome de Klüver e Bucy

    Directory of Open Access Journals (Sweden)

    José Longman

    1957-03-01

    Full Text Available Estudo clínico e paraclíníco de uma criança do sexo feminino, de quatro anos de idade, que, após um processo encefalopático agudo, de etiologia não esclarecida, apresentou um quadro neuropsiquiátrico comparável ao descrito por Klüver e Bucy em primatas sub-humanos, após lobectomia temporal bilateral. O quadro clínico caracterizou-se por: hipermetamorfose, tendência oral, cegueira psíquica com conservação da acuidade visual e, aparentemente, dos campos visuais, afasia global, ausência de reação os estímulos auditivos e olfativos, não participação táctil no reconhecimento dos objetos e alterações afetivas (ausência das reações de medo e raiva, assim como do riso. A paciente foi observada no período de 7 meses, tendo apresentado somente modificações moderadas, no sentido de atenuação das manifestações. A pneumoventriculografia, a pneumocisternografia e a isotopoencefalometria objetivaram um comprometimento bilateral da região fronto-temporal. Entretanto, êstes exames não esclareceram a natureza das lesões, nem mesmo se os distúrbios decorriam apenas do processo relacionado com a moléstia atual ou se - visto tratar-se de paciente que desde os dois anos de idade vinha apresentando crises convulsivas - se correspondiam a uma disgenesia cerebral. Dada a importância de que se reveste a observação dêste caso, foram comentadas, em relação à fisiopatologia cerebral, algumas das principais manifestações psicopatológicas.

  4. Okra (Abelmoschus esculentus Linn) inhibits lipopolysaccharide ...

    African Journals Online (AJOL)

    Tropical Journal of Pharmaceutical Research June 2017; 16 (6): 1285-1292 ... lipopolysaccharide-induced inflammatory mediators in .... Multiple comparison of data was carried out by one-way. ANOVA followed by Bonferroni post-tests. P <.

  5. Development of Abelmoschus esculentus (Okra)-Based ...

    African Journals Online (AJOL)

    Results: Okra gel formulation showed good properties in terms of pH, viscosity and mucoadhesion. ... filter and precipitated with three times the volume ... 2 days in hot air oven (NAAY-M40, Naugra, .... biodegradable nature as well as likely low.

  6. Rare KL decays at Fermilab

    International Nuclear Information System (INIS)

    Schnetzer, St.

    1997-01-01

    Recent results and the future prospects for rare K L decay at Fermilab are described. A summary of all rare decay results from E799 Phase I (the 1991 run) are presented. Three new results: K L → e + e - μ + μ - , K L → π 0 μe, and π 0 → e + e - e + e - are discussed in detail. Improvements for KTeV (the 1996-1997 run) are discussed and the expected sensitivities listed. Finally, the KAMI program for rare decays with the Main Injector (2000 and beyond) is presented with emphasis on a search for the decay K L → π 0 νν-bar at O(10 -12 ) single-event-sensitivity. (author)

  7. Bitki Sıklığının İki Farklı Kişniş (Coriandrum sativum L. Çeşidinde Verim ve Verim Unsurları Üzerine Etkisinin Belirlenmesi

    Directory of Open Access Journals (Sweden)

    Duran Katar

    2016-05-01

    Full Text Available Çalışma; çeşitlerin ve bitki sıklığının kişniş (Coriandrum sativum L. bitkisinin verim, verim unsurları ve uçucu yağ verimi üzerine etkisini belirlemek amacıyla; 2012 ve 2013 yıllarında Eskişehir Osmangazi Üniversitesi Ziraat Fakültesi Tarla Bitkileri Bölümü deneme tarlasında, Tesadüf Bloklarında Faktöriyel Deneme Desenine göre 8 uygulama ve 3 tekerrürlü olarak yürütülmüştür. Faktörler; çeşitler (Arslan ve Gürbüz ve 4 farklı bitki sıklığı (20, 30, 40 ve 50 bitki m-2’dır. Çalışma sonuçları; Arslan çeşidine kıyasla Gürbüz çeşidinden daha yüksek bitki boyu, uçucu yağ oranı ve uçucu yağ verimi elde edildiğini göstermiştir. Ayrıca bitki sıklığı değerlendirmeye alınan özelliklerin tümü üzerinde önemli etkiler göstermiştir. Maksimum bitki boyu, uçucu yağ oranı ve uçucu yağ verimi 50 bitki m-2; en yüksek bitki başına şemsiye sayısı, 1000 tohum ağırlığı ve tohum verimi sırasıyla 20, 30 ve 40 bitki m-2 bitki sıklıklarından elde edilmiştir.

  8. Radiation preservation of tiger nut (Cyperus esculentus L.) with special reference to fungi and the effect of the physico-chemical properties of the nuts before and after irradiation

    International Nuclear Information System (INIS)

    Agyeman, A.A.

    2011-01-01

    Tiger nut (Cyperus Esculentus L.) is an important minor crop in Ghana and is cultivated in at least four major Regions of Ghana (Central, Eastern, Brong Ahafo and Northern). A structured rapid appraisal questionnaire was designed to provide information on the sex distribution, age structure, educational level of respondents, knowledge of local names, types of cultivars or varieties, packaging and storage material, post-harvest losses, local utilisation and knowledge of its nutritional value. The sources of tiger nuts on the local market were also ascertained. To provide further information on its keeping quality in prolonged storage, moisture sorption isotherms of the nuts (using Glycerol: water mixture to simulate Equilibrium Relative Humidities ERH's of 20, 55, 65, 75, 85, 95%) was studied at 28 degrees Celsius to 30 degrees Celsius for 30 days. Some physical (length, width, water absorption capacity; moisture loss under ambient conditions) characteristics were investigated using conventional methods. These were supplemented with anatomical studies of the transverse section of the nuts to provide knowledge on the anatomical barrier characteristics of the cultivars from the various Regions. Resident mycoflora in the tiger nuts from Asebu Ekroful (Central Region), Bawjiase (Central Region), Kwahu Aduamoa (Eastern Region), Techiman (Brong Ahafo Region) and Bole (Northern Region) was ascertained by the decimal serial dilution technique up to 1:10 4 dilutions. The samples from Asebu Ekroful, Bawjiase and Kwahu Aduamoa were treated with gamma irradiation doses of 0.0, 2.5, 5.0 and 10.00 kGy in different packaging material (polyethylene terephthalate bottle, perforated and non-perforated polythene bags for 3 months. Moisture content (%), ash content (%), oil content (%) and total carbohydrate content of the samples were determined before and after irradiation using conventional methods. Elemental composition of tiger nuts were also determined using X-Ray Fluorescence

  9. Molecular genetic tests for JAK2V617F, Exon12_JAK2 and MPLW515K/L are highly informative in the evaluation of patients suspected to have BCR-ABL1-negative myeloproliferative neoplasms.

    Science.gov (United States)

    dos Santos, Marcos Tadeu; Mitne-Neto, Miguel; Miyashiro, Kozue; Chauffaille, Maria de Lourdes L Ferrari; Rizzatti, Edgar Gil

    2014-02-01

    Polycythaemia vera (PV), essential thrombocythemia (ET) and idiopathic myelofibrosis (MF), are the most common myeloproliferative neoplasms (MPN) in patients without the BCR-ABL1 gene rearrangement. They are caused by clonal expansion of haematopoietic stem cells and share, as a diagnostic criterion, the identification of JAK2V617F mutation. Classically, when other clinical criteria are present, a JAK2V617F negative case requires the analysis of Exon12_JAK2 for the diagnosis of PV, and of MPL515K/L mutations for the diagnosis of ET and MF. Here, we evaluated 78 samples from Brazilian patients suspected to have MPN, without stratification for PV, ET or MF. We found that 28 (35.9%) are JAK2V617F carriers; from the 50 remaining samples, one (2%) showed an Exon12_JAK2 mutation, and another (2%) was positive for MPLW515L mutation. In summary, the investigation of JAK2V617F, Exon12_JAK2 and MPLW515K/L was relevant for the diagnosis of 38.4% of patients suspected to have BCR-ABL1-negative MPN, suggesting that molecular genetic tests are useful for a quick and unequivocal diagnosis of MPN.

  10. 20-25 Yaş Arası Sağlıklı Gençlerde Gri ve Beyaz Cevher Hacimlerinin İncelenmesi: Planimetrik Çalışma

    OpenAIRE

    ÇAMURDANOĞLU, Niyazi ACER - Tolga ERTEKİN - Ayşegül KÜ; ACER, Niyazi; ERTEKİN, Tolga; KÜÇÜK, Ayşegül; BABAOĞLU, Cumhur; ÇANKAYA, M. Niyazi; ÇAMURDANOĞLU, Mehmet

    2015-01-01

    Amaç: İnsan beyninde cinsiyete ilişkin varyasyonlar birçok araştırıcı tarafından incelenmiştir. Bu çalışmaların çoğunda erkek beyin hacminin bayanlardan daha büyük olduğu bildirilmektedir. Bu çalışmanın amacı MR görüntüleri üzerinde beyaz ve gri cevher ölçümleri planimterik yöntem ile değerlendirmektir. Gereç ve Yöntemler: Bu çalışmada beyaz ve gri cevher hacimleri 20-25 yaş arası sağlıklı gençlerde incelenmiştir. T2 ağırlıklı MR görüntüleri 12 kişi üzerinde elde edilmiş, kadın ve erkeklerde ...

  11. Osmanlı Dönemi Başlıklı Ortakent Mezar Taşları Ottoman Period Headed Gravestones of Ortakent

    Directory of Open Access Journals (Sweden)

    H.Kamil BİÇİCİ

    2012-12-01

    Full Text Available This concerns, “Ortakent Gravestones.”. Among the cemetery of Ortakent, The dates of the gravestones are between 18.th-20.th centuries and 20 samples of 30 are from 18.th. century, 9 are from 19.th., 1 is from 20.th. century. Gravestones were of marble. The lenghts of the stones are between 140 cm.-45 cm., their widths are between 36 cm.-14 cm., their thicknesses are between 14 cm.-3.5 cm. Most of the samples are in rectangular and shapes and some are rectangular-prizmal. 3 of them have Foot gravestones. 30 head gravestones have large wadded turban (kavuk, turban (sarık, fez (fes and kerchief. All of the gravestones have inscriptions. 5 of them are without inscriptions. Inscriptions on 3 samples were laid diagonal, and 27 of them were laid in a linear system, 30 of head ve foot gravesones are in good condition. 3 samples are broken. 19 of 30 gravestones are men’s and 11 are of women’s. While scarping was used for making gravestones are scarping, and painting were used as the maindecoration tecnique is seen on foot stone with the painting technique,inscriptions of stones were coloured. Most of the inscriptions anddecorations are relieved. Decoration subjects seen on gravestones arephytomorphic, geometric, objective and calligraphic. “Osmanlı Dönemi Başlıklı Ortakent Mezar Taşları” konulu bu incelemede Ortakent Mezarlığında bulunan 30 mezar taşı araştırılarak, çalışmamızda yer almıştır. Mezar taşlarında tarihi bilinen bütün örnekler XVII. yy. ikinci çeyreği ile XX. yy. ilk çeyreği arasındadır. 30 örnekten 20 tanesi XVIII. yy., 9 tanesi XIX. yy., 1 tanesi XX. yy.dır. Mezar taşlarının hepsi mermer malzemeden yapılmıştır. Mezar taşlarının büyükten küçüğe doğru boyları 140 cm. ile 45 cm., genişlikleri 36 cm. ile 14 cm., kalınlıkları ise 14 ile 3.5 cm. arasında değişmektedir. Ortakent’te bulunan mezar taşları şahideli tiptedir. Örneklerin çoğu dikdörtgen gövdelidir. 3

  12. Rezension von: Ulrike Klöppel: XX0XY ungelöst. Hermaphroditismus, Sex und Gender in der deutschen Medizin. Eine historische Studie zur Intersexualität. Bielefeld: transcript Verlag 2010.

    Directory of Open Access Journals (Sweden)

    Sarah Radtke

    2010-10-01

    Full Text Available Ulrike Klöppel führt in ihrer materialreichen Studie vor, dass Hermaphroditismus für die Medizin immer wieder Anlass war, sich mit der Vielfalt der das Geschlecht bestimmenden Faktoren – Gestalt und Form der Genitalien, Chromosomengeschlecht, Keimdrüsengeschlecht (Hoden vs. Eierstöcke, Hormonhaushalt, Geschlechtsrolle und Geschlechtsidentität – zu befassen und zu versuchen, Geschlechtszugehörigkeiten verbindlich festzulegen. Neben einem historischen Teil, der vor allem die Medizingeschichte der Frühen Neuzeit, der Aufklärungszeit und des 19. Jahrhunderts in den Blick nimmt, wird im zweiten Teil der Arbeit der Zusammenhang zwischen der Formierung des gender-Konzepts und dem damit verbundenen Paradigmenwechsel in der Behandlung von Intersexualität dargestellt.

  13. HERSCHEL FAR-INFRARED SPECTRAL-MAPPING OF ORION BN/KL OUTFLOWS: SPATIAL DISTRIBUTION OF EXCITED CO, H{sub 2}O, OH, O, AND C{sup +} IN SHOCKED GAS

    Energy Technology Data Exchange (ETDEWEB)

    Goicoechea, Javier R.; Cernicharo, José; Cuadrado, Sara; Etxaluze, Mireya [Instituto de Ciencia de Materiales de Madrid (ICMM-CSIC). Sor Juana Ines de la Cruz 3, E-28049 Cantoblanco, Madrid (Spain); Chavarría, Luis [Centro de Astrobiología, CSIC-INTA, Ctra. de Torrejón a Ajalvir km 4, E-28850 Madrid (Spain); Neufeld, David A. [Department of Physics and Astronomy, Johns Hopkins University, 3400 North Charles Street, Baltimore, MD 21218 (United States); Vavrek, Roland [Herschel Science Center, ESA/ESAC, P.O. Box 78, Villanueva de la Cañada, E-28691 Madrid (Spain); Bergin, Edwin A. [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48109 (United States); Encrenaz, Pierre [LERMA, UMR 8112 du CNRS, Observatoire de Paris, École Normale Supérieure, F-75014 Paris (France); Melnick, Gary J. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, MS 66, Cambridge, MA 02138 (United States); Polehampton, Edward, E-mail: jr.goicoechea@icmm.csic.es [RAL Space, Rutherford Appleton Laboratory, Chilton, Didcot, Oxfordshire OX11 0QX (United Kingdom)

    2015-01-20

    We present ∼2' × 2' spectral-maps of Orion Becklin-Neugebauer/Kleinmann-Low (BN/KL) outflows taken with Herschel at ∼12'' resolution. For the first time in the far-IR domain, we spatially resolve the emission associated with the bright H{sub 2} shocked regions ''Peak 1'' and ''Peak 2'' from that of the hot core and ambient cloud. We analyze the ∼54-310 μm spectra taken with the PACS and SPIRE spectrometers. More than 100 lines are detected, most of them rotationally excited lines of {sup 12}CO (up to J = 48-47), H{sub 2}O, OH, {sup 13}CO, and HCN. Peaks 1/2 are characterized by a very high L(CO)/L {sub FIR} ≈ 5 × 10{sup –3} ratio and a plethora of far-IR H{sub 2}O emission lines. The high-J CO and OH lines are a factor of ≈2 brighter toward Peak 1 whereas several excited H{sub 2}O lines are ≲50% brighter toward Peak 2. Most of the CO column density arises from T {sub k} ∼ 200-500 K gas that we associate with low-velocity shocks that fail to sputter grain ice mantles and show a maximum gas-phase H{sub 2}O/CO ≲ 10{sup –2} abundance ratio. In addition, the very excited CO (J > 35) and H{sub 2}O lines reveal a hotter gas component (T {sub k} ∼ 2500 K) from faster (v {sub S} > 25 km s{sup –1}) shocks that are able to sputter the frozen-out H{sub 2}O and lead to high H{sub 2}O/CO ≳ 1 abundance ratios. The H{sub 2}O and OH luminosities cannot be reproduced by shock models that assume high (undepleted) abundances of atomic oxygen in the preshock gas and/or neglect the presence of UV radiation in the postshock gas. Although massive outflows are a common feature in other massive star-forming cores, Orion BN/KL seems more peculiar because of its higher molecular luminosities and strong outflows caused by a recent explosive event.

  14. Az ipar 4.0 fogalma, összetevői és hatása az értékláncra ----- Industry 4.0: definition, elements and effect on corporate value chain

    OpenAIRE

    Nagy, Judit

    2017-01-01

    Absztrakt: A tanulmány célja, hogy meghatározza az Ipar 4.0 fogalmát és mögé tekintsen, azaz magyarázatot találjon kialakulására, mozgatórugóira és legfőképpen, jelentőségére a vállalati értéklánc szempontjából. A dolgozat során rövid kitekintés erejéig foglalkozom makro, vagy gazdaságpolitikai kérdésekkel, de legfőképpen a vállalati szint vizsgálatára fókuszálok. A tanulmány megírása során azt tapasztaltam, hogy a szakirodalom is még ismerkedik a fogalommal, annak gazdasági hatásaival...

  15. 14-18 yaş arası ergenlerin benlik saygısı ve psikolojik dayanıklılık düzeyleri arasındaki ilişki

    OpenAIRE

    Sarıkaya, Açelya

    2015-01-01

    Bu araştırmanın amacı lise çağındaki ergenlerin benlik saygıları ile psikolojik dayanıklılıkları arasındaki ilişkinin incelenmesidir. Bunun yanı sıra teorik anlamda benlik saygısıyla ilişkili olduğu düşünülen; cinsiyet, yaş, doğum sırası, ebeveynlerin eğitim durumu, ebeveynlerin birliktelik durumu, algılanan sosyoekonomik düzey gibi demografik özelliklerin de bu değişkenle ilişkileri araştırılmıştır. Araştırmada ilişkisel tarama modeli kullanılmıştır ve araştırmanın evrenini Yalova ...

  16. 20. Yüzyıl Âşıklık Geleneğinde Gezginci Bir Âşık: Âşık Talibî Coşkun

    OpenAIRE

    CERRAHOĞLU, Münir

    2013-01-01

    Âşık Talibî Coşkun, yaşadığı dönemde unutulmaya yüz tutan âşıklık geleneğine hizmetleri olmuş 20. yüzyılın önemli âşıklarından biridir. Sanatıyla ve eserleriyle edebiyatımıza önemli katkıları olmuş hacimli destanlarıyla adından “destan şairi” olarak söz ettirmiştir. Çok yer gezmesi onu bir “gezgin” ve aynı zamanda bir “gezginci âşık” olmasını sağlamış; bu nedenle kendisi “İkinci Evliya Çelebi, 20. Yüzyılın Evliya Çelebisi, Turizm Halk Şairi” gibi sıfatlarla anılmıştır. Eserlerinde halkın zevk...

  17. Alteration geochemistry of the volcanic-hosted Dedeninyurdu, Yergen and Fındıklıyar Fe-Cu mineralization at Gökçedoǧan, Çorum-Kargi region, Turkey

    Science.gov (United States)

    Gumus, Lokman; Öztürk, Sercan; Yalçın, Cihan; Abdelnasser, Amr; Hanilçi, Nurullah; Kumral, Mustafa

    2016-04-01

    This study is to determine the mass/volume gain and loss of the major and trace elements during the alteration processes on Dedeninyurdu, Yergen and Fındıklıyar Fe-Cu mineralizations of the area. Fe-Cu mineralization occurred in the spilitic volcanic a rock of Saraycık Formation is associated with the different types of alteration zones which are pyritization, silicification and sericitization. The study area comprises Bekirli Formation, Saraycık Formation, Beşpınar Formation, and Ilgaz Formation. Saraycık formation consists of spilitic volcanic rocks with pelagic limestone, siltstone and chert. The ore mineralogical data show that the pyrite, chalcopyrite, covellite, hematite, malachite and goethite formed during three phases of mineralization. As well as the geologic and petrographic studies reveal three alteration zones with definite mineral assemblages; phyllic alteration (quartz + sericite + pyrite) that represents the main alteration and mineralized zone; propylitic alteration; and carbonatized sericitic alteration zone. The boundaries between these zones are gradual. Mass balance calculations suggested that the phyllic alteration zone represented by gain in Si, Fe, K, S, and LOI and loss in Mg, Ca, and Na refers to silicification, sericitization and pyritization as well as replacement of Fe-Mg silicate and plagioclase. While, in the propylitic alteration zone, enrichment of Si, Fe, Mg, LOI and S occurred with depletions of Ca, Na, and K reflecting chloritization alteration type. On the other hand, carbonatized sericitic alteration zone shows local gain in Si, CaO and K reflects the occurrence of calc-silicate alteration. All alteration zones contain a large proportion of sulfide minerals (gain in S) with increase in loss on ignition (LOI). Keywords: Alteration geochemistry; Mass balance calculation, Fe-Cu mineralization; phyllic alteration, propylitic alteration.

  18. IS Л Kl JW'Mí i

    African Journals Online (AJOL)

    The preferred method for diagnosis of endometriosis is surgical visual inspection ... cause the varied appearance of the disease allows less-obvious lesions to be overlooked. Empiric use of .... Musculoskeletal causes (e.g., pelvic. Male factor ...

  19. Klüver-Bucy Syndrome

    Science.gov (United States)

    ... inappropriate sexual behavior. Other symptoms may include visual agnosia (inability to visually recognize objects), loss of normal ... inappropriate sexual behavior. Other symptoms may include visual agnosia (inability to visually recognize objects), loss of normal ...

  20. Feminist i nye klæder

    DEFF Research Database (Denmark)

    Simonsen, Dorthe Gert

    1997-01-01

    Historie, Kønskonstruktioner, hverdags-misogyni og feminisme i akademia. Når man taler om feminisme, eller som feminist, taler man ind i et rum, der allerede er fyldt. Den kollektive viden om feminisme er fordomsfuld, og feminster har forsømt at forhandle med eller at forholde sig til de negative...

  1. Folikül Büyüklüğü ve Folikül Uyarıcı Hormon Konsantrasyonunun Sığır Oositlerinin İn Vitro Nükleer Olgunlaşması Üzerine Etkisi

    Directory of Open Access Journals (Sweden)

    Uğur Şen

    2015-05-01

    Full Text Available Bu çalışma folikül büyüklüğü ve folikül uyarıcı hormon (FSH konsantrasyonunun sığır oositlerinin in vitro nükleer olgunlaşması üzerine etkisini araştırmak amacıyla yapılmıştır. Sığır ovaryumundaki (87 adet foliküller küçük (

  2. Evaluation of Hibiscus esculentus Linn. on the Mechanical and ...

    African Journals Online (AJOL)

    Nx 6110

    of lamination and capping are of particular concern. REFERENCES. [1]. J.N. BeMiller, R.L. Whistler, D.G.. Barkalow and C.C. Chen in R. L.. Whistler and J. N. BeMiller (eds.). Industrial Gums, 3rd Edition, Academic. Press, New York. 1993, p 227-256. [2]. R.C. Woolfall, Soap Perfume Cosmet. 37 (1964) 965-970. [3]. O.A. Itiola ...

  3. Evaluation of Hibiscus esculentus Linn. on the Mechanical and ...

    African Journals Online (AJOL)

    Malvaceae) on the mechanical and disintegration properties of paracetamol tablets were investigated against gum acacia as a standard binding agent. The effects of the nature and concentration of the mucilage binder and the relative density ...

  4. Response of Okra (Abelmoschus esculentus) varieties to NPK ...

    African Journals Online (AJOL)

    Pot and field experiments were conducted to determine the response of three okra varieties to four NPK fertilizers. The okra varieties; V35 (in the pot experiment and Clemson spineless in the field trial), Jokoso, and Sologo formed the main plot treatments and four NPK fertilizer rates: no fertilizer (control), 30 +15 +15, 60 +30 ...

  5. Tiger Nut ( Cyperus Esculentus ): Composition, Products, Uses and ...

    African Journals Online (AJOL)

    ... flour and be used for different purposes such as bread and substitute in animal feed manufacture. Oil can also be obtained from tigernut, which is highly unsaturated and good for the health of humans. Tigernut can be used to produce drink/milk, which can serve as substitute of traditional cow milk, different types of tigernut ...

  6. Response of okra [ Abelmoschus esculentus (L.) Moench] to water ...

    African Journals Online (AJOL)

    Parameters such as relative water content, membrane permeability, chlorophyll content and yield of capsules varieties were evaluated. Our results show that water deficiency reduces relative water content of okra leaves. This reduction is more pronounced when water lack occurs at flowering stage of plants and, leakage of ...

  7. Devlet ve Vakıf Üniversiteleri Eğitim Fakültesi Öğrencilerinin Cep Telefonu Kullanım Sıklıklarının ve Marka Tercihlerinin Karşılaştırılması

    OpenAIRE

    TUTGUN ÜNAL, Aylin; ARSLAN, Ahmet

    2013-01-01

    Bu araştırmada, devlet ve vakıf üniversiteleri eğitim fakültesi öğrencilerinin cep telefonu kullanım sıklıkları ve marka tercihleri incelenmiştir. Araştırma, İstanbul’da yer alan Marmara Üniversitesi Atatürk Eğitim Fakültesi ve Maltepe Üniversitesi Eğitim Fakültesi’ne devam eden 985 öğrenci ile yürütülmüştür. Verilerin toplanmasında araştırmacılar tarafından geliştirilen “Cep Telefonu Kullanımı Sıklığı ve Marka Tercihi Belirleme Formu” kullanılmıştır. Araştırmada, eğitim fakültesi öğrencileri...

  8. klık Bakımının Doğal Sarıçam (Pinus sylvestris L. Meşcerelerinde Çap ve Göğüs Yüzeyi Üzerine Etkisi

    Directory of Open Access Journals (Sweden)

    Ömer ÖNCÜL

    2016-07-01

    Full Text Available Bu çalışmada, idare süresi sonunda işletme amacına uygun nitelikte ve ekonomik getirisi yüksek meşcereler oluşturabilmek için, sıklık çağındaki doğal sarıçam meşcerelerinde bakım tedbirleri sonucu, hektarda olması gereken göğüs yüzeyi miktarını ve birey sayısını belirlemek amaçlanmıştır. Bu amaçla Sarıkamış ve Ardahan’da belirlenen iki deneme alanında (18-20 yaş aralığında dört işlem (kontrol, zayıf, orta ve kuvvetli müdahale işlemi ve üç tekerrürden oluşan her biri 500 m²’lik toplam 24 parsel oluşturulmuştur. Zayıf müdahale parselinde alandaki toplam göğüs yüzeyinin %10-15’i, orta müdahale parselinde %20-25’i ve kuvvetli müdahale parselinde ise %30-35’i çıkarılmış, kontrol parsellerinde herhangi bir müdahale yapılmamıştır.  Deneme parsellerindeki bireylerde 2010 yılı ilkbaharında başlangıç çap değerleri ölçülmüş ve işlemlere göre müdahale kesimleri yapılarak, 2013 yılı ilkbaharındaki çap değerleri ile karşılaştırılıp her iki müdahale yılı arasındaki gelişim farkı tespitleri yapılmıştır. Elde edilen sonuçlara göre; yapılan sıklık bakımı müdahalelerinin gelişmeye etkisinin olduğu ve bu etkinin çap ve göğüs yüzeyi değerleri açısından en iyi gelişiminin kuvvetli müdahale işleminde gerçekleştiği tespit edilmiştir. Çalışma sonucunda, genel olarak 18-20 yaşlarındaki doğal sarıçam meşcerelerinde sıklık bakımı yapılan alanlarda ilk sıklık bakımı kesimlerinde hektardaki birey sayısının 3000-4000 adet civarında tutulması çap ve göğüs yüzeyi açısından en iyi sonucu vermektedir.Anahtar Kelimeler: Çap, göğüs yüzeyi, sarıçam, sıklık bakımı.

  9. Clinical Impact and Relevance of Antiganglioside Antibodies Test Results / Antigangliozīdu Antivielu Testa Rezultātu Klīniskā Ietekme un Nozīme Pacientam

    Directory of Open Access Journals (Sweden)

    Ķēniņa Viktorija

    2015-09-01

    Full Text Available Visbiežāk atrastās autoantivielas asociācijā ar perifērām neiropātijām ir pret gangliozīdiem GM1, GQ1b, asialo-GM1, GM2, GD1a un GD1b. Atzīta diagnostiska vērtība ir divām no tām - anti-GM1 un anti-GQ1b. Tika veikts retrospektīvs pētījums ar mērķi izvērtēt antigangliozīdu antivielu noteikšanas nozīmi pacientiem ar iespējamu autoimūnu neiropātiju. Pētījumā tika iekļauti 85 pacienti, kuri bija stacionēti Paula Stradiņa Klīniskajā universitātes slimnīcā laika posmā no 2013. gada janvāra līdz 2014. gada decembrim un kuru perifērajās asinīs tika noteiktas antigangliozīdu antivielas. Tika reģistrēti un analizēti arī pacientu demogrāfiskie dati, iepriekšējas un esošas saslimšanas, paraklīnisko izmeklējumu dati, t.sk. cerebrospinālā šķidruma atradne un elektrofizioloģiskās izmeklēšanas rezultāti. Mūsu pētījumā 27 pacienti (32% bija seropozitīvi attiecībā vismaz uz vienu no antigangliozīdu grupas antivielām. Visbiežāk atrastās antivielas bija pret asialo-GM1 (n = 13 un GM1 (n = 10 gangliozīdiem. Astoņu pacientu diagnozes sakrita ar slimībām, kur antigangliozīdu antivielām ir atzīta diagnostiska marķiera vērtība: pieciem pacientiem - Gijēna-Barē sindroms (GBS, vienam pacientam - Millera-Fišera sindroms (MFS, diviem pacientiem - multifokāla motora neiropātija (MMN. Trīs no pieciem pacientiem, kuriem bija diagnosticēts GBS, un viens no diviem pacientiem, kuriem bija diagnosticēta MMN, bija seronegatīvi. Akūta slimības gaita, pozitīvas antigangliozīdu antivielas un citoalbumināra disasociācija cerebrospinālajā šķidrumā bija faktori, kas noteica pacientam nepieciešamu specifisku imūnterapiju. Mūsu pētījuma rezultāti atbilst iepriekš aprakstītām novērotām asociācijam starp antigangliozīdu grupas antivielām un GBS, MFS un MMN.

  10. Health-promoting lifestyles and related factors among pregnant women/Gebelerde sağlıklı yaşam biçimi davranışları ve ilişkili faktörler

    Directory of Open Access Journals (Sweden)

    Güliz Onat

    2014-08-01

    Full Text Available AbstractObjective: A health-promoting lifestyle has an especially important role during pregnancy due to its direct link to healthy births, and to low maternal-fetal mortality and morbidity rates. The objectives of our study are to determine and analyse the health-promoting lifestyles and related factors in pregnant women. Methods: This descriptive study was carried out on 255 pregnant women in the city of Usak in Turkey, using the Health-Promoting-Lifestyle-Profile-II-(HPLP. Frequencies, percentage distributions, t tests, and the Mann Whitney U test and ANOVA were used to analyze the results. Results: The mean age of the pregnant women was 26.7±5.1 and their mean gestational week was 25.2±10.9. The mean total score on the HPLP was 130.7±20.0. The lowest score was for “physical activity” (14.4±5.0. The highest score was for “psychological wellbeing” (26.18±4.2. Smoking prevalence among the study population was 17% before the pregnancy,  and 3.9% during the pregnancy (with an average of 4 cigarettes/day. During the pregnancy diet habits improved. The rate of giving up smoking was high. Women also sought further knowledge about pregnancy and birth. Conclusions: In pregnant women the HPLP score was upper to intermediate in level. Of the women who participated in the survey, those that were unemployed, had a lower level of education, and those who had considered abortion were found to be at a higher risk of not having a health promoting life style. This finding provides a unique insight in identifying the risk group for health care providers who work at an antenatal clinic. Health caregivers should pay more attention to this risk group when evaluating healthy lifestyles during whole pregnancy. Key Words: Health-Promoting Lifestyles; pregnant women; Health Promoting Lifestyle Profile-IIÖzetAmaç: Sağlıklı yaşam biçimi davranışları; sağlıklı ve canlı bir doğum yapma, anne-yenidoğan mortalite ve morbidite oranını azaltma

  11. Kuzeydoğu Anadolu Bölgesi Kapsamında Su Ürünleri Sektörünün Ulaşabileceği Potansiyel Büyüklüğünün Mali Projeksiyonu / Financial Projection of Potential of Aquaculture Sector in Northern Anatolia

    OpenAIRE

    Aras, N. Mevlüt; Yanık, Telat; Kocaman, E. Mahmut; Haliloğlu, H. İbrahim

    2011-01-01

    ÖZET: Bu çalışmada Doğu Anadolu Projesi (DAP) kapsamında merkezi hükümet tarafından yürütülen alt yapı destekleme programının aksatılmadan devreye girmesiyle daha çok Kuzeydoğu Anadolu Bölgesi illerinde ulaşılabilecek potansiyelin mali büyüklüğü üzerinde durulmuştur. Ayrıca projelerin katma değerleri açısından istihdam kapasitesi, sosyal değeri ve illere...

  12. Genetic structure of the marsh frog (Pelophylax ridibundus) populations in urban landscape

    Czech Academy of Sciences Publication Activity Database

    Mikulíček, Peter; Pišút, P.

    2012-01-01

    Roč. 58, č. 5 (2012), s. 833-845 ISSN 1612-4642 Institutional support: RVO:68081766 Keywords : Genetic differentiation * Habitat fragmentation * Microsatellites * Rana ridibunda * Ranidae * Urbanization Subject RIV: EG - Zoology Impact factor: 1.355, year: 2012

  13. Vecāku prombūtnes un klātesošā vecāka audzināšanas pieejas saistība ar pusaudžu depresijas pazīmēm

    OpenAIRE

    Ločmele, Renāte

    2014-01-01

    Pētījuma mērķis bija noskaidrot, kādas ir saistības starp vecāku prombūtni, klātesošā vecāka audzināšanas pieeju un pusaudžu depresijas pazīmēm. Pētījumā piedalījās 62 respondenti – 37 meitenes un 25 zēni vecumā no 11 līdz 16 gadiem. Respondentu vidējais vecums bija 14 gadi. Tie tika sadalīti divās grupās: vienā grupā bija pusaudži, kuriem viens no vecākiem atrodas prombūtnē (n=31), otrā grupā bija pusaudži, kas dzīvo kopā ar abiem vecākiem ( n=31). Datu ievākšanai tika izmantotas sekojoš...

  14. Meta Analiz Yaklaşımı ile Laktasyon Sırası ve Buzağılama Mevsiminin 305 Günlük Laktasyon Süt Verimi Üzerindeki Etki Büyüklüğünün Tahmini

    Directory of Open Access Journals (Sweden)

    Hande Küçükönder

    2014-08-01

    Full Text Available Bu çalışmada, Siyah Alaca ırkı ineklerde süt verimini etkileyen faktörlerden laktasyon sırası ve buzağılama mevsimin etkisi meta analiz yöntemi ile incelenmiştir. Meta analiz aynı amaca yönelik olarak başka araştırıcılar tarafından yapılmış olan çalışmaların bir araya getirilerek yeniden değerlendirilmesini sağlayan istatistiksel bir tekniktir. Bu yöntem, çeşitli alanlarda yapılmış olan çalışmaların sonuçlarını birleştirir, özetler ve araştırıcılar arasında ortak bir yargının oluşturulmasında katkı sağlar. Bu sebeplerden ötürü, bu çalışmada 7 farklı araştırıcının çalışmaları meta analiz ile birleştirilmiş ve incelenen parametreler hakkında ortak bir bakış açısının yaratılması hedeflenmiştir. Ayrıca araştırmada etki büyüklüklerinin heterojenlik durumu Ki kare ve I2 test istatistikleri ile araştırılmış ve bu değerler sırasıyla ×^2=50,205 ve I2=%88 olarak bulunmuştur. Bundan dolayı çalışmaların birleştirilmesi için sabit etki modeli kullanılmamıştır. Araştırmada, söz konusu konuya ilişkin olarak araştırıcıların bulmuş oldukları çalışma sonuçları meta analitik tarama yöntemi ile taranmış meta analizde etki büyüklüğü ölçütü olan odds oranının (OR kullanılması ile birleştirilmiştir. Meta analiz sonucunda Odds oranı değeri 0,759 bulunmuş olup, bulunan etki düzeyi orta olarak tespit edilmiştir. Yapılan bu çalışmayla Siyah Alaca sığırlarda 305 günlük laktasyon süt verimi üzerinde, laktasyon sırasının yüksek süt verimi elde edilmesinde Yapmış olduğu katkı payının buzağılama mevsimine nazaran 0,759 kat daha fazla olduğu belirlenmiştir.

  15. Alpha Matting with KL-Divergence Based Sparse Sampling.

    Science.gov (United States)

    Karacan, Levent; Erdem, Aykut; Erdem, Erkut

    2017-06-22

    In this paper, we present a new sampling-based alpha matting approach for the accurate estimation of foreground and background layers of an image. Previous sampling-based methods typically rely on certain heuristics in collecting representative samples from known regions, and thus their performance deteriorates if the underlying assumptions are not satisfied. To alleviate this, we take an entirely new approach and formulate sampling as a sparse subset selection problem where we propose to pick a small set of candidate samples that best explains the unknown pixels. Moreover, we describe a new dissimilarity measure for comparing two samples which is based on KLdivergence between the distributions of features extracted in the vicinity of the samples. The proposed framework is general and could be easily extended to video matting by additionally taking temporal information into account in the sampling process. Evaluation on standard benchmark datasets for image and video matting demonstrates that our approach provides more accurate results compared to the state-of-the-art methods.

  16. CP violation in KL → π0e+e-

    International Nuclear Information System (INIS)

    Littenberg, L.S.

    1989-01-01

    It's been appreciated for many years that the decays K L → π 0 ell bar ell are CP violating to lowest order in the Standard Model, and that the component of direct CP violation in these decays is likely to be comparable to that of the CP violation due to state mixing (ε). This is to be contrasted with the case of K 0 → ππ wherein the latter contribution is predicted to be hundreds of times larger than the former. This paper investigates this CP violation further. 19 refs., 2 figs

  17. Proceedings of the 1981 KL-ONE Workshop,

    Science.gov (United States)

    1982-06-01

    of stereotypical plans and provides friendly truth maintenance and choice generation. Among other facilities, the system responds to questions about...Role3t Relations, which express the interrelations among the [ functional Roles. A superConoept serves as proximate genus , while the internal...structure expresses essential eIifferences, as in classical classificatory definition [Sellars 17]. The sumum genus is represented by the Concept THING. THING

  18. Transmission og modulation af kløe

    DEFF Research Database (Denmark)

    Elberling, Jesper; Arendt-Nielsen, Lars

    2014-01-01

    Chronic itch is an annoying and disabling symptom that severely affects patients' quality of life in several dermatological as well as non-dermatological disorders. Chronic itch may be maintained and even aggravated by sensitization of peripheral and central neuronal structures. The possibilities...... to effectively relieve chronic itch are often limited and the need of more specific, effective and quick-acting treatment options is huge. This review summarizes the fundamental aspects of itch, the neuronal transmission and modulation of itch, and discusses new treatment opportunities....

  19. What are the anti-particles of KL,S

    International Nuclear Information System (INIS)

    Mathur, V.S.; Rajeev, S.G.

    1991-01-01

    The authors study the consequences of an anti-unitary symmetry such as CPT for an unstable quantum system described by a non-self-adjoint Hamiltonian. In this paper it is shown that CPT invariance by itself does not imply that every particle has an anti-particle of equal mass and life-time. In particular, the neutral kaons K L and K S do not have anti-particles even when CPT is conserved

  20. Kløkt og fordom: Om holdningsendring i klasserommet

    Directory of Open Access Journals (Sweden)

    Solveig Moldrheim

    2014-03-01

    Full Text Available Most teachers have experienced various forms of prejudice expressed in the classroom. When one hears attitudes or opinions that go against school and society’s values, it is not always easy to know how to respond appropriately and wisely.Educators have a social responsibility both towards the individual and the community. Individuals are the learning subjects, but the context for learning is group-based. Teachers’ social responsibility entails both individuals that have expressed prejudice against a particular group, and those who identify themselves with this particular group. In addition, educators have responsibility for the group based learning arena, which all the individuals belong to. Beyond this, schools are expected to contribute to a democratic society. Preventing prejudice expressed in the class room will not only ensure a safer environment for the pupils, it will also contribute to society as a whole by promoting democratic values. In other words, there are several reasons why schools should work to prevent prejudice.Many have antipathies or prejudices against groups of people. However, but some groups are more often faced with prejudice than others. A prerequisite for the development of prejudice is the formation of categories. People are able to suppress their prejudices. Prejudice is not created in a vacuum; they are social stances that must be understood in the context of the specific human environment. Studies show that if a person has prejudices against Jews, for example, the person tends to be more disposed to have prejudices against other groups as well, such as for example gays, , Muslims and immigrants. This disposition is called "group focused enmity."When a child is between eight and twelve years, the child starts to check and correct its perception of the world. Before it reaches this stage, the child’s comments about out-groups mainly stems from other people’s instructions. Studies from the USA have shown that negativity towards people with a different skin color decreases from around the age of 10 compared to when the child was younger.An individual's attitudes are formed on the basis of that person's overall experience. Although formed individually, experience often take place in social interaction with other individuals. In social settings, people find their significant other, that is, an individual or individuals they may mirror and adjust to. Such individuals may include parents, siblings, friends and teachers. The school is therefore a very important arena for promoting positive attitudes.Albert Einstein allegedly claimed that "It is harder to crack a prejudice than an atom." But even if we take hold of prejudices and actively seek to fight them, it will require time and energy. The process of changing a person’s attitude is significantly longer than the process of developing a person’s academic knowledge and skill.It is often said that "prejudice must be fought with knowledge." Prejudice consists of both beliefs and attitudes. It is important that educators have access to constructive meeting arenas, read books, play games and watch movies that can make room for empathy. It is essential to find learning resources, initiatives and approaches that promote values such as empathy and community, and then creating positive experiences for the pupils.

  1. Geleneksel Anlatı Formları Olarak Mesnevîler ve Klâsik Aşk Mesnevîlerinin Motif Yapısı In Traditional Narrative Forms Mathnavies And Structure Motif Of Classic Love Mathnavies

    Directory of Open Access Journals (Sweden)

    Timuçin AYKANAT

    2012-12-01

    Full Text Available Text term can be generally described as written or verbal expressions. The texts that have an aesthetic and artistic value are called as literary texts. A literary text, carry its artistic work name in accordance with its artistic value. Artistic works mostly called differently due to creation era and form of creation. Classical mathnavi and modern novels, although they do not overlap exactly, are typical examples of this situation. The common feature of almost all artistic works comes from their being of narrative texts and these texts have fictional-narrative quality. Almost all fictional-narrative texts areconstructed by the knitting of different motifs in the hands of theirauthors. Although a text is knitted with lots of different motifs comingtogether, different works in the same context can use the same commonmotifs. Thus, different works emerge that have similar motif and plotbut different in accordance with their creators’ quantitative andqualitative characteristics. The commonality of this kind of texts,provide them to have an intertextual context. This study, investigateseighteen binary love mathnavi which have satisfied the narrative need ofhumanity for eras and have a place for themselves in the traditionalnarrative forms. Building upon this investigation, this study; has someevaluations on mathnavi as a traditional narrative form, searches formotifs that knit classical love mathnavi for their plot and emphasizesthe context that these texts construct. Metin ifâdesi, genel bir yaklaşımla yazılı ya da sözlü ibâreler şeklinde tanımlanabilir. Estetik beğeni ve sanatsal kaygı taşıyan metinler, edebî metinler olarak yorumlanmaktadır. Bir edebî metin, sanatsal kıymeti nispetinde, sanat yapıtı adını alır. Sanat yapıtları ise, oluşturulduğu çağ ve oluşturulma şekline göre, çoğu defa farklı adlandırılır. Klâsik mesnevîler ve modern romanlar; her ne kadar bire bir örtüşmeseler de bunun en tipik

  2. Sağlıklı genç olgularda yüksek yoğunluklu intervalli aerobik egzersiz eğitimi ile submaksimal sürekli aerobik egzersiz eğitiminin solunum fonksiyonları, egzersiz kapasitesi, stres düzeyi ve benlik saygısı üzerine etkilerinin karşılaştırılması

    OpenAIRE

    Yalman, Ali

    2016-01-01

    Bu çalışma iki farklı aerobik egzersiz eğitiminin (yüksek yoğunluklu interval egzersiz ve sürekli submaksimal egzersiz) solunum fonksiyonları, egzersiz kapasitesi, benlik saygısı ve stres düzeyi üzerine etkilerinin karşılaştırılması amacıyla yapılmıştır. Araştırmaya yaş ortalaması 20,83±0,97 yıl olan, 36 sağlıklı katılımcı dahil edildi. Katılımcılar yüksek yoğunluklu interval egzersiz eğitimi (YYİE) grubu (n=19 %52,8) ve sürekli submaksimal egzersiz eğitimi grubu (SSE) (n=17 %47,2) olmak üzer...

  3. Genetic and genomic interactions of animals with different ploidy levels.

    Science.gov (United States)

    Bogart, J P; Bi, K

    2013-01-01

    Polyploid animals have independently evolved from diploids in diverse taxa across the tree of life. We review a few polyploid animal species or biotypes where recently developed molecular and cytogenetic methods have significantly improved our understanding of their genetics, reproduction and evolution. Mitochondrial sequences that target the maternal ancestor of a polyploid show that polyploids may have single (e.g. unisexual salamanders in the genus Ambystoma) or multiple (e.g. parthenogenetic polyploid lizards in the genus Aspidoscelis) origins. Microsatellites are nuclear markers that can be used to analyze genetic recombinations, reproductive modes (e.g. Ambystoma) and recombination events (e.g. polyploid frogs such as Pelophylax esculentus). Hom(e)ologous chromosomes and rare intergenomic exchanges in allopolyploids have been distinguished by applying genome-specific fluorescent probes to chromosome spreads. Polyploids arise, and are maintained, through perturbations of the 'normal' meiotic program that would include pre-meiotic chromosome replication and genomic integrity of homologs. When possible, asexual, unisexual and bisexual polyploid species or biotypes interact with diploid relatives, and genes are passed from diploid to polyploid gene pools, which increase genetic diversity and ultimately evolutionary flexibility in the polyploid. When diploid relatives do not exist, polyploids can interact with another polyploid (e.g. species of African Clawed Frogs in the genus Xenopus). Some polyploid fish (e.g. salmonids) and frogs (Xenopus) represent independent lineages whose ancestors experienced whole genome duplication events. Some tetraploid frogs (P. esculentus) and fish (Squaliusalburnoides) may be in the process of becoming independent species, but diploid and triploid forms of these 'species' continue to genetically interact with the comparatively few tetraploid populations. Genetic and genomic interaction between polyploids and diploids is a complex

  4. Characterisation of cell wall polysaccharides from okra (Abelmoschus esculentus (L.) Moench)

    NARCIS (Netherlands)

    Sengkhamparn, N.; Verhoef, R.P.; Schols, H.A.; Sajjaanantakul, T.; Voragen, A.G.J.

    2009-01-01

    Okra pods are commonly used in Asia as a vegetable, food ingredient, as well as a traditional medicine for many different purposes; for example, as diuretic agent, for treatment of dental diseases and to reduce/prevent gastric irritations. The healthy properties are suggested to originate from the

  5. Genetic variability and heritability in cultivated okra [Abel moschus esculentus (L.) Moench

    Energy Technology Data Exchange (ETDEWEB)

    Nwangburuka, C. C.; Denton, O. A.; Khinde, O. B.; Ojo, D. K.; Popoola, A. R.

    2012-11-01

    Twenty-nine okra accessions from different agro-ecological regions in Nigeria were grown during the rainy and dry seasons, between 2006 and 2007 at Abeokuta (derived savanah) and Ilishan (rainforest) and assessed to determine their genetic variability, heritability and genetic advance from eight yield related characters. The experiment was laid out in a Randomized Complete Block Design with five replications. There was high genotypic coefficient of variability, % broad-sense heritability and genetic advance in traits such as plant height (26.2, 90.7, 51.5), fresh pod length (23.9, 98.5, 48.8), fresh pod width (23.9, 98.5, 48.8), mature pod length (28.6, 98.5, 52.3), branching per plant (29.3, 82.3, 54.8) and pod weight per plant (33.9, 90.0, 63.3), suggesting the effect of additive genes and reliability of selection based on phenotype of these traits for crop improvement. The positive and significant phenotypic and genotypic correlation between plant height at maturity, fresh pod width, seeds per pod and pods per plant, branches per plant with seed weight per plant and pod weight per plant, suggests that selection on the basis of the phenotype of these characters will lead to high seed and pod yield in okra. (Author) 26 refs.

  6. Physiological and biochemical response to high temperature stress in Okra (Abelmoschus esculentus L. Moench)

    Science.gov (United States)

    Hayamanesh, Shahnoosh; Keitel, Claudia; Ahmad, Nabil; Trethowan, Richard

    2016-04-01

    High temperature has been shown to lower the growth and yield of Okra, an important summer vegetable crop grown in Asia, Africa, the Middle East and Australia. We aimed to characterise the physiological and biochemical response of Okra to heat stress. 150 genotypes from Pakistan and the AVRDC (The World Vegetable Centre) were screened for their physiological response (fluorescence, electrolyte leakage and yield) to heat in a greenhouse. Four genotypes (including heat tolerant and sensitive) were selected and subsequently grown in control and hot greenhouses. Daytime temperatures were on average 10°C warmer in the hot greenhouse, whereas nighttime temperatures were similar between the two temperature treatments. During a 12 week period, the physiological (assimilation rate, transpiration rate, stomatal conductance, fluorescence, electrolyte leakage, water potential) and biochemical (carbohydrates, sugar alcohols, C content) response of the four genotypes to heat stress was assessed. The effect of heat stress on the C allocation patterns and yield in Okra will be discussed.

  7. MODE OF INHERITANCE OF POD SPININESS IN OKRA (Abelmoschus esculentus (L. Moench

    Directory of Open Access Journals (Sweden)

    Adil Hassan Ahmed Abdelmageed

    2009-10-01

    Full Text Available The mode of inheritance of spininess in okra was investigated. Two okra cultivars, namely ‘Khartoumia spiny’ and the Indian cultivar ‘Pusa Sawani’ were used in this study. The two parents were self pollinated for three successive generations to fix the character under study. Crosses were made between ‘Khartoumia spiny’ and ‘Pusa Sawani’, and reciprocal F1’s, F2’s and all possible backcrosses were derived from the initial crosses. No reciprocal differences were found between F1 and F2 generation for pod spininess. Segregation in the crosses between the local cultivar ‘Khartoumia spiny’ and the Indian cultivar ‘Pusa Sawani’ indicated that the presence of spines on pods was controlled by single gene, with incomplete dominance.

  8. Assessment of genetic diversity in okra (abelmoschus esculentus l.) using rapd markers

    International Nuclear Information System (INIS)

    Haq, I.; Khan, A.A.; Azmat, M.A.

    2013-01-01

    Thirty nine okra genotypes were assessed for genetic variability using Random Amplified Polymorphic DNA (RAPD) markers. Twenty polymorphic RAPD primers amplified 111 DNA fragments, with an average of 5.5 fragments per primer. Among 39 okra genotypes, 107 fragments (96%) were found to be polymorphic. The UPGMA cluster analysis placed okra genotypes into seven main clusters. Sabzpari 2001 and Acc. No. 019221 had shown maximum similarity (83%) while the minimum similarity (44.14%) was observed between the genotypes Punjab Selection and Acc. No. 019217. Thus, by using RAPD primers a considerable polymorphism appeared to exist, which showed genetic variability in the okra genotypes. (author)

  9. Genetic basis of variation for salinity tolerance in okra (abelmoschus esculentus L.)

    International Nuclear Information System (INIS)

    Ikram-ul-Haq; Khan, A.A.; Azhar, F.M.; Ullah, E.

    2010-01-01

    The development of salt tolerant plants through selection and breeding depends on the presence of the genetic variability within the crop species in response to salt stress, which must have significant genetic component. Such information is not extensively available in vegetable crops. The present study was carried out to gain some information on the genetic basis of variation for salinity tolerance in okra. North Carolina Mating Design II (NCM II) was used for the estimation of genetic components of variation in the traits affecting salinity tolerance. The inheritance of the traits affecting salinity tolerance at the seedling stage appeared to be controlled by both additive and non-additive effects (dominance and epistasis). The narrow sense heritability estimates ranged from 40 to 65% and 7 to 70% and the estimates of broad sense heritability ranged from 65 to 99% and 20 to 99% for absolute and relative values. The additive effects were relatively more prominent and narrow sense heritability was moderate. The high additive component for absolute Na/sup +/ and K/sup +//Na/sup +/ ratio at 60 and 80 mM NaCl, relative Na+ at 80 mM NaCl suggested that improvement for salinity tolerance in okra would be possible on the basis of these characteristics through selection and breeding. The genetic variation for tolerance to NaCl salinity existed among the okra genotypes, which had considerable heritable component and, therefore, genetic improvement of okra genotypes for salinity tolerance through recurrent selection method is possible. (author)

  10. Advances in breeding of okra [Abelmoschus esculentus (L.) Moench.] in India

    Energy Technology Data Exchange (ETDEWEB)

    Sharma, B R; Arora, S K [Department of Vegetable Crops, Landscaping and Floriculture, Punjab Agricultural University, Ludhiana (India)

    1990-01-01

    Full text: Okra, an important vegetable of the tropics and sub-tropics is very popular in India. Its production is limited by 'yellow vein mosaic virus'. Advances in breeding for resistance to this virus have been made through inter-specific hybridisation as well as mutagenesis. Hybridisation used A. manihot ssp. manihot and ssp. tetraphyllus. New varieties showed 87-146% yield increases over older virus susceptible varieties. The number of fruits increased by 13-30%, virus incidence decreased by 84-99%. An EMS induced mutant 'EMS8' showed a yield increase of 107%, a fruit number increase of 16% and a disease decrease of 99%. The mutant also carries a good amount of resistance to the fruit borer; infestation decreased by 46%. The mutant is the best among the tested varieties for canning, is suitable for dehydration, and can be stored prepacked at room temperature for 6 days. (author)

  11. Yellow nutsedge (Cyperus esculentus L.) control with herbicides: the role of tuberization

    International Nuclear Information System (INIS)

    Pereira, W.

    1985-01-01

    Trials were carried out under greenhouse, growth chamber, laboratory, outdoor pot, and field conditions to characterize stages of yellow nutsedge tuberization and to investigate the influence of herbicides. The effects of herbicides on tuberization and phytotoxicity at several growth stages, as well as on sprouting, growth characteristics, and survival of new tubers were determined. Tuberization was a continuous process, but was modulated by plant age and environmental conditions. The growth stage that included the time of first tuber initiation was the best for applying glyphosate [N-(phosphonomethyl)glycine] and oxyfluorfen [2-chloro-1-(3-ethoxy-4-nitrophenoxy)-4-(trifluromethyl)benzene]. Plant-age and length of period after spraying influenced glyphosate and oxyfluorfen absorption and translocation. Addition of unlabelled oxyfluorfen as a tank mixture can glyphosate increased absorption of 14 C-glyphosate to 27% after 1 day and 46% after 8 days and increased translocation into other plant parts. Timing of postemergence herbicide applications relative to tuberization is crucial for overall control of yellow nutsedge. When soil applied herbicides were compared in the field, consecutive applications of dichlobenil (2,6-dichlorobenzonitrile) and metolachlor [2-chloro-N-(2-ethyl-6-methylphenyl)-N-(2-methoxy-1-methylethyl)acetamide] for two years provided the best control of nutsedge

  12. Yellow nutsedge (Cyperus esculentus L. ) control with herbicides: the role of tuberization

    Energy Technology Data Exchange (ETDEWEB)

    Pereira, W.

    1985-01-01

    Trials were carried out under greenhouse, growth chamber, laboratory, outdoor pot, and field conditions to characterize stages of yellow nutsedge tuberization and to investigate the influence of herbicides. The effects of herbicides on tuberization and phytotoxicity at several growth stages, as well as on sprouting, growth characteristics, and survival of new tubers were determined. Tuberization was a continuous process, but was modulated by plant age and environmental conditions. The growth stage that included the time of first tuber initiation was the best for applying glyphosate (N-(phosphonomethyl)glycine) and oxyfluorfen (2-chloro-1-(3-ethoxy-4-nitrophenoxy)-4-(trifluromethyl)benzene). Plant-age and length of period after spraying influenced glyphosate and oxyfluorfen absorption and translocation. Addition of unlabelled oxyfluorfen as a tank mixture can glyphosate increased absorption of /sup 14/C-glyphosate to 27% after 1 day and 46% after 8 days and increased translocation into other plant parts. Timing of postemergence herbicide applications relative to tuberization is crucial for overall control of yellow nutsedge. When soil applied herbicides were compared in the field, consecutive applications of dichlobenil (2,6-dichlorobenzonitrile) and metolachlor (2-chloro-N-(2-ethyl-6-methylphenyl)-N-(2-methoxy-1-methylethyl)acetamide) for two years provided the best control of nutsedge.

  13. Is premeiotic genome elimination an exclusive mechanism for hemiclonal reproduction in hybrid males of the genus Pelophylax?

    Czech Academy of Sciences Publication Activity Database

    Doležálková, Marie; Sember, Alexandr; Marec, František; Ráb, Petr; Plötner, J.; Choleva, Lukáš

    2016-01-01

    Roč. 17, č. 100 (2016) ISSN 1471-2156 R&D Projects: GA ČR GJ15-19947Y; GA ČR(CZ) GA14-22765S Institutional support: RVO:67985904 ; RVO:60077344 Keywords : hybridogenesis * asexual propagation * hemiclone * meiotic cycle * genomic in situ hybridization * Rana Subject RIV: EG - Zoology; EB - Genetics ; Molecular Biology (BC-A) Impact factor: 2.266, year: 2016

  14. İzmir’de ikinci ve üçüncü basamak sağlık kuruluşlarına başvuran gebelerin aile hekimi tarafından izlenme sıklıkları ve etkileyen etmenler

    Directory of Open Access Journals (Sweden)

    Raika Durusoy

    2011-05-01

    Full Text Available ÖzetAmaç: İzmir’de ikinci ve üçüncü basamak sağlık kuruluşlarına başvuran gebelerin aile hekimi (AH tarafından tespit ve izlem sıklıklarını ve bunları etkileyen etmenleri değerlendirmek. Yöntem: Tanımlayıcı olan bu araştırma için, Aralık 2008 - Şubat 2009 tarihleri arasında İzmir’de bir ikinci, bir üçüncü basamak hastaneye izlem ya da doğum için başvuran 580 kadınla görüşülmüştür. Sosyodemografik özellikler, gebelikteki ilk izlem zamanları, AH’ne kayıt ve izlem durumu, 27 sorudan oluşan bir anketle sorgulanmıştır. Analizlerde ki-kare, McNemar ve t-testi kullanılmıştır. Bulgular: Araştırmaya katılan 580 gebenin 397’siyle (%64 ikinci basamak, 183’üyle (%32 üçüncü basamak hastanede görüşüldü. Kadınların  %55’i ilkokul ve altı eğitim düzeyine sahipti, %28’ini yeşil kartı olanlar veya sağlık güvencesi olmayanlar oluşturmaktaydı.  Kadınların 307’si (%53 ilk çocuğuna hamileydi ve yaş ortalamaları 27.1±5.5 idi. Gebelerin %26’sı gebelik testini aile sağlığı merkezinde yaptırmıştı ve ilk kontrolleri için en sık başvurdukları yerler sırasıyla devlet hastanesi (%33 ve aile hekimidir (%27.  Gebelerin %14’ünün AH’lerini bilmediği, %10’unun AH’de gebe kaydının bulunmadığı ve %15’inin AH tarafından izlenmediği saptanmıştır. Gebeler ortalama 11.3±6.3 kez izlenmişlerdir, bunun 4.3±3.3’ü aile sağlığı biriminde gerçekleşmiştir. AH tarafından izlenen gebelerin %95’i AH’ne kendisi başvurmuştu. Gebelerin ancak %69’u zamanında tespit edilmişti, %49’unu sadece ebeler izlemekteydi ve sadece %3’üne ev ziyareti yapılmış, %77’si telefonla kuruma çağrılmıştır. Son iki yılda İzmir’e göçle gelen, okuryazar olmayan, yükseköğrenim mezunu olan, çalışan, emekli sandığı mensubu olan, yüksek gelir düzeyine sahip olan gebelerin aile hekimleri tarafından izlenme oranları daha d

  15. Political Unrest and Educational Electronic Resource Usage in a Conflict Zone, Kashmir (Indian Administered Kashmir: Log Analysis as Politico Analytical Tool=Hindistan Tarafından Yönetilen Keşmir Anlaşmazlık Bölgesi’nde Siyasi Karışıklık ve Eğitimle İlgili Elektronik Kaynakların Kullanımı: Siyasi Analiz Aracı Olarak Log Analizleri

    Directory of Open Access Journals (Sweden)

    Sumeer Gul

    2013-10-01

    and conflict studies of a politically simmering area, Kashmir. The research can further be extended to analyze the impact of political normalcy on the academia of Kashmir.How normalcy acts as an indicator of enhanced e-resource usage can be studied./Elektronik kaynak kullanım analizi, kütüphane hizmetlerine yönelik olarak yapılan planlamalarda en iyi karar verme araçlarından biridir. Elektronik kaynak kullanım düzeyinin belirlenmesi, ülkelerdeki siyasi karışıklıklardan etkilenen eğitim planlamalarının yapılmasında önemli bir araç olarak nitelendirilebilir. Bu çalışma, Hindistan Keşmir Anlaşmazlık Bölgesi’ndeki elektronik kaynak kullanımını ve siyasi karışıklıkların bu kullanım üzerindeki etkisini incelemektedir.Ocak 2008 - Aralık 2010 tarihleri arasındaki anlaşmazlık döneminde Keşmir Üniversitesinde Proje Muse dergisinin makalelerinin kullanımı loglar aracılığıyla analiz edilmiştir. Barış süreci,toplumların gelişiminde her yönden büyük bir role sahiptir. Siyasi anlaşmazlık ise eğitim alanında yaşanacak gelişimin sağlanmasında büyük ölçüde engel teşkil etmektedir. Araştırmada,anlaşmazlık sürecinde Keşmirlilerin akademik davranışlarının gerçek durumu, loglar aracılığıyla ortaya konulmuştur. Araştırma, siyasi anlaşmazlığın genel olarak eğitim alanında, özel olarak elektronik kaynak kullanımında olumsuz etkiler yarattığı gerçeğini yansıtmıştır. Bu araştırma,Keşmir Anlaşmazlık Bölgesi’nde yaşanan ve eğitim alanında olumsuz etkiler yaratan siyasi anlaşmazlığın etkilerinin azaltılmasında eğitimle ilgili politikacılara fikir vermesi bakımından önemlidir. Ayrıca bu araştırma log analizlerinin, siyasi anlaşmazlığın akademik çevrelere yönelik ortaya koyduğu olumsuz etkilerin saptanmasında yardımcı olacağını vurgulamaktadır. Araştırma, Keşmir’de siyasi anlaşmazlık ve eğitim arasındaki ilişkiyi ortaya koyan ilk

  16. Improved upper limits on B(KL0 → μe) and B(KL0 → ee) and a new value for B(KL0 → μμ)

    International Nuclear Information System (INIS)

    Molzon, W.R.

    1998-01-01

    The author gives recent results from E791 at BNL with improved upper limits on the branching fractions B(K L 0 → μe) and B(K L 0 → ee) of 8.5 x 10 -11 and 11.6 x 10 -11 at 90% C.L. He also gives a preliminary result of a new measurement B(K L 0 → μμ) = 7.6 ± 0.5(stat) ± 0.4(syst) x 10 -9

  17. Measurements of Branching Fractions, Rate Asymmetries, and Angular Distributions in the Rare Decays B -> Kl+l- and B -> K*l+ l-

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B.

    2006-04-07

    We present measurements of the flavor-changing neutral current decays B {yields} K{ell}{sup +}{ell}{sup -} and B {yields} K*{ell}{sup +}{ell}{sup -}, where {ell}{sup +}{ell}{sup -} is either an e{sup +}e{sup -} or {mu}{sup +}{mu}{sup -} pair. The data sample comprises 229 x 10{sup 6} {Upsilon}(4S) {yields} B{bar B} decays collected with the BABAR detector at the PEP-II e{sup +}e{sup -} storage ring. Flavor-changing neutral current decays are highly suppressed in the Standard Model and their predicted properties could be significantly modified by new physics at the electroweak scale. We measure the branching fractions {Beta}(B {yields} K{ell}{sup +}{ell}{sup -}) = (0.34 {+-} 0.07 {+-} 0.02) x 10{sup -6}, {Beta}(B {yields} K*{ell}{sup +}{ell}{sup -}) = (0.78{sub -0.17}{sup +0.19} {+-} 0.11) x 10{sup -6}, the direct CP asymmetries of these decays, and the relative abundances of decays to electrons and muons. For two regions in {ell}{sup +}{ell}{sup -} mass, above and below m{sub J/{psi}}, we measure partial branching fractions and the forward-backward angular asymmetry of the lepton pair. In these same regions we also measure the K* longitudinal polarization in B {yields} K*{ell}{sup +}{ell}{sup -} decays. Upper limits are obtained for the lepton flavor-violating decays B {yields} Ke{mu} and B {yields} K*e{mu}. All measurements are consistent with Standard Model expectations.

  18. Evaluation of Fatty Acid and Amino Acid Compositions in Okra (Abelmoschus esculentus Grown in Different Geographical Locations

    Directory of Open Access Journals (Sweden)

    Rokayya Sami

    2013-01-01

    Full Text Available Okra has different uses as a food and a remedy in traditional medicine. Since it produces many seeds, distribution of the plant is also quite easy. Although seed oil yield is low (4.7%, since the linoleic acid composition of the seed oil is quiet high (67.5%, it can still be used as a source of (UNSAT unsaturated fatty acids. In this study, samples of okra grown in four different locations were analyzed to measure fatty acid and amino acid compositions. The content of the lipid extraction ranged from 4.34% to 4.52% on a dry weight basis. Quantitatively, the main okra fatty acids were palmitic acid (29.18–43.26%, linoleic acid (32.22–43.07%, linolenic acid (6.79–12.34%, stearic acid (6.36–7.73%, oleic acid (4.31–6.98%, arachidic acid (ND–3.48%, margaric acid (1.44–2.16%, pentadecylic acid (0.63–0.92%, and myristic acid (0.21–0.49%. Aspartic acid, proline, and glutamic acids were the main amino acids in okra pods, while cysteine and tyrosine were the minor amino acids. Statistical methods revealed how the fatty acid and amino acid contents in okra may be affected by the sampling location.

  19. Toxicity, absorption, translocation, and metabolism of chlorimuron in yellow and purple nutsedge (Cyperus esculentus and C. rotundus)

    International Nuclear Information System (INIS)

    Reddy, K.N.

    1987-01-01

    Greenhouse, laboratory, and field studies were conducted to investigate the activity of soil and foliar applied chlorimuron on yellow and purple nutsedge. Soil-applied chlorimuron (10 to 60 g/ha) significantly decreased tuber sprouting, shoot emergence, and shoot growth in both yellow and purple nutsedge. Previous exposure to soil-applied chlorimuron was not effective in reducing parent tuber sprouting at any rate in yellow nutsedge, while in purple nutsedge parent tuber sprouting was reduced significantly at 60 g/ha. Shoots of both yellow and purple nutsedge propagules absorbed greater amounts of 14 C than did roots and tubers. However, translocation of 14 C was greater from the roots and tuber than from the shoot. Toxicity of foliar-applied chlorimuron (5 to 30 g/ha) was evident by stunted growth, leaf discoloration, and death in both species. Application of chlorimuron at 20 g/ha gave 84% control in yellow nutsedge and 100% control in purple nutsedge. Chlorimuron treatments reduced shoot dry weight, inhibited secondary shoot production, and killed parent tubers attached to treated plants, regardless of rats, in both species. Over 13% of the foliar-applied 14 C recovered was absorbed and over 15% of that absorbed was translocated at 1 day after application in both species. This increased two-fold by 8 days after application. 14 C translocation was both acropetal and basipetal. Over 68% of the absorbed 14 C in yellow nutsedge and 63% in purple nutsedge was retained in the treated area at 8 days after application. Overall, the basal bulb, rhizomes, and tuber had the least amounts of 14 C in both species

  20. 6. Sınıf Öğrencilerinin Yazım Yanlışları Sıklığı ve Yazım Yanlışlarının Nedenlerine İlişkin Öğretmen Görüşleri 6th Grade Students’ Frequency Of Orthographic Mistakes And Teachers’ View About The Reasons For Orthographic Mistakes

    Directory of Open Access Journals (Sweden)

    Ahmet AKKAYA

    2013-07-01

    differently and efficiently, and to explain teachers the importance of orthographic mistakes. Yazım yanlışları, yazılı anlatımda iletişim sorunlarının ortaya çıkmasına neden olan önemli ögelerden biridir ve genellikle eğitim-öğretim ortamlarında öğrencilere öğretilmeye çalışılan yazılı anlatım kazanımlarındandır. Bu araştırmanın amacı, 6. sınıf öğrencilerinin sınav kâğıtlarında yaptıkları yazım yanlışlarının sıklığını ve Türkçe öğretmenlerinin yazım yanlışlarının nedenlerine ilişkin görüşlerini belirlemektir. Bu amaç doğrultusunda Adıyaman il merkezinden 2 ve köylerinden bir ortaokuldan tesadüfi olarak belirlenen 6. sınıfların 336 sınav kâğıdı incelenmiş ve bu araştırmanın verilerinin bir kısmı elde edilmiştir. Öğrencilerin 4142 yazım yanlışı yaptığı tespit edilmiştir. Öğrencilerin sınavlarda simgeleri, kısaltmaları, düzeltme işaretini, yabancı özel adları kullanmadığı; ek fiilin yazılışı ve fiil çekimiyle ilgili yanlış yapmadıkları; ünlü daralması ve ünlü türemesi ses olaylarının olduğu kelimeleri doğru yazdıkları görülmüştür. 6. sınıf öğrencilerinin en fazla büyük harflerin yazılışında yanlış yaptıkları tespit edilmiştir. Bununla birlikte sessiz harflerin yazılışı, sesli harflerin yazılışı, ses yutumu, bağlaç olan da, de'nin yazılışı ise en fazla tekrarlanan diğer yazım yanlışlarıdır. Öğrencilerin yaptığı yazım yanlışların nedenlerini belirlemek için de 6. sınıf Türkçe dersine giren 16 Türkçe öğretmenine “6. sınıf öğrencilerinin yazım yanlışlarının nedenleri nelerdir?” açık uçlu sorusu yöneltilmiş ve bu araştırmanın verilerinin diğer kısmı elde edilmiştir. Verilerin analiz edilmesinde içerik analizi tekniği kullanılmıştır. Türkçe öğretmenleri, 6. sınıf öğrencilerinin yazım yanlışlarının nedenlerinin ilgi ve dikkat eksikliğinden, temel dil

  1. Histopathological changes in the liver and kidney tissues of marsh frog (Pelophylax ridibundus induced by the action of Talstar 10EC insecticide

    Directory of Open Access Journals (Sweden)

    Alina PĂUNESCU

    2012-05-01

    Full Text Available Histopathological biomarkers of toxicity in frog organs are a useful indicator of environmental pollution. The frogs were experimentally exposed to sub-lethal concentrations (0.5mg bifenthrin/g of body weight of Talstar 10EC for 3 weeks. The present study proves its toxic potential in terms of the damages in liver and kidney level. Tissues were normal in the control group. Hepatic lesions in frog exposed to bifenthrin were characterized by vacuolation of hepatocytes and nuclear pycnosis, perisinusoidal and periportal fibrosis, dilatation of Disse space and sinusoid capillaries, presence of cellular infiltrates. Kidney lesions consisted of dilation of Bowman’s space, tubular necrosis, and epithelial cells shows pycnotic nuclei, discrete degree of interstitial edema.

  2. Status of BNL E791: Study of very rare KL0 decays

    International Nuclear Information System (INIS)

    McFarlane, W.K.

    1989-01-01

    BNL E791 is a search for the lepton-number non-conserving decay K L 0 → μe. During the 1988 run, the apparatus was also sensitive to the decays K L 0 → μμ, K L 0 → ee, and K L 0 → π 0 ee. Preliminary limits on the branching fractions from this run are: B(K L 0 → μe) -10 and B(K L 0 → ee) -10 . For the decay K L 0 → μμ, we identified 87 candidate events. We expect to reach a single-event sensitivity in the 10 -11 range in the future. 10 refs., 3 figs

  3. Search For the Rare Decay KL->pi0 pi0 gamma

    International Nuclear Information System (INIS)

    Smith, David Edward

    2006-01-01

    This thesis describes a search for the rare decay K L → π 0 π 0 γ using data from the KTeV experiment, using the topology K L → π 0 π D 0 γ (where π D 0 → γe + e - ). Due to Bose statistics and the real nature of the photon, the K L → π 0 π 0 γ decay can proceed at lowest order only by the Cp conserving direct emission of an E2 photon. The decay vanishes to O(p 4 ) in chiral perturbation theory and is a probe of the theory to the sixth order. The primary background to this decay consists of K L → π 0 π 0 π D 0 events with one lost photon. The upper limit for the decay K L → π 0 π 0 γ presented in this thesis is 2.32 x 10 -7 at the 90% confidence level. This upper limit was derived from both 1997 and 1999 data, using a blind analysis. The upper limit was derived from a Feldman-Cousins method, based on a weighted total of 0.53 data events in the signal region with an expected K L → π 0 π 0 π D 0 background of 0.37 ± 0.28 events. The previous upper limit for this decay was 5.6 x 10 -6 at the 90% confidence level

  4. Kanalnetz- und Kläranlagenzuflusssteuerung am Beispiel des Einzugsgebiets Wilhelmshaven

    DEFF Research Database (Denmark)

    Seggelke, Katja; Beeneken, Thomas; Fuchs, Lothar

    2013-01-01

    in overall stormwater overflow volumes at the sensitive sewage disposal point only thanks to the implementation of the control system. Moreover, the safe operation of the wastewater treatment plant can be guaranteed by simple means without significantly increasing stormwater overflow discharges. Currently......In the catchment area of the Wilhelmshaven wastewater treatment plant, an integrated, fuzzy-based control system has been in place for more than a year now. The system’s essential elements are a sewer network control system to reduce stormwater overflow events and volumes at a sensitive sewage...... disposal point as well as the control of the wastewater treatment plant’s inflow as a function of measurement values during the treatment process in order to avoid critical load conditions. The accompanying monitoring shows that operating experiences are positive and it confirms a more than 25 % reduction...

  5. Isolation of uv-sensitive variants of CHO-Kl by nylon cloth replicaplating

    International Nuclear Information System (INIS)

    Stamato, T.D.; Waldren, C.A.

    1977-01-01

    Techniques are described which permit the identification and isolation of uv-sensitive variants from mutagenized populations of Chinese hamster ovary (CHO) cells. Identification is based on the observation that within two days after receiving a dose of approximately 240 ergs/mm 2 of uv irradiation, most of the cells in a colony of CHO detach from the surface of a plastic tissue culture dish. At a lower dose of uv, which does not kill or detach a significant number of parental cells, uv-sensitive colonies are killed and become detached. Thus a clear plaque is produced in a lawn of unirradiated parental cells, marking the site occupied by a sensitive colony. Live cells from such sensitive colonies have been recovered from a nylon cloth replica prepared prior to irradiation and characterized. One uv-sensitive variant (CHO-UV-1) is indistinguishable from parental cells in x-ray resistance, chromosome number, generation time, and duration of the phases of the cell cycle

  6. Measurements of the Rare Decays B -> Kl+l- and B ->K*l+l-

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B.; Barate, R.; Boutigny, D.; Couderc, F.; Karyotakis, Y.; Lees, J.P.; Poireau, V.; Tisserand, V.; Zghiche, A.; /Annecy, LAPP; Grauges, E.; /Barcelona, IFAE; Palano, A.; Pappagallo, M.; Pompili, A.; /Bari U. /INFN, Bari; Chen, J.C.; Qi, N.D.; Rong, G.; Wang, P.; Zhu, Y.S.; /Beijing, Inst. High Energy Phys.; Eigen, G.; Ofte, I.; Stugu, B.

    2005-07-06

    The authors present measurements of the flavor-changing neutral current decays B {yields} K{ell}{sup +}{ell}{sup -} and B {yields} K*{ell}{sup +}{ell}{sup -}, where {ell}{sup +}{ell}{sup -} is either an e{sup +}e{sup -} or {mu}{sup +}{mu}{sup -} pair. The data sample comprises 229 x 10{sup 6} {Upsilon}(4S) {yields} B{bar B} decays collected with the BABAR detector at the PEP-II e{sup +}e{sup -} storage ring.

  7. Size of isospin breaking in charged $K_{l4}$ decay

    CERN Document Server

    Nehme, A

    2005-01-01

    We evaluate the size of isospin breaking corrections to form factors f and g of the K/sub l4/ decay process K/sup +/ to pi /sup +/ pi /sup -/l/sup +/vl which is actually measured by the extended NA48 setup at CERN. We found that, keeping apart the effect of Coulomb interaction, isospin breaking does not affect the moduli. This is due to the cancellation between corrections of electromagnetic origin and those generated by the difference between up and down quark masses. On the other hand, electromagnetism affects considerably the phases if the infrared divergence is dropped out using a minimal subtraction scheme. Consequently, the greatest care must be taken in the extraction of pi pi phase shifts from experiment.

  8. Jaan Klõšeiko soovitab: Jaan Tootseni film "Uus maailm"

    Index Scriptorium Estoniae

    2011-01-01

    Režissöör Jaan Tootsen dokumentaalfilmi "Uus Maailm" (produtsent Jaak Kilmi, Kuukulgur Film, 2011) saamisloost ja filmist, mis valiti 25.-30. oktoobrini Tšehhis toimuvale Jihlava rahvusvahelisele dokumentaalfilmide festivalile

  9. Difference-of-Convex optimization for variational kl-corrected inference in dirichlet process mixtures

    DEFF Research Database (Denmark)

    Bonnevie, Rasmus; Schmidt, Mikkel Nørgaard; Mørup, Morten

    2017-01-01

    Variational methods for approximate inference in Bayesian models optimise a lower bound on the marginal likelihood, but the optimization problem often suffers from being nonconvex and high-dimensional. This can be alleviated by working in a collapsed domain where a part of the parameter space...

  10. Klõps ja topeltklõps / Ahto Külvet

    Index Scriptorium Estoniae

    Külvet, Ahto

    2006-01-01

    Fotonäitusest "Click doubleclick - the documentary factor" Müncheni Kunsthalles 08.02-23.04 2006 ja 21.06-27.08 2006 Brüsselis, mis sümboliseerib üleminekuperioodi fotograafias - analoogtehnikalt digitaalsele. Näituse kuraatoriks on Thomas Wesk. Lisatud lühiintervjuud fotograafidega, näitamaks nende suhtumist fakti ja lavastuse vahekorda fotograafias

  11. Herschel CHESS discovery of the fossil cloud that gave birth to the Trapezium and Orion KL

    NARCIS (Netherlands)

    López-Sepulcre, A.; Kama, M.; Ceccarelli, C.; Dominik, C.; Caux, E.; Fuente, A.; Alonso-Albi, T.

    2013-01-01

    Context. The Orion A molecular complex is a nearby (420 pc), very well studied stellar nursery that is believed to contain examples of triggered star formation. Aims. As part of the Herschel guaranteed time key programme CHESS, we present the discovery of a diffuse gas component in the foreground of

  12. DISCOVERY OF AN EXPANDING MOLECULAR BUBBLE IN ORION BN/KL

    International Nuclear Information System (INIS)

    Zapata, Luis A.; Loinard, Laurent; Rodriguez, Luis F.; Schmid-Burgk, Johannes; Ho, Paul T. P.; Patel, Nimesh A.

    2011-01-01

    During their infancy, stars are well known to expel matter violently in the form of well-defined, collimated outflows. A fairly unique exception is found in the Orion Becklin-Neugebauer/Kleinmann-Low star-forming region where a poorly collimated and somewhat disordered outflow composed of numerous elongated 'finger-like' structures was discovered more than 30 years ago. In this Letter, we report the discovery in the same region of an even more atypical outflow phenomenon. Using 13 CO(2-1) line observations made with the Submillimeter Array, we have identified there a 500-1000 year old, expanding, roughly spherically symmetric bubble whose characteristics are entirely different from those of known outflows associated with young stellar objects. The center of the bubble coincides with the initial position of a now defunct massive multiple stellar system suspected to have disintegrated 500 years ago and with the center of symmetry of the system of molecular fingers surrounding the Kleinmann-Low nebula. We hypothesize that the bubble is made up of gas and dust that used to be part of the circumstellar material associated with the decayed multiple system. The Orion hot core, recently proposed to be the result of the impact of a shock wave onto a massive dense core, is located toward the southeast quadrant of the bubble. The supersonic expansion of the bubble and/or the impact of some low-velocity filaments provide a natural explanation for its origin.

  13. K,L X-rays production cross sections for 1H and 4He

    International Nuclear Information System (INIS)

    Heitz, C.; Costa, G.J.; Cailleret, J.; Lagarde, G.

    1982-01-01

    Experimental X-ray production cross sections are tabulated for 1 H and 4 He projectiles. In the case of K X-rays, a comparison with theoretical values is also performed in view of applications, such a PIXE analysis [fr

  14. Reedel avatud Nargen Hallis klõbisesid noad ja kahvlid / Mart Niineste

    Index Scriptorium Estoniae

    Niineste, Mart, 1983-

    2009-01-01

    Balti laevaremonditehase ja Kaljuste Lootsi koja vahelise lepingu tulemusel 7. augustil Tallinnas tsaariaegse sõjasadama territooriumil asuva Noblesseneri tehase valukojas avatud kontserdisaalist Nargen Hall

  15. T-odd correlation in the $K_{l3} \\gamma$ decay

    CERN Document Server

    Braguta, V V; Chalov, A E

    2002-01-01

    The dependence of the K/sup +/ to pi /sup 0/l/sup +/ nu /sub l/ gamma decay rate on the T-odd kinematical variable xi = q . Ýp/sub l/ * p /sub pi /¿/m/sub K//sup 3/ is investigated in the tree and one-loop approximations of the Standard Model (SM). It is shown that the partial width of the decay on the tree level is an even function of the variable, whereas the odd component is generated by the electromagnetic final-state interaction and determined by the imaginary parts of one-loop diagrams. The xi -odd components of the partial widths of the K/sup +/ to pi /sup 0/e/sup +/ nu /sub e/ gamma and K/sup +/ to pi /sup 0/ mu /sup +/ nu /sub mu / gamma decays calculated in the one-loop approximation are smaller by four orders of magnitude than the even components evaluated from the tree-level SM diagrams. (11 refs).

  16. T-odd correlations in radiative K+l3 decays and chiral perturbation theory

    International Nuclear Information System (INIS)

    Mueller, E.H.; Kubis, B.; Meissner, U.G.

    2006-01-01

    The charged kaon decay channel K + l3γ allows for studies of direct CP violation, possibly due to non-standard mechanisms, with the help of T-odd correlation variables. In order to be able to extract a CP-violating signal from experiment, it is necessary to understand all possible standard model phases that also produce T-odd asymmetries. We complement earlier studies by considering strong interaction phases in hadronic structure functions that appear at higher orders in chiral perturbation theory, and we compare our findings to other potential sources of asymmetries. (orig.)

  17. On short-distance CP-violating contributions to the KL,S→γγ processes

    International Nuclear Information System (INIS)

    Eeg, J.O.

    1987-07-01

    New short-distance penguin-induced quark diagrams for K o anti (K o ) → γγ within the standard model are considered. These diagrams leave the total CP-conserving amplitude essentially unchanged. However, the CP-violating amplitude receives a sizeable contribution comparable with the pole contribution, which has so far been considered to be the only contribution including direct CP-violation

  18. Constraints on the Kl3 form factors from analyticity and unitarity

    Indian Academy of Sciences (India)

    2012-10-05

    in. Abstract. The Kπ form factors are investigated at low energies by the method of unitarity bounds adapted so as to include information on the phase and modulus along the elastic region of the unitarity cut. Using as input the ...

  19. Sensitivity of the decay KL → π0νν-bar at Fermilab KAMI experiment

    International Nuclear Information System (INIS)

    Matsumoto, Mitsuhiro

    2002-01-01

    In order to study CP violation in kaon system, KAMI (Kaons At the Main Injector) is being planned at Fermilab. KAMI beam test was performed during Jan. and Feb. of 2000 to measure the kaon flux. Using the kaon energy spectrum and flux measured here, and photon detection inefficiency measured before, we estimated that KAMI can measure the CKM parameter, η, with a 5% accuracy in 1 year with 137 events. (author)

  20. ALMA OBSERVATIONS OF THE OUTFLOW FROM SOURCE I IN THE ORION-KL REGION

    Energy Technology Data Exchange (ETDEWEB)

    Zapata, Luis A.; Rodriguez, Luis F.; Loinard, Laurent [Centro de Radioastronomia y Astrofisica, UNAM, Apdo. Postal 3-72 (Xangari), 58089 Morelia, Michoacan (Mexico); Schmid-Burgk, Johannes; Menten, Karl M. [Max-Planck-Institut fuer Radioastronomie, Auf dem Huegel 69, 53121 Bonn (Germany); Curiel, Salvador [Instituto de Astronomia, Universidad Nacional Autonoma de Mexico, Ap. 70-264, 04510 DF (Mexico)

    2012-07-20

    In this Letter, we present sensitive millimeter SiO (J = 5-4; {nu} = 0) line observations of the outflow arising from the enigmatic object Orion Source I made with the Atacama Large Millimeter/Submillimeter Array (ALMA). The observations reveal that at scales of a few thousand AU, the outflow has a marked 'butterfly' morphology along a northeast-southwest axis. However, contrary to what is found in the SiO and H{sub 2}O maser observations at scales of tens of AU, the blueshifted radial velocities of the moving gas are found to the northwest, while the redshifted velocities are in the southeast. The ALMA observations are complemented with SiO (J = 8-7; {nu} = 0) maps (with a similar spatial resolution) obtained with the Submillimeter Array. These observations also show a similar morphology and velocity structure in this outflow. We discuss some possibilities to explain these differences at small and large scales across the flow.

  1. Dagmar Klímová - autobiografie a kontakty se Slovenskem

    Czech Academy of Sciences Publication Activity Database

    Pospíšilová, Jana

    2011-01-01

    Roč. 18, 1-2 (2011), s. 36-43 ISSN 1335-5074 Institutional research plan: CEZ:AV0Z90580513 Keywords : ethnology * autobiographical material * Czech-Slovak relations Subject RIV: AC - Archeology, Anthropology, Ethnology

  2. Klædt på til at bruge engelsk som undervisningssprog

    DEFF Research Database (Denmark)

    Westbrook, Peter Nils; Knudsen, Sophie J V Swerts

    2013-01-01

    and themselves cope more easily with the challenges of teaching through the medium of English. In 2012, with the funds from DGU , CIP was able to offer the workshops at the Department for Media, Cognition and Communication (IMEF) and the Faculty of Law (JURA). The article deals with the structure and content...... and Gastronomy & Health from Danish to English. This change proved in many cases to be a struggle for students and teaching staff alike, apparently leading to considerable increases in exam failure rates and a decline in the number of students applying for the MSc programmes. These results prompted the IHE...... to consider how to tackle the language problems the students evidently had. They decided to enlist the services of the Centre for Internationalisation and Parallel Language Use (CIP) at the University of Copenhagen to pilot a workshop for students on how to successfully participate in English Medium...

  3. Measurement of the $K_{L} \\to e^{+}e^{-}e^{+} e^{-}$ Decay Rate

    CERN Document Server

    Lai, A; Marras, D; Batley, J Richard; Dosanjh, R S; Gershon, T J; Kalmus, George Ernest; Lazzeroni, C; Munday, D J; Olaiya, E; Parker, M A; White, T O; Wotton, S A; Arcidiacono, R; Barr, G; Bocquet, G; Ceccucci, Augusto; Çuhadar-Dönszelmann, T; Cundy, Donald C; Doble, Niels T; Falaleev, V P; Gatignon, L; Gonidec, A; Gorini, B; Grafström, P; Kubischta, Werner; Lacourt, A; Norton, A; Panzer-Steindel, B; Tatishvili, G T; Wahl, H; Cheshkov, C; Khristov, P Z; Kekelidze, V D; Madigozhin, D T; Molokanova, N A; Potrebenikov, Yu K; Zinchenko, A I; Martin, V; Rubin, P; Sacco, R; Walker, A; Contalbrigo, M; Dalpiaz, Pietro; Duclos, J; Frabetti, P L; Gianoli, A; Martini, M; Petrucci, F; Savrié, M; Bizzeti, A; Calvetti, M; Collazuol, G; Graziani, G; Iacopini, E; Lenti, M; Martelli, F; Veltri, M; Eppard, M; Hirstius, A; Holtz, K; Kleinknecht, K; Koch, U; Köpke, L; Lopes da Silva, P; Marouelli, P; Mestvirishvili, I; Pellmann, I A; Peters, A; Schmidt, S A; Schönharting, V; Schué, Yu; Wanke, R; Winhart, A; Wittgen, M; Chollet, J C; Fayard, Louis; Iconomidou-Fayard, L; Unal, G; Wingerter-Seez, I; Anzivino, Giuseppina; Cenci, P; Imbergamo, E; Lubrano, P; Mestvirishvili, A; Nappi, A; Pepé, M; Piccini, M; Casali, R; Cerri, C; Cirilli, M; Costantini, F; Fantechi, R; Fiorini, Luca; Giudici, Sergio; Mannelli, I; Pierazzini, G M; Sozzi, M; Chèze, J B; De Beer, M; Debu, P; Derue, F; Formica, A; Granier de Cassagnac, R; Gouge, G; Marel, Gérard; Mazzucato, E; Peyaud, B; Turlay, René; Vallage, B; Holder, M; Maier, A; Ziolkowski, M; Biino, C; Cartiglia, N; Marchetto, F; Menichetti, E; Pastrone, N; Nassalski, J P; Rondio, Ewa; Szleper, M; Wislicki, W; Wronka, S; Dibon, Heinz; Jeitler, Manfred; Markytan, Manfred; Mikulec, I; Neuhofer, Günther; Pernicka, Manfred; Taurok, Anton; Widhalm, L; Beavis, D; Besliu, C; Budick, B; Bøggild, H; Chasman, C; Christensen, C H; Christiansen, P; Cibor, J; Debbe, R; Enger, E; Gaardhøje, J J; Germinario, M; Hagel, K; Ito, H; Jipa, A; Jundt, F; Jordre, J I; Jorgensen, C E; Karabowicz, R; Kim, E J; Kozik, T; Larsen, T M; Lee, J H; Lee, Y K; Lindal, S; Lystad, R; Løvhøiden, G; Majka, Z; Makeev, A; Mikelsen, M; Murray, M; Natowitz, J B; Neumann, B; Nielsen, B S; Ouerdane, D; Planeta, R; Rami, F; Ristea, C; Ristea, O; Röhrich, D; Samset, B H; Sandberg, D; Sanders, S J; Scheetz, R A; Staszel, P; Tveter, T S; Videbaek, F; Wada, R; Yin, Z; Zgura, I S

    2005-01-01

    The decay rate of the long-lived neutral K meson into the e^+ e^- e^+ e^- final state has been measured with the NA48 detector at the CERN SPS. Using data collected in 1998 and 1999, a total of 200 events has been observed with negligible background. This observation corresponds to a branching ratio of Br(K_L -> e^+ e^- e^+ e^-) = (3.30 + - 0.24_stat + - 0.23_sys + - 0.10_norm) x 10^-8.

  4. Future prospects of KL -> π0νanti-ν experiment at Fermilab

    International Nuclear Information System (INIS)

    Hsiung, Yee B.

    2000-01-01

    The authors reviewed the current status of a proposed KAMI (Kaon at Main Injector) experiment at Fermilab to measure the direct CP-violating K L (r a rrow) π 0 νanti-ν decay. Good progress and encouraging results have been made in the past two years for measuring the required photon veto inefficiencies for both CsI and lead-scintillator detectors in a test beam at INS-KEK Japan. New beam test with 150 GeV Main Injector protons has also been scheduled in January 2000 at Fermilab using the existing KTeV detector with two new beam calorimeters. Prospects of a feasible KAMI experiment in the future is discussed here

  5. A review of molecular effects in gas-phase KL X-ray emission

    Energy Technology Data Exchange (ETDEWEB)

    Guillemin, Renaud; Carniato, Stéphane; Journel, Loïc [UPMC Univ Paris 06, UMR 7614, Laboratoire de Chimie Physique Matière et Rayonnement, F-75005 Paris (France); CNRS, UMR 7614, Laboratoire de Chimie Physique Matière et Rayonnement, F-75005 Paris (France); Stolte, Wayne C. [Department of Chemistry, University of Nevada, Las Vegas, NV 89154-4003 (United States); Marchenko, Tatiana; Khoury, Lara El; Kawerk, Elie; Piancastelli, Maria Novella [UPMC Univ Paris 06, UMR 7614, Laboratoire de Chimie Physique Matière et Rayonnement, F-75005 Paris (France); CNRS, UMR 7614, Laboratoire de Chimie Physique Matière et Rayonnement, F-75005 Paris (France); Hudson, Amanda C.; Lindle, Dennis W. [Department of Chemistry, University of Nevada, Las Vegas, NV 89154-4003 (United States); Simon, Marc, E-mail: marc.simon@upmc.fr [UPMC Univ Paris 06, UMR 7614, Laboratoire de Chimie Physique Matière et Rayonnement, F-75005 Paris (France); CNRS, UMR 7614, Laboratoire de Chimie Physique Matière et Rayonnement, F-75005 Paris (France)

    2013-06-15

    The unique capabilities of resonant inelastic X-ray scattering (RIXS) to provide a deep insight into molecular dynamics following core excitation are reviewed here. Characteristic features of molecular X-ray emission are experimentally observed and theoretically interpreted. Some of our most significant results on molecular dynamics following deep core excitation are presented. In particular, we provide several examples of nuclear dynamics on the femtosecond or subfemtosecond time scale; line-narrowing effects related to the quenching of vibrational structure due to parallelism of intermediate and final state curves; anomalous line dispersion across a resonance, which is due to core-hole lifetime effects; spin–orbit-state populations derived from polarized RIXS experiments. We also show how to connect the RIXS results to the general chemical properties of the investigated systems.

  6. A review of molecular effects in gas-phase KL X-ray emission

    International Nuclear Information System (INIS)

    Guillemin, Renaud; Carniato, Stéphane; Journel, Loïc; Stolte, Wayne C.; Marchenko, Tatiana; Khoury, Lara El; Kawerk, Elie; Piancastelli, Maria Novella; Hudson, Amanda C.; Lindle, Dennis W.; Simon, Marc

    2013-01-01

    The unique capabilities of resonant inelastic X-ray scattering (RIXS) to provide a deep insight into molecular dynamics following core excitation are reviewed here. Characteristic features of molecular X-ray emission are experimentally observed and theoretically interpreted. Some of our most significant results on molecular dynamics following deep core excitation are presented. In particular, we provide several examples of nuclear dynamics on the femtosecond or subfemtosecond time scale; line-narrowing effects related to the quenching of vibrational structure due to parallelism of intermediate and final state curves; anomalous line dispersion across a resonance, which is due to core-hole lifetime effects; spin–orbit-state populations derived from polarized RIXS experiments. We also show how to connect the RIXS results to the general chemical properties of the investigated systems

  7. Standard model and new physics contributions to KL and KS into four leptons

    International Nuclear Information System (INIS)

    D'Ambrosio, Giancarlo; Greynat, David; Vulvert, Gregory

    2013-01-01

    We study the K L and K S decays into four leptons (e anti ee anti e, μanti μμanti μ, e anti eμanti μ) where we use a form factor motivated by vector meson dominance, and show the dependence of the branching ratios and spectra from the slopes. A precise determination of short-distance contribution to K L → μμ is affected by our ignorance on the sign of the amplitude A(K L → γγ) but we show a possibility to measure the sign of this amplitude by studying K L and K S decays in four leptons. We also investigate the effect of New Physics contributions for these decays. (orig.)

  8. Ny konsumtion av gamla kläder : – En studie om konsumenters miljömedvetenhet och motiv till att köpa second hand kläder på Myrorna

    OpenAIRE

    Björling, Maria

    2014-01-01

    The world’s consumption is increasing at an accelerating rate and it´s produced and consumed more goods and services than ever before. A large part of people's consumption consists of clothing that is bought and discarded increasingly leading to a number of environmental problems such as global warming, pollution, loss of biodiversity and the depletion of natural assets. One way to save the earth's resources is to buy used clothing, so called second hand, instead of new ones. The store chain ...

  9. Effect of Storage Methods and Period on the Physiological and Nutrient Components of Livingstone Potato (Plectranthus esculentus in Abia State, Nigeria

    Directory of Open Access Journals (Sweden)

    Ezeocha Chinelo Vanessa

    2017-02-01

    Full Text Available Livingstone potato production in Nigeria is faced with the challenge of high postharvest losses. The aim of this study was to assess the effect of some storage methods on the physiological and nutritional quality of livingstone potato. Potatoes were separated and stored using eight different methods: potatoes stored in3x3x3 ft pits and covered with sand under the shade (T1, potatoes stored in3x3x3 ft pits and covered with ash under the shade (T2, potatoes stored in3x3x3 ft pits and covered with rice husk under the shade (T3, potatoes stored in3x3x3 ft pits and covered with a wood shavings under the shade (T4, potatoes spread on a bamboo platform under the shade(T5, potatoes spread on a raffia palm platform under the shade(T6, potatoes spread on concrete pavement inside the barn (T7, potatoes spread on the ground under the shade(T8, potatoes buried under the ground (T9. T8 was used as the control treatment. Temperature and relative humidity of the environment was monitored, the roots were weighed monthly to access the weight loss, sprouting and rot were observed visually and proximate composition of the stored roots were evaluated using standard methods. The lowest percentage weight loss was observed in samples stored in a pit covered with wood ash and those covered with river sand. Samples stored in pits and covered with wood shavings, wood ash and river sand had the lowest percentage of sprouting (1.63%, 3.45% and 6.06% respectively. The dry matter content increased with storage period in all the storage methods. The starch yield varied in the different storage methods with the samplescovered with river sand (13.45% and the samples buried underground in the field(10.53% giving the highest starch yield at the end of the storage period. Samples stored under rice husk had the highest ash content (4.77% while the crude fibre and crude protein contents were highest in the samples spread on raffia palm. The results showed that spreading on the floor or on top of pavements are not good storage methods for living stone potato, however, storage in pits with alternate layers of river sand, wood ash and wood shavings are the best storage methods for livingstone potato.

  10. Induction of Defense-Related Physiological and Antioxidant Enzyme Response against Powdery Mildew Disease in Okra (Abelmoschus esculentus L.) Plant by Using Chitosan and Potassium Salts.

    Science.gov (United States)

    Soliman, Mona H; El-Mohamedy, Riad S R

    2017-12-01

    Foliar sprays of three plant resistance inducers, including chitosan (CH), potassium sorbate (PS) (C 6 H 7 kO 2 ), and potassium bicarbonates (PB) (KHCO 3 ), were used for resistance inducing against Erysiphe cichoracearum DC (powdery mildew) infecting okra plants. Experiments under green house and field conditions showed that, the powdery mildew disease severity was significantly reduced with all tested treatments of CH, PS, and PB in comparison with untreated control. CH at 0.5% and 0.75% (w/v) plus PS at 1.0% and 2.0% and/or PB at 2.0% or 3.0% recorded as the most effective treatments. Moreover, the highest values of vegetative studies and yield were observed with such treatments. CH and potassium salts treatments reflected many compounds of defense singles which leading to the activation power defense system in okra plant. The highest records of reduction in powdery mildew were accompanied with increasing in total phenolic, protein content and increased the activity of polyphenol oxidase, peroxidase, chitinase, and β-1,3-glucanase in okra plants. Meanwhile, single treatments of CH, PS, and PB at high concentration (0.75%, 2.0%, and/or 3.0%) caused considerable effects. Therefore, application of CH and potassium salts as natural and chemical inducers by foliar methods can be used to control of powdery mildew disease at early stages of growth and led to a maximum fruit yield in okra plants.

  11. Genetic and morphological diversity of okra (Abelmoschus esculentus [L.] Moench.) genotypes and their possible relationships, with particular reference to Greek landraces

    NARCIS (Netherlands)

    Kyriakopoulou, O.G.; Arens, P.F.P.; Pelgrom, K.T.B.; Karapanos, I.; Bebeli, P.; Passam, H.C.

    2014-01-01

    Despite its high economic value in many countries (especially in developing regions of the tropics and sub-tropics), okra has received little attention with respect to its source of origin and genetic diversity, particularly at the molecular level. Phenotypic description (morphology, pod

  12. USO DO QUIABO (ABELMOSCHUS ESCULENTUS COMO FLOCULANTE NA DESESTABILIZAÇÃO DE EMULSÕES ÓLEO/ÁGUA

    Directory of Open Access Journals (Sweden)

    André Carlos Silva

    2014-07-01

    Full Text Available O presente artigo visa apresentar os resultados da utilização do quiabo (Abelmoschus Esculentos como floculante no processo de desestabilização de emulsões do tipo óleo em água, sendo estas emulsões produzidas industrialmente no setor mineiro-metalúrgico. Vários problemas ambientais podem ser gerados por emulsões óleo em água, uma vez que este tipo de emulsão reduz a oxigenação dos corpos d’água, acarretando, assim, um intenso desequilíbrio ambiental. Utilizando-se quiabos que seriam posteriormente descartados por não apresentarem mais utilidade à alimentação humana buscou-se, além do desenvolvimento da tecnologia com o uso deste reagente. A potencialidade do uso do quiabo como floculante foi confirmada através dos ensaios experimentais realizados.

  13. Efficient genetic transformation of okra (Abelmoschus esculentus (L.) Moench) and generation of insect-resistant transgenic plants expressing the cry1Ac gene.

    Science.gov (United States)

    Narendran, M; Deole, Satish G; Harkude, Satish; Shirale, Dattatray; Nanote, Asaram; Bihani, Pankaj; Parimi, Srinivas; Char, Bharat R; Zehr, Usha B

    2013-08-01

    Agrobacterium -mediated transformation system for okra using embryos was devised and the transgenic Bt plants showed resistance to the target pest, okra shoot, and fruit borer ( Earias vittella ). Okra is an important vegetable crop and progress in genetic improvement via genetic transformation has been impeded by its recalcitrant nature. In this paper, we describe a procedure using embryo explants for Agrobacterium-mediated transformation and tissue culture-based plant regeneration for efficient genetic transformation of okra. Twenty-one transgenic okra lines expressing the Bacillus thuringiensis gene cry1Ac were generated from five transformation experiments. Molecular analysis (PCR and Southern) confirmed the presence of the transgene and double-antibody sandwich ELISA analysis revealed Cry1Ac protein expression in the transgenic plants. All 21 transgenic plants were phenotypically normal and fertile. T1 generation plants from these lines were used in segregation analysis of the transgene. Ten transgenic lines were selected randomly for Southern hybridization and the results confirmed the presence of transgene integration into the genome. Normal Mendelian inheritance (3:1) of cry1Ac gene was observed in 12 lines out of the 21 T0 lines. We selected 11 transgenic lines segregating in a 3:1 ratio for the presence of one transgene for insect bioassays using larvae of fruit and shoot borer (Earias vittella). Fruit from seven transgenic lines caused 100 % larval mortality. We demonstrate an efficient transformation system for okra which will accelerate the development of transgenic okra with novel agronomically useful traits.

  14. EFFECT OF THE ADDITION OF DEFATTED OKRA SEED (Abelmoschus esculentus FLOUR ON THE CHEMICAL COMPOSITION, FUNCTIONAL PROPERTIES AND Zn BIOAVAILABILITY OF PLANTAIN (Musa paradisiacal Linn FLOUR

    Directory of Open Access Journals (Sweden)

    Tesleem Ibrahim

    2012-08-01

    Full Text Available In Nigeria it is advised that nursing mothers should give their baby plantain flour paste “amala ogede” with ‘ewedu’ Corchorus olitorius soup during the process of weaning their baby. The over matured okra that cannot be cut with kitchen knife are thrown away in Nigeria, this lead to postharvest loss of okra. The seed in this okra could be utilised by processing into okra seed flour for the fortification of plantain flour. Since the okra seed flour is rich in oil and the oil contains cyclopropenoid fatty acids which cause some toxicity concerns therefore this work is to evaluate the chemical composition, the functional properties and Zn bioavailability of plantain flour mixed with defatted okra seed flour. The nutrient content increased significantly (P≤0.05, protein; 3.88 – 11.38 %, fibre; 3.03 – 16.30 % and ash; 2.72 – 5.77 % while the fat and carbohydrate content reduced significantly (P≤0.05 as the percentage of defatted okra seed flour increased. The bulk density of the plantain flour decreased significantly (P≤0.05 from 0.795 g/cm3 to 0.769 g/cm3 as the percentage of okra seed flour increased while the least gelation concentration increased significantly (P≤0.05 (10 to 20. The calculated [Ca][Phytate]/[Zn] molar ratio for the plantain flour mixed with defatted okra seed flour (0.02 – 0.04 mol/kg were below the critical level. The increase in the least gelation concentration coupled with increase in the protein content of the resultant flour from the blend means more of the protein will be available in the food made from the plantain flour mixed with defatted okra seed flour.

  15. Study of Okra Powder (Abelmoscus Esculentus Effects on Histology of Liver Tissue and Sero-Biochemical Parameters in Diabetic Rats (HFD/STZ

    Directory of Open Access Journals (Sweden)

    N erfani majd

    2016-12-01

    Full Text Available Introduction: Type 2 diabete is a kind of metabolic disease that it is associated with hyperglycemia, hyperlipidemia and disturbed liver function.  The aim of the present study was to evaluate the protective effects of Okra Powder on liver damage in high fat diet fed / streptozotocin (HFD-STZ-induced type 2 diabetic rats. Methods: In this experimental study, 25 Wistar Albino female rats with an average weight of (200–220 g were randomly divided  into 5 groups: Group I: (control group rats were fed the standard diet, Group II: healthy rats that received Okra Powder (200 mg/kg for 4 weeks; Group III (HFD/STZ group: Rats were fed with high-fat diet (HFD (60% fat for 4 weeks  and then injected low dose of STZ (35 mg/kg, Group IV:  Diabetic rats that received Okra Powder (200 mg/kg for 4 weeks. GroupV: Diabetic rats that received metformin (200 mg/kg for 4 weeks. At the end of experiment, biochemical parameters were measured. Liver samples were removed and 5-6 µ sections were made and stained by H&E and Sudan black staining. Results: The results showed that all the biochemical parameters, except HDL-C and serum insulin were increased in diabetic rats, while they were decreased in Okra supplementation group compared  to diabetic rats (p<0.05. The liver structure alterations were improved in treated diabetic rats with Okra Powder and metformin.  Conclusion: Our findings confirmed the potential anti-hyperglycemic and hypolipidemic effects of Okra Powder. Thus, it seems it has an important role in the management of type 2 diabete.

  16. Muon polarization in η, KL → μ anti-μ decays and electric dipole moments of electron and muon

    International Nuclear Information System (INIS)

    Geng, C.Q.; Ng, J.N.

    1990-08-01

    We review the CP-violating longitudinal polarization asymmetry P L of the outgoing muon in η → μ anti-μ and K L → μ anti-μ decays and the electric dipole moments of electron and muon (d l , l=e, μ) in various extensions of the standard CP violation model. We discuss the possibility of having large d l and P L in the decays. (Author) (48 refs.3 tabs., 5 figs.)

  17. Measurement of the branching ratio of the decay $K_{L} \\to \\pi^{pm}e^{mp}\

    CERN Document Server

    Lai, A; Arcidiacono, R; Barr, G; Becker, H G; Bevan, A; Biino, C; Bizzeti, A; Bocquet, G; Calvetti, Mario; Cartiglia, N; Casali, R; Ceccucci, A; Cenci, P; Cerri, C; Cheshkov, C; Chèze, J B; Chollet, J C; Cirilli, M; Cogan, J; Collazuol, G; Contalbrigo, M; Costantini, F; Çuhadar-Dönszelmann, T; Cundy, Donald C; D'Agostini, G; Dalpiaz, P; De Beer, M; Debu, P; Dibon, Heinz; Doble, Niels T; Dosanjh, R S; Duclos, J; Eppard, K; Eppard, M; Falaleev, V; Fantechi, R; Fayard, L; Fiorini, L; Fischer, G; Formica, A; Fox, H; Frabetti, P L; Gaponenko, A N; Gatignon, L; Gershon, T J; Gianoli, A; Giudici, Sergio; Gonidec, A; Gorini, B; Govi, G; Grafström, P; Graziani, G; Guida, R; Hay, B; Holder, M; Khristov, P Z; Iacopini, E; Iconomidou-Fayard, L; Imbergamo, E; Jeitler, Manfred; Kalmus, George Ernest; Kalter, A; Kekelidze, V D; Kleinknecht, K; Knowles, I; Koch, U; Köpke, L; Kubischta, Werner; Lacourt, A; Lamanna, G; Lazzeroni, C; Lenti, M; Litov, L; Lubrano, P; Madigozhin, D T; Maier, A; Mannelli, I; Marchetto, F; Markytan, Manfred; Marouelli, P; Marras, D; Martelli, F; Martin, V; Martini, M; Mazzucato, E; Menichetti, E; Mestvirishvili, A; Mikulec, I; Molokanova, N A; Munday, D J; Nappi, A; Nassalski, J P; Neuhofer, G; Norton, A; Ocariz, J; Olaiya, E; Palestini, S; Panzer-Steindel, B; Parker, M A; Pastrone, N; Pellmann, I; Pepé, M; Pernicka, M; Peters, A; Petrucci, F; Peyaud, B; Piccini, M; Pierazzini, G M; Potrebenikov, Yu K; Renk, B; Rondio, Ewa; Sacco, R; Savrié, M; Schmidt, S A; Schönharting, V; Schué, Yu; Sozzi, M; Stoynev, S; Szleper, M; Tatishvili, G T; Taureg, H; Taurok, A; Tkatchev, A; Turlay, René; Unal, G; Vallage, B; Velasco, M; Veltri, M; Wahl, H; Walker, A; Wanke, R; White, T O; Widhalm, L; Wingerter-Seez, I; Winhart, A; Wislicki, W; Wittgen, M; Wotton, S A; Wronka, S; Zinchenko, A I; Ziolkowski, M; Da Silva, P L; De Cassagnac, R G

    2004-01-01

    We present a new measurement of the branching ratio of the decay K /sub L/ to pi /sup +or-/e/sup -or+/ nu , denoted as K/sub e3/ relative to all charged K/sub L/ decays with two tracks, based on data taken with the NA48 detector at the CERN SPS. We measure R=0.4978 +or- 0.0035. From this we derive the K/sub e3/ branching fraction and the weak coupling parameter ¿V/sub us/¿ in the CKM matrix. We obtain |V/sub us/| f/sub +/(0)=0.2146 +or- 0.0016, where f /sub +/(0) is the vector form factor in the K/sub e3/ decay.

  18. CP violation in η, KL → μantiμ- decays and electric dipole moments of electron and muon

    International Nuclear Information System (INIS)

    Geng, C.Q.; Ng, J.N.

    1990-03-01

    The CP-violating longitudinal polarization asymmetry P L of the outgoing muon in η → μ μ - decays and the electric dipole moments of electron and muon (d l , l = e,μ) are studied in various extensions of the standard CP violation model. The possibility of having large P L in both decays and d l is explored

  19. Continuum limit of the leading order HQET form factor in B{sub s}→Klν decays

    Energy Technology Data Exchange (ETDEWEB)

    Bahr, Felix; Banerjee, Debasish; Koren, Mateusz; Simma, Hubert; Sommer, Rainer [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany). John von Neumann-Inst. fuer Computing NIC; Bernardoni, Fabio [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany). John von Neumann-Inst. fuer Computing NIC; Technische Univ. Dresden (Germany). Medizinische Fakultaet ' ' Carl Gustav Carus' ' ; Joseph, Anosh [Cambridge Univ. (United Kingdom). Dept. of Applied Mathematics and Theoretical Physics (DAMTP); Collaboration: ALPHA Collaboration

    2016-01-15

    We discuss the computation of form factors for semi-leptonic decays of B-, B{sub s}- mesons in lattice QCD. Considering in particular the example of the static B{sub s} form factors we demonstrate that after non-perturbative renormalization the continuum limit can be taken with confidence. The resulting precision is of interest for extractions of V{sub ub}. The size of the corrections of order 1/m{sub b} is just estimated at present but it is expected that their inclusion does not pose significant difficulties.

  20. Spiritualita jako klíč k osobnosti a lidským vztahům

    Czech Academy of Sciences Publication Activity Database

    Říčan, Pavel

    2006-01-01

    Roč. 50, č. 2 (2006), s. 119-137 ISSN 0009-062X R&D Projects: GA ČR GA406/05/0940 Institutional research plan: CEZ:AV0Z70250504 Keywords : spiritualiy * personality * human relationships Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006

  1. Prospects for measuring K+ -> π+ ν νbar and KL0 -> π0 ν νbar at BNL

    International Nuclear Information System (INIS)

    Bryman, D.A.; Littenberg, L.

    2000-01-01

    Rare kaon decay experiments underway or planned for the BNL AGS will yield new and independent determinations of V* ts V td . A measurement of B(K L 0 r a rrow π 0 νbar ν) allows a determination of the imaginary part of this quantity, which is the fundamental CP-violating parameter of the Standard Model, in a uniquely clean manner. Since the measurement of B(K + r a rrow π + νbar ν) determines vert b arV* ts V td , a complete derivation of the unitarity triangle is facilitated. These results can be compared to high precision data expected to come from the B sector in a number of ways, allowing for unique tests of new physics

  2. “Clas-si-fied (/ˈklæsɪfaɪd/)” - What’s that?

    CERN Multimedia

    Computer Security Team

    2012-01-01

    Have you ever thought about what information at CERN should or must be classified as confidential? Or public? What does “confidential” mean anyway? European law, for example, requires proper protection of your medical files. At CERN, for security reasons your passwords are yours and only yours (remember: “Your password is your toothbrush”). And it is in your own interest that your credit card details are kept confidential, too. But what about your office location, your CERN phone number, or your official photo for your CERN card?   CERN is now working on a coherent policy for classifying data, with the upcoming Data Protection Policy (DPP) currently under development by the CERN Legal Service, the GS, HR and IT Departments, and the Computer Security Team. The essential first step for such a DPP is a clear definition of which data must be kept confidential and which data can be treated as public. The draft Data Classification Policy (DCP) proposes four l...

  3. Privilegium Arnošta z Pardubic z roku 1357 pro klášter Panny Marie v Kladsku

    Czech Academy of Sciences Publication Activity Database

    Krafl, Pavel

    2017-01-01

    Roč. 23, č. 3 (2017), s. 29-33 ISSN 1211-1635 R&D Projects: GA ČR(CZ) GA17-16153S Institutional support: RVO:67985963 Keywords : Canons Regular of St. Augustine * canonry * Bohemia * Kłodzko * document * Middle Ages * jurisdiction * provost * prior Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  4. Thermische Klärschlammbehandlung in der Tschechischen Republik und experimentelle Bestimmung der Emissionen aus der Verbrennung

    Czech Academy of Sciences Publication Activity Database

    Elsasser, T.; Pohořelý, Michael; Jecha, D.; Punčochář, Miroslav; Stehlík, P.

    2013-01-01

    Roč. 85, č. 12 (2013), s. 1-7 ISSN 0009-286X R&D Projects: GA MŠk 2B08048 Institutional support: RVO:67985858 Keywords : limestone * sewage plant * sludge incineration Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 0.661, year: 2013

  5. Gaussian Processes and Polynomial Chaos Expansion for Regression Problem: Linkage via the RKHS and Comparison via the KL Divergence

    Directory of Open Access Journals (Sweden)

    Liang Yan

    2018-03-01

    Full Text Available In this paper, we examine two widely-used approaches, the polynomial chaos expansion (PCE and Gaussian process (GP regression, for the development of surrogate models. The theoretical differences between the PCE and GP approximations are discussed. A state-of-the-art PCE approach is constructed based on high precision quadrature points; however, the need for truncation may result in potential precision loss; the GP approach performs well on small datasets and allows a fine and precise trade-off between fitting the data and smoothing, but its overall performance depends largely on the training dataset. The reproducing kernel Hilbert space (RKHS and Mercer’s theorem are introduced to form a linkage between the two methods. The theorem has proven that the two surrogates can be embedded in two isomorphic RKHS, by which we propose a novel method named Gaussian process on polynomial chaos basis (GPCB that incorporates the PCE and GP. A theoretical comparison is made between the PCE and GPCB with the help of the Kullback–Leibler divergence. We present that the GPCB is as stable and accurate as the PCE method. Furthermore, the GPCB is a one-step Bayesian method that chooses the best subset of RKHS in which the true function should lie, while the PCE method requires an adaptive procedure. Simulations of 1D and 2D benchmark functions show that GPCB outperforms both the PCE and classical GP methods. In order to solve high dimensional problems, a random sample scheme with a constructive design (i.e., tensor product of quadrature points is proposed to generate a valid training dataset for the GPCB method. This approach utilizes the nature of the high numerical accuracy underlying the quadrature points while ensuring the computational feasibility. Finally, the experimental results show that our sample strategy has a higher accuracy than classical experimental designs; meanwhile, it is suitable for solving high dimensional problems.

  6. Půdní geoarchivy jako klíč k poznání historie krajiny

    Czech Academy of Sciences Publication Activity Database

    Vysloužilová, Barbora

    2015-01-01

    Roč. 25, č. 2 (2015), s. 26-27 ISSN 1210-3004 Institutional support: RVO:67985912 Keywords : soil archives * pedoanthracology * fossil soils * loess * soil organic matter Subject RIV: AC - Archeology, Anthropology, Ethnology

  7. OLAIFA A. Kl, ONWUKA S.K2*, ARIYIBI A3 AND CRAIG 0. 0.1

    African Journals Online (AJOL)

    Femi Olaleye

    small animal interference even though it has become less fashionable in countries that have facilities for inhalation anaesthesia (Hall and Clarke, 1983). It is marketed in this country as a sterile 6.5%. (W /V) solution containing propylene glycol and as a powder in gelatine capsules. For euthanasia it is sold as 20% (W /V).

  8. Slav ve Türk Dillerinin Karşılıklı Etkileşimi

    OpenAIRE

    AĞABABA, Naile

    2015-01-01

    I want to continue working series on the interaction Slavic and Turkish languages after finishing my studies at the subject of Turkish loanwords in the Persian language. Turkish peoples in Eastern Europe has left many traces in people’s culture and language is evident. İnvestigate these trasec have fish in our country will have an impact on scientific thinking. For the investigate of the history, culture and ancient literature of the peoples of Eastern Europe and Western Asia is of great impo...

  9. KlHEM13, un gen hipóxico en la biosíntesis de hemo

    OpenAIRE

    Blanco, Moisés

    2011-01-01

    [Resumen] El hemo es una molécula de interés desde el punto de vista del metabolismo energético, puesto que además de intervenir en la captura y el transporte del oxígeno (indispensable para el proceso de obtención de energía vía respiración) tambien forma parte como elemento funcional de las proteinas de la cadena de transporte electrónico y fosforilación oxidativa mitocondrial. Además, en el caso de las levaduras, actúa como un sensor de oxígeno a escala celular e interviene en la r...

  10. Ranakinestatin-PPF from the Skin Secretion of the Fukien Gold-Striped Pond Frog, Pelophylax plancyi fukienensis: A Prototype of a Novel Class of Bradykinin B2 Receptor Antagonist Peptide from Ranid Frogs

    OpenAIRE

    Ma, Jie; Luo, Yu; Ge, Lilin; Wang, Lei; Zhou, Mei; Zhang, Yingqi; Duan, Jinao; Chen, Tianbao; Shaw, Chris

    2014-01-01

    The defensive skin secretions of many amphibians are a rich source of bradykinins and bradykinin-related peptides (BRPs). Members of this peptide group are also common components of reptile and arthropod venoms due to their multiple biological functions that include induction of pain, effects on many smooth muscle types, and lowering systemic blood pressure. While most BRPs are bradykinin receptor agonists, some have curiously been found to be exquisite antagonists, such as the maximakinin ge...

  11. Effect of cooking methods on the micronutrient profile of selected ...

    African Journals Online (AJOL)

    Effect of cooking methods on the micronutrient profile of selected vegetables: okra fruit ( Abelmoshcus esculentus ), fluted pumpkin ( Telfairia occidentalis ), African spinach ( Amarantus viridis ), and scent leaf ( Ocumum gratissimum.

  12. Faktory určující klíčení vzácných druhů

    OpenAIRE

    Paulů, Andrea

    2014-01-01

    This bachelor's thesis is a literature review about the ecological factors determining germination of rare species of vascular plants. The main aim was to describe the factors affecting germination and methodologies. This study also outlines projects of seed banks, germination ecology and the importance of studying germination. This factors affecting germination will be applied in future on the data germination of rare species which we were given the Krkonoše National Park.

  13. Klíčové ukazatele výkonnosti (KPI) a jejich vazba na vrcholový ukazatel EVA

    OpenAIRE

    Hanzlík, Kamil

    2008-01-01

    This thesis is concerned with a discussion of advantages, disadvantages and potencial areas of usage of the Economic Value Added (EVA) as a measure of value based management. The coherency of EVA with key performance indicators as a tool of effective management is also analysed. Mentioned are also several alternative concepts. This thesis further analyses practical application of key performance indicators in mobile telecommunication company T-Mobile and evaluates the implemented concept of E...

  14. Klíčové dílo jako parergon aneb T. B. Janovka nechtěl zůstat jen autorem 'Clavis'

    Czech Academy of Sciences Publication Activity Database

    Matl, Jiří

    2004-01-01

    Roč. 127, 3-4 (2004), s. 308-324 ISSN 0024-4457 R&D Projects: GA AV ČR IAE9062102 Institutional research plan: CEZ:AV0Z9009908 Keywords : baroque * music theory * lexicography Subject RIV: AL - Art, Architecture, Cultural Heritage

  15. Hudební události pražského kláštera alžbětinek v roce 1776

    Czech Academy of Sciences Publication Activity Database

    Michl, Jakub

    2016-01-01

    Roč. 8, 1-2 (2016), s. 130-148 ISSN 1803-7828 Institutional support: RVO:68378076 Keywords : Sisters of Saint Elizabeth * cantatas * oratorios * Rochus Elinger SJ * Emilián Rickert OCist. * Marie Deodata a Presentatione B. V. Mariae OSE (Anna Justina von Klausniz) * Marie Juliana a Septem SS. Patribus OSE * Prague * music in convents Subject RIV: AL - Art, Architecture, Cultural Heritage

  16. $K^{0} \\leftrightharpoons \\overline{K}^0$ transitions monitored by strong interactions a new determination of the $K_{L} - K_{S}$ mass difference

    CERN Document Server

    Angelopoulos, Angelos; Backenstoss, Gerhard; Bargassa, P; Behnke, O; Benelli, A; Bertin, V; Blanc, F; Bloch, P; Carlson, P J; Carroll, M; Cawley, E; Chertok, M B; Danielsson, M; Dejardin, M; Derré, J; Ealet, A; Eleftheriadis, C; Fetscher, W; Fidecaro, Maria; Filipcic, A; Francis, D; Fry, J; Gabathuler, Erwin; Gamet, R; Gerber, H J; Go, A; Haselden, A; Haymen, P J; Henry-Coüannier, F; Hollander, R W; Jon-And, K; Kettle, P R; Kokkas, P; Kreuger, R; Le Gac, R; Leimgruber, F; Mandic, I; Manthos, N; Marel, Gérard; Mikuz, M; Miller, J; Montanet, François; Müller, A; Nakada, Tatsuya; Pagels, B; Papadopoulos, I M; Pavlopoulos, P; Polivka, G; Rickenbach, R; Roberts, B L; Ruf, T; Sakelliou, L; Schäfer, M; Schaller, L A; Schietinger, T; Schopper, A; Tauscher, Ludwig; Thibault, C; Touchard, F; Touramanis, C; van Eijk, C W E; Vlachos, S; Weber, P; Wigger, O; Wolter, M; Zavrtanik, D; Zimmerman, D

    2001-01-01

    The CPLEAR set-up (modified) has been used to determine the K/sub L/- K/sub S/ mass difference by a method where neutral-kaon strangeness oscillations are monitored through kaon strong interactions, rather than semileptonic decays, thus requiring no assumptions on CPT invariance for the decay amplitudes. The result, Delta m= (0.5343+or-0.0063/sub stat/+or-0.0025/sub syst/)*10/sup 10/ h(cross) /s, provides a valuable input for CPT tests. (22 refs).

  17. Klíčové faktory určující chemickou diverzitu aluviálních vod

    Czech Academy of Sciences Publication Activity Database

    Pithart, David; Pechar, Libor

    3,21, 2-3 (2004), s. 269-273 ISSN 1212-0731. [Agroregion 2004. České Budějovice, 06.09.2004-07.09.2004] R&D Projects: GA MŽP SM/640/18/03; GA ČR GA206/01/1113 Institutional research plan: CEZ:AV0Z6087904 Keywords : riparian zone * alluvial pools * water chemistry Subject RIV: DA - Hydrology ; Limnology

  18. Borrelia burgdorferi s.l. v klíšťatech na ostravských haldách

    Czech Academy of Sciences Publication Activity Database

    Jarošová, V.; Rudolf, Ivo; Halouzka, Jiří; Hubálek, Zdeněk

    2009-01-01

    Roč. 58, č. 2 (2009), s. 90-97 ISSN 1210-7913 R&D Projects: GA AV ČR KJB600930613 EU Projects: European Commission(XE) 10284 - EDEN Institutional research plan: CEZ:AV0Z60930519 Keywords : Ixodes ricinus * slag heaps * Lyme borreliosis * transmission risk Subject RIV: EE - Microbiology, Virology

  19. Archeologický výzkum minoritského kláštera ve Stříbře

    Czech Academy of Sciences Publication Activity Database

    Břicháček, Pavel

    -, č. 13 (2017), s. 50-79 ISSN 1804-2953 R&D Projects: GA ČR(CZ) GA16-06083S Institutional support: RVO:67985955 Keywords : Medieval archaeology * Middle Ages * Monastery * Christian Archaeology Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  20. The ρππ form factor in the decays ω, φ → 3π and η,KL → π+ π- γ

    International Nuclear Information System (INIS)

    Volkov, M.K.; Osipov, A.A.

    1992-01-01

    The processes ω → 3π, φ → 3π, η → π + π - γ, and K L → π + π - γ have been studied for a long time and from various points of view both in theoretical and in experimental elementary-particle physics. However, appreciable changes have occurred recently in the experimental data on the decays ω → 3π and η → π + π - . The width of the first decay has decreased by 20%, and that of the second has increased by 40%. In this work, taking account of the new data, the authors give a self-consistent description of these processes within the framework of the quark model of superconducting type (QMST) proposed by them. This model is a variety of the well-known Nambu-Jona-Lasinio quark model. They shall take into account all the main effects which have an appreciable influence on the final results. The important role played by the nondiagonal π-α 1 transitions on external lines of quark box diagrams and by the form factor of the ρππ vertex in pole diagrams is shown

  1. The effectiveness of cognitive behavioral therapy on the quality of life of patients with inflammatory bowel disease: multi-center design and study protocol (KL!C- study

    Directory of Open Access Journals (Sweden)

    Evertsz’ Floor Bennebroek

    2012-12-01

    Full Text Available Abstract Background Inflammatory Bowel Disease (IBD patients report poorer quality of life (QoL and more anxiety and depressive symptoms than controls from the general population. Cognitive behavioral therapy (CBT is effective for anxiety and depression, but questionable in case of co-morbidity with IBD. Therefore, an adapted new CBT specifically designed for IBD patients was developed. The objective of this study is to evaluate the effectiveness of adapted CBT on QoL. Methods/design IBD patients with a poor level of mental QoL (score less than or equal to 23 on the mental health scale of SF-36 will be randomly assigned to the experimental (n = 40 or waiting-list control condition (n = 40. The experimental condition will then immediately start CBT. The waiting-list control condition will wait 3,5 months before CBT begins with pre- and post assessments. Both conditions will complete a baseline and follow-up assessment following CBT and a mid-treatment assessment. The primary outcome is IBD-specific QoL (IBDQ. Secondary outcomes are generic QoL (SF-36 and anxiety and depression complaints (HADS, CES-D. Additionally, we will examine the working mechanism of the psychological intervention by investigating the impact of the intervention on illness-related cognitions, attitudes, coping styles and their associations with outcome. Data will be analysed on an intention to treat (ITT as well as treatment completer basis (greater than or equal to five sessions followed. Discussion If found effective, this IBD-specific CBT is a first step to enhance poor QoL in IBD patients and possibly, other gastroenterological diseases. By enhancing IBD patients’ QoL, we may also improve their mental and physical health, and lower unnecessary health care consumption. Trial registration number NTR (TC = 1869

  2. Kırsal Belediyelerde Optimal Büyüklüğü Belirlemeye Yönelik Bir Model Denemesi: Trabzon Örneği

    OpenAIRE

    Topal, A. Kadir

    2018-01-01

    Yerel yönetimlerin yeniden yapılandırılmasına ilişkin literatürde, Türk belediyecilik sisteminin küçük ölçekli belediyelerden oluştuğu ve bu durumun başta ekonomik etkinsizlikler olmak üzere önemli sorunlar yarattığı vurgulanmıştır.Sorunun çözümüne yönelik öneriler ise belediye kurulmasında temel alınan nüfus ölçeğinin 5000’e yükseltilmesi gerektiği üzerine odaklanmıştır. Nitekim, bu görüş ve öneriler uygulamada da yankı bulmuş ve 2005 yılında çıkarılan yeni Belediye Kanunu ile belediye kurul...

  3. Klíčové aspekty pojímání konkurence ve strategickém řízení konkurenceschopnosti firmy

    Directory of Open Access Journals (Sweden)

    Robert Zich

    2013-11-01

    Full Text Available Problem of definition of competition is crucial from the strategic management view of company competitiveness. Definition of term competition is not question of looking for the only correct explanation. It is about finding of common topics interconnected with strategic management of competitiveness. Economic, managerial and legal delimitations are just starting points for next discussion.

  4. Dominikánský klášter sv. Klimenta v Praze na Starém Městě

    Czech Academy of Sciences Publication Activity Database

    Havrda, Jan; Kovář, Miroslav; Žďárská, A.

    2017-01-01

    Roč. 33, č. 2 (2017), s. 2-71 ISSN 0231-6056 R&D Projects: GA ČR(CZ) GA16-06083S Institutional support: RVO:67985955 Keywords : mendicants * Dominican monastery * Prague * archaeological excavation * building history survey * Romanesque architecture * Gothic architecture Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  5. Konserthuset Göteborg - 21. oktober 1995 kl. 15.00 Stora Salen. I avslutning till Estival 95 Estniska Kulturdagar i Göteborg : [kontserdi kava

    Index Scriptorium Estoniae

    1995-01-01

    Erkki-Sven Tüür: Insula deserta für strakorkester W. A. Mozart: vesperae solennes de confessore K 339; Eduard Tubin: Piano concertino; L. v. Beethoven: Fantasi c-moll för piano, kör och orkester, op. 80. Göteborger Symphoniker, dirigent Neeme Järvi. Solister: Vardo Rumessen, piano; Kaia Urb, sopran; Riina Airenne, mezzosopran; Mati Kõrts, tenor; Uku Joller, bas. Estniska Gosskören, Venno Laul. Esinejate lühitutvustus

  6. Sağlıklı erişkin bir popülasyonda denge ve düşme riskinin değerlendirilmesi

    OpenAIRE

    Analan, Pınar; Yılmaz, Emine; Leblebici, Berrin

    2016-01-01

    Purpose: In this retrospective study, it was aimed to evaluate the risk of fall and balance, and to determine whether there is a correlation between the risk of fall and vestibular evoked myogenic potentials, which are the evaluating the vestibular system, in the healthy adults who are working in a factory. Material and Methods: The data of 69 male participants have been reached. Bilateral Vestibular Evoked Myogenic Potentials data and Berg Balance Scale of the participants have been reco...

  7. About absence of oscillations at CP violation and presence of interference between KS-, KL-meson states in the system of K0 mesons

    International Nuclear Information System (INIS)

    Beshtoev, Kh.M.

    2014-01-01

    Two approaches to the description of K 0 -, K 0 -bar-meson transitions into K 1 0 mesons at CP violation in weak interactions are considered. The first approach uses the standard theory of oscillations and the second approach supposes that (K S , K L ) states which arise at CP violation are normalized but not orthogonal state functions, then there arise interferences between these states but not oscillations. It is necessary to remark that the available experimental data are in good agreement with the second approach. So, we come to the conclusion that oscillations do not arise at CP violation in weak interactions in the system of K 0 mesons. Only interference between K S and K L states takes place here.

  8. Klíčení semen javoru jasanolistého (Acer negundo) a postup jeho invaze v ČR

    Czech Academy of Sciences Publication Activity Database

    Hrázský, Z.; Mihulka, Stanislav

    2008-01-01

    Roč. 43, Mater. 23 (2008), s. 151-162 ISSN 1212-3323. [Rostlinné invaze v ČR: situace, výzkum a management. Praha, 30.11.2007-01.12.2007] Institutional research plan: CEZ:AV0Z60050516 Keywords : Acer negundo * invasion * mapping of distributiion Subject RIV: EF - Botanics

  9. Budke, Alexandra; Kanwischer, Detlef; Pott, Andreas (Hg.), Internetgeographien : Beobachtungen zum Verhältnis von Internet, Raum und Gesellschaft / [rezensiert von] Helmut Klüter

    OpenAIRE

    Klüter, Helmut

    2009-01-01

    Rezensiertes Werk: Internetgeographien : Beobachtungen zum Verhältnis von Internet, Raum und Gesellschaft / hrsg. von Alexandra Budke ... - Stuttgart : Steiner, 2004. - 192 S. : Ill., graph. Darst., Kt. - (Erdkundliches Wissen ; 136) ISBN 3-515-08506-8

  10. Keim, Karl-Dieter, Das Fenster zum Raum : Traktat über die Erforschung sozialräumlicher Transformation / [rezensiert von] Helmut Klüter

    OpenAIRE

    Klüter, Helmut

    2009-01-01

    Rezensiertes Werk: Keim, Karl-Dieter: Das Fenster zum Raum : Traktat über die Erforschung sozialräumlicher Transformation / Karl-Dieter Keim. - Opladen : Leske + Budrich, 2003. - 171 S. : graph. Darst. - (Lehrtexte : Sozialwissenschaften) ISBN 3-8100-4050-9

  11. Hans-Heinrich Nolte (Hg.), Klaas Bähre (Red.), Innere Peripherien in Ost und West / [rezensiert von] Helmut Klüter

    OpenAIRE

    Klüter, Helmut

    2008-01-01

    Rezensiertes Werk: Innere Peripherien in Ost und West / Hrsg.: Hans-Heinrich Nolte. Red.: Klaas Bähre. - Stuttgart : Steiner, 2001. - 187 S. : Kt. - (Historische Mitteilungen : Beiheft ; 42) ISBN 3-515-07972-6

  12. Taphonomy of the vertebrate bone beds from the Klūnas fossil site, Upper Devonian Tērvete Formation of Latvia

    Directory of Open Access Journals (Sweden)

    Jeļena Vasiļkova

    2012-05-01

    Full Text Available Combined sedimentological and taphonomical study of the siliciclastic sequence of the Tērvete Formation in the stratotypical area was aimed at revealing the formation of the three oryctocoenoses discovered and related structural and textural features of the deposits, as well as at detailed observation of the taphonomical peculiarities of the obtained palaeontological material. The fossil vertebrate assemblage is represented by 14 taxa comprising placoderms, acanthodians, sarcopterygians and actinopterygians. The three oryctocoenoses, first recognized in 2010, differ in the proportions of repeatedly buried material, in the number and degree of preservation of small and fragile skeletal elements, as well as in the evaluated current velocity and the transportation distance. Sedimentary concentrations of marine vertebrate remains, dominated by the antiarchs Bothriolepis ornata and B. jani, have been formed under the influence of fluvial and tidal processes in the shallow-water environment, deltaic or estuarine settings. Elongated placoderm and sarcopterygian bones are probably better indicators of the palaeoflow direction than acanthodian spines or sarcopterygian teeth.

  13. Measurement of decay time of K→π0π0 and tagging the KL and KS in the NA48 experiment at CERN

    International Nuclear Information System (INIS)

    Crepe, Sabine

    1998-05-01

    The NA48 experiment aims to measure, in the neutral kaon system and with a precision of 0.0002, the real part of the ratio between the amplitudes of the direct and indirect breaking of the CP symmetry. To reach the requested precision NA48 has to minimize systematic uncertainties and thus has chosen to detect simultaneously and in the same fiducial region the long and short-lived (K L and K S ) decays into two charged or neutral pions. Consequently, kaon tagging is necessary. It is done using the time coincidences between these decays and the protons at the origin of the K S beam. As mis-tagging leads to large bias for the NA48 measurement, it has to be carefully evaluated and understood. It could be due either to detectors inefficiencies or to random coincidences between K L and protons. The detector used for the tagging of the neutral modes is the liquid krypton calorimeter. Its time performances, studied with 1996 and 1997 data, appear to be very good: for two neutral pion decays its resolution is 250 ps and its inefficiency smaller than 0.0001. Moreover, the amount of random coincidences between protons and K L is directly related to the instantaneous rate of the proton beam. The time structures of this beam have been studied, Several frequencies have been found and the effective spill length has been measured to be only 75 per cent of the total one. Finally, the uncertainties on the real part of the ratio between direct and indirect CP breaking due to mis-tagging have been evaluated for the 1997 data. They are smaller than the statistical one. (author)

  14. Immunohistochemical Ki-67/KL1 double stains increase accuracy of Ki-67 indices in breast cancer and simplify automated image analysis

    DEFF Research Database (Denmark)

    Nielsen, Patricia S; Bentzer, Nina K; Jensen, Vibeke

    2014-01-01

    observers and automated image analysis. RESULTS: Indices were predominantly higher for single stains than double stains (P≤0.002), yet the difference between observers was statistically significant (PPearson correlation coefficient for manual and automated indices ranged from 0.......69 to 0.85 (Pcorrelating automated indices with tumor characteristics, for example, tumor size (P... stains, Ki-67 should be quantified on double stains to reach a higher accuracy. Automated indices correlated well with manual estimates and tumor characteristics, and they are thus possibly valuable tools in future exploration of Ki-67 in breast cancer....

  15. Sağlıklı Beslenmede Türk Mutfak Kültürünün Yeri

    OpenAIRE

    ERTAŞ, Yasemin; GEZMEN-KARADAĞ, Makbule

    2013-01-01

    Turkish cuisine is one of the well-known three cuisines in the world with Chinese and French cuisine. The combination of meat and fermented products from Central Asia, cereals from Mesopotamia, vegetables and fruits from Mediterranean and spices from South Asia has created a rich food culture. With Islam, meats of some animals such as pig, donkey and frog are prohibited in Turkish cuisine. Today in Turkey, consumption of grains and grain products comes first place and consumption of vegetable...

  16. Avalynės pėdsakų panaudojimas atskleidžiant nusikaltimus : būklė ir perspektyvos

    OpenAIRE

    Juškevičiūtė, Janina; Ivanauskas, Julius

    2000-01-01

    The article analyses how the footprints mentioned in the historical sources helped to assist in disclosing crimes as well as the recent situation of footprints used for the disclosing of crimes is examined. On the basis of their and other research works, the authors present the perspectives of the footprint investigation. The main attention is paid to the newest footprint fixation technologies and to computer systems on footwear prints. Computer usage in investigation of crimes is not a new p...

  17. Sdílená pozornost jako klíč k rozdílu mezi člověkem a zvířetem?

    Czech Academy of Sciences Publication Activity Database

    Urban, Petr

    2013-01-01

    Roč. 61, č. 4 (2013), s. 483-496 ISSN 0015-1831 R&D Projects: GA ČR(CZ) GPP401/12/P544 Institutional support: RVO:67985955 Keywords : joint attention * anthropology * phenomenology * Tomasello Subject RIV: AA - Philosophy ; Religion

  18. Integruota įmonės finansinės būklės ir veiklos rezultatų analizės metodika

    OpenAIRE

    Mackevičius, Jonas; Valkauskas, Romualdas

    2010-01-01

    Information about company's financial status and its performance results is very important for the objective evaluation of company's position in the market and competitive possibilities in the future. Such information is provided in the financial statement. It is important to apply and investigate this information properly. The methodology of company's financial status and performance results integrated analysis is recommended in this article. This methodology consists of these three elements...

  19. Įmonės finansinės būklės ir rezultatų prognozavimas ir vertinimas

    OpenAIRE

    Martusevičiūtė-Sedleckienė, Rasa

    2005-01-01

    The object of the research: the prognostication and evaluation of the financial position and results of a company. The purpose of the research: to prepare the system of prognostication and evaluation of the company��s financial position and financial results. The tasks of the research: 1)To determine the importance of financial position and financial results in the process of prognostication and evaluation of the company’s activities; 2)To prepare the system of prognostication of financial po...

  20. Navození bezpečí jako klíčový moment v terapii polytraumatizovaných dětí a adolescent

    Czech Academy of Sciences Publication Activity Database

    Schmidtová, Jana; Štěpánek, Petr; Čermák, Ivo

    2017-01-01

    Roč. 11, č. 2 (2017), s. 132-147 ISSN 1802-3983 R&D Projects: GA ČR GA16-17529S Institutional support: RVO:68081740 Keywords : trauma focused therapy * therapeutic exposition * therapeutic window * therapeutic titration * polytraumatization * Complex PTSD * Developmental Trauma Disorder Subject RIV: AN - Psychology OBOR OECD: Psychology (including human - machine relations)

  1. Kreatör eller reklampelare? : En intervjustudie om influencers deltagande och påverkan i ett klädföretags kampanj

    OpenAIRE

    Törnqvist, Alexandra; Horneij, Sofia

    2018-01-01

    Creator or billboard? An interview study based on influencers’ participation and impact in a clothing company’s campaign. The purpose of this study is to examine six influencers’ experiences of participating in a clothing company's campaign. The aim is to acquire a deeper understanding of what impact the influencers have in the campaign. The method used is qualitative interviews with six of fifteen influencers who participated in a clothing company's campaign in October 2017. The influencers ...

  2. Cíp, cvik(l) a klín v anoikonymech na Moravě a v české části Slezska

    Czech Academy of Sciences Publication Activity Database

    Kloferová ml., Stanislava

    2009-01-01

    Roč. 50, č. 1 (2009), s. 117-128 ISSN 1211-4413 R&D Projects: GA ČR GA405/08/0703 Institutional research plan: CEZ:AV0Z90610518 Keywords : minor place names * form of piece of land * tip * wedge Subject RIV: AI - Linguistics

  3. Romulus, Scott a Klára Issová. Kdy vlastní jména zkracují deskripce?

    Czech Academy of Sciences Publication Activity Database

    Marvan, Tomáš

    2013-01-01

    Roč. 61, Suppl. 2 (2013), s. 47-61 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : Bertrand Russell * proper names * denotation * description * designation Subject RIV: AA - Philosophy ; Religion

  4. Growth performance, carcass and hematological characteristics of ...

    African Journals Online (AJOL)

    Growth performance, carcass and hematological characteristics of rabbits fed graded levels of tiger nuts ( Cyperus esculentus ) ... (p>0.05) difference between treatments. Results demonstrated that (Cyperus esculentus) could be used up to 5% in rabbit's diets without adverse effect on the animals' performance and health.

  5. HPLC Analysis of Water-Soluble Vitamins (B2, B3, B6, B12, and C and Fat-Soluble Vitamins (E, K, D, A, and β-Carotene of Okra (Abelmoschus esculentus

    Directory of Open Access Journals (Sweden)

    Rokayya Sami

    2014-01-01

    Full Text Available Okra is consumed as a vegetable by populations in Africa and Asia and particularly in Egypt. In this study, we investigated some nutritional components of okra grown in four different geographical locations of Egypt. A comparative analysis of water-soluble vitamins (B2, B3, B6, B12, and C and fat-soluble vitamins (E, K, D, A, and β-carotene in okra pods was carried out. Results of principal component analysis (PCA showed three clusters of varieties. The first cluster included the Dakahlia (D and Kafr El-Sheikh (K varieties. The second and the third clusters separated out the Suez (S and Mansoura (M varieties independently. The S pod showed the highest contents of vitamins B6 (49.81 μg/100 g and E (1.47 mg/100 g but contained the lowest contents of vitamins B3 (1.42 μg/100 g and B12 (undetected. The K pod showed the lowest vitamin C content (11.60 mg/100 g. The M pod showed the highest contents of vitamins B3 (22.70 μg/100 g, B12 (91.20 μg/100 g, C (27.14 mg/100 g, and K (0.21 mg/100 g. The D pod showed the lowest contents of vitamins E (0.15 mg/100 g, K (0.05 mg/100 g, and B6 (11.50 μg/100 g. These findings could help develop meal planning at the community level by incorporating okra varieties with high vitamin content.

  6. Využití GIS pro mapování klíšťat a klíšťaty přenášených patogenů v Jihočeském kraji

    Czech Academy of Sciences Publication Activity Database

    Švec, P.; Hönig, Václav; Daniel, M.; Danielová, V.; Grubhoffer, Libor

    2009-01-01

    Roč. 114, č. 3 (2009), s. 157-168 ISSN 1212-0014 Institutional research plan: CEZ:AV0Z60220518 Keywords : GIS * ticks * tick-borne encephalitis * mapping * Lyme borreliosis * ArcGIS Subject RIV: EC - Immunology

  7. Metindilbilimi Metindilbilimsel Bağdaşıklık ve Haldun Taner’in Onikiye Bir Var Adlı Öyküsünde Metindilbilimsel Bağdaşıklık Görünümleri

    OpenAIRE

    ÖZKAN, Bülent

    2013-01-01

    This article is a comprehensive summary of the seminar study whose name is “Text Linguistics And Text Linguistics Cohesion At The Story ‘Onikiye Bir Var’ by Haldun TANER” In this article we aimed to research what ‘text linguistics’ and ‘text linguistic chosion’ are and how the text linguistic chosion is reflected in the story ‘Onikiye Bir Var’ by Haldun TANER Key words: Text Linguistics Text Linguistics Cohesion Haldun TANER

  8. Dicty_cDB: VHG624 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ---DYMTLXIGTYSFEGKFIKKAIINGNRIVTINNXLLNENQLNSNSTIXKEKDSSNQLS SFISIEIPHYDSTCIIRSKFFSFIRFK*ii*kl*kfnlyfkkilktyyrsnxcycygfcs fcnns...NQLS SFISIEIPHYDSTCIIRSKFFSFIRFK*ii*kl*kfnlyfkkilktyyrsnxcycygfcs fcnnssslynr*ifxi**ifiyknfll*iixti*xkvlnlff

  9. Nigerian Journal of Chemical Research 1 Vol. 15, 2010 ...

    African Journals Online (AJOL)

    Hp

    University of Benin, GeoEnvironmental & Climate Change Adaptation ... transferability of the metal to okra (Abelmoschus esculentus) plant, and the long term ... to 85% in poultry manure amended soil for As. Post-harvest acid treatment of the ...

  10. Nigeria Agricultural Journal - Vol 38 (2007)

    African Journals Online (AJOL)

    Plectranthus esculentus), Hausa potato (Selenosterum rotundifolius) and Tumeric (Curcuma longa) in Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. ON Eke-Okoro, AO Olojede, C Nwadili, 24-30.

  11. Author Details

    African Journals Online (AJOL)

    Plectranthus esculentus), Hausa potato (Selenosterum rotundifolius) and Tumeric (Curcuma longa) in Nigeria Abstract · Vol 39 (2008) - Articles Preliminary elations of temperate sugar beet accession s for tuber yield and quality 8in the high altitude of ...

  12. Biodigestion of cassava peels blended with pig dung for methane ...

    African Journals Online (AJOL)

    OKOROIGWE

    2013-10-02

    Oct 2, 2013 ... Biogas production from cassava (Manihot esculentus) peels and pig dung under a mesophilic ... is a gap to be filled up by further investigation. Ezekoye ..... Biofertilizer and Chemical Fertilizer Application on Maize Production.

  13. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 227 ... ... on Soil Physical Properties in Enugu State South Eastern Nigeria, Abstract PDF ... on hydrocarbon reduction and growth of Abelmoschus esculentus ... volatile oils of Eucalyptus citrodora and lemon grass, Abstract PDF.

  14. Genetic relationships among West African okra ( Abelmoschus caillei )

    African Journals Online (AJOL)

    Abelmoschus caillei) and 43 Asian genotypes (A. esculentus) were assessed for genetic distinctiveness and relationships using random amplified polymorphic DNA (RAPD). The molecular analysis showed that all the thirteen primers used ...

  15. Download this PDF file

    African Journals Online (AJOL)

    User

    ABSTRACT. The deteriorating effect of microorganisms on tiger nut (Cyperus esculentus) milk has hampered its ..... of food poisoning (Kloos, 1980). .... Food Uses and Health Benefits. American .... Ihekoronye, A.I. and Ngoddy, P.O. (1985).

  16. Morphological classification of genetic diversity in cultivated okra ...

    African Journals Online (AJOL)

    Morphological classification of genetic diversity in cultivated okra, Abelmoschus esculentus (L) Moench using principal component analysis (PCA) and single linkage cluster analysis (SLCA). CC Nwangburuka, OB Kehinde, DK Ojo, OA Denton, AR Popoola ...

  17. Remedial Investigation of Contaminant Mobility at Naval Weapons Station, Concord, California.

    Science.gov (United States)

    1986-01-01

    Houghton. 1983. Heavy Metal Uptake by Agronomic Crops Grown on Contaminated Soils and Cyperus esculentus Grown on Oxidized and Reduced Contaminated Soils...Respiratory Metabolism and Haemoglobin Concentration in an Earthworm Eisenia foetida (SAVIGNY 1826) Under Exposure of Lead Intoxication . Acta...Comparison of the Heavy-Metal Uptake of Cyperus esculentus and of Agronomic Plants Grown on Contaminated Sediments. Miscellaneous Paper D-83-1. US

  18. Ernst Enno 121 : [Ernst Enno nimelise kirjandusliku omaloominguvõistluse 1996. aasta paremad luuletused

    Index Scriptorium Estoniae

    1996-01-01

    Janek Nee (Haapsalu Wiedemanni gümnaasiumi 11. kl.). Teed lõpmatusse; Liina Krips (Haapsalu gümnaasiumi 12. kl.). Inimene, 'Olin arvanud, et minust hoolitakse...'; Loola Hütt (Haapsalu sanatoorse internaatkooli 13. kl.). 'Mäletad kui hele oli kuu..., 'Jälle ei jõa kuu...', 'Suveöö sumedates silmapilkudes...'; Evelin Lillepuu (Taebla gümnaasiumi 9. kl.). Tuul; Anne Roovere (Kullamaa keskk. 8. kl.). See on koht; Martin Kaasik (Haapsalu Wiedemanni gümnaasiumi 7. kl.). Vembumehed; Külli Kivi (Haapsalu Wiedemanni gümnaasiumi 9. kl.). Vaikus

  19. Global exponential stability of periodic solution for shunting inhibitory CNNs with delays

    International Nuclear Information System (INIS)

    Li Yongkun; Liu Chunchao; Zhu Lifei

    2005-01-01

    By using the continuation theorem of coincidence degree theory and constructing suitable Lyapunov functions, we study the existence and stability of periodic solution for shunting inhibitory cellular neural networks (SICNNs) with delays x-bar ij (t)=-a ij (t)x ij (t)--bar B kl -bar Nr(i,j)B ij kl (t)f ij (x kl (t))x ij (t)--bar C kl -bar Nr(i,j)C ij kl (t)g ij (x kl (t-τ kl ))x ij (t)+L ij (t)

  20. Entheseal changes: Do they reflect socioeconomic status in the Early Medieval Central European population? (Mikulčice - Klášteřisko, Great Moravian Empire, 9th - 10th century)

    Czech Academy of Sciences Publication Activity Database

    Havelková, P.; Hladík, Marek; Velemínský, P.

    2013-01-01

    Roč. 23, č. 2 (2013), s. 237-251 ISSN 1047-482X Institutional research plan: CEZ:AV0Z80010507 Institutional support: RVO:68081758 Keywords : Early Middle Ages * enthesopathies * factor analysis * grave goods * musculoskeletal stress markers * social status Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 1.070, year: 2013

  1. Borrelie v klíšťatech parazitujících na člověku a profylaxe lymské borreliózy

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk; Halouzka, Jiří; Juřicová, Zina

    2003-01-01

    Roč. 52, č. 1 (2003), s. 13-17 ISSN 1210-7913 R&D Projects: GA ČR GA206/00/1204; GA AV ČR IBS6093007 Institutional research plan: CEZ:AV0Z6093917 Keywords : Borrelia burgdorferi * Lyme disease * ticks Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology http://www.clsjep.cz/Ukazclanek2.asp?clanek=14099&jazyk=&cislo=868

  2. Enzīmu inducētas rezistences noteikšana klīniski nozīmīgos Gram negatīvo baktēriju celmos

    OpenAIRE

    Vēvere, Indra

    2013-01-01

    Noteikta K.pneumoniae, P.aeruginosa, A.baumannii un E.coli rezistence pret antibakteriālajiem preparātiem. Darbs izstrādāts RAKUS Tuberkulozes un plaušu slimību centra Mikobakterioloģijas laboratorijā. Izanalizēti materiāli no 2012. gada. No elpceļu izolātiem iegūtas tīrkultūras, kuru rezistences spēja pārbaudīta ar β-laktāmu, aminoglikozīdu un hinolonu klases antibakteriālajiem preparātiem. Izmantotās metodes-disku difūzijas tests, Hodge tests, E-tests un dubultdisku metode. Izdalīti 267...

  3. Marginálie k diskusi o počátcích dominikánského kláštera v Sezimově Ústí

    Czech Academy of Sciences Publication Activity Database

    Kovář, Miroslav

    2017-01-01

    Roč. 125, č. 3 (2017), s. 145-158 ISSN 1803-1382 R&D Projects: GA ČR(CZ) GA16-06083S Institutional support: RVO:67985955 Keywords : South Bohemia * Sezimovo Ústí * Dominican * monastery * Early Gothic * architectural element * vault corbels Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  4. Bassani – Brentner – Villicus: hudební repertoár dvou rukopisných sborníků z piaristického kláštera v Podolínci

    Czech Academy of Sciences Publication Activity Database

    Kapsa, Václav

    3 /29/, č. 2 (2012), s. 195-215 ISSN 1338-2594 R&D Projects: GA ČR GPP409/12/P953; GA MŠk(CZ) MEB0810155 Keywords : baroque music * solo motet * arias * cantatas * musical sources * Jan Josef Ignác Brentner * Giovanni Battista Bassani Subject RIV: AL - Art, Architecture, Cultural Heritage

  5. Vhodná údržba městských parků přispívá k regulaci klíněnky jírovcové

    Czech Academy of Sciences Publication Activity Database

    Kopačka, M.; Zemek, Rostislav; Kopačka, D.

    2011-01-01

    Roč. 2011, č. 10 (2011), s. 53-54 ISSN 1213-7596 R&D Projects: GA MŠk 2B06005 Institutional research plan: CEZ:AV0Z50070508 Keywords : Cameraria ohridella Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection

  6. NA48/2 final results on charged semileptonic kaon decays and $|V_{(us)}|$, NA48 measurements of the $K\\mu3$ form factors from $K_{L}$ decays

    CERN Document Server

    Dabrowski , A

    2007-01-01

    Measured ratios of decay rates for $\\Re_{Ke3/K2π}, \\Re_{K\\mu3/K2\\pi}$ and $\\Re_{K\\mu 3/Ke3}$ are presented, based on $K^{\\pm}$ decays collected in a dedicated run in 2003 by the NA48/2 experiment at CERN. The results obtained are $\\Re_{Ke3/K2\\pi} = 0.2470 \\pm 0.0009_{stat} \\pm 0.0004_{syst}$ and $\\Re_{K\\mu3/K2\\pi} = 0.1637 \\pm 0.0006_{stat} \\pm 0.0003_{syst}$. Using the PDG average for the $K^{\\pm} \\rightarrow \\pi^{\\pm}\\pi^{0}$ normalisation mode, both values are found to be larger than the current values given by the Particle Data Book [1] and lead to a larger magnitude of the $|V_{us}|$ element in the CabibboKobayashi-Maskawa (CKM) matrix than previously accepted. When combined with the latest Particle Data Book value of $|V_{ud}|$[1], the result is in agreement with unitarity of the CKM matrix. In addition, a new measured value of $Re_{K\\mu3/K2\\pi} = 0.663 \\pm 0.003_{stat} \\pm 0.001_{syst}$ is compared to the semi-empirical predictions based on the latest form factor measurements. The $K\\mu 3$ form factor...

  7. Klášter, nebo hrad? Rezidence litomyšlských biskupů v letech 1344–1421, její hypotetická rekonstrukce a klasifikace

    Czech Academy of Sciences Publication Activity Database

    Večeře, Vojtěch

    2017-01-01

    Roč. 17, č. 1 (2017), s. 135-153 ISSN 1211-6831 Institutional support: RVO:67985963 Keywords : Litomyšl * castle * monastery * bishopric * cathedral * 1344-1421 Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  8. Structure of the bifunctional methyltransferase YcbY (RlmKL) that adds the m7G2069 and m2G2445 modifications in Escherichia coli 23S rRNA

    DEFF Research Database (Denmark)

    Wang, Kai-Tuo; Desmolaize, Benoit; Nan, Jie

    2012-01-01

    to be fusions from two separate proteins found in Gram-positives. The crystal structures described here show that both the N- and C-terminal halves of E. coli YcbY have a methyltransferase active site and their folding patterns respectively resemble the Streptococcus mutans proteins Smu472 and Smu776. Mass...

  9. Kokůtkův odkaz. Příspěvek k dějinám knihovny kláštera augustiniánů kanovníků v Třeboni

    Czech Academy of Sciences Publication Activity Database

    Dragoun, Michal

    2012-01-01

    Roč. 42, č. 1 (2012), s. 33-50 ISSN 0585-5691 R&D Projects: GA ČR(CZ) GBP405/12/G148 Institutional support: RVO:68378092 Keywords : book legacies * manuscripts * Augustinian Canon monastery in Třeboň – library * Martin of Třeboň Subject RIV: AB - History

  10. Gebelerde Kronik Yorgunluk Sendromu Belirti ve Bulgularının Sıklığının Araştırılması

    OpenAIRE

    Gölcür, Mehmet; Sarı, Oktay; Aydoğan, Ümit; Akpak, Yaşam Kemal; Keskin, Uğur

    2017-01-01

    Amaç: Kronik yorgunluk sendromu (KYS) istirahat ile düzelmeyen ve en az altıaydan beri devam eden yorgunluk ile birlikte, ayrıca hafıza ve konsantrasyonproblemleri, miyalji, artralji, başağrısı, uyku bozukluğu, tekrarlayan boğazağrısı ve hassas lenf nodları gibi bulgulardan en az dört tanesininbulunmasıyla karakterize bir hastalıktır. Gebelik süreci ise çeşitli hormonal,metabolik ve anatomik değişiklikler paralelinde benzer yakınmalarıngörülebileceği fizyolojik bir süreçtir. Çalışmamızda, geb...

  11. Sedimenty ve Sloupsko-šošůvských jeskyních a v Kůlně – klíč k porozumění podzemním procesům

    Czech Academy of Sciences Publication Activity Database

    Kadlec, Jaroslav

    2012-01-01

    Roč. 31, - (2012), s. 26-33 ISSN 1211-8397. [Speleofórum 2012 : setkání speleologů v Moravském krasu. Moravský kras, 20.04.2012-22.04.2012] Institutional research plan: CEZ:AV0Z30130516 Keywords : cave sediment s * Moravian Karst * paleomagnetic and radiomentric datings Subject RIV: DB - Geology ; Mineralogy

  12. Düş Kırıklığı Bağlamında Tevfik Fikret ve Vatan In The Context Of Disappointment, Tevfik Fikret And Country

    Directory of Open Access Journals (Sweden)

    Mehmet Emin ULUDAĞ

    2013-03-01

    Full Text Available There are objects that forming each of poet’s art center. Theseobjects are essentially abstract and concrete which can be either singlepartand can be attributed different images to this objects according toartist. These objects painting, architecture, sculpture, works such asnovels and poems that make up the core of the time, people, space, andfact takes shape according to temperament of poets and artists.In addition, in Literature, the places affect the perspectives andstyles of poets in different ways. This interaction sometimes appearsescape and sometimes appears rescue. In the westernization period,there is an escape among especially the Servet-i Fünuncus to NewZealand, Scotland, and Finland. This escape can be seen as both analienation and help-seeking. Historical point of view, sociologicalresearch and in-depth analysis personal sufferings of intellectuals whoattempted to escape can provide true findings and information, whichcan light this period, about dualism of this intellectuals and attempts toescape.Tevfik Fikret is one of the pioneers who symbolize this escape.Fikret does not leave the homeland, but in much poetry, heattributes a mission of escape and rescue to places in his poem. Places,where this mission is the most intense, are street, Asiyan, grave,mosque, Istanbul, the parliament, palace, garden and village. Theperspective of the poet are sometimes tragic, funny, often reaches thesize of complexity.In this study, Tevfik Fikret’s thoughts about phenomenon ofplace, and the images and the meanings was attributed to places ofRubab-i Şikeste will be examined.The study was prepared from poems of this poet and comparisonsbetween this poet and poet living in this age, aims to describe the viewof the motherland, identification and perception of Tevfik Fikret. Her şairin sanat merkezini oluşturan objeler vardır. Soyut ve somut olabilen bu objeler temelde tek parça olup sanatkâra göre farklı imajlar yüklenirler. Bu objelerden resim, mimari, heykeltıraş, roman ve şiir gibi eserlerin çekirdeğini oluşturan zaman, kişiler, mekân ve vakıa şairlerin ve sanatkârların mizaçlarına göre şekil alır.Ayrıca edebiyatta mekânlar da şairlerin bakış açılarını ve üsluplarını farklı şekillerde etkiler. Bu etkileşim bazen bir kaçış bazen de bir kurtuluş olarak belirir. Batılılaşma döneminde özellikle Servet-i Fünûncularda -Yeni Zellanda, İskoçya, Finlandiya- vb. ülkelere bir kaçış vardır. Bu kaçış hem bir uzaklaşma hem de bir çare arama olarak görülebilir. Tarihsel bakış, sosyolojik inceleme ve ferdi ıstırapları derinlemesine tahlil bu kaçış dönemi ve kaçışa teşebbüs eden aydınların yaşadıkları dualizm hakkında doğru tespitler ve dönemi aydınlatacak bilgiler verebilir.Bu kaçışı sembolize eden şairlerimizin başında Tevfik Fikret gelir. Fikret vatanı terk etmez ancak birçok şiirinde mekânlara hem bir kaçış hem de bir kurtuluş misyonunu yükler. Bu misyonun en yoğun olduğu mekânlar ise sokak, âşiyan, kabir, camii, İstanbul, meclis, saray, bahçe ve köy gibi yerlerdir. Şairin perspektifi çoğu zaman trajik bazen de komik bir komplekslik boyutundadır.Bütün bunlardan hareketle çalışmada Tevfik Fikret’in mekân olgusu üzerindeki düşünceleri ve Rübab-ı Şikeste’deki mekânlara yüklediği imajlar ve anlamlar irdelenecek.Şairin şiirlerinden ve devrinin şairleriyle mukayeseyle hazırlanan çalışma özellikle Tevfik Fikret’in vatana bakışını ve onu algılayış ve tarif edişini tespit etmeyi amaçlamaktadır.

  13. Mikrodialýza a hmotnostní spektrometrie jako klíč k monitorování metabolitů v nezralém mozku

    Czech Academy of Sciences Publication Activity Database

    Vondráková, Kateřina; Uttl, Libor; Kubová, Hana; Tsenov, Grygoriy; Kačer, P.

    2017-01-01

    Roč. 111, č. 1 (2017), s. 66-69 ISSN 0009-2770 R&D Projects: GA ČR(CZ) GA14-20613S Institutional support: RVO:67985823 Keywords : microdialysis * immature brain * HPLC-MS * aminoacids Subject RIV: FH - Neurology OBOR OECD: Neurosciences (including psychophysiology Impact factor: 0.387, year: 2016

  14. Roles of Pauli correlations, channel couplings, and shake-off in ion-induced KL/sup v/ and K2L/sup v/ multiple-vacancy production

    International Nuclear Information System (INIS)

    Becker, R.L.; Ford, A.L.; Reading, J.F.

    1983-01-01

    Cross sections for target K-plus-L-shell multiple-vacancy production by ions can be inferred from experimental measurements of K x-ray and Auger satellite intensities. The theory of K/sup n/L/sup v/ multiple-vacancy distributions has been generalized from the single-particle model (the statistically independent electron approximation) to the independent Fermi particle model. The Pauli correlations (electron exchange terms) are found to nearly cancel in many cases because of a tendency toward random phases. This results in the first quantal demonstration that the vacancy distribution is nearly binomial (but slightly narrower). Calculations have been generalized from the traditional first-order approximations to unitary approximations (first Magnus and coupled-channels) which correctly predict the saturation of the mean vacancy probability with increasing projectile charge. The recent availability of satellite and hypersatellite data for the same collision system makes possible the beginning of an investigation of the effects of increased removal energies and increased shaking in hypersatellites (K 2 L/sup v/) as compared with satellites. We review our unified treatment of ion-plus-shaking induced amplitudes for L-vacancy production accompanying ion-generated K-holes. Calculations for C 6+ + Ne satellite and hypersatellite vacancy distributions are presented

  15. České Hercynikum versus Západní Karpaty: Klíčové biogeografické rozhraní Evropy v posledním glaciálu

    Czech Academy of Sciences Publication Activity Database

    Pokorný, P.; Jankovská, Vlasta; Horáček, I.

    2015-01-01

    Roč. 50, č. 2 (2015), s. 165-180 ISSN 1211-5258 R&D Projects: GA ČR GAP209/10/0519 Institutional support: RVO:67985939 Keywords : MIS 2 * Late Glacial * refugia Subject RIV: EH - Ecology, Behaviour

  16. Genderovanost porodu jako příklad antropologického zkoumání lidské reprodukce: přehled klíčových konceptů

    Directory of Open Access Journals (Sweden)

    Ema Hrešanová

    2012-12-01

    Full Text Available In the past few years social scientists have extensively focused on the domain of human reproduction. This focus has provided many incentives for the development of related social theory. Building on these recent scholarly discussions, which emphasize the central role played by human reproduction in our social lives, this paper focuses on childbirth as one of the peak reproductive events and on its gender aspects. Predominantly building on the anthropology of reproduction and gender and related scholarship in the social sciences, the paper‘s aim is to provide a review of key ideas and concepts that make the „genderedness“ of childbirth visible. First, I explain what constitutes the gendered nature of childbirth and in what ways gender relations shape the birthing process. I build on Connell’s distinction of three main theoretical understandings of gender. Subsequently, I focus on the cultural aspects of childbirth and demonstrate its cultural construction with regard to gender. Next I highlight the importance of gender roles which are deeply internalized and work even during the birthing process, thus affecting the whole birthing experience. The interaction between medical personnel and a birthing woman is in itself an important part of this experience in Western societies and is shaped by the the overall medicalization of childbirth, which I then go on to discuss. Sunsequesntly, I focus on the issue of modern obstetrics as the ultimate source of authoritative knowledge. Childbirth however is also a crucial lifecycle event accompanied by rite de passage in non-Western as well as Western societies and the conclusion of this paper is therefore dedicated to presenting key works and ideas related to this important anthropological concept in relation to childbirth.

  17. When a clonal genome finds its way back to a sexual species: evidence from ongoing but rare introgression in the hybridogenetic water frog complex

    Czech Academy of Sciences Publication Activity Database

    Mikulíček, P.; Kautman, M.; Demovič, B.; Janko, Karel

    2014-01-01

    Roč. 27, č. 3 (2014), s. 628-642 ISSN 1010-061X R&D Projects: GA ČR GA206/09/1298 Institutional support: RVO:67985904 Keywords : hybridization * hybridogenesis * Pelophylax Subject RIV: EG - Zoology Impact factor: 3.232, year: 2014

  18. Complete Genome Sequence of a Common Midwife Toad Virus-Like Ranavirus Associated with Mass Mortalities in Wild Amphibians in the Netherlands

    Science.gov (United States)

    Hughes, Joseph; Saucedo, Bernardo; Rijks, Jolianne; Kik, Marja; Haenen, Olga L. M.; Engelsma, Marc Y.; Gröne, Andrea; Verheije, M. Helene; Wilkie, Gavin

    2014-01-01

    A ranavirus associated with mass mortalities in wild water frogs (Pelophylax spp.) and other amphibians in the Netherlands since 2010 was isolated, and its complete genome sequence was determined. The virus has a genome of 107,772 bp and shows 96.5% sequence identity with the common midwife toad virus from Spain. PMID:25540340

  19. Gidon Kremer ja Kremerata Baltica

    Index Scriptorium Estoniae

    2001-01-01

    G. Kremer ja Kremerata Baltica esitamas Tshaikovski, shostakovitshi ja Desjatnikovi loomingut pühapäeval, 16. detsembril kl.19 Vanemuise Kontserdimajas ja esmaspäeval, 17. detsembril kl.19 Estonia kontserdisaalis

  20. Dicty_cDB: Contig-U05646-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available HLWFY HYHQDY*kl*llislgfywllfllslvi*l*lvvlqi*l*lkxxx*nwffrifkiwctfn yishfnwctdcsfnw*iif*iyiyiyi**nki Translat...WTILEPFVPIDSTHLNVLKIFIFSILILVLCNILGNVHLWFY HYHQDY*kl*llislgfywllfllslvi*l*lvvlqi*l*lkxxx*nwffrifkiwctfn yishfnwctdcs

  1. Dicty_cDB: SSJ246 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ifihf*kkkkkkkkkkkkkkkk Translated Amino Acid sequence (All Frames) Frame A: kl*nviqiitinhkc*lnpkesnffnfsrkhtik**cstlrccstccnsrfid...nfsrkhtik**cstlrccstccnsrfidccrccsy lnlqriln*liihilipweifenlivylinn*LYLLIFKKKKKKK...AAAAAAAAAAAAAAAAAAAAAAAA sequence update 1998.12.21 Translated Amino Acid sequence kl*nviqiitinhkc*lnpkesnff

  2. ORF Alignment: NC_004354 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 122 ... Query: 96 ... LVDWINDELAEQRIIVQHLEEDMYDGQVLHKLWEKLTGKKLDVPEVTQSEQGQHEKLNIV 155 ... L+DWIND...EL E+RIIV ++EED+YDGQVL+KLWEKL+ ... KL+VPEVTQS +GQ +KL++V Sbjct: 1 ... LIDWINDELVEERIIVTNIEEDLYDGQVLQKLWEKLSNNKLNVPEVTQSAEGQRQKLSVV 60 ...

  3. Genetics Home Reference: FG syndrome

    Science.gov (United States)

    ... MJ, Hoo JJ, Jones KL, McKeown C, Moeschler JB, Raymond FL, Rogers RC, Schwartz CE, Battaglia A, ... E, Huddleston L, Clark RD, Jones KL, Moeschler JB, Opitz JM, Morford J, Simensen R, Rogers RC, ...

  4. Bicarbonate-sensitive calcification and lifespan of klotho-deficient mice.

    Science.gov (United States)

    Leibrock, Christina B; Voelkl, Jakob; Kohlhofer, Ursula; Quintanilla-Martinez, Leticia; Kuro-O, Makoto; Lang, Florian

    2016-01-01

    Klotho, a protein counteracting aging, is a powerful inhibitor of 1,25-dihydroxyvitamin D3 [1,25(OH)2D3] formation and regulator of mineral metabolism. In klotho hypomorphic (kl/kl) mice, excessive 1,25(OH)2D3 formation leads to hypercalcemia, hyperphosphatemia and vascular calcification, severe growth deficits, accelerated aging and early death. Kl/kl mice further suffer from extracellular volume depletion and hypotension, leading to the stimulation of antidiuretic hormone and aldosterone release. A vitamin D-deficient diet, restriction of dietary phosphate, inhibition of mineralocorticoid receptors with spironolactone, and dietary NaCl all extend the lifespan of kl/kl mice. Kl/kl mice suffer from acidosis. The present study explored whether replacement of tap drinking water by 150 mM NaHCO3 affects the growth, tissue calcification, and lifespan of kl/kl mice. As a result, NaHCO3 administration to kl/kl mice did not reverse the growth deficit but substantially decreased tissue calcification and significantly increased the average lifespan from 78 to 127 days. NaHCO3 did not significantly affect plasma concentrations of 1,25(OH)2D3 and Ca(2+) but significantly decreased plasma phosphate concentration and plasma aldosterone concentration. The present study reveals a novel effect of bicarbonate, i.e., a favorable influence on vascular calcification and early death of klotho-deficient mice. Copyright © 2016 the American Physiological Society.

  5. Global exponential stability of periodic solution for shunting inhibitory CNNs with delays

    Energy Technology Data Exchange (ETDEWEB)

    Li Yongkun [Department of Mathematics, Yunnan University, Kunming, Yunnan 650091 (China)]. E-mail: yklie@ynu.edu.cn; Liu Chunchao [Department of Mathematics, Yunnan University, Kunming, Yunnan 650091 (China); Zhu Lifei [Department of Mathematics, Yunnan University, Kunming, Yunnan 650091 (China)

    2005-03-28

    By using the continuation theorem of coincidence degree theory and constructing suitable Lyapunov functions, we study the existence and stability of periodic solution for shunting inhibitory cellular neural networks (SICNNs) with delays x-bar {sub ij}(t)=-a{sub ij}(t)x{sub ij}(t)--bar B{sup kl}-bar Nr(i,j)B{sub ij}{sup kl}(t)f{sub ij}(x{sub kl}(t))x{sub ij}(t)--bar C{sup kl}-bar Nr(i,j)C{sub ij}{sup kl}(t)g{sub ij}(x{sub kl}(t-{tau}{sub kl}))x{sub ij}(t)+L{sub ij}(t)

  6. Protective roles of DMP1 in high phosphate homeostasis.

    Directory of Open Access Journals (Sweden)

    Afsaneh Rangiani

    Full Text Available Dmp1 (dentin matrix protein1 null mice (Dmp1(-/- display hypophosphatemic rickets with a sharp increase in fibroblast growth factor 23 (FGF23. Disruption of Klotho (the obligatory co-receptor of FGF23 results in hyperphosphatemia with ectopic calcifications formed in blood vessels and kidneys. To determine the role of DMP1 in both a hyperphosphatemic environment and within the ectopic calcifications, we created Dmp1/Klotho compound deficient (Dmp1(-/-kl/kl mice.A combination of TUNEL, immunohistochemistry, TRAP, von Kossa, micro CT, bone histomorphometry, serum biochemistry and Scanning Electron Microscopy techniques were used to analyze the changes in blood vessels, kidney and bone for wild type control, Dmp1(-/-, Klotho deficient (kl/kl and Dmp1(-/-kl/kl animals.Interestingly, Dmp1(-/-kl/kl mice show a dramatic improvement of rickets and an identical serum biochemical phenotype to kl/kl mice (extremely high FGF23, hyperphosphatemia and reduced parathyroid hormone (PTH levels. Unexpectedly, Dmp1(-/-kl/kl mice presented elevated levels of apoptosis in osteocytes, endothelial and vascular smooth muscle cells in small and large blood vessels, and within the kidney as well as dramatic increase in ectopic calcification in all these tissues, as compared to kl/kl.These findings suggest that DMP1 has an anti-apoptotic role in hyperphosphatemia. Discovering this novel protective role of DMP1 may have clinical relevance in protecting the cells from apoptosis in high-phosphate environments as observed in chronic kidney disease (CKD.

  7. Effect of industrial effluents on the growth and anatomical structures ...

    African Journals Online (AJOL)

    The authors investigated the impact of industrial effluents from 5 different industrial concerns in Lagos, Nigeria on Okra (Abelmoschus esculentus). During the study, it was observed that these effluents induced detrimental effects on the flowering, fruiting, stem length, leaf width and leaf length of okra. Other parameters ...

  8. Plant species responses to oil degradation and toxicity reduction in ...

    African Journals Online (AJOL)

    Vegetated plots were established by planting different plant species – legumes and vegetable (Abelmoschus, esculentus, Telfaria occidentalis and Vigna unguiculata) and applied with sawdust and chromolaena leaves at different intensities of oil pollution. Toxicity of the soil was evaluated using germination percentage, ...

  9. Chemical, physical and biological features of Okra pectin

    NARCIS (Netherlands)

    Sengkhamparn, N.

    2009-01-01

    In Thailand, many plants have been used as vegetables as well as for traditional
    medicine. Okra, Abelmoschus esculentus (L.) Moench, is an example of such a plant.
    Examples for the medical use are treatment of gastric irritation, treatment of dental
    diseases, lowering cholesterol

  10. WATER AND PHYSIOLOGICAL RESPONSES OF OKRA ...

    African Journals Online (AJOL)

    H. Rahim Guealia

    1 sept. 2017 ... for agricultural production. ... bentonite (WB) under controlled greenhouse conditions. ..... esculentus L.) âgées de deux mois cultivé sur substrat sans ..... Kırnak H et Taş I. Amelioratrive effect of calcium nitrate on cucumber.

  11. On the botanical distribution of chiral forms of gossypol

    DEFF Research Database (Denmark)

    Jaroszewski, J W; Strøm-Hansen, T; Hansen, S H

    1992-01-01

    to the cotton tribe (Gossypieae) contained gossypol (detection limit better than 0.001%). In particular, no gossypol could be detected in ABELMOSCHUS ESCULENTUS (ocra), HIBISCUS TILIACEUS, H. SABDARIFFA, and HEREA BRASI-LIENSIS, earlier claimed to contain this compound. Gossypol-containing plants usually...

  12. effect of the liming materials and rates on plant growth and nutrient ...

    African Journals Online (AJOL)

    Mrs Ify Greg Onwuka

    (Elaeis guineensis), raphia palm (Raphia spp), cocoyam (Colocasia esculentus), avocado tree (Persea. Americana), shrubs (mainly Sponelias munibin) and sparsely distributed grasses. The upland farm close to this stream was grown to cassava (Manihot esculenta), pepper (Capsicum spp), and yam (Dioscorea spp). The.

  13. Nutrient elements distribution in cultivated and uncultivated soils ...

    African Journals Online (AJOL)

    The Okai stream was surrounded by a three-year old fallow land dominated by oil palm (Elaeis guineensis), raphia palm (Raphia spp), cocoyam (Colocasia esculentus), avocado tree (Persea Americana), shrubs (mainly Sponelias munibin) and sparsely distributed grasses. The upland farm close to this stream was grown to ...

  14. Effects of spacing on the growth and yield of Okra ( Abelmochus ...

    African Journals Online (AJOL)

    The effects of plant population on growth and yield of Okra (Abelmoschus esculentus L. Moench) was investigated for two planting seasons (2008 and 2009) in the teaching and research farm, Department of Agronomy, Cross River University of Technology, Obubra . Treatments were five Okra plant populations : 111,111, ...

  15. Macro and Trace Element Accumulation in Edible Crabs and Frogs ...

    African Journals Online (AJOL)

    The tissue accumulation of five macroelements (Na, Mg, K, Ca, Fe) and twelve trace elements (Vd, Mn, Co, Ni, Cu, Zn, As, Se, Mo, Ag, Cd, Pb) were assessed in the organs of the edible frogs; Xenopus laevis and Rana esculentus, and whole body of the crab, Callinestes caught from Alaro Stream Floodplain (Ibadan, ...

  16. Beneficial effect of medicinal plants on the contractility of post-hypoxic isolated guinea pig atria - Potential implications for the treatment of ischemic-reperfusion injury

    NARCIS (Netherlands)

    Bipat, Robbert; Toelsie, Jerry R.; Magali, Indira; Soekhoe, Rubaina; Stender, Karin; Wangsawirana, Angelique; Oedairadjsingh, Krishan; Pawirodihardjo, Jennifer; Mans, Dennis R. A.

    Context Ischemic-reperfusion injury is accompanied by a decreased contractility of the myocardium. Positive-inotropic agents have proven useful for treating this condition but may exert serious side-effects.Objective In this study, aqueous preparations from Abelmoschus esculentus L. Moench

  17. Effect of animal manures on soil properties, growth, nutrients status ...

    African Journals Online (AJOL)

    A comparative field study was carried out at two sites in Akure, Southwest Nigeria to determine effect of different animal manures on soil physical and chemical properties and performance of tomato (Lycopersicm esculentus Mill). Analysis of cattle (CM), goat (GM), pig (PG) and poultry (PM) manures showed that N, K, Ca ...

  18. Effects of different traditional cooking methods on nutrients and ...

    African Journals Online (AJOL)

    The objective of this research was to determine the effect of cooking using two different methods of preparing okra soup in Ondo state on nutrient, mineral content including zinc bioavailability of okra, Abelmoschus esculentus. The okra fruits were grated and divided into four lots; two lots were cooked with other ingredients of ...

  19. Growth Responses of Two Cultivated Okra Species (Abelmoschus ...

    African Journals Online (AJOL)

    Abelmoschus esculentus was investigated using six accessions; three for each species in crude oil contaminated soil. The seeds ..... industrial waste. Environmental and Experimental. Botany, 52.79-88. Siemonsma, J. S and Hamon, S. (2002). Abelmoschus caillei (A. chev) Stevels. In: Oyen, L.P.A. and. Lemmens R.H.M. ...

  20. Phytochemical screening and nutrient-antinutrient composition of ...

    African Journals Online (AJOL)

    Levels of some nutrients and antinutrients in 14 commonly consumed tropical green leafy vegetables were evaluated and also screened for some phytochemicals. Saponin was present in all the vegetables with the exception of Hibiscus esculentus, Solanum macrocarpon and Piper guineese while only tannin was absent in ...

  1. African Journal of Biotechnology - Vol 10, No 54 (2011)

    African Journals Online (AJOL)

    Morphological classification of genetic diversity in cultivated okra, Abelmoschus esculentus (L) Moench using principal component analysis (PCA) and single ... Evaluation of 14 winter bread wheat genotypes in normal irrigation and stress conditions after anthesis stage · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  2. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. SUBRATA DUTTA. Articles written in Journal of Genetics. Volume 97 Issue 1 March 2018 pp 25-33 RESEARCH ARTICLE. Genetic control of yellow vein mosaic virus disease tolerance in Abelmoschus esculentus (L.) Moench · PUSHPARANI SENJAM BIJOY KUMAR SENAPATI ARUP ...

  3. Author Details

    African Journals Online (AJOL)

    Nwaoguala, CNC. Vol 15, No 2 (2015) - Articles Influence by artificial defoliation and NPK fertilizer application on growth and yield of Okra (Abelmoschus esculentus (L) Moench) Abstract PDF. ISSN: 1684-5374. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...

  4. Physicochemical and Sensory Properties, and In-Vitro Digestibility of ...

    African Journals Online (AJOL)

    Physicochemical and Sensory Properties, and In-Vitro Digestibility of Biscuits Made from Blends of Tigernut ( Cyperus esculentus ) and Pigeon Pea ( Cajanus cajan ) ... Nigerian Journal of Nutritional Sciences ... Objective: The study explored the potential of tigernut and pigeon pea flour blends in the preparation of biscuits.

  5. Fulltext PDF

    Indian Academy of Sciences (India)

    2015-04-20

    Apr 20, 2015 ... 2011). The effect of the composition may be due to the presence of Hibiscus esculentus ... Prospects for preventive anti-aging measures. Compared to ... Furthermore, a pulsed electric field has also been reported in the patent literature to ..... stem cells after radiofrequency treatment for aging skin. Dermatol.

  6. Prevalence, incidence and progression of lumbar spondylosis by gender and age strata.

    Science.gov (United States)

    Muraki, Shigeyuki; Yoshimura, Noriko; Akune, Toru; Tanaka, Sakae; Takahashi, Ikuno; Fujiwara, Saeko

    2014-07-01

    To identify the prevalence, incidence and progression of radiographic lumbar spondylosis (LS). From the Adult Health Study conducted by the Radiation Effects Research Foundation, 1,204 participants aged 44-85 years who had lumbar spine radiographs in 1990-1992 were reexamined in 1998-2000 (mean 7.9-year interval). The radiographic severity of LS was determined by Kellgren/Lawrence (KL) grading. In the overall population, the prevalence of radiographic KL ≥ 2 and ≥ 3 LS was 52.9% and 23.6%, respectively. KL ≥ 2 LS was more prevalent in men, whereas KL ≥ 3 LS was more prevalent in women. During the 8-year follow-up, the incidence of KL ≥ 2 LS in men and women was 65.5% and 46.6%, that of KL ≥ 3 LS was 27.3% and 29.5%, that of progressive LS was 31.3% and 34.0%, and multilevel LS was 44.9% and 33.4%, respectively. Body-mass index was a risk factor for both KL ≥ 2 and KL ≥ 3 LS, after adjusting for age and sex. The present longitudinal study revealed the prevalence, incidence and progression of radiographic LS. Prevalence and incidence of KL ≥ 2 LS was higher in men than women, while, those of KL ≥ 3 were similar between men and women.

  7. Wound healing delays in α-Klotho-deficient mice that have skin appearance similar to that in aged humans - Study of delayed wound healing mechanism.

    Science.gov (United States)

    Yamauchi, Makoto; Hirohashi, Yoshihiko; Torigoe, Toshihiko; Matsumoto, Yoshitaka; Yamashita, Ken; Kayama, Musashi; Sato, Noriyuki; Yotsuyanagi, Takatoshi

    2016-05-13

    Skin atrophy and delayed wound healing are observed in aged humans; however, the molecular mechanism are still elusive. The aim of this study was to analyze the molecular mechanisms of delayed wound healing by aging using α-Klotho-deficient (kl/kl) mice, which have phenotypes similar to those of aged humans. The kl/kl mice showed delayed wound healing and impaired granulation formation compared with those in wild-type (WT) mice. The skin graft experiments revealed that delayed wound healing depends on humoral factors, but not on kl/kl skin tissue. The mRNA expression levels of cytokines related to acute inflammation including IL-1β, IL-6 and TNF-α were higher in wound lesions of kl/kl mice compared with the levels in WT mice by RT-PCR analysis. LPS-induced TNF-α production model using spleen cells revealed that TNF-α production was significantly increased in the presence of FGF23. Thus, higher levels of FGF23 in kl/kl mouse may have a role to increase TNF-α production in would lesion independently of α-Klotho protein, and impair granulation formation and delay wound healing. Copyright © 2016 Elsevier Inc. All rights reserved.

  8. Genetic analysis of a Y-chromosome region that induces triplosterile phenotypes and is essential for spermatid individualization in Drosophila melanogaster.

    Science.gov (United States)

    Timakov, B; Zhang, P

    2000-01-01

    The heterochromatic Y chromosome of Drosophila melanogaster contains approximately 40 Mb of DNA but has only six loci mutable to male sterility. Region h1-h9 on YL, which carries the kl-3 and kl-5 loci, induces male sterility when present in three copies. We show that three separate segments within the region are responsible for the triplosterility and have an additive effect on male fertility. The triplosterile males displayed pleiotropic defects, beginning at early postmeiotic stages. However, the triplosterility was unaffected by kl-3 or kl-5 alleles. These data suggest that region h1-h9 is complex and may contain novel functions in addition to those of the previously identified kl-3 and kl-5 loci. The kl-3 and kl-5 mutations as well as deficiencies within region h1-h9 result in loss of the spermatid axonemal outer dynein arms. Examination using fluorescent probes showed that males deficient for h1-h3 or h4-h9 displayed a postmeiotic lesion with disrupted individualization complexes scattered along the spermatid bundle. In contrast, the kl-3 and kl-5 mutations had no effect on spermatid individualization despite the defect in the axonemes. These results demonstrate that region h1-h9 carries genetically separable functions: one required for spermatid individualization and the other essential for assembling the axonemal dynein arms. PMID:10790393

  9. Identifikace klíčových faktorů úspěchu internacionalizace malých a středních firem podnikajících v oboru strojírenství

    Directory of Open Access Journals (Sweden)

    Lea Kubíčková

    2013-11-01

    Full Text Available Purpose of the article: The small and medium enterprises (SMEs are very important part of the Czech economy, the situation of SMEs is currently more difficult because of the economical crisis, therefore the increased attention is drawn to them. The paper is focused on the internationalization of SMEs, especially on identifying key success factors of small and medium-sized companies that do business in engineering industry. Scientific aim: The authors focused on the specification of the most important aspects of the internationalization of Czech engineering small and medium enterprises. Methodology/methods: Authors realized due to several years survey among various small and medium sized enterprises, that the internationalization process of SMEs in different fields have different characteristics, therefore, attention was particularly stiff in engineering. Based on a survey of engineering SMEs operating in foreign markets the authors tried to determine what is typical for a successful company, what are their common features and what could be generalized and recommend to other small and medium-sized enterprises. Findings: It was found that the most successful SMEs chose a direct export as an ideal form of entry into foreign markets. Furthermore, it was found that one of the key success factors of SMEs in the foreign market is the ability to adapt to foreign market, especially on price and product. From long-term perspective are the most successful small and medium engineering businesses, which maintain its market share through pricing policy tools. Conclusions: Based on a survey among SMEs, which operate in foreign markets, the finds examined whether firms that are successful on foreign markets, have some common features that could be generalized as determinants of success of the internationalization process in the engineering industry. Most of the SMEs, which in foreign markets successfully operating, there are a limited liability company, which as a form of entry into foreign markets have chosen direct exports. Research indicates that for success on foreign markets is not affected by the use of aids and subsidies, while one of the key success factors appear capable of adapting to foreign market. The most successful are those on foreign markets engineering SMEs that maintain or increase its market share through pricing policy tools. In the long run is important for SMEs, the fact that manufacturing firms in engineering put increasing emphasis on research and development, which becomes a competitive advantage.

  10. Benediktinské opatství sv. Petra a Pavla ve Vilémově. Příspěvek k historii a stavební podobě "zapomenutého" kláštera pod Železnými horami

    Czech Academy of Sciences Publication Activity Database

    Kovář, M.; Musílek, Martin

    2009-01-01

    Roč. 117, č. 3 (2009), s. 157-183 ISSN 1803-1382 Grant - others:AV ČR(CZ) M300090903 Institutional research plan: CEZ:AV0Z90090514 Keywords : Bohemia * Middle Ages * Vilémov * monastery of Vilémov * Benedictine * Benedictine abbey Subject RIV: AA - Philosophy ; Religion

  11. Presence of Human Bocavirus 1 in Hospitalised Children with Acute Respiratory Tract Infections in Latvia and Lithuania / Cilvēka Bokavīrusa 1 Klātbūtne Latvijā Un Lietuvā Hospitalizētiem Bērniem Ar Akūtām Elpceīu Slimībām

    Directory of Open Access Journals (Sweden)

    Nora-Krūkle Zaiga

    2016-08-01

    Full Text Available Human bocavirus 1 (HBoV1 is a parvovirus recently found to be a possible aetiologic agent of acute respiratory disease in children. We conducted the first clinical and molecular study on this virus in Latvia (LV and Lithuania (LT. The aim of the study was to determine the occurrence of HBoV1 in respiratory tract samples taken from hospitalised children with acute respiratory tract infections in LV and LT. In total 186 children with age one to 50 months, and who fulfilled criteria of acute respiratory tract infection, including lower respiratory tract infections, with or without fever, were included in this study. A nasopharyngeal aspirate was obtained from each patient on admission. DNA was isolated and polimerase chain reaction (PCR performed targeting the HBoV1 NS1sequence. HBoV1 positive samples were sequenced and phylogenetic analysis was performed. HBoV1 sequence was detected in 42 (32% of 130 LV and in 8 (14% of 56 LT samples. In LV the majority of patients with HBoV1 infection were observed in February while in LT in October. The phylogenetic tree for HBoV1 indicated that isolates of HBoV1 cluster closely and include almost all of the isolates in this study. HBoV1 is common in Latvia and Lithuania and might be a significant pathogen that contributes to acute respiratory tract infections in children.

  12. Na okraj k opomíjeným architektonickým formám raně gotického presbytáře augustiniánského (dříve vilemitského) kláštera v Pivoni

    Czech Academy of Sciences Publication Activity Database

    Kovář, Miroslav

    -, č. 51 (2016), s. 201-221 ISSN 0544-3830 R&D Projects: GA ČR(CZ) GA16-06083S Institutional support: RVO:67985955 Keywords : construction history * Pivoň * Augustinians * monastery * presbytary * architecture * middle ages Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  13. Farklı Isıl İşlem Görmüş İnek Sütlerinden Kefir Kültürü ve Tanesi ile Üretilen Kefirlerin Nitelikleri ve Dayanıklılığı Üzerine Araştırmalar

    Directory of Open Access Journals (Sweden)

    Ergin Oktar

    2015-02-01

    Full Text Available Kaynatılmış, pastörize ve sterilize inek sütlerine ayrı ayrı kefir tanesi ve kefir kültürü aşılanarak üretilen kefirlerin depolamanın 1., 6 ve 9. günlerinde fiziksel, kimyasal ve duyusal analizleri yapılmıştır. Kefir örneklerinin depolama süresince pH’ları düşmüş, asitlikleri yükselmiştir. Kefir üretiminde yağ, protein ve laktoz miktarlarında azalma görülmüştür. Depolamada yağ miktarı değişmezken protein ve laktoz miktarında az da olsa azalma görülmüştür. Serbest yağ asitleri gerek üretim gerekse depolama boyunca artış göstermiştir. Tane ile üretilen kefirlerde maya miktarı kültür ile üretilenlere göre daha fazladır. Alkol, asetaldehit ve aseton kefir üretimi sırasında oluşmuş, depolama sırasında artış göstermiştir. Tüm kefir örnekleri depolama süresince duyusal değerlendirmede beğeni kazanmıştır. Kefir kalitesinin; tane ve kültürü aşılama oranına, inkübasyon sıcaklığı ve süresine, katılan sütün bileşim ve uygulanan ısıl işleme bağlı olduğu belirlenmiştir.

  14. Mersin’de Faaliyet Gösteren Küçük ve Orta Büyüklükteki İşletmelerin Yenilik Faaliyetlerinin Ölçülmesi = The Measurement of the Innovative Actions of SMEs’ which are Located in Mersin

    Directory of Open Access Journals (Sweden)

    Ayşe ŞAHİN

    2009-06-01

    Full Text Available In recent years, businesses are realizing important innovation functions in order to maintain a progressive profit and to have a long life-time. In the first part of this study, innovation, invention and creativity concepts are defined, types of innovation are explained. And then, the importance of innovation functions of SMEs’ in their development and institutionalization are analyzed. In the second part, a field survey about innovation functions of 260 SMEs’ in Mersin is conducted. Data are collected by questionnaire forms and tested with Chi-Square Independence Analysis. At the end of the research, it has been concluded that, ninty-six SMEs’ are realizing innovation function in Mersin. The most important reason of SMEs’ for innovation function is to reduce material wastes and expenses. Also, the factors effecting non-innovativeness are the lack of financial resources and qualified personnel.

  15. Rukopis kartuziánského kláštera v Tržku ve vatikánské knihovně Palatina a nové poznatky k osobě zakladatele tržecké kartouzy Alberta ze Šternberka

    Czech Academy of Sciences Publication Activity Database

    Petr, Stanislav

    41 /2011/, č. 0 (2012), s. 19-56 ISSN 0585-5691 R&D Projects: GA ČR GAP405/12/1412 Institutional research plan: CEZ:AV0Z80770509 Keywords : Carthusians * libraries * manuscripts Subject RIV: AB - History

  16. Konventní kostel kláštera cisterciáků v Sedlci: položení základního kamene českým králem Václavem II. roku 1304

    Czech Academy of Sciences Publication Activity Database

    Doležel, Jiří

    2015-01-01

    Roč. 7, č. 2 (2015), s. 195-210 ISSN 1804-0977 Institutional support: RVO:68081758 Keywords : Sedlec near Kutná Hora * Cistercian abbey * Convent Church of Our Lady * Bohemian King Wenceslas II. * Gothic architecture Subject RIV: AC - Archeology, Anthropology, Ethnology

  17. Vasarinių miežių ir žieminių kviečių sėklų įterpimo diskiniais sėjamųjų noragėliais į skirtingai įdirbtas dirvas tyrimai

    OpenAIRE

    Kulvinskaitė, Inga

    2006-01-01

    There are presented the following parts in the final master diploma work: introduction, 5 chapters, conslusions and list of literature. Total coverage of diploma work - 68 pages, including 59 pictures and 6 charts. There are presented sources or 24 information. The goal of diploma work - to range of the insert of the summer barley and winter wheat seeds with disc seeding maschine ploughshares in difeferently cultivated soils.

  18. Optimalizace nákupu a prodeje měnového páru EUR/USD pomocí genetických algoritmů jako klíč ke zvyšování ziskovosti investiční strategie

    Directory of Open Access Journals (Sweden)

    Jan Budík

    2013-10-01

    Full Text Available Purpose of the article: The aim of this paper is to show the possibility of increasing the profitability of selected investment strategy, which is used for trading currency pair EUR/USD. Model strategy is based on the assumption of continuing the trend yesterday, and only works with the days when the price rose. In the event that the trend of rising yesterday’s, so at the beginning of the current buy is made and the current at the end of the sell is made. In the long term this investment strategy unprofitable. The research in this paper works with possibilities placement optimization buy order to the market so that long-term strategy was profitable. Due to the computationally intensive tasks are used genetic algorithms to significantly reduce the time for finding the optimal values of selected parameters. Methodology/methods: Method study the currency pair EUR/USD is done using technical analysis. To enter investment position, the method based on the momentum of price movements and its subsequent sequels. The original proposal of a long-term strategy is not profitable and increase profitability using methods strategy is modified into a form that generates a long-term gain. Scientific aim: Scientific contribution of this paper is the implementation of genetic algorithms in the process of increasing the profitability of investment strategies. This is achieved by adding an additional parameter to specify entry into investment position. Findings: The analysis and optimization were found optimal parameter values for the modification of the original strategy. These parameters include the precise timing of input in terms of hours, as well as making a buy at a discounted price using the LIMIT order. Due to the implementation of financial leverage is necessary to secure positions with automatic order to exit positions at a loss. Selection of positions with a higher probability of profit is secured by a rule that allows the current trading day only yesterday when he was big enough difference between the opening and closing price. Conclusions: Modified strategy is used in the simulation to account for the size of $ 50.000. During the period from 1. 1. 2009 to 31. 12. 2012 evaluate the account to $ 67.722, an increase of 35,45%.

  19. Reaktivita N-chráněných 3-amino-1,2-epoxy-4-fenylbutanů, klíčových synthonů pro přípravu hyroxyethylaminových isosterů peptidové vazby

    Czech Academy of Sciences Publication Activity Database

    Hradilek, Martin

    2002-01-01

    Roč. 96, č. 4 (2002), s. 218 ISSN 0009-2770. [ Sigma -Aldrich konference mladých chemiků, biochemiků a molekulárních biologů. 22.05.2002-25.05.2002, Velké Meziříčí] R&D Projects: GA ČR GP203/02/P095 Institutional research plan: CEZ:AV0Z4055905 Key words : hyroxyethylamine isosters Subject RIV: CE - Biochemistry

  20. Augustiniánská knihovna u sv. Tomáše v Praze. I. část: Od založení kláštera do počátku 16. století

    Czech Academy of Sciences Publication Activity Database

    Sladká, Veronika

    2016-01-01

    Roč. 23, 1/2 (2016), s. 127-146 ISSN 1210-8510 Institutional support: RVO:67985971 Keywords : Augustinian convent of Saint Thomas in Prague * monastic libraries * provenance research * library history * librarian practice in the Order of Saint Augustine * Codex Thomaeus Subject RIV: AB - History

  1. A New Approach to Solve Flowshop Scheduling Problems by Artificial Immune Systems = Akış Tipi Çizelgeleme Problemlerinin Yapay Bağışıklık Sistemleri ile Çözümünde Yeni Bir Yaklaşım

    Directory of Open Access Journals (Sweden)

    Alper DÖYEN

    2007-01-01

    Full Text Available The n-job, m-machine flow shop scheduling problem is one of the most general job scheduling problems. This study deals with the criteria of makespan minimization for the flow shop scheduling problem. Artificial Immune Systems (AIS are new intelligent problem solving techniques that are being used in scheduling problems. AIS can be defined as computational systems inspired by theoretical immunology, observed immune functions, principles and mechanisms in order to solve problems. In this research, a computational method based on clonal selection principle and affinity maturation mechanisms of the immune response is used. The operation parameters of meta-heuristics have an important role on the quality of the solution. Thus, a generic systematic procedure which bases on a multi-step experimental design approach for determining the efficient system parameters for AIS is presented. Experimental results show that, the artificial immune system algorithm is more efficient than both the classical heuristic flow shop scheduling algorithms and simulated annealing.

  2. Kleč a smilka - klíčoví hráči vývoje alpínského bezlesí Krkonoš (Vysoké Sudety, Česká republika)

    Czech Academy of Sciences Publication Activity Database

    Štursa, J.; Wild, Jan

    2014-01-01

    Roč. 2014, č. 51 (2014), s. 5-36 ISSN 0139-925X R&D Projects: GA ČR GA205/06/0587; GA ČR GAP209/10/0519 Institutional support: RVO:67985939 Keywords : arcto-alpine tundra * Pinus mugo * management Subject RIV: EF - Botanics

  3. Türkiye'deki Drama Ağırlıklı Matematik Öğretimi Çalışmaları Üzerine Bir Değerlendirme/ An Evaluatıon of Drama Orıented Mathematıcs Teachıng Studıes In Turkey

    OpenAIRE

    Kayhan, Hüseyin Cahit

    2013-01-01

    Bu çalışmada alan yazın taraması yapılarak Türkiye'de Matematik öğretiminde drama, dramatizasyon ve yaratıcı drama yönteminin yeri nedir?” sorusuna yanıt aranmıştır. İlgili literatür incelemesi doğrultusunda drama, dramatizasyon ve yaratıcı dramanın öğretim açısından önemi ve özellikle Türkiye'de matematik öğretiminde yaratıcı dramanın bir yöntem olarak kullanılması ile ilgili yapılmış araştırmalar değerlendirilmiştir. Matematik, soyut kavramların kazanılmasındaki zorluklardan dolayı öğrencil...

  4. Türkiye'deki Drama Ağırlıklı Matematik Öğretimi Çalışmaları Üzerine Bir Değerlendirme/ An Evaluatıon of Drama Orıented Mathematıcs Teachıng Studıes In Turkey

    OpenAIRE

    Kayhan, Hüseyin

    2013-01-01

    Bu çalışmada alan yazın taraması yapılarak Türkiye'de Matematik öğretiminde drama, dramatizasyon ve yaratıcı drama yönteminin yeri nedir?” sorusuna yanıt aranmıştır. İlgili literatür incelemesi doğrultusunda drama, dramatizasyon ve yaratıcı dramanın öğretim açısından önemi ve özellikle Türkiye'de matematik öğretiminde yaratıcı dramanın bir yöntem olarak kullanılması ile ilgili yapılmış araştırmalar değerlendirilmiştir. Matematik, soyut kavramların kazanılmasındaki zorluklardan dolay...

  5. Studentų odontologų, besiskundžiančių viršutinės nugaros dalies skausmu, fizinės būklės ir jaučiamo skausmo kaita taikant kinezioteipavimo metodą

    OpenAIRE

    Bagdonas, Justas

    2016-01-01

    Aim -to identify physical status and pain intensity changes after kinesiotaping in students dentists, who suffer from upper back pain. Objectives: 1. To assess pain intensity changes after kinesiotaping method. 2. To assess physical status changes after kinesiotaping method. Methods: basic questionnaire;Neck Disability index;questionnaire on The Disabilities of the Arm, Shoulder and Hand;Numeric Pain Rating Scale; questionnaire on headache; kinesiotaping. Survey participants: Stud...

  6. Mevsimlik Tarım İşçisi Gençlerin Sağlıklı Yaşam Bilgi ve Davranışlarına Akran Eğitiminin Etkisi/The Effect of Peer Education on the Healthy-Life Knowledge and Behavior of Young Seasonal Farmworkers

    Directory of Open Access Journals (Sweden)

    Zeynep Simsek

    2013-04-01

    Full Text Available Objective: To evaluate the effects of peer education on young seasonal farmworkers’ healthy life knowledge and behavior related to living arrangement, pesticide use, and reproductive - sexual health.Method: In this controlled-experimental design study, two settlements with similar characteristics were selected experiment and control group. Twenty six youths from experimental area were selected and trained as peer educator. One-hundred young people from among the 650 in that neighborhood that received training were randomly selected and compared with the control group, which consisted of 125 youths. For data collection, a questionnaire developed by the authors was used. The questionnaires were applied in face-to-face interview. A total of 113 young people were reached in the intervention group (response rate 90%, and 118 young people were reached in the control group (response rate 94%. It was used t-test, chi-square and analyses of variance for statistical analyses.Findings: No significant differences were detected between the intervention and control groups with regards to age, gender, duration of work as farmworkers or level of education (p>0.05. The difference between the total scores of the intervention and control groups (respectively;50.8±8.6- 27.2±9.1 and the scores of sub domains were significant (p<0.05. In addition, the frequency of use of iodized salt, vaccination, hand-washing, breast self examination and testicular self examination was significantly higher in the intervention group.Conclusion: The peer education model could be of use in the development of healthy life skills among young seasonal farmworkers.

  7. Allatio capillorum Beatae Mariae Virginis: chorální liturgie neznámého mariánského svátku v klášteře sv. Jiří v Praze

    Czech Academy of Sciences Publication Activity Database

    Vozková, Jana

    2016-01-01

    Roč. 53, č. 4 (2016), s. 365-388 ISSN 0018-7003 Institutional support: RVO:68378076 Keywords : plainchant * medieval liturgy * benedictine convents Subject RIV: AL - Art, Architecture, Cultural Heritage

  8. La regulación de la biosíntesis de hemo en Kluyveromyces lactis: regulación transcripcional de los genes KIHEM1, KlHEM12 y análisis comparativo de los factores reguladores Hap1p y Srb10p en levaduras.

    OpenAIRE

    Núñez-Naveira, Laura

    2011-01-01

    [Resumen] Kluyveromyces lactis es una levadura de elevado interés biotecnológico que se diferencia de la levadura tradicional de estudio Saccharomyces cerevisiae en diversos aspectos de su metabolismo. Mientras que en condiciones de aerobiosis y con glucosa como fuente de carbono K. lactis posee un metabolismo fundamentalmente respirativo, S. cervisiae lo tiene fermentativo en el mismo contexto. Estas diferencias metabólicas podrían ser el reflejo de una diferente regulación transcrip...

  9. Serum periostin is associated with prevalent knee osteoarthritis and disease incidence/progression in women: the OFELY study.

    Science.gov (United States)

    Rousseau, J C; Sornay-Rendu, E; Bertholon, C; Garnero, P; Chapurlat, R

    2015-10-01

    Our aim was to investigate the relationships between serum periostin (POSTN) and both prevalence and incidence/progression of knee osteoarthritis (OA) in women. We investigated 594 women (62.7 ± 11.2 yr) from the OFELY cohort. Knee radiographs were scored according to the Kellgren & Lawrence (KL) grading system at baseline and 4 years later. Spine, hip and hand OA were assessed at baseline. Prevalent knee OA was defined by a KL score higher or equal in 2. Progression of KL was defined as an increase of the KL score ≥1 during the 4 years follow-up. Serum POSTN was measured at baseline by ELISA. By non-parametric tests, POSTN was significantly lower in 83 women with a KL score ≥2 at baseline, compared to those with a KL score women. Copyright © 2015 Osteoarthritis Research Society International. Published by Elsevier Ltd. All rights reserved.

  10. A homozygous missense mutation in human KLOTHO causes severe tumoral calcinosis

    Science.gov (United States)

    Ichikawa, Shoji; Imel, Erik A.; Kreiter, Mary L.; Yu, Xijie; Mackenzie, Donald S.; Sorenson, Andrea H.; Goetz, Regina; Mohammadi, Moosa; White, Kenneth E.; Econs, Michael J.

    2007-01-01

    Familial tumoral calcinosis is characterized by ectopic calcifications and hyperphosphatemia due to inactivating mutations in FGF23 or UDP-N-acetyl-α-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GALNT3). Herein we report a homozygous missense mutation (H193R) in the KLOTHO (KL) gene of a 13-year-old girl who presented with severe tumoral calcinosis with dural and carotid artery calcifications. This patient exhibited defects in mineral ion homeostasis with marked hyperphosphatemia and hypercalcemia as well as elevated serum levels of parathyroid hormone and FGF23. Mapping of H193R mutation onto the crystal structure of myrosinase, a plant homolog of KL, revealed that this histidine residue was at the base of the deep catalytic cleft and mutation of this histidine to arginine should destabilize the putative glycosidase domain (KL1) of KL, thereby attenuating production of membrane-bound and secreted KL. Indeed, compared with wild-type KL, expression and secretion of H193R KL were markedly reduced in vitro, resulting in diminished ability of FGF23 to signal via its cognate FGF receptors. Taken together, our findings provide what we believe to be the first evidence that loss-of-function mutations in human KL impair FGF23 bioactivity, underscoring the essential role of KL in FGF23-mediated phosphate and vitamin D homeostasis in humans. PMID:17710231

  11. Turbulence effects on volatilization rates of liquids and solutes

    Science.gov (United States)

    Lee, J.-F.; Chao, H.-P.; Chiou, C.T.; Manes, M.

    2004-01-01

    Volatilization rates of neat liquids (benzene, toluene, fluorobenzene, bromobenzene, ethylbenzene, m-xylene, o-xylene, o-dichlorobenzene, and 1-methylnaphthalene) and of solutes (phenol, m-cresol, benzene, toluene, ethylbenzene, o-xylene, and ethylene dibromide) from dilute water solutions have been measured in the laboratory over a wide range of air speeds and water-stirring rates. The overall transfer coefficients (KL) for individual solutes are independent of whether they are in single- or multi-solute solutions. The gas-film transfer coefficients (kG) for solutes in the two-film model, which have hitherto been estimated by extrapolation from reference coefficients, can now be determined directly from the volatilization rates of neatliquids through anew algorithm. The associated liquid-film transfer coefficients (KL) can then be obtained from measured KL and kG values and solute Henry law constants (H). This approach provides a novel means for checking the precision of any kL and kG estimation methods for ultimate prediction of KL. The improved kG estimation enables accurate K L predictions for low-volatility (i.e., low-H) solutes where K L and kGH are essentially equal. In addition, the prediction of KL values for high-volatility (i.e., high-H) solutes, where KL ??? kL, is also improved by using appropriate reference kL values.

  12. Dicty_cDB: AFJ783 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lvnfkvvtl*clqtkmkk*rnqflkanthhkgr dyqmltn*iiivkkpiwi*kl*nnnnnnnicklkidinniinnsnnk...ll Frames) Frame A: lvykf*ttkisinnffyi*nltqtlik*ithitpitrell*iiiinitiiitiiiiiiit tiitkellyqihqknpfskmps*psqm

  13. Infrared spectra of 4HeH+, 4HeD+, 3HeH+, and 3HeD+

    International Nuclear Information System (INIS)

    Crofton, M.W.; Altman, R.S.; Haese, N.N.; Oka, T.

    1989-01-01

    Isotopic species of the HeH + molecular ion provide an excellent testing ground for studying isotopic dependence of vibration--rotation constants because of the small masses of He and H isotopes. We have observed infrared spectra of the hot band v=2 left-arrow 1 of HeH + and fundamental bands of isotopic species HeD + , 3 HeH + , and 3 HeD + , and obtained the Dunham coefficients Y kl , and the isotopically independent parameters U kl , Δ He kl , and Δ H kl

  14. Turbulence effects on volatilization rates of liquids and solutes.

    Science.gov (United States)

    Lee, Jiunn-Fwu; Chao, Huan-Ping; Chiou, Cary T; Manes, Milton

    2004-08-15

    Volatilization rates of neat liquids (benzene, toluene, fluorobenzene, bromobenzene, ethylbenzene, m-xylene, o-xylene, o-dichlorobenzene, and 1-methylnaphthalene) and of solutes (phenol, m-cresol, benzene, toluene, ethylbenzene, o-xylene, and ethylene dibromide) from dilute water solutions have been measured in the laboratory over a wide range of air speeds and water-stirring rates. The overall transfer coefficients (K(L)) for individual solutes are independent of whether they are in single- or multi-solute solutions. The gas-film transfer coefficients (kG) for solutes in the two-film model, which have hitherto been estimated by extrapolation from reference coefficients, can now be determined directly from the volatilization rates of neat liquids through a new algorithm. The associated liquid-film transfer coefficients (kL) can then be obtained from measured K(L) and kG values and solute Henry law constants (H). This approach provides a novel means for checking the precision of any kL and kG estimation methods for ultimate prediction of K(L). The improved kG estimation enables accurate K(L) predictions for low-volatility (i.e., low-H) solutes where K(L) and kGH are essentially equal. In addition, the prediction of K(L) values for high-volatility (i.e., high-H) solutes, where K(L) approximately equal to kL, is also improved by using appropriate reference kL values.

  15. Prevalence of radiographic lumbar spondylosis and its association with low back pain in elderly subjects of population-based cohorts: the ROAD study.

    Science.gov (United States)

    Muraki, S; Oka, H; Akune, T; Mabuchi, A; En-Yo, Y; Yoshida, M; Saika, A; Suzuki, T; Yoshida, H; Ishibashi, H; Yamamoto, S; Nakamura, K; Kawaguchi, H; Yoshimura, N

    2009-09-01

    Although lumbar spondylosis is a major cause of low back pain and disability in elderly people, few epidemiological studies have been performed. The prevalence of radiographic lumbar spondylosis was investigated in a large-scale population study and the association with low back pain was examined. From a nationwide cohort study (Research on Osteoarthritis Against Disability; ROAD), 2288 participants aged > or =60 years (818 men and 1470 women) living in urban, mountainous and coastal communities were analysed. The radiographic severity at lumbar intervertebral levels from L1/2 to L5/S was determined by Kellgren/Lawrence (KL) grading. In the overall population the prevalence of radiographic spondylosis with KL> or =2 and > or =3 at the severest intervertebral level was 75.8% and 50.4%, respectively, and that of low back pain was 28.8%. Although KL> or =2 spondylosis was more prevalent in men, KL> or =3 spondylosis and low back pain were more prevalent in women. Age and body mass index were risk factors for both KL > or =2 and KL> or =3 spondylosis. Although KL = 2 spondylosis was not significantly associated with low back pain compared with KL = 0 or 1, KL> or =3 spondylosis was related to the pain only in women. This cross-sectional study in a large population revealed a high prevalence of radiographic lumbar spondylosis in elderly subjects. Gender seems to be distinctly associated with KL> or =2 and KL> or =3 lumbar spondylosis, and disc space narrowing with or without osteophytosis in women may be a risk factor for low back pain.

  16. In silico Analysis and Experimental Validation of Lignan Extracts from Kadsura longipedunculata for Potential 5-HT1AR Agonists.

    Directory of Open Access Journals (Sweden)

    Yaxin Zheng

    Full Text Available Kadsura longipedunculata (KL has been widely used for the treatment of insomnia in traditional Chinese medicine. The aim of this study was to explore the mechanism of the sedative and hypnotic effects of KL.The content of KL was evaluated by HPLC-TOF-MS, and a potential target was found and used to construct its 3D structure to screen for potential ligands among the compounds in KL by using bioinformatics analysis, including similarity ensemble approach (SEA docking, homology modeling, molecular docking and ligand-based pharmacophore. The PCPA-induced insomnia rat model was then applied to confirm the potential targets related to the sedative effects of KL by performing the forced swimming test (FST, the tail suspension test (TST and the measurement of target-related proteins using western blotting and immunofluorescence.Bioinformatics analysis showed that most of lignan compounds in KL were optimal ligands for the 5-HT1A receptor (5-HT1AR, and they were found to be potential targets related to sedative effects; the main lignan content of KL extracts was characterized by HPLC-TOF-MS, with 7 proposed lignans detected. Administration of KL could significantly reduce FST and TST immobility time in the PCPA-induced 5HT-depleted insomnia rat model. The expressions of proteins related to the 5-HT1AR pathway were regulated by extracts of KL in a concentration-dependent manner, indicating that extracts of KL had 5-HT1AR agonist-like effects.In silico analysis and experimental validation together demonstrated that lignan extracts from KL can target 5-HT1AR in insomniac rats, which could shed light on its use as a potential 5-HT1AR agonist drug.

  17. Taxonomic evaluation using pollen grain sculpture and seed coat characters of 11 taxa of genus Hibiscus (Malvaceae in Egypt

    Directory of Open Access Journals (Sweden)

    M.A. El-Kholy

    2011-06-01

    Full Text Available Pollen grain morphology and seed coat characters of 11 cultivars belonging to two species of genus Hibiscus (Family Malvaceae namely H. esculentus, H. abelmoschus and H. sabdariffa were investigated. This study was carried out using light microscope (LM and scanning electron microscopy (SEM. Pollen morphology of this genus is fairly uniform. Generally radially symmetrical apolar, mostly spheroidal, pantoporate. Seed exomorphic characters revealed four types of ornamentations; reticulate, ocealate, foveolate and ruminate. Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS–PAGE was employed to characterize those taxa. Thirty-one bands of seed protein profiles have been constructed from the gel. The produced dendrograms that were analyzed by STATISCA program using UPGMA clustering method showed a close affinity among the seven H. esculentus cultivars and the four H. sabdariffa cultivars.

  18. Prevalence of oral soft tissue lesions in out-patients at two Malaysian and Thai dental schools.

    Science.gov (United States)

    Axéll, T; Zain, R B; Siwamogstham, P; Tantiniran, D; Thampipit, J

    1990-04-01

    At the Faculties of Dentistry in Chiang Mai, Thailand (CM), and Kuala Lumpur, Malaysia (KL), 234 and 233 consecutive out-patients of mean ages 33.8 and 31.0 yr, respectively, were examined for the presence of oral mucosal lesions. Tobacco in some form was regularly used by 31.7% and 27.5% of the study populations in CM and KL, respectively. Cigarette smoking was the predominant habit. In CM three persons chewed betel quids and nine smoked banana leaf cigars daily. In addition, there were 24 habitual chewers of tea leaves (miang). In KL six persons chewed betel quids daily. In CM and KL three cases each (1.3%) of tobacco-associated leukoplakias were found. In KL an additional idiopathic leukoplakia was registered. One and three cases of betel related lesions were found in CM and KL, respectively. One case of a squamous cell carcinoma was found in a 45-yr-old Indian woman in KL who had been chewing betel with tobacco daily for many years. High prevalence figures were found for lichen planus, 3.8% in CM and 2.1% in KL, and an extremely high one, 48.3%, in CM for episodes of aphthous ulcers experienced during the last 2 yr. Comparatively low prevalence figures were found for herpes labialis. As could be expected melanin pigmentation was prevalent while only low figures were encountered for denture-related lesions and amalgam tattoos.

  19. Kroppen

    DEFF Research Database (Denmark)

    2002-01-01

    Et interaktivt undervisningsprogram om krop og idræt, edb og ergonomi. Til idræts- og klasselæreren. Fra 5.kl......Et interaktivt undervisningsprogram om krop og idræt, edb og ergonomi. Til idræts- og klasselæreren. Fra 5.kl...

  20. A chimeric LysK-lysostaphin fusion enzyme lysing Staphylococcus aureus cells: a study of both kinetics of inactivation and specifics of interaction with anionic polymers

    Science.gov (United States)

    A staphylolytic fusion protein (K-L) was created, harboring three unique lytic activities comprised of the LysK CHAP endopeptidase, and amidase domains, and the lysostaphin glycyl-glycine endopeptidase domain. To assess the potential of possible therapeutic applications, the kinetic behavior of K-L...

  1. Using an alignment of fragment strings for comparing protein structures

    DEFF Research Database (Denmark)

    Friedberg, Iddo; Harder, Tim; Kolodny, Rachel

    2007-01-01

    . RESULTS: Here we describe the use of a particular structure fragment library, denoted here as KL-strings, for the 1D representation of protein structure. Using KL-strings, we develop an infrastructure for comparing protein structures with a 1D representation. This study focuses on the added value gained...

  2. Dramatic Decline of Respiratory Illness Among US Military Recruits After the Renewed Use of Adenovirus Vaccines

    Science.gov (United States)

    2014-10-01

    editors consider relevant to the con- tent of the manuscript have been disclosed. References 1. Broderick MP, Hansen CJ, Russell KL. Exploration of...Russell KL, Broderick MP, Franklin SE, et al. Transmission dynamics and prospective environmental sampling of adenovirus in a military recruit setting

  3. Soot measurements for diesel and biodiesel spray combustion under high temperature highly diluted ambient conditions

    KAUST Repository

    Zhang, Ji; Jing, Wei; Roberts, William L.; Fang, Tiegang

    2014-01-01

    This paper presents the soot temperature and KL factor for biodiesel, namely fatty acid methyl ester (FAME) and diesel fuel combustion in a constant volume chamber using a two-color technique. The KL factor is a parameter for soot concentration

  4. Dicty_cDB: CHD673 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TKSSLIG*kfnsqishfrctk***stfiyk*ikki*rlsfs*sm *snifn*ttssnwypsa*yaicrwwfss*cgck*ld*ntwgilqkrfkrnywyslccrtw *stsfsgncid*gwnests...rwwfss*cgck*ld*ntwgilqkrfkrnywyslccrtw*st sfsgncid*gwnestsss*ihs*kkkrfn*y*tnsis*kl*kqkeifmqnhvnesfilyi i*mlk...k*ld*ntwgilqkrfkrnywyslccrtw *stsfsgncid*gwnestsss*ihs*kkkrfn*y*tnsis*kl*kqkeifmq

  5. First Responder Immersive Training Simulation Environment (FRITSE): Downwind Hazard Modeling of Scenarios

    Science.gov (United States)

    2014-07-31

    MODULE datatype !>>TYPE TYPE OUTPUT_TYPE INTEGER :: MX INTEGER :: IL, JL, KL INTEGER :: IG, JG, KG END TYPE...PARAMETER :: C_cutoff = 1.E-20 END MODULE datatype 21 in which (IL,JL,KL) and (IG,JG,KG) represent (I,J,K) indices in the local and

  6. Impact of Different Lignin Fractions on Saccharification Efficiency in Diverse Species of the Bioenergy Crop Miscanthus

    NARCIS (Netherlands)

    Weijde, van der Tim; Torres Salvador, Andres Francisco; Dolstra, Oene; Dechesne, Annemarie; Visser, Richard G.F.; Trindade, Luisa M.

    2016-01-01

    Lignin is a key factor limiting saccharification of lignocellulosic feedstocks. In this comparative study, various lignin methods—including acetyl bromide lignin (ABL), acid detergent lignin (ADL), Klason lignin (KL), and modified ADL and KL determination methods—were evaluated for their

  7. A short Introduction to Danish Hymnody

    DEFF Research Database (Denmark)

    Balslev-Clausen, Peter

    1988-01-01

    After a general introduction of Danish Hymnody an analysis of 4 Danish Hymns from Thomas Kingo to K.L. Aastrup, followed by a presentation of "Songs from Denmark"......After a general introduction of Danish Hymnody an analysis of 4 Danish Hymns from Thomas Kingo to K.L. Aastrup, followed by a presentation of "Songs from Denmark"...

  8. The CIE94 colour difference formula for describing visual detection thresholds in static noise

    NARCIS (Netherlands)

    Lucassen, M.P.; Bijl, P.

    2004-01-01

    The parametric factors kL, kC and kH that scale the CIELAB components kL*, kC* and kH* in the CIE94 colour difference formula are unity under reference conditions. When the conditions are changed, the scaling factors may be adapted to account for the influence of specific experimental conditions on

  9. Loaded versus unloaded magnetic resonance imaging (MRI of the knee: Effect on meniscus extrusion in healthy volunteers and patients with osteoarthritis

    Directory of Open Access Journals (Sweden)

    Rina Patel

    2016-01-01

    Conclusion: Our study demonstrated that medial meniscal extrusion significantly increased during loading, specifically in those low KL scores (0 and 1 and in KL score of 3. Loaded MRI may more accurately determine the extent of medial meniscal extrusion in particular in those with no to minimal OA.

  10. Avoidance, biomass and survival response of soil dwelling (endogeic) earthworms to OECD artificial soil: potential implications for earthworm ecotoxicology.

    Science.gov (United States)

    Brami, C; Glover, A R; Butt, K R; Lowe, C N

    2017-05-01

    Soil dwelling earthworms are now adopted more widely in ecotoxicology, so it is vital to establish if standardised test parameters remain applicable. The main aim of this study was to determine the influence of OECD artificial soil on selected soil-dwelling, endogeic earthworm species. In an initial experiment, biomass change in mature Allolobophora chlorotica was recorded in Standard OECD Artificial Soil (AS) and also in Kettering Loam (KL). In a second experiment, avoidance behaviour was recorded in a linear gradient with varying proportions of AS and KL (100% AS, 75% AS + 25% KL, 50% KS + 50% KL, 25% AS + 75% KL, 100% KL) with either A. chlorotica or Octolasion cyaneum. Results showed a significant decrease in A. chlorotica biomass in AS relative to KL, and in the linear gradient, both earthworm species preferentially occupied sections containing higher proportions of KL over AS. Soil texture and specifically % composition and particle size of sand are proposed as key factors that influenced observed results. This research suggests that more suitable substrates are required for ecotoxicology tests with soil dwelling earthworms.

  11. Gamma ray and sodium azide induced heterophylly of Bhindi and Clusterbean

    International Nuclear Information System (INIS)

    Khaleel Basha, S.; Gopala Rao, P.

    1988-01-01

    Gamma rays (35, 45 Krad) and sodium azide (100, 200 ppm) and their combinations caused heterophylly in Bhindi (Hibiscus esculentus) and Clusterbean (Cyamopsis tetragonoloba). Changes like notching of leaf at the tip region, reduction of secondary and tertiary veins, formation of 2,4 leaflets, reduction of leaf lobes and change of shape were noticed. More changes were observed at higher doses of the mutagens. (author). 12 refs

  12. Analysis of morphological traits in different host plants associated ...

    African Journals Online (AJOL)

    Maximum trichome density per plant was 444±72.4 in sunflower followed by 411.6±19.6, 399±52, 391.6±22.0, in C. bonariensis, Abelmoschus esculentus and Withania somnifera respectively but minimum were 2.33±1.45 in Chinopodium morale, followed by 2.66±1.4, and 3±2.08 in Portulaca oleracea and Trianthema ...

  13. EFFECT OF POLYETHYLENE BLACK PLASTIC MULCH ON GROWTH AND YIELD OF TWO SUMMER VEGETABLE CROPS UNDER RAIN-FED CONDITIONS UNDER SEMI-ARID REGION CONDITIONS

    OpenAIRE

    Atif Y. Mahadeen

    2014-01-01

    Water use efficiency in agriculture can be enhanced by several strategies mainly by reducing evaporation from the soil surface. The mulching techniques were being used widely in irrigated crop production worldwide. The mulching techniques can be also implemented in summer vegetables production under rain-fed conditions. The current study aimed at evaluating the effect of polyethylene black plastic mulch on growth and yield of okra, Abelmoschus esculentus and summer squash, ...

  14. sur la croissance des graines de gombo en serre Résumé Abstract

    African Journals Online (AJOL)

    AKA BOKO

    Le gombo (Abelmoschus esculentus L., Malvaceae) est une herbe annuelle érigée et couverte de soies duveteuses [1]. C'est une plante de grande valeur nutritionnelle, riche en protéines, sels minéraux (Calcium, fer, magnésium, potassium, sodium etc.) vitamines (A, C E et K) et lipides (acides oléiques et linoléiques, et.

  15. A survey of ichthyofauna of Lake Kanyaboli and other small waterbodies in Kenya: alternative refugia for endangered fish species

    OpenAIRE

    Maithya, J.

    1998-01-01

    In 1988, the World Conservation Union (WCU) Red Book of Endangered Species listed hundreds of endemic fishes of Lake Victoria under a single heading - "ENDANGERED". Most of the endemic native food fishes are either endangered or extinct. However, a survey of the fauna of Lake Kanyaboli, revealed that a few remaining samples of these native fishes are actually thriving. These include several unidentified Haplochromis spp., Oreochromis esculentus and Oreochromis variabilis. As a resul...

  16. CARACTERISATION PHYSICO-CHIMIQUE ET POTENTIALITES ...

    African Journals Online (AJOL)

    AISA

    Le pois sucré (Cyperus esculentus L. Cyperaceae) présente des potentialités insuffisamment exploitées sur le plan nutritionnel. Afin de contribuer à la connaissance de ce produit, une enquête a été menée auprès d'une frange de la population d'Abidjan (Côte d'Ivoire). Des analyses physiques et chimiques ont été.

  17. Phytoremediation potential and ecological and phenological changes of native pioneer plants from weathered oil spill-impacted sites at tropical wetlands.

    Science.gov (United States)

    Palma-Cruz, Felipe de J; Pérez-Vargas, Josefina; Rivera Casado, Noemí Araceli; Gómez Guzmán, Octavio; Calva-Calva, Graciano

    2016-08-01

    Pioneer native plant species from weathered oil spill-affected sites were selected to study their potential for phytoremediation on the basis of their ecological and phenological changes during the phytoremediation process. Experiments were conducted in field and in greenhouse. In field, native plants from aged oil spill-impacted sites with up 400 g of weathered petroleum hydrocarbons per kilogram soil were selected. In the impacted sites, the principal dominant plant species with potential for hydrocarbons removal were Cyperus laxus, Cyperus esculentus, and Ludwigia peploides. In greenhouse, the phenology of the selected plant species was drastically affected by the hydrocarbons level above 325 g total petroleum hydrocarbons (TPH) per kilogram soil after 2 years of phytoremediation of soils from the aged oil spill-impacted sites. From the phytoremediation treatments, a mix-culture of C. laxus, C. esculentus, and L. peploides in soil containing 325 g TPH/kg soil, from which 20.3 % were polyaromatic hydrocarbons (PAH) and 34.2 % were asphaltenes (ASF), was able to remove up 93 % of the TPH, while in unvegetated soil the TPH removal was 12.6 %. Furthermore, evaluation of the biodiversity and life forms of plant species in the impacted sites showed that phytoremediation with C. esculentus, alone or in a mix-culture with C. laxus and L. peploides, reduces the TPH to such extent that the native plant community was progressively reestablished by replacing the cultivated species resulting in the ecological recovery of the affected soil. These results demonstrate that native Cyperus species from weathered oil spill-affected sites, specifically C. esculentus and C. laxus, alone or in a mix-culture, have particular potential for phytoremediation of soils from tropical wetlands contaminated with weathered oil hydrocarbons.

  18. Establishment of sandwich ELISA for soluble alpha-Klotho measurement: Age-dependent change of soluble alpha-Klotho levels in healthy subjects.

    Science.gov (United States)

    Yamazaki, Yuji; Imura, Akihiro; Urakawa, Itaru; Shimada, Takashi; Murakami, Junko; Aono, Yukiko; Hasegawa, Hisashi; Yamashita, Takeyoshi; Nakatani, Kimihiko; Saito, Yoshihiko; Okamoto, Nozomi; Kurumatani, Norio; Namba, Noriyuki; Kitaoka, Taichi; Ozono, Keiichi; Sakai, Tomoyuki; Hataya, Hiroshi; Ichikawa, Shoji; Imel, Erik A; Econs, Michael J; Nabeshima, Yo-Ichi

    2010-07-30

    Alpha-Klotho (alphaKl) regulates mineral metabolism such as calcium ion (Ca(2+)) and inorganic phosphate (Pi) in circulation. Defects in mice result in clinical features resembling disorders found in human aging. Although the importance of transmembrane-type alphaKl has been demonstrated, less is known regarding the physiological importance of soluble-type alphaKl (salphaKl) in circulation. The aims of this study were: (1) to establish a sandwich ELISA system enabling detection of circulating serum salphaKl, and (2) to determine reference values for salphaKl serum levels and relationship to indices of renal function, mineral metabolism, age and sex in healthy subjects. We successively developed an ELISA to measure serum salphaKl in healthy volunteers (n=142, males 66) of ages (61.1+/-18.5year). The levels (mean+/-SD) in these healthy control adults were as follows: total calcium (Ca; 9.46+/-0.41mg/dL), Pi (3.63+/-0.51mg/dL), blood urea nitrogen (BUN; 15.7+/-4.3mg/dL), creatinine (Cre; 0.69+/-0.14mg/dL), 1,25 dihydroxyvitamin D (1,25(OH)(2)D; 54.8+/-17.7pg/mL), intact parathyroid hormone (iPTH; 49.2+/-20.6pg/mL), calcitonin (26.0+/-12.3pg/mL) and intact fibroblast growth factor (FGF23; 43.8+/-17.6pg/mL). Serum levels of salphaKl ranged from 239 to 1266pg/mL (mean+/-SD; 562+/-146pg/mL) in normal adults. Although salphaKl levels were not modified by gender or indices of mineral metabolism, salphaKl levels were inversely related to Cre and age. However, salphaKl levels in normal children (n=39, males 23, mean+/-SD; 7.1+/-4.8years) were significantly higher (mean+/-SD; 952+/-282pg/mL) than those in adults (mean+/-SD; 562+/-146, Plevel was notably lower than those of age-matched controls. We established a detection system to measure human serum salphaKl for the first time. Age, Ca and Pi seem to influence serum salphaKl levels in a normal population. This detection system should be an excellent tool for investigating salphaKl functions in mineral metabolism. Copyright

  19. Evaluation of the normal fetal kidney length and its correlation with gestational age.

    Science.gov (United States)

    Seilanian Toosi, Farrokh; Rezaie-Delui, Hossein

    2013-05-30

    A true estimation of gestational age (GA) plays an important role in quality maternity care and scheduling the labor date. This study aimed to evaluate the normal fetal kidney length (KL) and its correlation with GA. A cross-sectional study on 92 pregnant women between 8th and 10th week of gestation with normal singleton pregnancy underwent standard ultrasound fetal biometry and kidney length measurement. univariate and multivariate linear regression analysis was used to create a predictive equation to estimate GA on the KL and fetobiometry parameters. A significant correlation was found between GA and KL (r=0.83, P<0.002). The best GA predictor was obtained by combining head circumference, fetal biparietal diameter, femur length and KL with a standard error (SE) about 14.2 days. Our findings showed that KL measurements combination with other fetal biometric parameters could predict age of pregnancy with a better precision.

  20. Evaluation of the Normal Fetal Kidney Length and Its Correlation with Gestational Age

    Directory of Open Access Journals (Sweden)

    Farrokh Seilanian Toosi

    2013-05-01

    Full Text Available A true estimation of gestational age (GA plays an important role in quality maternity care and scheduling the labor date. This study aimed to evaluate the normal fetal kidney length (KL and its correlation with GA. A cross-sectional study on 92 pregnant women between 8th and 10th week of gestation with normal singleton pregnancy underwent standard ultrasound fetal biometry and kidney length measurement. univariate and multivariate linear regression analysis was used to create a predictive equation to estimate GA on the KL and fetobiometry parameters. A significant correlation was found between GA and KL (r=0.83, P<0.002. The best GA predictor was obtained by combining head circumference, fetal biparietal diameter, femur length and KL with a standard error (SE about 14.2 days. Our findings showed that KL measurements combination with other fetal biometric parameters could predict age of pregnancy with a better precision.

  1. Inactivation of the forkhead transcription factor FoxO3 is essential for PKB-mediated survival of hematopoietic progenitor cells by kit ligand

    DEFF Research Database (Denmark)

    Engström, Maria; Karlsson, Richard; Jönsson, Jan-Ingvar

    2003-01-01

    OBJECTIVE: Kit ligand (KL) is a major survival factor for hematopoietic stem cells. Although anti-apoptotic bcl-2 family members are expressed in these cells, the survival effects by KL appear to involve other mechanisms. Survival signals can also be elicited by the activation of phosphatidylinos......OBJECTIVE: Kit ligand (KL) is a major survival factor for hematopoietic stem cells. Although anti-apoptotic bcl-2 family members are expressed in these cells, the survival effects by KL appear to involve other mechanisms. Survival signals can also be elicited by the activation......, immunofluorescence, and subcellular fractionation, we analyzed the effects of KL on PKB and different forkhead family members in two factor-dependent cell lines, FDCP-mix and FDC-P1, as well as primary mouse bone marrow-derived Lin(-) progenitors. Forced overexpression of triple mutated form of FoxO3 by retroviral...

  2. Myostatin serum concentrations are correlated with the severity of knee osteoarthritis.

    Science.gov (United States)

    Zhao, Chang; Shao, Yan; Lin, Chuangxin; Zeng, Chun; Fang, Hang; Pan, Jianying; Cai, Daozhang

    2017-09-01

    Myostatin, a member of the transforming growth factor-β family, contributes to joint deterioration in mice. Thus, we aimed to assess the correlation of myostatin concentrations with the presence and severity of knee osteoarthritis (OA). We determined serum and synovial fluid (SF) myostatin concentrations in a population of 184 patients with knee OA and 109 healthy controls. The knee OA group presented with higher serum myostatin concentrations than the controls. Knee OA patients with KL grade 4 showed higher serum and SF myostatin concentrations compared with those with KL grade 2 and 3. Knee OA patients with KL grade 3 had higher serum and SF myostatin concentrations compared with those with KL grade 2. Serum and SF myostatin concentrations were significantly correlated with KL grading. Serum and SF myostatin concentrations were correlated with the presence and severity of knee OA. © 2016 Wiley Periodicals, Inc.

  3. Genetic Variants in KLOTHO Associate With Cognitive Function in the Oldest Old Group

    DEFF Research Database (Denmark)

    Mengel-From, Jonas; Sørensen, Mette; Nygaard, Marianne

    2016-01-01

    , for example, growth factor signaling. In the present study, 19 tagging gene variants in KL were studied in relation to 2 measures of cognitive function, a 5-item cognitive composite score and the Mini Mental State Examination, in 1,480 Danes 92-100 years of age. We found that heterozygotes for the previously......Decline in cognitive abilities is a major concern in aging individuals. A potential important factor for functioning of the central nervous system in late-life stages is the KLOTHO (KL) gene. KL is expressed in various organs including the brain and is involved in multiple biological processes...... reported KL-VS had poorer cognitive function than noncarriers. Two other variants positioned in the 5' end of the gene, rs398655 and rs562020, were associated with better cognitive function independently of KL-VS, and the common haplotype AG was associated with poorer cognition, consistently across two...

  4. The use of hogdahl convention k0 neutron activation analysis (NAA) standardization method and atomic absortion spectroscopy (ASS) for determination of toxic elements in foodstuffs

    International Nuclear Information System (INIS)

    Ahiamadie, H.

    2008-06-01

    Copper, cadmium, tin, chromium, arsenic, antimony, vanadium and mercury contents were determined in various foodstuffs (Mussa paradisiaca (plantains), Manihot esculentus (cassavas), Vantosoma sagittifolium (cocoyam). Vantosoma sagittifolium leaves (kontomire), Lycopersicum esculentus (tomatoes), Capsicum species (peppers), Solanum melongena (garden eggs), Nbelmoschus esculentus (okro), and Colocasia esculenta (kooko or taro)) produced in the Wassa West District, Ghana. These plants are the basis of human nutrition in the study area. These elements were determined using Hogdahl convention k 0 Instrumental Neutron Activation Analysis (NAA) Standardization Method and Atomic Absorption Spectroscopy (AAS). The elements in the various foodstuffs and their concentration ranges were Cu (16.87-180.06) mg/kg, As (2.68-9.84) µg/g, Cd (0.63-5.64) µg/g, Hg (0.01-67) ng/g, Cr (0.03-3.66) µg/g, Sb (1.1- 18.6) ng/g, Sn (3.4-58.4) ng/g, and V (12-99) ng/g. The study showed that there are high levels of toxic elements in the foodstuffs grown in the mining areas as compared to that of the non-mining area (i.e., control area). This could be attributed to gold mines pollution. Compared to the World Health Organization (WHO) permissible levels of toxic elements in foods, Cu, Cr and Hg were above the permissible levels whereas the concentrations of As, Cd. Sb, Sn and V fall within the permissible levels. (au)

  5. Acinetobacter baumannii K11 and K83 capsular polysaccharides have the same 6-deoxy-l-talose-containing pentasaccharide K units but different linkages between the K units.

    Science.gov (United States)

    Kenyon, Johanna J; Shashkov, Alexander S; Senchenkova, Sof'ya N; Shneider, Mikhail M; Liu, Bin; Popova, Anastasiya V; Arbatsky, Nikolay P; Miroshnikov, Konstantin A; Wang, Lei; Knirel, Yuriy A; Hall, Ruth M

    2017-10-01

    Acinetobacter baumannii produces a variety of capsular polysaccharides (CPS) via genes located at the chromosomal K locus and some KL gene clusters include genes for the synthesis of specific sugars. The structures of K11 and K83 CPS produced by isolates LUH5545 and LUH5538, which carry related KL11a and KL83 gene clusters, respectively, were established by sugar analysis and one- and two-dimensional 1 H and 13 C NMR spectroscopy. Both CPS contain l-rhamnose (l-Rha) and 6-deoxy-l-talose (l-6dTal), and both KL gene clusters include genes for dTDP-l-Rhap synthesis and a tle (talose epimerase) gene encoding an epimerase that converts dTDP-l-Rhap to dTDP-l-6dTalp. The K11 and K83 repeat units are the same pentasaccharide, consisting of d-glucose, l-Rha, l-6dTal, and N-acetyl-d-glucosamine, except that l-6dTal is 2-O-acetylated in K83. However, the K units are linked differently, with l-Rha in the main chain in K11, but as a side-branch in K83. KL11 and KL83 encode unrelated Wzy polymerases that link the K units together and different acetyltransferases, though only Atr8 from KL83 is active. The substrate specificity of each Wzy polymerase was assigned, and the functions of all glycosyltransferases were predicted. The CPS structures produced by three closely related K loci, KL29, KL105 and KL106, were also predicted. Copyright © 2017 Elsevier B.V. All rights reserved.

  6. Microstructural investigation into calcium phosphate biomaterials by spatially resolved cathodoluminescence

    Energy Technology Data Exchange (ETDEWEB)

    Goetze, J.; Heimann, R.B.; Hildebrandt, H. [Freiberg Univ. of Mining and Technology (Germany). Dept. of Mineralogy; Gburek, U. [Wuerzburg Univ. (Germany). Dept. of Experimental Dentistry

    2001-02-01

    From cathodoluminescence (CL) investigations of synthetic and natural calcium phosphates it can be concluded that the CL of pure synthetic apatite is mainly characterized by intrinsic luminescence, whereas the luminescence of naturally occurring apatites is frequently activated by trace elements. CL revealed internal structures within plasma-sprayed hydroxyapatite coatings which were not discernible by SEM-BSE imaging. However, cathodoluminescence microscopy alone can presently not be used in every case to characterize synthetic calcium phosphate biomaterials because of the dominant intrinsic blue CL emission. In the future, optimum results will likely be achieved by using a combination of CL microscopy and spectroscopy with other spatially resolved analytical methods such as SEM-BSE, SEM-CL or micro-Raman spectroscopy. In the present study, different types of tetracalcium phosphate dental cements could be distinguished due to varying CL colours and CL spectra that are caused by a different content of impurity Mn. These results emphasize the advantages of spectral CL measurements for spatially resolved detection of trace elements in solids. (orig.) [German] Ergebnisse von Kathodolumineszenz- (KL-) Untersuchungen synthetischer und natuerlicher Apatite zeigen, dass die KL synthetischer Apatite vorrangig durch intrinsische Lumineszenz gekennzeichnet ist, waehrend die KL natuerlicher Apatite meist durch Spurenlemente aktiviert wird. Mittels KL koennen Internstrukturen in plasmagespritzten Hydroxylapatit-Schichten sichtbar gemacht werden, die im REM-BSE nicht nachweisbar sind. Allerdings kann die KL-Mikroskopie aufgrund der dominierenden blauen intrinsischen Lumineszenz gegenwaertig nicht als alleinige Untersuchungsmethode zur Charakterisierung von Calciumphosphat Biomaterialien eingesetzt werden. Optimale Resultate werden zukuenftig durch Kombination von KL-Mikrroskopie und -spektroskopie mit anderen ortsaufgeloesten analytischen Methoden wie REM-BSE, REM-KL oder Mikro

  7. Effects of water management, connectivity, and surrounding land use on habitat use by frogs in rice paddies in Japan.

    Science.gov (United States)

    Naito, Risa; Yamasaki, Michimasa; Lmanishi, Ayumi; Natuhara, Yosihiro; Morimoto, Yukihiro

    2012-09-01

    In Japan, rice paddies play an important role as a substitute habitat for wetland species, and support rich indigenous ecosystems. However, since the 1950s, agricultural modernization has altered the rice paddy environment, and many previously common species are now endangered. It is urgently necessary to evaluate rice paddies as habitats for conservation. Among the species living in rice paddies, frogs are representative and are good indicator species, so we focused on frog species and analyzed the influence of environmental factors on their habitat use. We found four frog species and one subspecies (Hyla japonica, Pelophylax nigromaculatus, Glandirana rugosa, Lithobates catesbeianus, and Pelophylax porosa brevipoda) at our study sites in Shiga prefecture. For all but L. catesbeianus, we analyzed the influence of environmental factors related to rice paddy structure, water management and availability, agrochemical use, connectivity, and land use on breeding and non-breeding habitat use. We constructed generalized additive mixed models with survey date as the smooth term and applied Akaike's information criterion to choose the bestranked model. Because life histories and biological characteristics vary among species, the factors affecting habitat use by frogs are also expected to differ by species. We found that both breeding and non-breeding habitat uses of each studied species were influenced by different combinations of environmental factors and that in most cases, habitat use showed seasonality. For frog conservation in rice paddies, we need to choose favorable rice paddy in relation to surrounding land use and apply suitable management for target species.

  8. Klâsik Türk Edebiyatında Metinler Arasılık Alanında Bibliyografya Denemesi ve Hasibe Mazıoğlu’nun “Fuzûlî-Hâfız” Örneği A Bibliyography Trial On Intertextuality In Classical Turkish Literature And A Case Study Of “Fuzûlî-Hâfız” By Hasibe Mazıoğlu

    Directory of Open Access Journals (Sweden)

    Nagehan UÇAN EKE

    2013-03-01

    Full Text Available The development of the civilizations is impossible if they do notmeet richer cultures and civilizations and do not benefit from them. Theolder and great civilizations like Sumerian, Egyptian, Greek, Latin andIslam civilizations survive their presence by receiving something fromthe previous civilizations and giving something to latter civilizations. Alot of famous writer benefit from the language and culture they met andenrich their philosophy. Writer who uses works of different languagesand different cultures has the opportunity of the comparison of differentcultures. A way to compare it to “the other person to come and discoverhim to face with” means. Each literary work or text, although ownoriginality, there are other artifacts are a reflection on them and getsthe location within the network, enters into the relationships ofharmony and affinity. Comparison of two different literature or culturewas regarded as the concept of “comparative literature”, in later yearsas an interdisciplinary field of literature-sociology, literaturepsychology,literature-philosophy, literature and other arts-painting,music, photos, relationships, especially in recent years, is regarded asan extension of literature with close ties to the movie and compare it tothese different areas are technical, such as aspects of style. Butconsidiring the context in which information, comparative literature,different cultures and different literatures are treated as an unfoldingand vanishing expansion. In this study, first “intertextuality” and“comparative literature” concepts are briefly described than a generalBibliography on Classical Turkish Literature and Intertextuality of workuntil today are presented and finally “Fuzûlî-Hâfız: A comparison of twopoet” is presented from Hasibe Mazıoğlu, which is one of the first andmost notable work in this area.

  9. "Jeg skal opfølgende anmode jer om at melde tilbage, hvorvidt I mener, at der er nogen sundheds- eller miljømæssige ricisi, der kan begrunde, at Danmark stemmer imod ansøgningen. Jeg skal bede om en tilbagemeldig allerede i dag, kl. 17.00. Svar den 25.10.2005" Dianthus caryophyllus (123.2.38/ 123

    DEFF Research Database (Denmark)

    Kjellsson, Gøsta

    2005-01-01

    Mail: DMU har på grundlag af vores økologiske risikovurdering (pr. 18-04-2005) samt yderligere oplysninger i sagen (DMU kommentarer pr. 27-05-2005 og 13-10-2005) ikke fundet nogen miljømæssige ricisi, der kan begrunde at Danmark stemmer imod en markedsføring af den genmodificerede Florigene nelli...

  10. P-12: Spora Başlama ve/veya Lisans Muayeneleri İçin Spor Hekimliği Polikliniğine Başvuran Çocuk ve Gençlerde Postür Bozukluklarının Sıklığının Araştırılması

    Directory of Open Access Journals (Sweden)

    Berrin Topçu Özcan

    2017-03-01

    Full Text Available GirişPostür, vücut bölümlerinin birbirleri ile ilişkili biçimdeki duruş şekli ve duruş vaziyetidir. Ayrıca, herhangi bir zamanda vücudun tüm noktalarının duruşlarının birleşenidir. AmaçHastanemiz spor hekimliği polikliniğine spor lisansı almak ve/veya yenilemek yada spora katılım öncesi sağlık kontrollerinden geçmek için başvuran çocuk ve gençlerde postür bozukluğu varlığıyla spor yapma ve yapılan spor yılı arasındaki ilişkiyi incelemek. Gereç ve yöntemÇalışmamıza 125’i erkek, 51’i kız ve yaşları 6-21 arasında (ort.:13,27 olmak üzere toplam 176 kişi katıldı. Katılımcıların 52’si spora yeni başlayacak olup, diğerleri çeşitli spor dallarını en az 1 yıldır yapmaktaydı. Vücut postürü fiziki muayene ile değerlendirildi. Boy, kilo ölçümleri Healthometer Professional marka cihazla yapıldı. VKİ(Vücut Kitle İndeksi hesaplandı. Spora başlama yaşı, spor tipi ve katılımcıların şikayetleri sorgulandı. Elde edilen veriler Minitab ikili lojistik regresyon analizi ve bazı sonuçlar da kikare testiyle değerlendirildi.Bulgular Spor geçmişi(yıl ile postür bozukluğu arasında anlamlı ilişki saptandı(p=0,019. Çocukların %3'ü daha önceden postür bozuklukluğu tanısı konduğu için tedavi edici olarak spora başlamıştı. Spora başlama yaşı ve sporun tipine göre postür bozukluğu bulunma olasılığı arasında anlamlı bir ilişki bulunamamıştır. VKİ ile postür bozukluğu arasında da anlamlı bir ilişki bulunamamıştır. Bununla beraber 10 yaş üstünde VKİ anlamlı olarak daha yüksek bulunmuştur. 10 yaşın altında daha az spor yapıldığı saptanmıştır. Tartışma/sonuçSpor yapma yılı arttıkça postür bozukluğu görülme olasılığının artması beklenen bir sonuç değildi. Katılımcıların farklı alanlarda spor dallarıyla uğraşması ve ayrı ayrı değerlendirildiğinde vaka sayımızın az olması, yaş olarak geniş bir grup olması, antrenman tipi ve yoğunluklarının hesaplanmamış olması vb nedenlerin sonucu etkilemiş olabileceğini düşünmekteyiz. Bulduğumuz sonuç bize özellikle küçük yaşlarda yapılan spor dallarının, antrenman tipi ve yoğunluklarının araştırılması gerektiğini düşündürmüştür. Çalışmamız devam etmekte olup, postür bozukluklarının erken yaşta tespit edilmesi ve uygun tedavilerinin yapılabilmesi açısından çalışmamızın önemli olduğunu düşünmekteyiz.Duruş Bozukluğu ve Spor Geçmiş (yıl arası ilişki (Binary Logistic RegressionSourceDFAdj DevAdj MeanChi-SquareP-ValueRegresion15,4615,4615,460,019Spor Geçmiş (yıl15,4615,4615,460,019Error174237,4121,364Total175242,873

  11. Application of Concentration-Number and Concentration-Volume Fractal Models to Recognize Mineralized Zones in North Anomaly Iron Ore Deposit, Central Iran / Zastosowanie Modeli Fraktalnych Typu K-L (Koncentracja-Liczba), Oraz K-O (Koncentracja Objętość) Do Rozpoznawania Stref Występowania Surowców Mineralnych W Regionie Złóż Rud Żelaza North Anomaly, W Środkowym Iranie

    Science.gov (United States)

    Afzal, Peyman; Ghasempour, Reza; Mokhtari, Ahmad Reza; Haroni, Hooshang Asadi

    2015-09-01

    Identification of various mineralized zones in an ore deposit is essential for mine planning and design. This study aims to distinguish the different mineralized zones and the wall rock in the Central block of North Anomaly iron ore deposit situated in Bafq (Central Iran) utilizing the concentration-number (C-N) and concentration-volume (C-V) fractal models. The C-N model indicates four mineralized zones described by Fe thresholds of 8%, 21%, and 50%, with zones 50% Fe representing wall rocks and highly mineralized zone, respectively. The C-V model reveals geochemical zones defined by Fe thresholds of 12%, 21%, 43% and 57%, with zones 50% zawartości żelaza, co odpowiada pasmu skalnemu oraz strefie o wysokim stopniu zawartości rudy. Model koncentracja-objętość wskazuje na istnienie stref geochemicznych określonych poprzez progowe wartości zawartości żelaza: 12%, 21%, 43% i 57 % oraz strefy <12%, co odpowiada ścianie skalnej. Obydwa modele stwierdzają obecność stref o wysokim stopniu zawartości surowca w środkowej i zachodniej części złoża. Wyniki walidacji modeli fraktalnych przy użyciu modeli geologicznych wskazują, ze model fraktalny koncentracja-liczba lepiej odwzorowuje obecność stref o wysokiej zawartości rud niż model fraktalny typu koncentracja-objętość.

  12. Klotho-related Molecules Upregulated by Smoking Habit in Apparently Healthy Men: A Cross-sectional Study.

    Science.gov (United States)

    Nakanishi, Kaori; Nishida, Makoto; Harada, Masaya; Ohama, Tohru; Kawada, Noritaka; Murakami, Masaaki; Moriyama, Toshiki; Yamauchi-Takihara, Keiko

    2015-09-18

    While aging is unavoidable, the aging mechanism is still unclear because of its complexity. Smoking causes premature death and is considered as an environmental aging accelerator. In the present study, we focused on the influence of smoking to the serum concentration of anti-aging protein α-klotho (αKl) and the β-klotho-associated protein fibroblast growth factor (FGF)-21 in men. Subjects consisted of apparently healthy men over 40 years of age who underwent health examination. Physical and biochemical parameters, including the levels of several cytokines and growth factors, were obtained from the subjects. Among middle-aged men (46.1 ± 5.1 years), serum levels of FGF-21, soluble αKl (sαKl), and inflammation-related cytokine interleukin (IL)-6 were significantly higher in smokers than in never-smokers. Serum levels of FGF-21 increased and correlated with alanine transaminase, γ guanosine-5'-triphosphate, and total cholesterol only in smokers, suggesting FGF-21 as a metabolic disorder-related factor in smokers. In aged men (60.3 ± 1.7 years), although the serum levels of sαKl in never-smokers were low, smokers showed highly increased serum levels of sαKl. Serum levels of sαKl was correlated with IL-6 in middle-aged never-smokers, suggesting sαKl regulates IL-6. However, this correlation was disrupted in smokers and aged men.

  13. Formulation and in vitro evaluation of theophylline matrix tablets prepared by direct compression: Effect of polymer blends

    Science.gov (United States)

    El-Bagory, Ibrahim; Barakat, Nahla; Ibrahim, Mohamed A.; El-Enazi, Fouza

    2011-01-01

    The deformation mechanism of pharmaceutical powders, used in formulating directly compressed matrix tablets, affects the characteristics of the formed tablets. Three polymers of different deformation mechanisms were tested for their impact on theophylline directly compressed tablets namely Kollidon SR (KL SR, plastic deformation), Ethylcellulose (EC, elastic deformation) and Carnauba wax (CW, brittle deformation) at different compression forces. However, tablets based mainly on KL SR, the plastically deformed polymer (TN1) exhibited the highest hardness values compared to the other formulae which are based on either blends of KL SR with CW, the very brittle deformed polymer. The upper detected force for TN formulae and the lower punch force were found to dependent mainly on the powder deformation. This difference is attributed to the work done during the compression phase as well as the work lost during the decompression phase. Furthermore, the release profiles of TN from formulae TN2 and TN4 that are based on the composition (2KL SR:1EC) and (1KL SR:2EC), respectively, were consistent with different deformation mechanisms of KL SR and EC and on the physicochemical properties like the water absorptive capacity of EC. Upon increasing the weight ratio of KL SR (TN2), the release rate was greatly retarded (39.4%, 37.1%, 35.0% and 33.6% released after 8 h at 5, 10, 15 and 20 kN. PMID:24115902

  14. Variation in the complex carbohydrate biosynthesis loci of Acinetobacter baumannii genomes.

    Directory of Open Access Journals (Sweden)

    Johanna J Kenyon

    Full Text Available Extracellular polysaccharides are major immunogenic components of the bacterial cell envelope. However, little is known about their biosynthesis in the genus Acinetobacter, which includes A. baumannii, an important nosocomial pathogen. Whether Acinetobacter sp. produce a capsule or a lipopolysaccharide carrying an O antigen or both is not resolved. To explore these issues, genes involved in the synthesis of complex polysaccharides were located in 10 complete A. baumannii genome sequences, and the function of each of their products was predicted via comparison to enzymes with a known function. The absence of a gene encoding a WaaL ligase, required to link the carbohydrate polymer to the lipid A-core oligosaccharide (lipooligosaccharide forming lipopolysaccharide, suggests that only a capsule is produced. Nine distinct arrangements of a large capsule biosynthesis locus, designated KL1 to KL9, were found in the genomes. Three forms of a second, smaller variable locus, likely to be required for synthesis of the outer core of the lipid A-core moiety, were designated OCL1 to OCL3 and also annotated. Each K locus includes genes for capsule export as well as genes for synthesis of activated sugar precursors, and for glycosyltransfer, glycan modification and oligosaccharide repeat-unit processing. The K loci all include the export genes at one end and genes for synthesis of common sugar precursors at the other, with a highly variable region that includes the remaining genes in between. Five different capsule loci, KL2, KL6, KL7, KL8 and KL9 were detected in multiply antibiotic resistant isolates belonging to global clone 2, and two other loci, KL1 and KL4, in global clone 1. This indicates that this region is being substituted repeatedly in multiply antibiotic resistant isolates from these clones.

  15. Outflow of traffic from the national capital Kuala Lumpur to the north, south and east coast highways using flow, speed and density relationships

    Institute of Scientific and Technical Information of China (English)

    Nik Hashim Nik Mustapha; Nik Nur Wahidah Nik Hashim

    2016-01-01

    The functional relationships between flow (veh/km), density (veh/h) and speed (km/h) in traffic congestion have a long history of research. However, their findings and techniques persist to be relevant to this day. The analysis is pertinent, particularly in finding the best fit for the three major highways in Malaysia, namely the KL-Karak Highway, KL-Seremban Highway and KL-Ipoh Highway. The trans-logarithm function of density—speed model was compared to the classical models of Greenshields, Greenberg, Underwood and Drake et al. using data provided by the Transport Statistics Malaysia 2014. The results of regression analysis revealed that the Greenshields and Greenberg models were statistically signifi-cant. The trans-logarithm function was also tested and the results were nonetheless without exception. Its usefulness in addition to statistical significance related to the derived economic concepts of maximum speed and the related number of vehicles, flow and density and the limits of free speed were relevant in comparing the individual levels of traffic congestion between highways. For instance, KL-Karak Highway was least congested compared to KL-Seremban Highway and KL-Ipoh Highway. Their maximum speeds, based on three lanes carriage capacity of one direction, were 33.4 km/h for KL-Karak, 15.9 km/h for KL-Seremban, and 21.1 km/h for KL-Ipoh. Their corresponding flows were approxi-mated at 1080.9 veh/h, 1555.4 veh/h, and 1436.6 veh/h.

  16. Outflow of traffic from the national capital Kuala Lumpur to the north, south and east coast highways using flow, speed and density relationships

    Directory of Open Access Journals (Sweden)

    Nik Hashim Nik Mustapha

    2016-12-01

    Full Text Available The functional relationships between flow (veh/km, density (veh/h and speed (km/h in traffic congestion have a long history of research. However, their findings and techniques persist to be relevant to this day. The analysis is pertinent, particularly in finding the best fit for the three major highways in Malaysia, namely the KL-Karak Highway, KL-Seremban Highway and KL-Ipoh Highway. The trans-logarithm function of density–speed model was compared to the classical models of Greenshields, Greenberg, Underwood and Drake et al. using data provided by the Transport Statistics Malaysia 2014. The results of regression analysis revealed that the Greenshields and Greenberg models were statistically significant. The trans-logarithm function was also tested and the results were nonetheless without exception. Its usefulness in addition to statistical significance related to the derived economic concepts of maximum speed and the related number of vehicles, flow and density and the limits of free speed were relevant in comparing the individual levels of traffic congestion between highways. For instance, KL-Karak Highway was least congested compared to KL-Seremban Highway and KL-Ipoh Highway. Their maximum speeds, based on three lanes carriage capacity of one direction, were 33.4 km/h for KL-Karak, 15.9 km/h for KL-Seremban, and 21.1 km/h for KL-Ipoh. Their corresponding flows were approximated at 1080.9 veh/h, 1555.4 veh/h, and 1436.6 veh/h.

  17. [Research on Rapid Discrimination of Edible Oil by ATR Infrared Spectroscopy].

    Science.gov (United States)

    Ma, Xiao; Yuan, Hong-fu; Song, Chun-feng; Hu, Ai-qin; Li, Xiao-yu; Zhao, Zhong; Li, Xiu-qin; Guo Zhen; Zhu, Zhi-qiang

    2015-07-01

    A rapid discrimination method of edible oils, KL-BP model, was proposed by attenuated total reflectance infrared spectroscopy. The model extracts the characteristic of classification from source data by KL and reduces data dimension at the same time. Then the neural network model is constructed by the new data which as the input of the model. 84 edible oil samples which include sesame oil, corn oil, canola oil, blend oil, sunflower oil, peanut oil, olive oil, soybean oil and tea seed oil, were collected and their infrared spectra determined using an ATR FT-IR spectrometer. In order to compare the method performance, principal component analysis (PCA) direct-classification model, KL direct-classification model, PLS-DA model, PCA-BP model and KL-BP model are constructed in this paper. The results show that the recognition rates of PCA, PCA-BP, KL, PLS-DA and KL-BP are 59.1%, 68.2%, 77.3%, 77.3% and 90.9% for discriminating the 9 kinds of edible oils, respectively. KL extracts the eigenvector which make the distance between different class and distance of every class ratio is the largest. So the method can get much more classify information than PCA. BP neural network can effectively enhance the classification ability and accuracy. Taking full of the advantages of KL in extracting more category information in dimension reducing and the features of BP neural network in self-learning, adaptive, nonlinear, the KL-BP method has the best classification ability and recognition accuracy and great importance for rapidly recognizing edible oil in practice.

  18. Studied on Virgin Coconut Oil (VCO) and Olive Oil (OO) as an Alternative for Stabilizer of Radiation Vulcanized Natural Rubber Latex (RVNRL) Preparation

    International Nuclear Information System (INIS)

    Syuhada Ramli; Sofian Ibrahim; Mohd Noorwadi Mat Lazim

    2016-01-01

    This paper presents the effects of virgin coconut oil (VCO) and olive oil (OO) as an alternative stabilizer in the radiation vulcanized natural rubber latex (RVNRL). Potassium laurite (KL) as a stabilizer considered as a control of RVNRL sample were compared to mixed ratio 1:1 KL: VCO and 1:1 KL: OO stabilizer formulation. Total solid content (TSC) and tensile strength (TS) results showed no significant different between the formulations. Mechanical stability time (MST) indicates higher stability of RVNRL with addition of VCO. The fatty acid composition in VCO indicate VCO was acting well as stabilizer for latex stabilizer formulation. (author)

  19. Phosphatidylinositol 3-kinase is essential for kit ligand-mediated survival, whereas interleukin-3 and flt3 ligand induce expression of antiapoptotic Bcl-2 family genes

    DEFF Research Database (Denmark)

    Karlsson, Richard; Engström, Maria; Jönsson, Maria

    2003-01-01

    Cytokines such as interleukin 3 (IL-3), kit ligand (KL), and flt3 ligand (FL) promote survival of hematopoietic stem cells and myeloid progenitor cells. In many cell types, members of the Bcl-2 gene family are major regulators of survival, but the mediating mechanisms are not fully understood....... Using two myeloid progenitor cell lines, FDCP-mix and FDC-P1, as well as primary mouse bone marrow progenitors, we demonstrate that KL-mediated survival is dependent on the activation of phosphatidylinositol-3 (PI-3) kinase. The inhibitor LY294002 was able to completely abolish survival mediated by KL...

  20. Ultrasonographic assessment of pes anserinus tendon and pes anserinus tendinitis bursitis syndrome in patients with knee osteoarthritis.

    Science.gov (United States)

    Toktas, Hasan; Dundar, Umit; Adar, Sevda; Solak, Ozlem; Ulasli, Alper Murat

    2015-01-01

    The aim of this study was to assess the ultrasonographic (US) findings of pes anserinus tendon and bursa in patients with knee osteoarthritis (OA) with or without clinical pes anserinus tendinitis bursitis syndrome (PATBS). A total of 157 female patients with the diagnosis of knee OA on both knees (314 knees), and 30 age, and body mass index- matched healthy female controls without knee pain (60 knees), were included in the study. PATBS was clinically diagnosed. US evaluation parameters were the measurement of the thickness of pes anserinus tendon insertion region (PA) and examination of the morphologic intratendinous PA tissue characteristics and pes anserinus bursitis (PAB). Radiographic knee osteoarthritis graded I-IV according to Kellgren and Lawrence (KL) for each knee was recorded. Pain and functional status were assessed by the Visual Analog Scale (VAS) and Western Ontario and McMaster Universities Osteoarthritis Index (WOMAC). There were 183 PATBS (58.3%) clinical diagnoses among the 314 knees with OA. The mean thickness of PA in the patients with knee OA graded 1,2,3,4 with/without PATBS was significantly greater than the controls (p = 0.001). The mean thickness of PA in knees with OA KL graded 3 and 4 with/without PATBS, was greater than knees with OA KL graded 1 and 2 with/without PATBS (p < 0,05) (except knee OA KL graded 2 with PATBS versus knee OA KL graded 4 without PATBS).The knee OA KL graded 1,2,3,4 with PATBS had significantly more PAB and less loss of normal fibrillar echotexture of PA compared to controls and knees with OA KL graded 1,2,3,4 without PATBS (p < 0.05). The VAS scores of knees with OA KL graded 3, 4 with PATBS were significantly greater than those of knees with OA KL graded 3,4 without PATBS (p < 0.05). PA thickness was significantly associated with the KL grade (r: 0.336, p:0.001) and PATBS (r: 0.371, p < 0.001). It is concluded that the mean thickness of PA in knees with OA with/without PATBS was significantly greater than the

  1. An allosteric gating model recapitulates the biophysical properties of IK,L expressed in mouse vestibular type I hair cells.

    Science.gov (United States)

    Spaiardi, Paolo; Tavazzani, Elisa; Manca, Marco; Milesi, Veronica; Russo, Giancarlo; Prigioni, Ivo; Marcotti, Walter; Magistretti, Jacopo; Masetto, Sergio

    2017-11-01

    Vestibular type I and type II hair cells and their afferent fibres send information to the brain regarding the position and movement of the head. The characteristic feature of type I hair cells is the expression of a low-voltage-activated outward rectifying K + current, I K,L , whose biophysical properties and molecular identity are still largely unknown. In vitro, the afferent nerve calyx surrounding type I hair cells causes unstable intercellular K + concentrations, altering the biophysical properties of I K,L . We found that in the absence of the calyx, I K,L in type I hair cells exhibited unique biophysical activation properties, which were faithfully reproduced by an allosteric channel gating scheme. These results form the basis for a molecular and pharmacological identification of I K,L . Type I and type II hair cells are the sensory receptors of the mammalian vestibular epithelia. Type I hair cells are characterized by their basolateral membrane being enveloped in a single large afferent nerve terminal, named the calyx, and by the expression of a low-voltage-activated outward rectifying K + current, I K,L . The biophysical properties and molecular profile of I K,L are still largely unknown. By using the patch-clamp whole-cell technique, we examined the voltage- and time-dependent properties of I K,L in type I hair cells of the mouse semicircular canal. We found that the biophysical properties of I K,L were affected by an unstable K + equilibrium potential (V eq K + ). Both the outward and inward K + currents shifted V eq K + consistent with K + accumulation or depletion, respectively, in the extracellular space, which we attributed to a residual calyx attached to the basolateral membrane of the hair cells. We therefore optimized the hair cell dissociation protocol in order to isolate mature type I hair cells without their calyx. In these cells, the uncontaminated I K,L showed a half-activation at -79.6 mV and a steep voltage dependence (2.8 mV). I K,L also

  2. Reductive de-polymerization of kraft lignin for chemicals and fuels using formic acid as an in-situ hydrogen source.

    Science.gov (United States)

    Huang, Shanhua; Mahmood, Nubla; Tymchyshyn, Matthew; Yuan, Zhongshun; Xu, Chunbao Charles

    2014-11-01

    In this study, formic acid (FA) was employed as an in-situ hydrogen donor for the reductive de-polymerization of kraft lignin (KL). Under the optimum operating conditions, i.e., 300 °C, 1 h, 18.6 wt.% substrate concentration, 50/50 (v/v) water-ethanol medium with FA at a FA-to-lignin mass ratio of 0.7, KL (Mw∼10,000 g/mol) was effectively de-polymerized, producing de-polymerized lignin (DL, Mw 1270 g/mol) at a yield of ∼90 wt.% and polymerization of KL. Copyright © 2014 Elsevier Ltd. All rights reserved.

  3. Tardive dyskinesia

    Science.gov (United States)

    ... GS, Sullivan KL, Zesiewicz TA; American Academy of Neurology. Evidence-based guideline: treatment of tardive syndromes: report ... Guideline Development Subcommittee of the American Academy of Neurology. Neurology . 2013;81(5):463-469. PMID: 23897874 ...

  4. Jaundice

    Science.gov (United States)

    ... Saunders; 2016:chap 21. Wheatley MA, Heilpern KL. Jaundice. In: Marx JA, Hockberger RS, Walls RM, et al, eds. Rosen's Emergency Medicine: Concepts and Clinical Practice . 8th ed. Philadelphia, PA: Elsevier ...

  5. Srez zemnoi korõ / Veera Vassilkova

    Index Scriptorium Estoniae

    Vassilkova, Veera

    2000-01-01

    Ukrainas sündinud ja arhitektiks õppinud eesti kunstniku (Tartu KL liige) Stanislav Netshvolodovi (s. 1935) lühibiograafia. Tema töödest (maalid, graafika, puupannoo) näitusel Tartu Kunstimajas.

  6. African Journal of Biotechnology - Vol 14, No 4 (2015)

    African Journals Online (AJOL)

    producing thermophilic Streptomyces coelicoflavus NBRC 15399T · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. MK Duddu, KL Tripura, G Guntuku, DS Divya, 327-340 ...

  7. GENERAL SURGERY

    African Journals Online (AJOL)

    Results: Overall morbidity was 24% (n = 112), with bile leaks occurring in 25 ... biliary stenting (n = 8) and percutaneous transhepatic biliary drainage (n = 3). ..... Lam CM, Lo CM, Liu CL, Fan ST. ... Lau JY, Leung KL, Chung SC, Lau WY.

  8. Acrodysostosis

    Science.gov (United States)

    ... hands and feet Short bones Shortening of the forearm bones near the wrist Two genes have been ... Arkless-Graham; Acrodysplasia; Maroteaux-Malamut Images Anterior skeletal anatomy References Jones KL, Jones MC, Del Campo M. ...

  9. Sõjapidamine XIII : Eesti kaitsmisest sõjas ja rahus 5 / Rene Toomse

    Index Scriptorium Estoniae

    Toomse, Rene

    2011-01-01

    Eriüksused (erioperatsioonide grupp EOG, Kaitseliidu erioperatsioonide grupp KL EOG, Küberkaitseliit) ning strateegilise, operatsioonilise ja taktikalise tasandi toetussüsteemid. Võimaliku tsiviilkaitsesüsteemi toimimine ja otstarbekus

  10. Electronic Warfare: Army Special Operations Acquisition Strategy for Improved Equipment Is Sound

    National Research Council Canada - National Science Library

    1999-01-01

    ... to you. The Army Special Operations Command employs modified Chinook and Blackhawk helicopters, the MH-47D/E and MH-60K/L, respectively, in support of special operations missions worldwide These aircraft...

  11. A simple and efficient procedure to enhance artemisinin content in ...

    African Journals Online (AJOL)

    SERVER

    2007-06-18

    Jun 18, 2007 ... Full Length Research Paper. A simple .... The leaf material after the extraction was weighed (to measure the dry ... standard control in the measurement. ..... Ro DK, Paradise EM, Ouellet M, Fisher KJ, Newman KL, Ndungu JM,.

  12. Adsorption of Cu (II) onto Bamboo Supported Manganese (BS-Mn ...

    African Journals Online (AJOL)

    PROF HORSFALL

    Maximum monolayer coverage capacity(mg.g-1);. KL = Langmuir isotherm ... Nanotechnology offers the potential of creating material and device ... disorderliness, reduction in the rate of photosynthesis, cirrhosis .... Therefore, protonation and cationic.

  13. Osteoarthritic cartilage is more homogeneous than healthy cartilage

    DEFF Research Database (Denmark)

    Qazi, Arish A; Dam, Erik B; Nielsen, Mads

    2007-01-01

    it evolves as a consequence to disease and thereby can be used as a progression biomarker. MATERIALS AND METHODS: A total of 283 right and left knees from 159 subjects aged 21 to 81 years were scanned using a Turbo 3D T1 sequence on a 0.18-T MRI Esaote scanner. The medial compartment of the tibial cartilage...... sheet was segmented using a fully automatic voxel classification scheme based on supervised learning. From the segmented cartilage sheet, homogeneity was quantified by measuring entropy from the distribution of signal intensities inside the compartment. Each knee was examined by radiography...... of the region was evaluated by testing for overfitting. Three different regularization techniques were evaluated for reducing overfitting errors. RESULTS: The P values for separating the different groups based on cartilage homogeneity were 2 x 10(-5) (KL 0 versus KL 1) and 1 x 10(-7) (KL 0 versus KL >0). Using...

  14. The effect of thrombolytic therapy on QT dispersion in acute ...

    African Journals Online (AJOL)

    2013-07-02

    Jul 2, 2013 ... intraventricular conduction defect or atrial fibrillation were excluded from the study. .... detection and their benign characteristics. In some series including .... Glancy JM, Garratt CJ, Woods KL, de Bono DP. QT dispersion and ...

  15. Helminthiasis in Pregnancy in the Niger - Delta Region of Nigeria

    African Journals Online (AJOL)

    TNHJOURNALPH

    Kinikanwo Innocent Green, John Dimpka Ojule. Departments of ... Helminthiasis in Pregnancy- Green Kl, et al. Epidemiological surveys ..... Anaemia, iron deficiency, meat consumption and ... vitamin K, boron, chromium, copper, molybdenum ...

  16. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2017-10-05

    Oct 5, 2017 ... ... house, terraced 2 floors and. Author Correspondence, e-mail: ahmadshakir@ ... mental Healthcare, University Kuala Lumpur MESTECH(UniKL),. Kajang, Selangor .... ETS (cigarette) exposure at home. Yes. 35. 36.1. No. 62.

  17. Observation of the Rotational Spectra of 4HeH+, 4HeD+, 3HeH+, and 3HeD+

    International Nuclear Information System (INIS)

    Matsushima, F.; Oka, T.; Takagi, K.

    1997-01-01

    Low J rotational transitions of 4 HeH + , 4 HeD + , 3 HeH + , and 3 HeD + were observed in the 2 endash 5THz region with a high-precision far-infrared spectrometer. Dunham coefficients Y kl and isotopically independent parameters U kl , Δ He kl , and Δ H kl were determined. In particular, Δ parameters with k=0 and l=1,2 were determined with unprecedented accuracy, and provide important information for breakdown of the Born-Oppenheimer approximation. The lowest J=1 left-arrow 0 transition of 4 HeH + observed at 2010.1839(2)GHz will be an important future probe for detecting this species in space. copyright 1997 The American Physical Society

  18. Risk factors for placental malaria and associated adverse pregnancy ...

    African Journals Online (AJOL)

    ... suggest that, multigravida. African Health Sciences Vol 15 Issue 3, September 2015 .... Christian Medical University College Ethical Commit- tee (CRERC) on behalf of ..... Conroy AL, McDonald CR, Silver KL, et al. Com- plement activation: a ...

  19. Malocclusion (Misaligned Teeth)

    Science.gov (United States)

    ... and Dental Disorders Malocclusion Causes Treatment More Information Medical Dictionary Also of Interest (Quiz) Biology of the Mouth Additional Content Medical News Malocclusion ˌmal-ə-ˈklü-zhən (Misaligned Teeth) ...

  20. Automatic classification of MR scans in Alzheimer's disease

    OpenAIRE

    García, Fernando Pérez; uk, fernando perezgarcia ucl ac

    2018-01-01

    Presentation of the paper "Automatic classification of MR scans in Alzheimer's disease" by Klöppel et al. for the journal club of the Centre for Doctoral Training in Medical Image Computing at University College London.