Briquet, M.; Hubrig, S.; Cat, P. de; Aerts, C.C.; North, P.; Schöller, M.
2007-01-01
Aims. In order to better model massive B-type stars, we need to understand the physical processes taking place in slowly pulsating B (SPB) stars, chemically peculiar Bp stars, and non-pulsating normal B stars co-existing in the same part of the H-R diagram. Methods: We carry out a comparative study
Magnetic field of massive chemically peculiar stars in the Orion OB1 association
Romanyuk, I. I.; Semenko, E. A.; Kudryavtsev, D. O.; Yakunin, I. A.
2018-01-01
Spectropolarimetric observations of 55 chemically peculiar stars in the Orion OB1 association were obtained at the 6 m telescope of the Russian Academy of Sciences with the aim of searching for the presence of stellar magnetic fields. We found 8 new magnetic stars in addition to 20 previously known objects. The frequency of chemically peculiar A and B-type stars among normal A and B-type stars and the frequency of magnetic stars among all chemically peculiar stars decreases with age in the Orion OB1 association.
CHANDRA X-RAY DETECTION OF THE ENIGMATIC FIELD STAR BP Psc
International Nuclear Information System (INIS)
Kastner, Joel H.; Montez, Rodolfo; Rodriguez, David; Zuckerman, B.; Perrin, Marshall D.; Grosso, Nicolas; Forveille, Thierry; Graham, James R.
2010-01-01
BP Psc is a remarkable emission-line field star that is orbited by a dusty disk and drives a parsec-scale system of jets. We report the detection by the Chandra X-ray Observatory of a weak X-ray point source coincident with the centroids of optical/IR and submillimeter continuum emission at BP Psc. As the star's photosphere is obscured throughout the visible and near-infrared, the Chandra X-ray source likely represents the first detection of BP Psc itself. The X-rays most likely originate with magnetic activity at BP Psc and hence can be attributed either to a stellar corona or to star-disk interactions. The log of the ratio of X-ray to bolometric luminosity, log(L X /L bol ), lies in the range -5.8 to -4.2. This is smaller than log(L X /L bol ) ratios typical of low-mass, pre-main sequence stars, but is well within the log(L X /L bol ) range observed for rapidly rotating (FK Com-type) G giant stars. Hence, the Chandra results favor an exotic model wherein the disk/jet system of BP Psc is the result of its very recently engulfing a companion star or a giant planet, as the primary star ascended the giant branch.
HD 101065, the Most Peculiar Star
Indian Academy of Sciences (India)
2016-01-27
Jan 27, 2016 ... In this paper we discuss the prospects for asteroseismology with spatial resolution and motivate studies of the most chemically peculiar roAp star HD 101065. We present the first results from a high-precision radial velocity (RV) study of HD 101065 based on data spanning four nights that were acquired ...
Search for white dwarf companions of cool stars with peculiar element abundances
Energy Technology Data Exchange (ETDEWEB)
Boehm-Vitense, E.
1984-01-01
A search for a white dwarf companions of cool stars with peculiar element abundances was undertaken. One additional star the xi Cet, was found with a white dwarf companion. It was found that HR 1016, 56Uma, 16 Ser, have high excitation emission lines which indicate a high temperature object in the system. It is suggested that since these indications for high temperature companions were seen for all nearby Ba stars, it is highly probable that all Ba stars have white dwarf companions, and that the peculiar element abundances seen in the Ba stars are due to mass transfer. Observations, arguments and conclusions are presented. White dwarf companions were not found. Together with the Li and Be abundances and the chromospheric emission line spectra in these stars were studied. No white dwarf companions were seen for subgiant CH stars.
Search for white dwarf companions of cool stars with peculiar element abundances
International Nuclear Information System (INIS)
Boehm-Vitense, E.
1984-01-01
A search for a white dwarf companions of cool stars with peculiar element abundances was undertaken. One additional star the xi Cet, was found with a white dwarf companion. It was found that HR 1016, 56Uma, 16 Ser, have high excitation emission lines which indicate a high temperature object in the system. It is suggested that since these indications for high temperature companions were seen for all nearby Ba stars, it is highly probable that all Ba stars have white dwarf companions, and that the peculiar element abundances seen in the Ba stars are due to mass transfer. Observations, arguments and conclusions are presented. White dwarf companions were not found. Together with the Li and Be abundances and the chromospheric emission line spectra in these stars were studied. No white dwarf companions were seen for subgiant CH stars
International Nuclear Information System (INIS)
Adelman, S.J.
1979-01-01
Photometric indices are used to study the broad, continuum features that are present in the energy distributions of many peculiar A stars and that may be indicators of the atmospheric structure. Values of Maitzen's Δa index, which is a measure of the lambda5200 feature, are synthesized from spectrophotometric data to examine the properties of this photometric system as well as to establish a preliminary criterion of presence for the feature. Many Ap stars definitely exhibit this feature, which normal main sequence stars lack. Two indices Δiota and Δiota* are calculated from spectrophotometry to measure the strength of the lambda4200 feature. About 90% of the Ap stars are found to have definite positive results based on the preliminary criterion of presence of the latter index. For the Ap stars there is a general tendency for Δa to increase with Δiota and Δiota*. This most likely reflects the tendency for most abundances to increase together in the Ap stars. The HgMn stars have systematically larger Δiota* and Δa values than the normal stars. This does not necessarily mean that they have the lambda4200 and lambda5200 features of the peculiar A stars. To study this question requires careful comparison of the energy distributions of the HgMn stars with those of other stars and with the predictions of model atmospheres
The Nainital Cape Survey Project : A Search for Pulsation in Chemically Peculiar Stars
Chakradhari, Nand Kumar; Joshi, Santosh
2018-04-01
The Nainital-Cape Survey is a dedicated search programme initiated in 1999 in the coordination of astronomers from SAAO South Africa, ARIES Nainital and ISRO Bangalore. Over the last 17 years a total of 345 chemically peculiar stars were monitored for photometric variability, making it one of the longest ground-based survey to search for pulsation in chemically peculiar stars in terms of both time span and sample size. Under this survey, we discovered rapid pulsation in the Ap star HD12098 while δ Scuti-type pulsations were detected in seven Am stars. Those stars in which pulsations were not detected have also been tabulated along with their detailed astrophysical parameters for further investigation.
A search for peculiar stars in the open cluster Hogg 16
Cariddi, Stefano; Azatyan, Naira M.; Kurfürst, Petr; Štofanová, Lýdia; Netopil, Martin; Paunzen, Ernst; Pintado, Olga I.; Aidelman, Yael J.
2018-01-01
The study of chemically peculiar (CP) stars in open clusters provides valuable information about their evolutionary status. Their detection can be performed using the Δa photometric system, which maps a characteristic flux depression at λ ∼ 5200 Å. This paper aims at studying the occurrence of CP stars in the earliest stages of evolution of a stellar population by applying this technique to Hogg 16, a very young Galactic open cluster ( ∼ 25 Myr). We identified several peculiar candidates: two B-type stars with a negative Δa index (CD - 60 4701, CPD - 60 4706) are likely emission-line (Be) stars, even though spectral measurements are necessary for a proper classification of the second one; a third object (CD - 60 4703), identified as a Be candidate in literature, appears to be a background B-type supergiant with no significant Δa index, which does not rule out the possibility that it is indeed peculiar as the normality line of Δa for supergiants has not been studied in detail yet. A fourth object (CD - 60 4699) appears to be a magnetic CP star of 8 M⊙, but obtained spectral data seem to rule out this hypothesis. Three more magnetic CP star candidates are found in the domain of early F-type stars. One is a probable nonmember and close to the border of significance, but the other two are probably pre-main sequence cluster objects. This is very promising, as it can lead to very strong constraints to the diffusion theory. Finally, we derived the fundamental parameters of Hogg 16 and provide for the first time an estimate of its metal content.
The occurrence of peculiar stars in open clusters
International Nuclear Information System (INIS)
Abt, H.A.; Levato, H.
1978-01-01
The authors have classified on the MK system a total of 455 stars in 12 open clusters and associations. The classification is based on wide (1.2 mm) spectra of two reciprocal dispersions (39, 128 A mm -1 ) obtained with the Kitt Peak 2.1 m and 90 cm reflectors respectively. The higher dispersion is necessary to show the subtle peculiarities found in some stars. The clusters are the Orion Nebula cluster, Orion OB1 association, Lacerta OB1 association, IC 2602, IC 4665, Pleiades, M39, M34, NGC 2516, NGC 6633, NGC 6475, and Coma. (Auth.)
Oksala, M. E.; Silvester, J.; Kochukhov, O.; Neiner, C.; Wade, G. A.; the MiMeS Collaboration
2018-01-01
Previous studies of the chemically peculiar Bp star 36 Lyn revealed a moderately strong magnetic field, circumstellar material and inhomogeneous surface abundance distributions of certain elements. We present in this paper an analysis of 33 high signal-to-noise ratio, high-resolution Stokes IV observations of 36 Lyn obtained with the Narval spectropolarimeter at the Bernard Lyot Telescope at Pic du Midi Observatory. From these data, we compute new measurements of the mean longitudinal magnetic field, Bℓ, using the multiline least-squares deconvolution (LSD) technique. A rotationally phased Bℓ curve reveals a strong magnetic field, with indications for deviation from a pure dipole field. We derive magnetic maps and chemical abundance distributions from the LSD profiles, produced using the Zeeman-Doppler imaging code INVERSLSD. Using a spherical harmonic expansion to characterize the magnetic field, we find that the harmonic energy is concentrated predominantly in the dipole mode (ℓ = 1), with significant contribution from both the poloidal and toroidal components. This toroidal field component is predicted theoretically, but not typically observed for Ap/Bp stars. Chemical abundance maps reveal a helium enhancement in a distinct region where the radial magnetic field is strong. Silicon enhancements are located in two regions, also where the radial field is stronger. Titanium and iron enhancements are slightly offset from the helium enhancements, and are located in areas where the radial field is weak, close to the magnetic equator.
SPECTROPOLARIMETRY OF THE CLASSICAL T TAURI STAR BP TAU
International Nuclear Information System (INIS)
Chen, Wei; Johns-Krull, Christopher M.
2013-01-01
We implement a least-squares deconvolution (LSD) code to study magnetic fields on cool stars. We first apply our code to high-resolution optical echelle spectra of 53 Cam (a magnetic Ap star) and three well-studied cool stars (Arcturus, 61 Cyg A, and ξ Boo A) as well as the Sun (by observing the asteroid Vesta) as tests of the code and the instrumentation. Our analysis is based on several hundred photospheric lines spanning the wavelength range 5000 Å to 9000 Å. We then apply our LSD code to six nights of data on the Classical T Tauri Star BP Tau. A maximum longitudinal field of 370 ± 80 G is detected from the photospheric lines on BP Tau. A 1.8 kG dipole tilted at 129° with respect to the rotation axis and a 1.4 kG octupole tilted at 104° with respect to the rotation axis, both with a filling factor of 0.25, best fit our LSD Stokes V profiles. Measurements of several emission lines (He I 5876 Å, Ca II 8498 Å, and 8542 Å) show the presence of strong magnetic fields in the line formation regions of these lines, which are believed to be the base of the accretion footpoints. The field strength measured from these lines shows night-to-night variability consistent with rotation of the star
SPECTROPOLARIMETRY OF THE CLASSICAL T TAURI STAR BP TAU
Energy Technology Data Exchange (ETDEWEB)
Chen, Wei; Johns-Krull, Christopher M., E-mail: wc2@rice.edu, E-mail: cmj@rice.edu [Department of Physics and Astronomy, Rice University, Houston, TX 77005 (United States)
2013-10-20
We implement a least-squares deconvolution (LSD) code to study magnetic fields on cool stars. We first apply our code to high-resolution optical echelle spectra of 53 Cam (a magnetic Ap star) and three well-studied cool stars (Arcturus, 61 Cyg A, and ξ Boo A) as well as the Sun (by observing the asteroid Vesta) as tests of the code and the instrumentation. Our analysis is based on several hundred photospheric lines spanning the wavelength range 5000 Å to 9000 Å. We then apply our LSD code to six nights of data on the Classical T Tauri Star BP Tau. A maximum longitudinal field of 370 ± 80 G is detected from the photospheric lines on BP Tau. A 1.8 kG dipole tilted at 129° with respect to the rotation axis and a 1.4 kG octupole tilted at 104° with respect to the rotation axis, both with a filling factor of 0.25, best fit our LSD Stokes V profiles. Measurements of several emission lines (He I 5876 Å, Ca II 8498 Å, and 8542 Å) show the presence of strong magnetic fields in the line formation regions of these lines, which are believed to be the base of the accretion footpoints. The field strength measured from these lines shows night-to-night variability consistent with rotation of the star.
The composite nature of the peculiar star HR 6560 (HD 159870)
Wegner, Gary; Cowley, Charles R.
1992-01-01
Ground-based high-dispersion photographic spectra and ultraviolet spectra obtained with the IUE satellite are described and employed to determine the nature of the peculiar star HR 6560 (HD 159870). Previously this object had been described as both a composite system and as a strong Fm star. The UBVRI, Stromgren, and ultraviolet colors of HR 6560 are compared with objects classified composite from the Bright Star Catalogue and normal dwarfs and giants. The colors of HR 6560 are not unusual for a composite and are consistent with a late-A dwarf, combined with a late-G or early-K giant. The ultraviolet satellite clearly shows the presence of an A component, but its precise spectral type is difficult to assign. The IUE and TD-1 data suggest that the ultraviolet is dominated by light from an A5 V secondary and the visual from a GO III primary. This does not agree well with the most plausible model that fits the visual photometry. The peculiar nature of HR 6560's spectrum is most likely due to its composite nature.
Search for molecular outflows associated with peculiar nebulosities and regions of star formation
Energy Technology Data Exchange (ETDEWEB)
Torrelles, J M; Rodriguez, L F; Canto, J; Marcaide, J; Gyulbudaghian, A L
1983-01-01
We surveyed an extensive list of peculiar nebulosities and regions of star formation searching for conspicuous cases of high-velocity carbon monoxide emission. We detected an apparently isotropic outflow associated with the star-forming region GL 2591. Among the other sources surveyed, the cometary nebula GM 24 is of interest since it is located in a very hot molecular spot where formation of massive stars took place recently.
Peculiar early-type galaxies with central star formation
International Nuclear Information System (INIS)
Ge Chong; Gu Qiusheng
2012-01-01
Early-type galaxies (ETGs) are very important for understanding the formation and evolution of galaxies. Recent observations suggest that ETGs are not simply old stellar spheroids as we previously thought. Widespread recent star formation, cool gas and dust have been detected in a substantial fraction of ETGs. We make use of the radial profiles of g — r color and the concentration index from the Sloan Digital Sky Survey database to pick out 31 peculiar ETGs with central blue cores. By analyzing the photometric and spectroscopic data, we suggest that the blue cores are caused by star formation activities rather than the central weak active galactic nucleus. From the results of stellar population synthesis, we find that the stellar population of the blue cores is relatively young, spreading from several Myr to less than one Gyr. In 14 galaxies with H I observations, we find that the average gas fraction of these galaxies is about 0.55. The bluer galaxies show a higher gas fraction, and the total star formation rate (SFR) correlates very well with the H I gas mass. The star formation history of these ETGs is affected by the environment, e.g. in the denser environment the H I gas is less and the total SFR is lower. We also discuss the origin of the central star formation of these early-type galaxies.
The peculiar A star HD 110066: a photographic region line identification study
International Nuclear Information System (INIS)
Adelman, S.J.
1988-01-01
A line identification study of the very sharp-lined peculiar A star HD 110066 has been performed using four high dispersion photographic region spectrograms. New species found include Al I, Si I, S II, Ti I, Co II, Zr II, Cd I, La II, Ce III, Gd III, Dy II, Er II and Tm II. The presence of these species is in accord with the continuity of the magnetic Ap star sequence. (author)
HD 101065, the Most Peculiar Star: First Results from Precise Radial ...
Indian Academy of Sciences (India)
Abstract. In this paper we discuss the prospects for asteroseismology with spatial resolution and motivate studies of the most chemically peculiar. roAp star HD 101065. We present the first results from a high-precision radial velocity (RV) study of HD 101065 based on data spanning four nights that were acquired using the ...
International Nuclear Information System (INIS)
Tomasella, Lina; Munari, Ulisse; Zwitter, Tomaz
2010-01-01
We present an Echelle+CCD, high signal-to-noise ratio, high-resolution (R = 20,000) spectroscopic atlas of 108 well-known objects representative of the most common types of peculiar and variable stars. The wavelength interval extends from 4600 to 9400 A and includes the RAVE, Gaia, and HERMES wavelength ranges. Multi-epoch spectra are provided for the majority of the observed stars. A total of 425 spectra of peculiar stars, which were collected during 56 observing nights between 1998 November and 2002 August, are presented. The spectra are given in FITS format and heliocentric wavelengths, with accurate subtraction of both the sky background and the scattered light. Auxiliary material useful for custom applications (telluric dividers, spectrophotometric stars, flat-field tracings) is also provided. The atlas aims to provide a homogeneous database of the spectral appearance of stellar peculiarities, a tool useful both for classification purposes and inter-comparison studies. It could also serve in the planning and development of automated classification algorithms designed for RAVE, Gaia, HERMES, and other large-scale spectral surveys. The spectrum of XX Oph is discussed in some detail as an example of the content of the present atlas.
HD 185330 — chemically peculiar 3He star in the Kepler field
Niemczura, E.; Vennes, S.; Różański, T.; Pigulski, A.; Hełminiak, K.; Lehmann, H.
2018-01-01
We analyzed high-resolution spectra of the chemically peculiar 3He star HD 185330. We determined its atmospheric parameters (Teff, log g, ξ) and constrained its rotation velocity and abundance pattern. In particular, we found a large (×100) phosphorus abundance excess and evidence of 3He and 4He abundance stratification in the atmosphere.
Mullan, D. J.
2009-09-01
Two large X-ray flares have been reported from the direction of a magnetic B2p star (σ Ori E). Sanz-Forcada et al. have suggested that the flares did not occur on the B2p star but on a companion of late spectral type. A star which is a candidate for a late-type flare star near σ Ori E has recently been identified by Bouy et al. However, based on the properties of the flares, and based on a recent model of rotating magnetospheres, we argue that, rather than attributing the two flares to a late-type dwarf, it is a viable hypothesis that the flares were magnetic phenomena associated with the rotating magnetosphere of the B2p star itself.
International Nuclear Information System (INIS)
Mullan, D. J.
2009-01-01
Two large X-ray flares have been reported from the direction of a magnetic B2p star (σ Ori E). Sanz-Forcada et al. have suggested that the flares did not occur on the B2p star but on a companion of late spectral type. A star which is a candidate for a late-type flare star near σ Ori E has recently been identified by Bouy et al. However, based on the properties of the flares, and based on a recent model of rotating magnetospheres, we argue that, rather than attributing the two flares to a late-type dwarf, it is a viable hypothesis that the flares were magnetic phenomena associated with the rotating magnetosphere of the B2p star itself.
The incidence of chemically peculiar stars in open clusters
Energy Technology Data Exchange (ETDEWEB)
Netopil, M.
2013-07-01
The formation and evolution of chemically peculiar (CP) stars is still a matter of debate, although the first representatives were detected already more than 110 years ago. From the astrophysical point of view, these objects are of particular interest, since they combine a wide variety of specific properties. This work deals with a subgroup of CP stars, showing beside overabundances of some iron-peak (e.g. Chromium) and rare earth elements like Europium, also strong ordered magnetic fields as well as a slow rotation. Based on a selection of well investigated close field stars, the possible connections of these properties were examined. However, the main research focus was the analysis of a relationship between the number of CP stars and their age. For this purpose, the results of the extensive Delta-a survey in open clusters were used. This photometric filter system allows an efficient and economic detection of magnetic CP stars due to a characteristic flux depression at 520 nm. Compared to field stars, open clusters offer the big advantage that for example the age and the distance can be determined more accurately on a statistical basis, since all member stars of an open cluster originate more or less at the same time from a single molecular cloud. After the membership analysis of all in Delta a investigated objects and the determination of the cluster parameters, it was shown that the occurrence of CP stars depend on age, but can be explained by the general evolution of stars. This entails amongst others that CP stars show their typical characteristics already as soon as they have arrived the main-sequence, or even before. Furthermore, we were able to detect at least one representative, probably still in its pre-main-sequence phase. (author) [German] Die Entstehung und Entwicklung von chemisch pekuliaren (CP) Sternen ist nach wie vor nicht restlos geklärt, und das obwohl die ersten Vertreter dieser Sterngruppe bereits vor mehr als 110 Jahren entdeckt wurden. Aus
Kinematic and spatial distributions of barium stars - are the barium stars and Am stars related?
International Nuclear Information System (INIS)
Hakkila, J.
1989-01-01
The possibility of an evolutionary link between Am stars and barium stars is considered, and an examination of previous data suggests that barium star precursors are main-sequence stars of intermediate mass, are most likely A and/or F dwarfs, and are intermediate-mass binaries with close to intermediate orbital separations. The possible role of mass transfer in the later development of Am systems is explored. Mass transfer and loss from systems with a range of masses and orbital separations may explain such statistical peculiarities of barium stars as the large dispersion in absolute magnitude, the large range of elemental abundances from star to star, and the small number of stars with large peculiar velocities. 93 refs
Milisavljevic, Dan; Margutti, Raffaella
2018-06-01
What makes a supernova truly "peculiar?" In this review we attempt to address this question by tracing the history of the use of "peculiar" as a descriptor of non-standard supernovae back to the original binary spectroscopic classification of Type I vs. Type II proposed by Minkowski (Publ. Astron. Soc. Pac., 53:224, 1941). A handful of noteworthy examples are highlighted to illustrate a general theme: classes of supernovae that were once thought to be peculiar are later seen as logical branches of standard events. This is not always the case, however, and we discuss ASASSN-15lh as an example of a transient with an origin that remains contentious. We remark on how late-time observations at all wavelengths (radio-through-X-ray) that probe 1) the kinematic and chemical properties of the supernova ejecta and 2) the progenitor star system's mass loss in the terminal phases preceding the explosion, have often been critical in understanding the nature of seemingly unusual events.
Ake, Thomas B.; Johnson, Hollis R.
1988-01-01
Ultraviolet spectra of the peculiar red giants (PRGs) called MS stars are investigated, and the discovery of a white dwarf (WD) companion to the MS star 4 Omicron(1) Orionis is reported. The observations and data analysis are discussed and compared with those for field WDs in order to derive parameters for the WD and the luminosity of the primary. Detection limits for the other MS stars investigated are derived, and the binary hypothesis for PRGs is reviewed.
HD 66051, an eclipsing binary hosting a highly peculiar, HgMn-related star.
Niemczura, Ewa; Hümmerich, Stefan; Castelli, Fiorella; Paunzen, Ernst; Bernhard, Klaus; Hambsch, Franz-Josef; Hełminiak, Krzysztof
2017-07-19
HD 66051 is an eclipsing system with an orbital period of about 4.75 d that exhibits out-of-eclipse variability with the same period. New multicolour photometric observations confirm the longevity of the secondary variations, which we interpret as a signature of surface inhomogeneities on one of the components. Using archival and newly acquired high-resolution spectra, we have performed a detailed abundance analysis. The primary component is a slowly rotating late B-type star (T eff = 12500 ± 200 K; log g = 4.0, v sin i = 27 ± 2 km s -1 ) with a highly peculiar composition reminiscent of the singular HgMn-related star HD 65949, which seems to be its closest analogue. Some light elements as He, C, Mg, Al are depleted, while Si and P are enhanced. Except for Ni, all the iron-group elements, as well as most of the heavy elements, and in particular the REE elements, are overabundant. The secondary component was estimated to be a slowly rotating A-type star (T eff ~ 8000 K; log g = 4.0, v sin i ~ 18 km s -1 ). The unique configuration of HD 66051 opens up intriguing possibilities for future research, which might eventually and significantly contribute to the understanding of such diverse phenomena as atmospheric structure, mass transfer, magnetic fields, photometric variability and the origin of chemical anomalies observed in HgMn stars and related objects.
Spectrophotometry of peculiar B and A stars. II. Eleven mercury-manganese stars
International Nuclear Information System (INIS)
Adelman, S.J.; Pyper, D.M.
1979-01-01
Spectrophotometry of eleven HgMn stars is presented for the optical region. As found in Paper I, the HgMn stars have systematically larger Δiota* and Δa values than the normal main sequence stars due to differences with respect to the mean continuum particularly of the lambda4464 values and the lambda5200 region, respectively. The HgMn stars exhibit a continuous range in the behavior of both the lambda4200 and lambda5200 regions between those stars that have index values larger than the appropriate criterion of presence and present definite evidence for the features to those stars with only a slight possibility of such features. The strengths of the lambda4200 and lambda5200 features appear not to be correlated. In the HgMn stars, both features may be due to differential line blocking. In the energy distribution of all eleven stars, the Balmer jump regions best fit the predictions of slightly hotter solar composition, log g=4.0, fully line blanketed model atmospheres than do the corresponding Paschen continua
Peculiarities and Variations in the Optical Spectrum of the RV Tauri-type Star R Sct
Directory of Open Access Journals (Sweden)
Kipper Tõnu
2013-06-01
Full Text Available We analyzed some new high resolution optical spectra of the semiregular RV Tauri-type star R Sct. Fundamental parameters were found to be Teff = 4500 K, log g = 0.0 and ξt = 4.0 km s−1. The results of chemical analysis show that R Sct is a metal-poor star with [Fe/H]≈ −0.5. The carbon content with respect to iron is significantly larger than in the Sun, [C/Fe]=0.84, but there is an evident deficiency of heavy elements. We found no tight correlation of the chemical abundances on the condensation temperatures of elements. This means that in R Sct the depletion by condensation into dust does not work, with possible exception of Ca and Sc. The luminosity derived from the Hipparcos parallax corresponds to a tip of the red-giant branch or slightly above it. Thus it is possible that R Sct evolved off the early-AGB when it has not yet experienced the third dredge-up in thermal pulses, or it is still located on AGB. The peculiarities of spectral features (emissions, line-splitting and the complicated time-variable radial velocities were also studied.
Wolf-Rayet stars and O-star runaways with HIPPARCOS - I. Kinematics
Moffat, AFJ; Marchenko, SV; Seggewiss, W; van der Hucht, KA; Schrijver, H; Stenholm, B; Lundstrom, [No Value; Gunawan, DYAS; Sutantyo, W; van den Heuvel, EPJ; De Cuyper, JP; Gomez, AE
Reliable systemic radial velocities are almost impossible to secure for Wolf-Rayet stars, difficult for O stars. Therefore, to study the motions - both systematic in the Galaxy and peculiar - of these two related types of hot, luminous star, we have examined the Hipparcos proper motions of some 70
The peculiar galactic center neutron star X-ray binary XMM J174457-2850.3
Energy Technology Data Exchange (ETDEWEB)
Degenaar, N.; Reynolds, M. T.; Miller, J. M. [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48109 (United States); Wijnands, R. [Anton Pannekoek Institute of Astronomy, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Altamirano, D. [School of Physics and Astronomy, University of Southampton, Highfield, Southampton SO17 1BJ (United Kingdom); Kennea, J. [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); Gehrels, N. [Astrophysics Science Division, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Haggard, D. [CIERA, Physics and Astronomy Department, Northwestern University, 2145 Sheridan Road, Evanston, IL 60208 (United States); Ponti, G., E-mail: degenaar@umich.edu [Max Planck Institute fur Extraterrestriche Physik, D-85748 Garching (Germany)
2014-09-10
The recent discovery of a millisecond radio pulsar experiencing an accretion outburst similar to those seen in low mass X-ray binaries, has opened up a new opportunity to investigate the evolutionary link between these two different neutron star manifestations. The remarkable X-ray variability and hard X-ray spectrum of this object can potentially serve as a template to search for other X-ray binary/radio pulsar transitional objects. Here we demonstrate that the transient X-ray source XMM J174457-2850.3 near the Galactic center displays similar X-ray properties. We report on the detection of an energetic thermonuclear burst with an estimated duration of ≅2 hr and a radiated energy output of ≅ 5 × 10{sup 40} erg, which unambiguously demonstrates that the source harbors an accreting neutron star. It has a quiescent X-ray luminosity of L {sub X} ≅ 5 × 10{sup 32}(D/6.5 kpc){sup 2} erg s{sup –1} and exhibits occasional accretion outbursts during which it brightens to L {sub X} ≅ 10{sup 35}-10{sup 36}(D/6.5 kpc){sup 2} erg s{sup –1} for a few weeks (2-10 keV). However, the source often lingers in between outburst and quiescence at L {sub X} ≅ 10{sup 33}-10{sup 34}(D/6.5 kpc){sup 2} erg s{sup –1}. This peculiar X-ray flux behavior and its relatively hard X-ray spectrum, a power law with an index of Γ ≅ 1.4, could possibly be explained in terms of the interaction between the accretion flow and the magnetic field of the neutron star.
Spectrophotometry of peculiar B and A stars
International Nuclear Information System (INIS)
Adelman, S.J.
1980-01-01
Spectrophotometry of the optical region lambda lambda 3300-7100 is presented for seven magnetic Ap stars: HD 32650, 84 Ursa Majoris, HD 149822, 19 Lyrae, 4 Cygni, HD 196178, and 108 Aquarii. The energy distributions of all seven stars show definite lambda 4200 and lambda 5200 broad, continuum features as well as other more subtle deviations from the predictions of normal stellar atmospheres. The observations of HD 32650 violate the general rule for the Ap stars that the temperature found by comparing the Balmer jump regions with the predictions of normal stalle atmospheres with log g = 4.0 are systematically greater than those found from fitting the slopes of the Paschen continua. (orig.)
Kılıçoğlu, Tolgahan; Çalışkan, Şeyma; Ünal, Kübraözge
2018-01-01
To understand the origin of the abundance peculiarities of non-magnetic A-type stars, we present the first detailed chemical abundance analysis of a metallic line star HD 23193 (A2m) and an A-type subgiant HD 170920 (A5), which could have been a HgMn star on the main sequence. Our analysis is based on medium (R ∼ 14,000) and high (R ∼ 40,000) resolution spectroscopic data of the stars. The abundances of 18 elements are derived: C, O, Na, Mg, Al, Si, S, Ca, Sc, Ti, Cr, Mn, Fe, Ni, Zn, Sr, Y, and Ba. The masses of HD 23193 and HD 170920 are estimated from evolutionary tracks as 2.3 ± 0.1 M ⊙ and 2.9 ± 0.1 M ⊙. The ages are found to be 635 ± 33 Myr for HD 23193 and 480 ± 50 Myr for HD 170920 using isochrones. The abundance pattern of HD 23193 shows deviations from solar values in the iron-peak elements and indicates remarkable overabundances of Sr (1.16), Y (1.03), and Ba (1.24) with respect to the solar abundances. We compare the derived abundances of this moderately rotating (v\\sin i =37.5 km s‑1) Am star to the theoretical chemical evolution models including rotational mixing. The theoretically predicted abundances resemble our derived abundance pattern, except for a few elements (Si and Cr). For HD 170920, we find nearly solar abundances, except for C (‑0.43), S (0.16), Ti (0.15), Ni (0.16), Zn (0.41), Y (0.57), and Ba (0.97). Its low rotational velocity (v\\sin i=14.5 km s‑1), reduced carbon abundance, and enhanced heavy element abundances suggest that the star is most likely an evolved HgMn star. Based on observations made at the TÜBITAK National Observatory (Program ID 14BRTT150–671), and the Ankara University Observatory, Turkey.
Bychkov, V. D.; Bychkova, L. V.; Madej, J.
2008-01-01
Now it is known about 1212 stars of the main sequence and giants (from them 610 stars - it is chemically peculiarity (CP) stars) for which direct measurements of magnetic fields were spent (Bychkov et al.,2008). Let's consider, what representations were generated about magnetic fields (MT) of stars on the basis of available observations data.
Energy Technology Data Exchange (ETDEWEB)
Chen, Wen-Cong [School of Physics and Electrical Information, Shangqiu Normal University, Shangqiu 476000 (China); Podsiadlowski, Philipp, E-mail: chenwc@pku.edu.cn [Department of Physics, University of Oxford, Oxford OX1 3RH (United Kingdom)
2016-10-20
It is generally believed that ultracompact X-ray binaries (UCXBs) evolved from binaries consisting of a neutron star accreting from a low-mass white dwarf (WD) or helium star where mass transfer is driven by gravitational radiation. However, the standard WD evolutionary channel cannot produce the relatively long-period (40–60 minutes) UCXBs with a high time-averaged mass-transfer rate. In this work, we explore an alternative evolutionary route toward UCXBs, where the companions evolve from intermediate-mass Ap/Bp stars with an anomalously strong magnetic field (100–10,000 G). Including the magnetic braking caused by the coupling between the magnetic field and an irradiation-driven wind induced by the X-ray flux from the accreting component, we show that intermediate-mass X-ray binaries (IMXBs) can evolve into UCXBs. Using the MESA code, we have calculated evolutionary sequences for a large number of IMXBs. The simulated results indicate that, for a small wind-driving efficiency f = 10{sup −5}, the anomalous magnetic braking can drive IMXBs to an ultra-short period of 11 minutes. Comparing our simulated results with the observed parameters of 15 identified UCXBs, the anomalous magnetic braking evolutionary channel can account for the formation of seven and eight sources with f = 10{sup −3}, and 10{sup −5}, respectively. In particular, a relatively large value of f can fit three of the long-period, persistent sources with a high mass-transfer rate. Though the proportion of Ap/Bp stars in intermediate-mass stars is only 5%, the lifetime of the UCXB phase is ≳2 Gyr, producing a relatively high number of observable systems, making this an alternative evolutionary channel for the formation of UCXBs.
International Nuclear Information System (INIS)
Lutz, J.H.
1978-01-01
Difficulties occurring in the observation of central stars of planetary nebulae are reviewed with emphasis on spectral classifications and population types, and temperature determination. Binary and peculiar central stars are discussed. (U.M.G.)
The magnetic early B-type stars I: magnetometry and rotation
Shultz, M. E.; Wade, G. A.; Rivinius, Th; Neiner, C.; Alecian, E.; Bohlender, D.; Monin, D.; Sikora, J.; MiMeS Collaboration; BinaMIcS Collaboration
2018-04-01
The rotational and magnetic properties of many magnetic hot stars are poorly characterized, therefore the Magnetism in Massive Stars and Binarity and Magnetic Interactions in various classes of Stars collaborations have collected extensive high-dispersion spectropolarimetric data sets of these targets. We present longitudinal magnetic field measurements for 52 early B-type stars (B5-B0), with which we attempt to determine their rotational periods Prot. Supplemented with high-resolution spectroscopy, low-resolution Dominion Astrophysical Observatory circular spectropolarimetry, and archival Hipparcos photometry, we determined Prot for 10 stars, leaving only five stars for which Prot could not be determined. Rotational ephemerides for 14 stars were refined via comparison of new to historical magnetic measurements. The distribution of Prot is very similar to that observed for the cooler Ap/Bp stars. We also measured v sin i and vmac for all stars. Comparison to non-magnetic stars shows that v sin i is much lower for magnetic stars, an expected consequence of magnetic braking. We also find evidence that vmac is lower for magnetic stars. Least-squares deconvolution profiles extracted using single-element masks revealed widespread, systematic discrepancies in between different elements: this effect is apparent only for chemically peculiar stars, suggesting it is a consequence of chemical spots. Sinusoidal fits to H line measurements (which should be minimally affected by chemical spots), yielded evidence of surface magnetic fields more complex than simple dipoles in six stars for which this has not previously been reported; however, in all six cases, the second- and third-order amplitudes are small relative to the first-order (dipolar) amplitudes.
Magnetic fields in beta Cep, SPB, and Be stars
Schoeller, M.; Hubrig, S.; Briquet, M.; Ilyin, I.
2013-01-01
Recent observational and theoretical results emphasize the potential significance of magnetic fields for structure, evolution, and environment of massive stars. Depending on their spectral and photometric behavior, the upper main-sequence B-type stars are assigned to different groups, such as beta Cep stars and slowly pulsating B (SPB) stars, He-rich and He-deficient Bp stars, Be stars, BpSi stars, HgMn stars, or normal B-type stars. All these groups are characterized by different magnetic fi...
International Nuclear Information System (INIS)
Loden, L.O.; Sundman, A.
1989-01-01
This study is part of an investigation of the possibility of using chemically peculiar (CP) stars to map local galactic structure. Correct luminosities of these stars are therefore crucial. CP stars are generally regarded as main-sequence or near-main-sequence objects. However, some CP stars have been classified as giants. A selection of stars, classified in literature as CP giants, are compared to normal stars in the same effective temperature interval and to ordinary 'non giant' CP stars. There is no clear confirmation of a higher luminosity for 'CP giants', than for CP stars in general. In addition, CP characteristics seem to be individual properties not repeated in a component star or other cluster members. (author). 50 refs., 5 tabs., 3 figs
The Kuwano peculiar object (PU Vulpeculae)
International Nuclear Information System (INIS)
Belyakina, T.S.; Gershberg, R.E.; Efimov, Yu.S.; Krasnobabtsev, V.I.; Pavlenko, E.P.; Petrov, P.P.; Chuvaev, K.K.; Shenavrin, V.I.
1982-01-01
U, B, V, J, H, K photometry, polarimetry and spectroscopy of this peculiar object was made from August 1979 to December 1980 and the observations are briefly discussed. The authors consider PU Vul to be binary with a late M giant and a component of probably low luminosity. The latter flared in 1979, and the former also changed a little. From the photometric, spectroscopic and polarimetric data they estimate E(B-V) <= 0.4 and locate the star at 5-7 kpc from the sun and 0.7-1.0 kpc from the galactic plane. The photometric behaviour, duplicity, and nature of the components are similar to those of novae and symbiotic stars, but no evidence for an ejected envelope is seen. (Auth.)
Using the Seismology of Non-magnetic Chemically Peculiar Stars as ...
Indian Academy of Sciences (India)
2016-01-27
Jan 27, 2016 ... Chemical composition is a good tracer of the hydrodynamical processes that occur in stars as they often lead to mixing and particle transport. By comparing abundances predicted by models and those observed in stars we can infer some constraints on those mixing processes. As pulsations in the stars are ...
On the origin of high-velocity runaway stars
Gvaramadze, V.V.; Gualandris, A.; Portegies Zwart, S.
2009-01-01
We explore the hypothesis that some high-velocity runaway stars attain their peculiar velocities in the course of exchange encounters between hard massive binaries and a very massive star (either an ordinary 50-100 M-circle dot star or a more massive one, formed through runaway mergers of ordinary
Hyperfast pulsars as the remnants of massive stars ejected from young star clusters
Gvaramadze, Vasilii V.; Gualandris, Alessia; Portegies Zwart, Simon
2008-04-01
Recent proper motion and parallax measurements for the pulsar PSR B1508+55 indicate a transverse velocity of ~1100kms-1, which exceeds earlier measurements for any neutron star. The spin-down characteristics of PSR B1508+55 are typical for a non-recycled pulsar, which implies that the velocity of the pulsar cannot have originated from the second supernova disruption of a massive binary system. The high velocity of PSR B1508+55 can be accounted for by assuming that it received a kick at birth or that the neutron star was accelerated after its formation in the supernova explosion. We propose an explanation for the origin of hyperfast neutron stars based on the hypothesis that they could be the remnants of a symmetric supernova explosion of a high-velocity massive star which attained its peculiar velocity (similar to that of the pulsar) in the course of a strong dynamical three- or four-body encounter in the core of dense young star cluster. To check this hypothesis, we investigated three dynamical processes involving close encounters between: (i) two hard massive binaries, (ii) a hard binary and an intermediate-mass black hole (IMBH) and (iii) a single stars and a hard binary IMBH. We find that main-sequence O-type stars cannot be ejected from young massive star clusters with peculiar velocities high enough to explain the origin of hyperfast neutron stars, but lower mass main-sequence stars or the stripped helium cores of massive stars could be accelerated to hypervelocities. Our explanation for the origin of hyperfast pulsars requires a very dense stellar environment of the order of 106- 107starspc-3. Although such high densities may exist during the core collapse of young massive star clusters, we caution that they have never been observed.
SHOCKS AND A GIANT PLANET IN THE DISK ORBITING BP PISCIUM?
International Nuclear Information System (INIS)
Melis, C.; Zuckerman, B.; Gielen, C.; Chen, C. H.; Rhee, Joseph H.; Song, Inseok
2010-01-01
Spitzer Infrared Spectrograph data support the interpretation that BP Piscium, a gas and dust enshrouded star residing at high Galactic latitude, is a first-ascent giant rather than a classical T Tauri star. Our analysis suggests that BP Piscium's spectral energy distribution can be modeled as a disk with a gap that is opened by a giant planet. Modeling the rich mid-infrared emission line spectrum indicates that the solid-state emitting grains orbiting BP Piscium are primarily composed of ∼75 K crystalline, magnesium-rich olivine; ∼75 K crystalline, magnesium-rich pyroxene; ∼200 K amorphous, magnesium-rich pyroxene; and ∼200 K annealed silica (cristobalite). These dust grains are all sub-micron sized. The giant planet and gap model also naturally explains the location and mineralogy of the small dust grains in the disk. Disk shocks that result from disk-planet interaction generate the highly crystalline dust which is subsequently blown out of the disk mid-plane and into the disk atmosphere.
THE PECULIAR CHEMICAL INVENTORY OF NGC 2419: AN EXTREME OUTER HALO 'GLOBULAR CLUSTER'
International Nuclear Information System (INIS)
Cohen, Judith G.; Kirby, Evan N.; Huang Wenjin
2011-01-01
NGC 2419 is a massive outer halo Galactic globular cluster (GC) whose stars have previously been shown to have somewhat peculiar abundance patterns. We have observed seven luminous giants that are members of NGC 2419 with Keck/HIRES at reasonable signal-to-noise ratio. One of these giants is very peculiar, with an extremely low [Mg/Fe] and high [K/Fe] but normal abundances of most other elements. The abundance pattern does not match the nucleosynthetic yields of any supernova model. The other six stars show abundance ratios typical of inner halo Galactic GCs, represented here by a sample of giants in the nearby GC M30. Although our measurements show that NGC 2419 is unusual in some respects, its bulk properties do not provide compelling evidence for a difference between inner and outer halo GCs.
Gaia's view of the λ Boo star puzzle
Murphy, Simon J.; Paunzen, Ernst
2017-04-01
The evolutionary status of the chemically peculiar class of λ Boo stars has been intensely debated. It is now agreed that the λ Boo phenomenon affects A stars of all ages, from star formation to the terminal age main sequence, but the cause of the chemical peculiarity is still a puzzle. We revisit the debate of their ages and temperatures in order to shed light on the phenomenon, using the new parallaxes in Gaia Data Release 1 with existing Hipparcos parallaxes and multicolour photometry. We find that no single formation mechanism is able to explain all the observations, and suggest that there are multiple channels producing λ Boo spectra. The relative importance of these channels varies with age, temperature and environment.
Inter-Division IV/V WG on Active OB Stars
Owocki, S.; Aerts, C.; Fabregat, J.; Gies, D.; Henrichs, H.F.; McDavid, D.; Porter, J.; Rivinius, T.; Peters, G.; Stefl, S.
2007-01-01
Our group studies active early-type (OB) stars, with historical focus on classical Be stars, but extending in recent years to include Slowly Pulsating B-stars (SPB), Beta-Cephei stars, the strongly magnetic Bp stars, Luminous Blue Vairiable (LBV) stars, and B[e] stars. An overall goal is to
Peculiar A star HD 43819 - A photographic region line-identification study
International Nuclear Information System (INIS)
Adelman, S.J.; The Citadel, Charleston, SC)
1985-01-01
A line identification study of the sharp-lined silicon star HD 43819 has been performed for the photographic region 3759-4924 A. Comparison of this star's spectrum with those of other silicon stars shows that it shares many of their apparent abundance anomalies. The TiII, CrII, FeI, and FeII spectra are well represented while the singly ionized rare earths are represented by at best a few lines per species. 21 references
Ultraviolet energy distributions and the temperatures of peculiar B and A stars
International Nuclear Information System (INIS)
Adelman, S.J.; NASA, Goddard Space Flight Center, Greenbelt, MD)
1985-01-01
Color temperatures have been estimated by comparing ultraviolet observations of HgMn and magnetic Ap stars with those of normal stars. Ultraviolet data from the OAO-2, ANS, TD-1, and IUE satellites generally give similar results. The values for the normal stars were derived from comparison of fluxes predicted by solar-composition fully line-blanketed model atmospheres with optical region spectrophotometry. The ultraviolet temperatures of the HgMn stars cover a narrower temperature range than do their optical region values. Magnetic Ap stars with similar optical region temperatures can show substantial differences in their ultraviolet color temperatures. This may result from magnetic field configuration and abundance differences. 27 references
On the origin of hyperfast neutron stars
Gvaramadze, V.V.; Gualandris, A.; Portegies Zwart, S.
2007-01-01
We propose an explanation for the origin of hyperfast neutron stars (e.g. PSR B1508+55, PSR B2224+65, RX J0822-4300) based on the hypothesis that they could be the remnants of a symmetric supernova explosion of a high-velocity massive star (or its helium core) which attained its peculiar velocity
Optical region elemental abundance analyses of B and A stars
International Nuclear Information System (INIS)
Adelman, S.J.; Young, J.M.; Baldwin, H.E.
1984-01-01
Abundance analyses using optical region data and fully line blanketed model atmospheres have been performed for two sharp-lined hot Am stars o Pegasi and σ Aquarii and for the sharp-lined marginally peculiar A star v Cancri. The derived abundances exhibit definite anomalies compared with those of normal B-type stars and the Sun. (author)
Searching for dust around hyper metal poor stars
International Nuclear Information System (INIS)
Venn, Kim A.; Divell, Mike; Starkenburg, Else; Puzia, Thomas H.; Côté, Stephanie; Lambert, David L.
2014-01-01
We examine the mid-infrared fluxes and spectral energy distributions for stars with iron abundances [Fe/H] <–5, and other metal-poor stars, to eliminate the possibility that their low metallicities are related to the depletion of elements onto dust grains in the formation of a debris disk. Six out of seven stars examined here show no mid-IR excesses. These non-detections rule out many types of circumstellar disks, e.g., a warm debris disk (T ≤ 290 K), or debris disks with inner radii ≤1 AU, such as those associated with the chemically peculiar post-asymptotic giant branch spectroscopic binaries and RV Tau variables. However, we cannot rule out cooler debris disks, nor those with lower flux ratios to their host stars due to, e.g., a smaller disk mass, a larger inner disk radius, an absence of small grains, or even a multicomponent structure, as often found with the chemically peculiar Lambda Bootis stars. The only exception is HE0107-5240, for which a small mid-IR excess near 10 μm is detected at the 2σ level; if the excess is real and associated with this star, it may indicate the presence of (recent) dust-gas winnowing or a binary system.
Searching for dust around hyper metal poor stars
Energy Technology Data Exchange (ETDEWEB)
Venn, Kim A.; Divell, Mike; Starkenburg, Else [Department of Physics and Astronomy, University of Victoria, 3800 Finnerty Road, Victoria, BC, V8P 5C2 (Canada); Puzia, Thomas H. [Institute of Astrophysics, Pontificia Universidad Catolica de Chile, Av. Vicuna Mackenna 4860, 7820436 Macul, Santiago (Chile); Côté, Stephanie [NRC Herzberg Institute of Astrophysics, 5071 West Saanich Road, Victoria, BC, V9E 2E7 (Canada); Lambert, David L., E-mail: kvenn@uvic.ca [McDonald Observatory and the Department of Astronomy, University of Texas at Austin, RLM 15.308, Austin, TX 78712 (United States)
2014-08-20
We examine the mid-infrared fluxes and spectral energy distributions for stars with iron abundances [Fe/H] <–5, and other metal-poor stars, to eliminate the possibility that their low metallicities are related to the depletion of elements onto dust grains in the formation of a debris disk. Six out of seven stars examined here show no mid-IR excesses. These non-detections rule out many types of circumstellar disks, e.g., a warm debris disk (T ≤ 290 K), or debris disks with inner radii ≤1 AU, such as those associated with the chemically peculiar post-asymptotic giant branch spectroscopic binaries and RV Tau variables. However, we cannot rule out cooler debris disks, nor those with lower flux ratios to their host stars due to, e.g., a smaller disk mass, a larger inner disk radius, an absence of small grains, or even a multicomponent structure, as often found with the chemically peculiar Lambda Bootis stars. The only exception is HE0107-5240, for which a small mid-IR excess near 10 μm is detected at the 2σ level; if the excess is real and associated with this star, it may indicate the presence of (recent) dust-gas winnowing or a binary system.
What stars become peculiar type I supernovae?
International Nuclear Information System (INIS)
Uomoto, A.
1986-01-01
Hot hydrogen-deficient binaries such as Upsilon Sgr and KS Per are suggested as the stars most likely to become Type Ib supernovae. These systems satisfy the preexplosion constraints imposed by Type Ib observations by not having any hydrogen in their atmospheres (explaining their spectra), being truncated at the Roche lobe (explaining their light curves), and having large main-sequence masses (explaining their presence in extreme Population I locations). Although none of those known seems to be in danger of exploding, a system with a current primary mass of about solar masses may do so by core collapse. 36 references
On the Origin of Hyperfast Neutron Stars
Gvaramadze, V. V.; Gualandris, A.; Portegies Zwart, S.
2008-05-01
We propose an explanation for the origin of hyperfast neutron stars (e.g. PSR B1508+55, PSR B2224+65, RX J0822 4300) based on the hypothesis that they could be the remnants of a symmetric supernova explosion of a high-velocity massive star (or its helium core) which attained its peculiar velocity (similar to that of the neutron star) in the course of a strong three- or four-body dynamical encounter in the core of a young massive star cluster. This hypothesis implies that the dense cores of star clusters (located either in the Galactic disk or near the Galactic centre) could also produce the so-called hypervelocity stars ordinary stars moving with a speed of ~ 1 000 km s-1.
The Peculiar Chemical Inventory of NGC 2419: An Extreme Outer Halo "Globular Cluster"
Cohen, Judith G.; Huang, Wenjin; Kirby, Evan N.
2011-10-01
NGC 2419 is a massive outer halo Galactic globular cluster (GC) whose stars have previously been shown to have somewhat peculiar abundance patterns. We have observed seven luminous giants that are members of NGC 2419 with Keck/HIRES at reasonable signal-to-noise ratio. One of these giants is very peculiar, with an extremely low [Mg/Fe] and high [K/Fe] but normal abundances of most other elements. The abundance pattern does not match the nucleosynthetic yields of any supernova model. The other six stars show abundance ratios typical of inner halo Galactic GCs, represented here by a sample of giants in the nearby GC M30. Although our measurements show that NGC 2419 is unusual in some respects, its bulk properties do not provide compelling evidence for a difference between inner and outer halo GCs. Based in part on observations obtained at the W. M. Keck Observatory, which is operated jointly by the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration.
Studying coherent scattering in the CP stars atmospheres
Fišák, J.; Kubát, J.; Krtička, J.
2018-01-01
Chemically peculiar stars form a very interesting class of stars which frequently show variability. The variability is probably caused by the uneven surface distribution of chemical elements. Some elements are overabundant and some elements are underabundant compared to the solar chemical composition. In the case of chemically overabundant composition some of the rare photon-atom processes can be more important than in the atmospheres of stars with solar chemical composition. We study the importance of Rayleigh scattering by helium.
A Binary Nature of the Marginal CP Star Sigma Sculptoris
Janík, Jan; Krtička, Jiří; Mikulášek, Zdeněk; Zverko, Juraj; Pintado, Olga; Paunzen, Ernst; Prvák, Milan; Skalický, Jan; Zejda, Miloslav; Adam, Christian
2018-05-01
The A2 V star σ Scl was suspected of being a low-amplitude rotating variable of the Ap-type star by several authors. Aiming to decide whether the star is a variable chemically peculiar (CP) star, we searched for the photometric and spectroscopic variability, and determined chemical abundances of σ Scl. The possible variability was tested using several types of periodograms applied to the photometry from Long-Term Photometry of Variables project (LTPV) and Hipparcos. Sixty spectrograms of high signal-to-noise (S/N) were obtained and used for chemical analysis of the stellar atmosphere and for looking for spectral variability that is symptomatic for the CP stars. We did not find any signs of the light variability or prominent chemical peculiarity, that is specific for the CP stars. The only exception is the abundance of scandium, which is significantly lower than the solar one and yttrium and barium, which are strongly overabundant. As a by-product of the analysis, and with the addition of 29 further spectra, we found that σ Scl is a single-lined spectroscopic binary with orbital period of 46.877(8) d. We argue that σ Scl is not an Ap star, but rather a marginal Am star in SB1 system. The spectral energy distribution of the binary reveals infrared excess due to circumstellar material.
Spectroscopic survey of Kepler stars - II. FIES/NOT observations of A- and F-type stars
Niemczura, E.; Polińska, M.; Murphy, S. J.; Smalley, B.; Kołaczkowski, Z.; Jessen-Hansen, J.; Uytterhoeven, K.; Lykke, J. M.; Triviño Hage, A.; Michalska, G.
2017-09-01
We have analysed high-resolution spectra of 28 A and 22 F stars in the Kepler field, observed using the Fibre-Fed Échelle Spectrograph at the Nordic Optical Telescope. We provide spectral types, atmospheric parameters and chemical abundances for 50 stars. Balmer, Fe I and Fe II lines were used to derive effective temperatures, surface gravities and microturbulent velocities. We determined chemical abundances and projected rotational velocities using a spectrum synthesis technique. Effective temperatures calculated by spectral energy distribution fitting are in good agreement with those determined from the spectral line analysis. The stars analysed include chemically peculiar stars of the Am and λ Boo types, as well as stars with approximately solar chemical abundances. The wide distribution of projected rotational velocity, vsin I, is typical for A and F stars. The microturbulence velocities obtained are typical for stars in the observed temperature and surface gravity ranges. Moreover, we affirm the results of Niemczura et al. that Am stars do not have systematically higher microturbulent velocities than normal stars of the same temperature.
Conflicting evidence on the composition of Am stars
International Nuclear Information System (INIS)
't Veer, C. van
1976-01-01
The programme involves the study of Am stars of differing temperatures and luminosities as well as of the Am stars deviating from the positions of the classical ones in the photometric diagrams. For certain stars a significant disagreement between the so-called 'abundance indices' and the abundances determined at high dispersion is found. Often giants or spectroscopic binaries, or stars with a detectable rotation, are involved. However, there are no consistent relationships between these different peculiarities and the observed disagreements. Examples are given of stars studied. Are these 'abundance indices' really what they are supposed to be in all cases. In which cases are they not and why. (Auth.)
International Nuclear Information System (INIS)
Kafatos, M.; Michalitsianos, A.G.
1984-01-01
Among the several hundred million binary systems estimated to lie within 3000 light years of the solar system, a tiny fraction, no more than a few hundred, belong to a curious subclass whose radiation has a wavelength distribution so peculiar that it long defied explanation. Such systems radiate strongly in the visible region of the spectrum, but some of them do so even more strongly at both shorter and longer wavelengths: in the ultraviolet region and in the infrared and radio regions. This odd distribution of radiation is best explained by the pairing of a cool red giant star and an intensely hot small star that is virtually in contact with its larger companion. Such objects have become known as symbiotic stars. On photographic plate only the giant star can be discerned, but evidence for the existence of the hot companion has been supplied by satellite-born instruments capable of detecting ultraviolet radiation. The spectra of symbiotic stars indicate that the cool red giant is surrounded by a very hot ionized gas. Symbiotic stars also flared up in outbursts indicating the ejection of material in the form of a shell or a ring. Symbiotic stars may therefore represent a transitory phase in the evolution of certain types of binary systems in which there is substantial transfer of matter from the larger partner to the smaller
Peculiar variable star R Aquarii and its jet
Energy Technology Data Exchange (ETDEWEB)
Kafatos, M; Michalitsianos, A G [National Aeronautics and Space Administration, Greenbelt, MD (USA). Goddard Space Flight Center
1982-08-05
The formation of a jet from the central star in the symbiotic variable R Aquarii is discussed and it is suggested that it is the result of supercritical accretion of mass transferred from the cool 387-day period Mira to the hot companion in a highly elliptical orbit. Ancient Japanese astronomical records suggest a nova outburst in AD930 may be associated with R Aquarii which formed the outer extended nebulosity. It is considered that the jet may help explain the outbursts of this object as well as the excitation of the R Aquarii nebula.
The distribution of silicon on BP Boo
International Nuclear Information System (INIS)
Hatzes, A.P.
1990-01-01
A version of the Doppler imaging technique which incorporates the principles of maximum entropy reconstruction is used to derive the silicon distribution on the Ap star BP Boo (HR 5857). The method used made it possible to detect an error in the published photometric period and a new value of 1.29557 d was determined. The silicon distribution consists of two depleted spots of unequal area separated by about 180deg in longitude. These spots may coincide with the location of the magnetic poles of the star as in the case of γ 2 Ari. Near the larger of the depleted silicon spots is a spot of enhanced abundance. The unequal area of the depleted spots as well as the close proximity of the enhanced spot to one of the depleted regions suggests the presence of non-axisymmetric magnetic field lines. (author)
Using the Seismology of Non-magnetic Chemically Peculiar Stars as ...
Indian Academy of Sciences (India)
stars we can infer some constraints on those mixing processes. As pulsa- tions in the ... Finally, microscopic diffusion due to gravity and radiation pressure ... complications posed by the largely unknown strength and geometry of the magnetic.
Kochukhov, O.; Silvester, J.; Bailey, J. D.; Landstreet, J. D.; Wade, G. A.
2017-09-01
Context. The young, rapidly rotating Bp star HR 5624 (HD 133880) shows an unusually strong non-sinusoidal variability of its longitudinal magnetic field. This behaviour was previously interpreted as the signature of an exceptionally strong, quadrupole-dominated surface magnetic field geometry. Aims: We studied the magnetic field structure and chemical abundance distributions of HR 5624 with the aim to verify the unusual quadrupolar nature of its magnetic field and to investigate correlations between the field topology and chemical spots. Methods: We analysed high-resolution, time series Stokes parameter spectra of HR 5624 with the help of a magnetic Doppler imaging inversion code based on detailed polarised radiative transfer modelling of the line profiles. Results: We refined the stellar parameters, revised the rotational period, and obtained new longitudinal magnetic field measurements. Our magnetic Doppler inversions reveal that the field structure of HR 5624 is considerably simpler and the field strength is much lower than proposed by previous studies. We find a maximum local field strength of 12 kG and a mean field strength of 4 kG, which is about a factor of three weaker than predicted by quadrupolar field models. Our model implies that overall large-scale field topology of HR 5624 is better described as a distorted, asymmetric dipole rather than an axisymmetric quadrupole. The chemical abundance maps of Mg, Si, Ti, Cr, Fe, and Nd obtained in our study are characterised by large-scale, high-contrast abundance patterns. These structures correlate weakly with the magnetic field geometry and, in particular, show no distinct element concentrations in the horizontal field regions predicted by theoretical atomic diffusion calculations. Conclusions: We conclude that the surface magnetic field topology of HR 5624 is not as unusual as previously proposed. Considering these results together with other recent magnetic mapping analyses of early-type stars suggests that
International Nuclear Information System (INIS)
Gomez, A.; Lortet, M.-C.; Pitault, A.
1981-01-01
The re-examination of the spatial distribution of 158 Wolf-Rayet stars in the Galaxy may help to define different breeds of Wolf-Rayet stars and put constraints on possible evolutionary scenarios. (Auth.)
On the origin of the hypervelocity runaway star HD 271791
Gvaramadze, V. V.
2010-01-01
We discuss the origin of the early-B-type runaway star HD 271791 and show that its extremely high velocity (≃530 - 920km s-1) cannot be explained within the framework of the binary-supernova ejection scenario. Instead, we suggest that HD 271791 attained its peculiar velocity in the course of a strong dynamical encounter between two hard, massive binaries or through an exchange encounter between a hard, massive binary and a very massive star, formed through runaway mergers of ordinary massive stars in the dense core of a young massive star cluster.
On the origin of high-velocity runaway stars
Gvaramadze, Vasilii V.; Gualandris, Alessia; Portegies Zwart, Simon
2009-06-01
We explore the hypothesis that some high-velocity runaway stars attain their peculiar velocities in the course of exchange encounters between hard massive binaries and a very massive star (either an ordinary 50-100Msolar star or a more massive one, formed through runaway mergers of ordinary stars in the core of a young massive star cluster). In this process, one of the binary components becomes gravitationally bound to the very massive star, while the second one is ejected, sometimes with a high speed. We performed three-body scattering experiments and found that early B-type stars (the progenitors of the majority of neutron stars) can be ejected with velocities of >~200-400kms-1 (typical of pulsars), while 3-4Msolar stars can attain velocities of >~300-400kms-1 (typical of the bound population of halo late B-type stars). We also found that the ejected stars can occasionally attain velocities exceeding the Milky Ways's escape velocity.
Energy Technology Data Exchange (ETDEWEB)
Cheng, Kwang-Ping; Johnson, Dustin M.; Tarbell, Erik S.; Romo, Christopher A. [California State University, Fullerton CA (United States); Neff, James E. [College of Charleston, Charleston, SC (United States); Gray, Richard O. [Appalachian State University, Boone, NC (United States); Corbally, Christopher J. [Vatican Observatory, Tucson, AZ (United States)
2017-01-01
Since the peculiar nature of Lambda Boötis was first noticed in 1943, the Lambda Boo stars have been recognized as a group of peculiar A-type stars. They are Population I dwarfs that show deficiencies of iron-peak elements (up to 2 dex), but have near-solar C, N, O, and S abundances. In a previous paper, we used both observed and synthetic ultraviolet spectra to demonstrate that the C i 1657 Å/Al ii 1671 Å equivalent width ratio can help distinguish between Lambda Boo stars and other metal-weak stars hotter than 8000 K. In this paper, using observed and synthetic visible (4000–6800 Å) spectra, we demonstrate that the C i 5052.17 Å/Mg ii 4481 Å equivalent width ratio can be used as a quantitative diagnostic for cooler Lambda Boo stars.
The first stars: CEMP-no stars and signatures of spinstars
Maeder, André; Meynet, Georges; Chiappini, Cristina
2015-04-01
Aims: The CEMP-no stars are "carbon-enhanced-metal-poor" stars that in principle show no evidence of s- and r-elements from neutron captures. We try to understand the origin and nucleosynthetic site of their peculiar CNO, Ne-Na, and Mg-Al abundances. Methods: We compare the observed abundances to the nucleosynthetic predictions of AGB models and of models of rotating massive stars with internal mixing and mass loss. We also analyze the different behaviors of α- and CNO-elements, as well the abundances of elements involved in the Ne-Na and Mg-Al cycles. Results: We show that CEMP-no stars exhibit products of He-burning that have gone through partial mixing and processing by the CNO cycle, producing low 12C/13C and a broad variety of [C/N] and [O/N] ratios. From a 12C/13C vs. [C/N] diagram, we conclude that neither the yields of AGB stars (in binaries or not) nor the yields of classic supernovae can fully account for the observed CNO abundances in CEMP-no stars. Better agreement is obtained once the chemical contribution by stellar winds of fast-rotating massive stars is taken into account, where partial mixing takes place, leading to various amounts of CNO being ejected. The [(C+N+O)/H] ratios of CEMP-no stars vary linearly with [Fe/H] above [Fe/H] = -4.0 indicating primary behavior by (C+N+O). Below [Fe/H] = -4.0, [(C+N+O)/H] is almost constant as a function of [Fe/H], implying very high [(C+N+O)/Fe] ratios up to 4 dex. In view of the timescales, such abundance ratios reflect more individual nucleosynthetic properties, rather than an average chemical evolution. The high [(C+N+O)/Fe] ratios (as well as the high [(C+N+O)/α-elements]) imply that stellar winds from partially mixed stars were the main source of these excesses of heavy elements now observed in CEMP-no stars. The ranges covered by the variations of [Na/Fe], [Mg/Fe], and [Al/Fe] are much broader than for the α-elements (with an atomic mass number above 24) and are comparable to the wide ranges covered
On the origin of the hypervelocity runaway star HD271791
Gvaramadze, V. V.
2009-01-01
We discuss the origin of the runaway early B-type star HD271791 and show that its extremely high velocity (\\simeq 530-920 km/s) cannot be explained within the framework of the binary-supernova ejection scenario. Instead, we suggest that HD271791 attained its peculiar velocity in the course of a strong dynamical encounter between two hard massive binaries or via an exchange encounter between a hard massive binary and a very massive star, formed through runaway mergers of ordinary massive stars...
A Runaway Yellow Supergiant Star in the Small Magellanic Cloud
Neugent, Kathryn F.; Massey, Philip; Morrell, Nidia I.; Skiff, Brian; Georgy, Cyril
2018-05-01
We recently discovered a yellow supergiant (YSG) in the Small Magellanic Cloud (SMC) with a heliocentric radial velocity of ∼300 km s‑1, which is much larger than expected for a star at its location in the SMC. This is the first runaway YSG ever discovered and only the second evolved runaway star discovered in a galaxy other than the Milky Way. We classify the star as G5-8 I and use de-reddened broad-band colors with model atmospheres to determine an effective temperature of 4700 ± 250 K, consistent with what is expected from its spectral type. The star’s luminosity is then log L/L ⊙ ∼ 4.2 ± 0.1, consistent with it being a ∼30 Myr 9 M ⊙ star according to the Geneva evolution models. The star is currently located in the outer portion of the SMC’s body, but if the star’s transverse peculiar velocity is similar to its peculiar radial velocity, in 10 Myr the star would have moved 1.°6 across the disk of the SMC and could easily have been born in one of the SMC’s star-forming regions. Based on its large radial velocity, we suggest it originated in a binary system where the primary exploded as a supernovae, thus flinging the runaway star out into space. Such stars may provide an important mechanism for the dispersal of heavier elements in galaxies given the large percentage of massive stars that are runaways. In the future, we hope to look into additional evolved runaway stars that were discovered as part of our other past surveys. This paper includes data gathered with the 6.5 m Magellan Telescopes located at Las Campanas Observatory, Chile.
Torsional oscillations and observed rotational period variations in early-type stars
Czech Academy of Sciences Publication Activity Database
Krtička, J.; Mikulášek, Z.; Henry, G.W.; Kurfürst, P.; Karlický, Marian
2017-01-01
Roč. 464, č. 1 (2017), s. 933-939 ISSN 0035-8711 R&D Projects: GA ČR(CZ) GA16-01116S; GA ČR GAP209/12/0103 Institutional support: RVO:67985815 Keywords : MHD * chemically peculiar stars * early-type stars Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 4.961, year: 2016
DEFF Research Database (Denmark)
Hubrig, S.; González, J. F.; Ilyin, I.
2012-01-01
Context. The frequent presence of weak magnetic fields on the surface of spotted late-B stars with HgMn peculiarity in binary systems has been controversial during the two last decades. Recent studies of magnetic fields in these stars using the least-squares deconvolution (LSD) technique have...... failed to detect magnetic fields, indicating an upper limit on the longitudinal field between 8 and 15G. In these LSD studies, assumptions were made that all spectral lines are identical in shape and can be described by a scaled mean profile. Aims. We re-analyse the available spectropolarimetric material...
A peculiar Herbig-Haro object located far outside Lynds 1641
International Nuclear Information System (INIS)
Ogura, Katsuo
1991-01-01
A peculiar Herbig-Haro object, named HH 131, has been discovered by low-dispersion slit spectroscopy and narrowband CCD imaging. It lies well outside the dark cloud Lynds (L) 1641 toward the southwest. Accordingly, it has no associated molecular cloud, but it may be related to a cloud of atomic hydrogen. Its morphology is also unique, showing a fairly high degree of axisymmetric structure as well as a sort of double helix. No likely candidates for its energy source have been found in the IRAS Point Source Catalog, or by slit spectroscopy and an objective-prism Schmidt survey of nearby stars. 24 refs
Stars of type MS with evidence of white dwarf companions. [IUE, Main Sequence (MS)
Peery, Benjamin F., Jr.
1986-01-01
A search for white dwarf companions of MS-type stars was conducted, using IUE. The overendowments of these stars in typical S-process nuclides suggest that they, like the Ba II stars, may owe their peculiar compositions to earlier mass transfer. Short-wavelength IUE spectra show striking emission line variability in HD35155, HD61913, and 4 Ori; HD35155 and 4 Ori show evidence of white dwarf companions.
Adelman, S. J.; Pyper, D. M.
1985-01-01
Optical region spectrophotometry at 3300-7850 A has been obtained for three helium rich stars, HR 1890, Sigma Ori E, and HD 37776, of the Orion OB1 Association. New uvby-beta photometry of HR 1890 and HD 37776 as well as published data are also used to investigate the variability of these stars. A new period of 1.53862 days was determined for HD 37776. For all three stars H-beta varies in antiphase with strong He I lines. The spectrophotometric bandpass containing the strong He I line at 4471 A varies in phase with the R index of Pedersen and Thomsen (1977). Evidence is found for weak absorption features which appear to be an extension of the 5200 A feature seen in cooler CP stars.
Spectroscopic Peculiarity of the Herbig Be Star HD 259431
Pogodin, M. A.; Pavlovskij, S. E.; Drake, N. A.; Beskrovnaya, N. G.; Kozlova, O. V.; Alekseev, I. Yu.; Borges Fernandes, M.; Pereira, C. B.; Valyavin, G.
2017-06-01
High-resolution spectra of the Herbig Be star HD 259431 obtained in 2010-2016 at three observatories (Crimean AO, ESO in Chile, and OAN SPN in Mexico) are analysed. The object demonstrates a very rich emission line profile spectrum. The bulk of the lines exhibit double-peaked emission profiles and originate in the gaseous disk. The atmospheric lines are unusually shallow, and majority of them are distorted by the circumstellar (CS) contribution. Moreover, we have revealed that they are overlapped with an additional continuum emission. Using the observed ratio of the equivalent widths of two He I λ 4009 and 4026 lines, we estimated the spectral type of the object as B5 V. We also constructed the spectral energy distribution of the additional continuum using wide wings of the atmospheric Hβ-Hɛ lines free of the CS contribution. The continuum corresponds to the blue part of the black body spectrum. The Hβ - Hɛ Balmer emission lines show very variable profiles looking as either of P Cyg-type or a double-peaked emission line with a depression of the red wing. We found the period of this variability P = 2.630d and interpreted it as a sign of a rotating magnetosphere of the star with the magnetic axis inclined to the rotation axis. At different phases of rotation, the observer can see either an accretion flow at high magnetic latitudes or a wind zone at lower latitudes. We also estimated the inclination of the rotation axis i = 52°±1°.
International Nuclear Information System (INIS)
Arias, Julia I.; Barbá, Rodolfo H.; Sabín-Sanjulián, Carolina; Walborn, Nolan R.; Díaz, Sergio Simón; Apellániz, Jesús Maíz; Gamen, Roberto C.; Morrell, Nidia I.; Sota, Alfredo; Marco, Amparo; Negueruela, Ignacio
2016-01-01
On the basis of the Galactic O Star Spectroscopic Survey (GOSSS), we present a detailed systematic investigation of the O Vz stars. The currently used spectral classification criteria are rediscussed, and the Vz phenomenon is recalibrated through the addition of a quantitative criterion based on the equivalent widths of the He i λ 4471, He ii λ 4542, and He ii λ 4686 spectral lines. The GOSSS O Vz and O V populations resulting from the newly adopted spectral classification criteria are comparatively analyzed. The locations of the O Vz stars are probed, showing a concentration of the most extreme cases toward the youngest star-forming regions. The occurrence of the Vz spectral peculiarity in a solar-metallicity environment, as predicted by the fastwind code, is also investigated, confirming the importance of taking into account several processes for the correct interpretation of the phenomenon.
Energy Technology Data Exchange (ETDEWEB)
Arias, Julia I.; Barbá, Rodolfo H.; Sabín-Sanjulián, Carolina [Departamento de Física y Astronomía, Universidad de La Serena, Av. Cisternas 1200 Norte, La Serena (Chile); Walborn, Nolan R. [Space Telescope Science Institute, 3700 San Martin Drive, MD 21218, Baltimore (United States); Díaz, Sergio Simón [Instituto de Astrofísica de Canarias, E-38200, Departamento de Astrofísica, Universidad de La Laguna, E-38205, La Laguna, Tenerife (Spain); Apellániz, Jesús Maíz [Centro de Astrobiología, CSIC-INTA, campus ESAC, Camino Bajo del Castillo s/n, E-28 692 Madrid (Spain); Gamen, Roberto C. [Instituto de Astrofísica de La Plata (CONICET, UNLP), Facultad de Ciencias Astronómicas y Geofísicas, Universidad Nacional de La Plata, Paseo del Bosque s/n, 1900 La Plata (Argentina); Morrell, Nidia I. [Las Campanas Observatory, Carnegie Observatories, Casilla 601, La Serena (Chile); Sota, Alfredo [Instituto de Astrofísica de Andalucía-CSIC, Glorieta de la Astronomía s/n, E-18 008 Granada (Spain); Marco, Amparo; Negueruela, Ignacio, E-mail: jarias@userena.cl [Departamento de Física, Ingeniería de Sistemas y Teoría de la Señal, Escuela Politécnica Superior, Universidad de Alicante, Carretera San Vicente del Raspeig s/n, E03690, San Vicente del Raspeig (Spain); and others
2016-08-01
On the basis of the Galactic O Star Spectroscopic Survey (GOSSS), we present a detailed systematic investigation of the O Vz stars. The currently used spectral classification criteria are rediscussed, and the Vz phenomenon is recalibrated through the addition of a quantitative criterion based on the equivalent widths of the He i λ 4471, He ii λ 4542, and He ii λ 4686 spectral lines. The GOSSS O Vz and O V populations resulting from the newly adopted spectral classification criteria are comparatively analyzed. The locations of the O Vz stars are probed, showing a concentration of the most extreme cases toward the youngest star-forming regions. The occurrence of the Vz spectral peculiarity in a solar-metallicity environment, as predicted by the fastwind code, is also investigated, confirming the importance of taking into account several processes for the correct interpretation of the phenomenon.
A search for magnetic fields in Lambda Bootis stars
International Nuclear Information System (INIS)
Bohlender, D.A.; Landstreet, J.D.
1990-01-01
We have searched a sample of λ Boo stars for magnetic fields similar to those observed in the magnetic Ap and Bp stars, using a Balmer-line Zeeman analyser. Apart from one dubious measurement, no fields are detected in our sample. It appears that magnetic fields of the λ Boo stars, if they exist, are significantly smaller than those found in magnetic upper main-sequence stars of similar spectral type; this conclusion is supported at about the 90 or 95 per cent confidence level by the present data. (author)
Global and radial variations in the efficiency of massive star formation among galaxies
International Nuclear Information System (INIS)
Allen, L.E.; Young, J.S.
1990-01-01
In order to determine the regions within galaxies which give rise to the most efficient star formation and to test the hypothesis that galaxies with high infrared luminosities per unit molecular mass are efficiently producing high mass stars, researchers have undertaken an H alpha imaging survey in galaxies whose CO distributions have been measured as part of the Five College Radio Astronomy Observatory (FCRAO) Extragalactic CO Survey. From these images researchers have derived global H alpha fluxes and distributions for comparison with far infrared radiation (FIR) fluxes and CO fluxes and distributions. Here, researchers present results on the global massive star formation efficiency (SFE = L sub H sub alpha/M(H2)) as a function of morphological type and environment, and on the radial distribution of the SFE within both peculiar and isolated galaxies. On the basis of comparison of the global L sub H sub alpha/M(H2) and L sub FIR/M(H2) for 111 galaxies, researchers conclude that environment rather than morphological type has the strongest effect on the global efficiency of massive star formation. Based on their study of a small sample, they find that the largest radial gradients are observed in the interacting/peculiar galaxies, indicating that environment affects the star formation efficiency within galaxies as well
Pulsations of the R Coronae Borealis stars
International Nuclear Information System (INIS)
Cox, J.P.; King, D.S.; Cox, A.N.; Wheeler, J.C.; Hansen, C.J.; Hodson, S.W.
1980-01-01
The radial pulsations of very luminous, low-mass models (L/M approx. 10 4 , solar units), which are possible representatives of the R CrB stars, have been examined. These pulsations are extremely nonadiabatic. There are in some cases at least one extra (strange) mode which makes interpretation difficult. The blue instability edges are also peculiar, in that there is an abrupt excursion of the blue edge to the blue for L/M sufficiently large. The range of periods of the model encompasses observed periods of the Cepheid-like pulsations of actual R CrB stars
Cyanogen strengths of globular cluster post-main-sequence stars
International Nuclear Information System (INIS)
Hesser, J.E.; Hartwick, F.D.A.; McClure, R.D.
1976-01-01
CN strengths in the peculiar clusters ω Cen and M22 and the metal-rich clusters 47 Tuc, M71, and NGC 6352 are found to vary markedly from star to star. The strong variations in CN strength found earlier for ω Cen by Norris and Bessell and by Dickens and Bell are shown to extend to fainter stars, although expected correlations of CN strength with position in the color-magnitude (C-M) diagram are less evident in our sample. Several CN and metal-strong stars were also observed in M22. We conclude that CN, once it appears in globular clusters, can vary much more than it does in equivalent Population I samples, a result we briefly examine in light of current understanding regarding physical processes in the stars themselves and of models of galactic chemical evolution
Hearily reddened Hg-Mn star HD 29647
International Nuclear Information System (INIS)
Strajzhis, V.; Glagolevskij, Yu.V.; Romanyuk, I.I.; Bychkov, V.D.; AN SSSR, Nizhnij Arkhyz. Spetsial'naya Astrofizicheskaya Observatoriya)
1982-01-01
A heavily reddened HD 29647 (V=8sup(m).4) star is investigated using the 6-meter telescope spectrograms with dispersions 9 and 28 A/mm and photometric observations in the Vilnius seven- color system. Parameters Tsub(e)=15600 K (corresponding spectral type B5) and log g=3.70 from hydrogen lines and Balmer jump were obtained. HD 29647 is a peculiar star of the Hg-Mn type. The radial velocity of the star is+14.1+-1.0 km/s, almost identical with that of the dark Taurus cloud and its T Tauri-type variables. If the star is near the front edge of the dark cloud at the distance of 165 pc and has Esub(B-V)=1.06, its visual absolute magnitude is - 0sup(m).9. Photometric observations permit to suspect a slight varia bility in the U, P, and X colors [ru
International Nuclear Information System (INIS)
Hartigan, P.; Hartmann, L.; Kenyon, S.; Hewett, R.; Stauffer, J.
1989-01-01
A method for separating the 'veiling' continuum often present in T Tauri stars from the underlying photospheric spectrum is described. Echelle observations from 5100 to 6800 A of the partially veiled T Tauri star BP Tau were analyzed to determine the shape of the veiling spectrum. The residuals of the fit indicate the deviation of the veiling spectrum from a simple continuum and identify the location and strength of any emission-line components. It is shown, by means of goodness-of-fit tests, that the spectrum of BP Tau can be decomposed into a normal stellar spectrum plus a smooth veiling continuum with only a few emission lines superposed. The continuum dominates the veiling spectrum in this spectral region; the veiling does not arise from numerous deep photospheric absorption lines that are filled in by weak emission. 36 refs
Massive runaway stars in the Small Magellanic Cloud
Gvaramadze, V. V.; Pflamm-Altenburg, J.; Kroupa, P.
2011-01-01
Using archival Spitzer Space Telescope data, we identified for the first time a dozen runaway OB stars in the Small Magellanic Cloud (SMC) through the detection of their bow shocks. The geometry of detected bow shocks allows us to infer the direction of motion of the associated stars and to determine their possible parent clusters and associations. One of the identified runaway stars, AzV 471, was already known as a high-velocity star on the basis of its high peculiar radial velocity, which is offset by ≃ 40 km s-1 from the local systemic velocity. We discuss implications of our findings for the problem of the origin of field OB stars. Several of the bow shock-producing stars are found in the confines of associations, suggesting that these may be “alien” stars contributing to the age spread observed for some young stellar systems. We also report the discovery of a kidney-shaped nebula attached to the early WN-type star SMC-WR3 (AzV 60a). We interpreted this nebula as an interstellar structure created owing to the interaction between the stellar wind and the ambient interstellar medium.
Rayleigh scattering in the atmospheres of hot stars
Czech Academy of Sciences Publication Activity Database
Fišák, J.; Krtička, J.; Munzar, D.; Kubát, Jiří
2016-01-01
Roč. 590, June (2016), A95/1-A95/6 ISSN 0004-6361 R&D Projects: GA ČR(CZ) GA14-02385S Grant - others:GA MŠk(CZ) LM2010005 Institutional support: RVO:67985815 Keywords : atomic processes * scattering * stars: chemically peculiar Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.378, year: 2014
On the kinematics of visual binary and multiple stars of the FK4 cataloque
International Nuclear Information System (INIS)
Starikova, G.A.
1981-01-01
Kinematic features of single, binary and multiple stars are considered. To compare kinematics of such stars with the kinematics of single stars the data on positions and proper motions of those stars which are given in the basic catalogue FK4. Single as well as visual binary and multiple stars united because of their limited content in FK4 have been subdivided by spectra and classes of luminosity into groups with account for known kinematic peculiarities of various spectral groups. Kinematic features for the studied spectral groups are given. By the stars of the FK4 catalogue for various spectral classes the difference of kinematic features of single, visual binary and multiple stars is obtained. However the values of these differences need to be specified due to small number of stars included in five of six groups considered
International Nuclear Information System (INIS)
Kitamura, Yoshinori; Muroo, Yoji; Hamanaka, Isao
2003-01-01
A new type of burnable poison (BP) volume reduction system is currently being developed. Many BP rods, a subcomponent of spent fuel assemblies are discharged from nuclear power reactors. This new system reduces the overall volume of BP rods. The main system consists of BP rod cutting equipment, equipment for the recovery of BP cut pieces, and special transport equipment for the cut rods. The equipment is all operated by hydraulic press cylinders in water to reduce operator exposure to radioactivity. (author)
The unusual gamma-ray burst GRB 101225A explained as a minor body falling onto a neutron star.
Campana, S; Lodato, G; D'Avanzo, P; Panagia, N; Rossi, E M; Della Valle, M; Tagliaferri, G; Antonelli, L A; Covino, S; Ghirlanda, G; Ghisellini, G; Melandri, A; Pian, E; Salvaterra, R; Cusumano, G; D'Elia, V; Fugazza, D; Palazzi, E; Sbarufatti, B; Vergani, S D
2011-11-30
The tidal disruption of a solar-mass star around a supermassive black hole has been extensively studied analytically and numerically. In these events, the star develops into an elongated banana-shaped structure. After completing an eccentric orbit, the bound debris falls into the black hole, forming an accretion disk and emitting radiation. The same process may occur on planetary scales if a minor body passes too close to its star. In the Solar System, comets fall directly into our Sun or onto planets. If the star is a compact object, the minor body can become tidally disrupted. Indeed, one of the first mechanisms invoked to produce strong gamma-ray emission involved accretion of comets onto neutron stars in our Galaxy. Here we report that the peculiarities of the 'Christmas' gamma-ray burst (GRB 101225A) can be explained by a tidal disruption event of a minor body around an isolated Galactic neutron star. This would indicate either that minor bodies can be captured by compact stellar remnants more frequently than occurs in the Solar System or that minor-body formation is relatively easy around millisecond radio pulsars. A peculiar supernova associated with a gamma-ray burst provides an alternative explanation.
Atomic hydrogen in the Orion star-forming region
International Nuclear Information System (INIS)
Chromey, F.R.; Elmegreen, B.G.; Elmegreen, D.M.
1989-01-01
A large-scale survey of atomic hydrogen in Orion reveals low-density material with a total mass comparable to that in dense molecular clouds. The atomic gas is sufficiently dense that it can shield the molecular material from photodissociative radiation and provide a pressure link to the low-density intercloud medium. An excess of H I emission comes from photodissociation fronts near the bright stars and from a giant shell in the Orion Belt region. This shell may have caused the apparent bifurcation between the Orion A and B clouds, and the associated pressures may have induced peculiar motions and star formation in NGC 2023 and 2024. 49 refs
All-star sports medicine film panel
International Nuclear Information System (INIS)
Rogers, L.F.; Braunstein, E.M.; DeSmet, A.A.; Helms, C.A.; Pavlov, H.; Sukaer, J.R.; Torg, J.S.
1987-01-01
All Star Sports Panel cases are selected to test the mettle of the panelists and familiarize the audience with injuries peculiar to participation in a variety of sports. Match wits with the experts on the field. Gear up for the big game by previewing the clinical histories and initial radiographic examinations. Diagnosis requires familiarity with stresses incurred in the performance of various athletic pursuits, knowledge of specific radiographic findings, and awareness of imaging techniques that best demonstrate underlying injury
Asteroseismology of δ Scuti Stars: Problems and Prospects M.-J ...
Indian Academy of Sciences (India)
overshoot, time dependent convection, rotation interaction with oscillation and with convection. 2.2 Oscillations δ Scuti stars are pulsating with periods of a few hours. The mechanism which excites the observed modes is similar to that of a thermal machine or heat engine in that, energy is stored in some peculiar region of ...
Peculiar velocity measurement in a clumpy universe
Habibi, Farhang; Baghram, Shant; Tavasoli, Saeed
Aims: In this work, we address the issue of peculiar velocity measurement in a perturbed Friedmann universe using the deviations from measured luminosity distances of standard candles from background FRW universe. We want to show and quantify the statement that in intermediate redshifts (0.5 deviations from the background FRW model are not uniquely governed by peculiar velocities. Luminosity distances are modified by gravitational lensing. We also want to indicate the importance of relativistic calculations for peculiar velocity measurement at all redshifts. Methods: For this task, we discuss the relativistic correction on luminosity distance and redshift measurement and show the contribution of each of the corrections as lensing term, peculiar velocity of the source and Sachs-Wolfe effect. Then, we use the SNe Ia sample of Union 2, to investigate the relativistic effects, we consider. Results: We show that, using the conventional peculiar velocity method, that ignores the lensing effect, will result in an overestimate of the measured peculiar velocities at intermediate redshifts. Here, we quantify this effect. We show that at low redshifts the lensing effect is negligible compare to the effect of peculiar velocity. From the observational point of view, we show that the uncertainties on luminosity of the present SNe Ia data prevent us from precise measuring the peculiar velocities even at low redshifts (z < 0.2).
The Peculiar Radial Distribution of Multiple Populations in the Massive Globular Cluster M80
Dalessandro, E.; Cadelano, M.; Vesperini, E.; Salaris, M.; Ferraro, F. R.; Lanzoni, B.; Raso, S.; Hong, J.; Webb, J. J.; Zocchi, A.
2018-05-01
We present a detailed analysis of the radial distribution of light-element multiple populations (LE-MPs) in the massive and dense globular cluster M80, based on a combination of UV and optical Hubble Space Telescope data. Surprisingly, we find that first-generation (FG) stars (FG) are significantly more centrally concentrated than extreme second-generation (SG) stars out to ∼2.5r h from the cluster center. To understand the origin of such peculiar behavior, we used a set of N-body simulations following the long-term dynamical evolution of LE-MPs. We find that, given the advanced dynamical state of the cluster, the observed difference does not depend on the primordial relative distributions of FG and SG stars. On the contrary, a difference of ∼0.05–0.10 M ⊙ between the average masses of the two subpopulations is needed to account for the observed radial distributions. We argue that such a mass difference might be the result of the higher He abundance of SG stars (of the order of ΔY ∼ 0.05–0.06) with respect to FG stars. Interestingly, we find that a similar He variation is necessary to reproduce the horizontal branch morphology of M80. These results demonstrate that differences in mass among LE-MPs, due to different He content, should be properly taken into account for a correct interpretation of their radial distribution, at least in dynamically evolved systems.
Photographic infrared spectroscopy and near infrared photometry of Be stars
International Nuclear Information System (INIS)
Swings, J.P.
1976-01-01
Two topics are tackled in this presentation: spectroscopy and photometry. The following definitions are chosen: photographic infrared spectroscopy (wavelengths Hα<=lambda<1.2 μ); near infrared photometry (wavebands: 1.6 μ<=lambda<=20 μ). Near infrared spectroscopy and photometry of classical and peculiar Be stars are discussed and some future developments in the field are outlined. (Auth.)
Turcotte, S.
2005-01-01
Chemical composition is a good tracer of hydrodynamical processes that occur in stars as they often lead to mixing and particle transport. By comparing abundances predicted by models and those observed in stars we can infer some constraints on those mixing processes. As pulsations in stars are often very sensitive to chemical composition, we can use asteroseismology to probe the internal chemical composition of stars where no direct observations are possible. In this paper I focus on main seq...
International Nuclear Information System (INIS)
Chan, J.G.
2000-01-01
Full text: A monograph for Fluorodeoxyglucose F-18 Injection (FDG) was first released in Supplement 1 of the United States Pharmacopoeia 1990 (USP 90) on 1 November 1989 to become effective on 1 January 1990. As this was the only monograph available until recently it served as the applicable standard to be followed. The Therapeutic Goods Act states that the British Pharmacopoeia (BP) is the precedent to be followed in Australia and implies that if a monograph exists for a finished product then this needs to be applied to achieve a certain standard of quality. If the monograph does not exist in the BP then other pharmacopoeia monographs can be sourced starting with the European Pharmacopoeia (Ph Eur) then the USP. A monograph for FDG first appeared in the Ph Eur in a 1999 Supplement (effective 1 January 1999 and now included in the Ph Eur 2000) and then in the BP 1999 (effective 1 December 1999). The Commonwealth Government Gazette (Notice 48, 1/12/99) published that the BP 99 was adopted on the 1st December 1999. Since then manufacturers have been required to comply with the monograph for FDG in the BP 99. This presentation looks at the content of the BP 99 monograph and compares it with that in the USP. Copyright (2000) The Australian and New Zealand Society of Nuclear Medicine Inc
Lines profile variations and binarity in Wolf-Rayet stars
International Nuclear Information System (INIS)
Bisiacchi, G.F.; Firmani, C.; Lara, E. de
1982-01-01
Recently, HD50896, a WN5 star, for a long time considered as isolated, has been demonstrated to be a binary. This star shows very small displacement of the lines due to orbital motion and no evidence of the secondary spectrum. Is HD50896 a rare system in which the profile variations are peculiarly strong and easy to be detected, or are there many of these undetected binaries for which the analysis of the profile variation may be a powerful method to determine the periodicity. With this problem in mind the authors have observed a sample of 17 WR stars during a week to analyze both profile and radial velocity variations. This sample includes all the WR stars with Msub(v) 0 0 except for five stars that are binaries with determined period. All the spectra have been taken with a dispersion of 1.1 A channel -1 using a SIT television camera and a low dispersion spectrograph attached to the 2-meter telescope of the Observatorio Astronomico Nacional in San Pedro Martir, Baja California (Mexico). (Auth.)
Spectrographic study of λ 4200 silicon particular stars
International Nuclear Information System (INIS)
Didelon, Pierre
1983-01-01
This research thesis reports a spectrographic study of sample of particular stars belonging to the Si(II) λ 4200 subgroup which builds up the hot end of conventional 'Ap,Bp' stars. Twenty snapshots taken at the Haute-Provence observatory have been studied and compared with the observation of 17 standard stars. All these snapshots have been digitalised and processed. This allowed the identification of lines which indicated the presence of gallium and the absence of manganese which contradicts the close correlation between these elements that was generally admitted. An inexplicable and until now non observed duplication of Si(II) lines has also been observed. The problem of spectral classification of these stars has been studied. In order to study the concerned stars without calculation of atmospheric models, a comparative method between group stars and reference stars has been used. Results are discussed and seem to indicate an erratic and non-correlated behaviour of light elements (C, Mg, Ca, Si), and a presence of heavier elements (Ga, Sr) and rare earths (Eu, Gd) only when elements of the iron peak are stronger [fr
HR 8844: A New Transition Object between the Am Stars and the HgMn Stars?
Monier, R.; Gebran, M.; Royer, F.; Kilicoglu, T.; Frémat, Y.
2018-02-01
While monitoring a sample of apparently slowly rotating superficially normal early-A stars, we have discovered that HR 8844 (A0 V) is actually a new chemically peculiar star. We first compared the high-resolution spectrum of HR 8844 with that of four slow rotators near A0V (ν Cap, ν Cnc, Sirius A, and HD 72660) to highlight similarities and differences. The lines of Ti II, Cr II, Sr II, and Ba II are conspicuous features in the high-resolution high signal-to-noise SOPHIE spectra of HR 8844 and much stronger than in the spectra of the normal star ν Cap. The Hg II line at 3983.93 Å is also present in a 3.5% blend. Selected unblended lines of 31 chemical elements from He up to Hg have been synthesized using model atmospheres computed with ATLAS9 and the spectrum synthesis code SYNSPEC48 including hyperfine structure of various isotopes when relevant. These synthetic spectra have been adjusted to the mean SOPHIE spectrum of HR 8844, and high-resolution spectra of the comparison stars. Chi-squares were minimized to derive abundances or upper limits to the abundances of these elements for HR 8844 and the comparison stars. HR 8844 is found to have underabundances of He, C, O, Mg, Ca, and Sc, mild enhancements of Ti, V, Cr, Mn, and distinct enhancements of the heavy elements Sr, Y, Zr, Ba, La, Pr, Sm, Eu, and Hg, the overabundances increasing steadily with atomic number. This chemical pattern suggests that HR 8844 may actually be a new transition object between the coolest HgMn stars and the Am stars.
Araucaria Project: Pulsating stars in binary systems and as distance indicators
Directory of Open Access Journals (Sweden)
Pilecki Bogumił
2017-01-01
Type II Cepheids are recently becoming more important as distance indicators and astrophysics laboratory, although our knowledge of these stars is quite limited. Their evolutionary status is also not well understood and observational constraints are needed to confirm the current theories. We are presenting here our first results of the spectroscopic analysis of 4 of these systems. The masses of type II Cepheids seem consistent with the expected 0.5 − 0.6 M⊙. We also present first results of the fully modeled pulsator originally classified as peculiar W Vir star. The mass of this star is 1.51 ± 0.09 M⊙ and the p-factor 1.3 ± 0.03. It was eventually found not to belong to any typical Cepheid group.
Low resolution spectroscopic investigation of Am stars using Automated method
Sharma, Kaushal; Joshi, Santosh; Singh, Harinder P.
2018-04-01
The automated method of full spectrum fitting gives reliable estimates of stellar atmospheric parameters (Teff, log g and [Fe/H]) for late A, F, G, and early K type stars. Recently, the technique was further improved in the cooler regime and the validity range was extended up to a spectral type of M6 - M7 (Teff˜ 2900 K). The present study aims to explore the application of this method on the low-resolution spectra of Am stars, a class of chemically peculiar stars, to examine its robustness for these objects. We use ULySS with the Medium-resolution INT Library of Empirical Spectra (MILES) V2 spectral interpolator for parameter determination. The determined Teff and log g values are found to be in good agreement with those obtained from high-resolution spectroscopy.
Congenital Arthrogryposis: An Extension of the 15q11.2 BP1-BP2 Microdeletion Syndrome?
Directory of Open Access Journals (Sweden)
K. M. Usrey
2014-01-01
Full Text Available The proximal 15q11–q13 region contains 5 breakpoints (BP1–BP5. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes. The genes in this region are known to play a role in central nervous system development and/or function. Microdeletions within the 15q11.2 BP1-BP2 region have been reported in patients with neurological dysfunction, developmental delays, behavioral problems, and dysmorphic features. We report two unrelated subjects with the 15q11.2 BP1-BP2 microdeletion and presenting with congenital arthrogryposis, a feature which has not been previously reported as part of this newly recognized microdeletion syndrome. While arthrogryposis seen in these two subjects may be coincidental, we propose that congenital arthrogryposis may result from neurological dysfunction and involvement of the microdeletion of the 15q11.2 BP1-BP2 region, further expanding the phenotype of this microdeletion syndrome. We encourage others to report patients with this chromosome microdeletion and neurological findings to further characterize the clinical phenotype.
Very massive runaway stars from three-body encounters
Gvaramadze, Vasilii V.; Gualandris, Alessia
2011-01-01
Very massive stars preferentially reside in the cores of their parent clusters and form binary or multiple systems. We study the role of tight very massive binaries in the origin of the field population of very massive stars. We performed numerical simulations of dynamical encounters between single (massive) stars and a very massive binary with parameters similar to those of the most massive known Galactic binaries, WR 20a and NGC 3603-A1. We found that these three-body encounters could be responsible for the origin of high peculiar velocities (≥70 km s-1) observed for some very massive (≥60-70 M⊙) runaway stars in the Milky Way and the Large Magellanic Cloud (e.g. λ Cep, BD+43°3654, Sk -67°22, BI 237, 30 Dor 016), which can hardly be explained within the framework of the binary-supernova scenario. The production of high-velocity massive stars via three-body encounters is accompanied by the recoil of the binary in the opposite direction to the ejected star. We show that the relative position of the very massive binary R145 and the runaway early B-type star Sk-69°206 on the sky is consistent with the possibility that both objects were ejected from the central cluster, R136, of the star-forming region 30 Doradus via the same dynamical event - a three-body encounter.
NuSTAR DISCOVERY OF A 3.76 s TRANSIENT MAGNETAR NEAR SAGITTARIUS A*
DEFF Research Database (Denmark)
Mori, Kaya; Gotthelf, Eric V.; Zhang, Shuo
2013-01-01
We report the discovery of 3.76 s pulsations from a new burst source near Sgr A* observed by the NuSTAR observatory. The strong signal from SGR J1745-29 presents a complex pulse profile modulated with pulsed fraction 27% +/- 3% in the 3-10 keV band. Two observations spaced nine days apart yield a......-ray band or have been detected as high-B radio pulsars. The peculiar location of SGR J1745-29 has important implications for the formation and dynamics of neutron stars in the Galactic center region....
Discovery of new magnetic early-B stars within the MiMeS HARPSpol survey
Czech Academy of Sciences Publication Activity Database
Alecian, E.; Kochukhov, O.; Petit, V.; Grunhut, J.; Landstreet, J.; Oksala, Mary E.; Wade, G.A.; Hussain, G.; Neiner, C.; Bohlender, D.A.
2014-01-01
Roč. 567, July (2014), A28/1-A28/19 ISSN 0004-6361 R&D Projects: GA ČR(CZ) GAP209/11/1198 Institutional support: RVO:67985815 Keywords : star s * magnetic field * chemically peculiar Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.378, year: 2014
International Nuclear Information System (INIS)
Victor, David G.; House, Joshua C.
2006-01-01
Between 1998 and 2001, BP reduced its emissions of greenhouse gases by more than 10%. BP's success in cutting emissions is often equated with its use of an apparently market-based emissions trading program. However no independent study has ever examined the rules and operation of BP's system and the incentives acting on managers to reduce emissions. We use interviews with key managers and with traders in several critical business units to explore the bound of BP's success with emissions trading. No money actually changed hands when permits were traded, and the main effect of the program was to create awareness of money-saving emission controls rather than strong price incentives. We show that the trading system did not operate like a 'textbook' cap and trade scheme. Rather, the BP system operated much like a 'safety valve' trading system, where managers let the market function until the cost of doing so surpassed what the company was willing to tolerate
G 2.4 + 1.4: a supernova remnant or ring nebula around a peculiar star
International Nuclear Information System (INIS)
Johnson, H.M.
1975-01-01
G2.4+1.4 is a probable nonthermal radio source and an optical nebula which appears to be a supernova remnant (SNR). It also contains an O vi sequence star of great excitation. We present new radiofrequency continuum and (nil) H 92α observations, optical spectroscopy, and Fabry-Perot scanner observations of the nebula. The object distance (5 kpc), origin of gas kinematics (SNR expansion), and mode of excitation of the gas (photoexcitation and/or shock wave) remain uncertain. We discuss the possible roles of the O vi star as ''runaway'' in a SNR, as a source of photoexcitation, and as an ejector of a ''counterfeit'' SNR
THE PECULIAR DISTRIBUTION OF CH{sub 3}CN IN IRC +10216 SEEN BY ALMA
Energy Technology Data Exchange (ETDEWEB)
Agúndez, M.; Cernicharo, J.; Quintana-Lacaci, G.; Prieto, L. Velilla [Instituto de Ciencia de Materiales de Madrid, CSIC, C/Sor Juana Inés de la Cruz 3, E-28049 Cantoblanco (Spain); Castro-Carrizo, A.; Guélin, M. [Institut de Radioastronomie Millimétrique, 300 rue de la Piscine, F-38406 St. Martin d’Héres (France); Marcelino, N. [INAF, Istituto di Radioastronomia, via Gobetti 101, I-40129 Bologna (Italy)
2015-12-01
IRC +10216 is a circumstellar envelope around a carbon-rich evolved star which contains a large variety of molecules. According to interferometric observations, molecules are distributed either concentrated around the central star or as a hollow shell with a radius of ∼15″. We present ALMA Cycle 0 band 6 observations of the J = 14 – 13 rotational transition of CH{sub 3}CN in IRC +10216, obtained with an angular resolution of 0.″76 × 0.″61. The bulk of the emission is distributed as a hollow shell located at just ∼2″ from the star, with a void of emission in the central region up to a radius of ∼1″. This spatial distribution is markedly different from those found to date in this source for other molecules. Our analysis indicates that methyl cyanide is not formed in either the stellar photosphere or far in the outer envelope, but at radial distances as short as 1″–2″, reaching a maximum abundance of ∼0.02 molecules cm{sup −3} at 2″ from the star. Standard chemical models of IRC +10216 predict that the bulk of CH{sub 3}CN molecules should be present at a radius of ∼15″ where other species such as polyyne radicals and cyanopolyynes are observed, with an additional inner component within 1″ from the star. The non-uniform structure of the circumstellar envelope and grain surface processes are discussed as possible causes of the peculiar distribution of methyl cyanide in IRC +10216.
The Discovery of λ Bootis Stars: The Southern Survey I
Energy Technology Data Exchange (ETDEWEB)
Gray, R. O.; Riggs, Q. S.; Newsome, I. M. [Department of Physics and Astronomy, Appalachian State University, Boone, NC 26808 (United States); Koen, C. [Department of Statistics, University of the Western Cape, Private Bag X17, Bellville, 7535 Cape Town (South Africa); Murphy, S. J. [Sydney Institute for Astronomy (SIfA), School of Physics, University of Sydney, NSW 2006 (Australia); Corbally, C. J. [Vatican Observatory Research Group, Steward Observatory, Tucson, AZ, 85721-0065 (United States); Cheng, K.-P. [California State University, Fullerton, Fullerton, CA (United States); Neff, J. E. [National Science Foundation, Arlington, VA (United States)
2017-07-01
The λ Boo stars are a class of chemically peculiar Population I A-type stars characterized by under-abundances of the refractory elements, but near-solar abundances of carbon, nitrogen, oxygen, and sulfur. There is some evidence that λ Boo stars have higher frequencies of “bright” debris disks than normal A-type stars. The discovery of four exoplanets orbiting HR 8799, a λ Boo star with a resolved debris disk, suggests that the λ Boo phenomenon may be related to the presence of a dynamic debris disk, perhaps perturbed by migrating planets. However, only 64 λ Boo stars are known, and those stars were discovered with different techniques, making it problematic to use that sample for statistical purposes, including determining the frequency of debris disks. The purpose of this paper is to derive a new sample of λ Boo stars using a technique that does not lead to biases with respect to the presence of infrared excesses. Through spectroscopic observations in the southern hemisphere, we have discovered 33 λ Boo stars and have confirmed 12 others. As a step toward determining the proportion of λ Boo stars with infrared excesses, we have used WISE data to examine the infrared properties of this sample out to 22 μ m. On this basis, we cannot conclude that λ Boo stars have a greater tendency than normal A-type stars to show infrared excesses. However, observing this sample at longer wavelengths may change that conclusion, as many λ Boo debris disks are cool and do not radiate strongly at 22 μ m.
The Discovery of λ Bootis Stars: The Southern Survey I
International Nuclear Information System (INIS)
Gray, R. O.; Riggs, Q. S.; Newsome, I. M.; Koen, C.; Murphy, S. J.; Corbally, C. J.; Cheng, K.-P.; Neff, J. E.
2017-01-01
The λ Boo stars are a class of chemically peculiar Population I A-type stars characterized by under-abundances of the refractory elements, but near-solar abundances of carbon, nitrogen, oxygen, and sulfur. There is some evidence that λ Boo stars have higher frequencies of “bright” debris disks than normal A-type stars. The discovery of four exoplanets orbiting HR 8799, a λ Boo star with a resolved debris disk, suggests that the λ Boo phenomenon may be related to the presence of a dynamic debris disk, perhaps perturbed by migrating planets. However, only 64 λ Boo stars are known, and those stars were discovered with different techniques, making it problematic to use that sample for statistical purposes, including determining the frequency of debris disks. The purpose of this paper is to derive a new sample of λ Boo stars using a technique that does not lead to biases with respect to the presence of infrared excesses. Through spectroscopic observations in the southern hemisphere, we have discovered 33 λ Boo stars and have confirmed 12 others. As a step toward determining the proportion of λ Boo stars with infrared excesses, we have used WISE data to examine the infrared properties of this sample out to 22 μ m. On this basis, we cannot conclude that λ Boo stars have a greater tendency than normal A-type stars to show infrared excesses. However, observing this sample at longer wavelengths may change that conclusion, as many λ Boo debris disks are cool and do not radiate strongly at 22 μ m.
The Discovery of λ Bootis Stars: The Southern Survey I
Gray, R. O.; Riggs, Q. S.; Koen, C.; Murphy, S. J.; Newsome, I. M.; Corbally, C. J.; Cheng, K.-P.; Neff, J. E.
2017-07-01
The λ Boo stars are a class of chemically peculiar Population I A-type stars characterized by under-abundances of the refractory elements, but near-solar abundances of carbon, nitrogen, oxygen, and sulfur. There is some evidence that λ Boo stars have higher frequencies of “bright” debris disks than normal A-type stars. The discovery of four exoplanets orbiting HR 8799, a λ Boo star with a resolved debris disk, suggests that the λ Boo phenomenon may be related to the presence of a dynamic debris disk, perhaps perturbed by migrating planets. However, only 64 λ Boo stars are known, and those stars were discovered with different techniques, making it problematic to use that sample for statistical purposes, including determining the frequency of debris disks. The purpose of this paper is to derive a new sample of λ Boo stars using a technique that does not lead to biases with respect to the presence of infrared excesses. Through spectroscopic observations in the southern hemisphere, we have discovered 33 λ Boo stars and have confirmed 12 others. As a step toward determining the proportion of λ Boo stars with infrared excesses, we have used WISE data to examine the infrared properties of this sample out to 22 μm. On this basis, we cannot conclude that λ Boo stars have a greater tendency than normal A-type stars to show infrared excesses. However, observing this sample at longer wavelengths may change that conclusion, as many λ Boo debris disks are cool and do not radiate strongly at 22 μm.
Pires, A. M.; Motch, C.; Turolla, R.; Schwope, A.; Pilia, M.; Treves, A.; Popov, S. B.; Janot-Pacheco, E.
2012-08-01
While fewer in number than the dominant rotation-powered radio pulsar population, peculiar classes of isolated neutron stars (INSs) - which include magnetars, the ROSAT-discovered "Magnificent Seven" (M7), rotating radio transients (RRATs), and central compact objects in supernova remnants (CCOs) - represent a key element in understanding the neutron star phenomenology. We report the results of an observational campaign to study the properties of the source 2XMM J104608.7-594306, a newly discovered thermally emitting INS. The evolutionary state of the neutron star is investigated by means of deep dedicated observations obtained with the XMM-Newton Observatory, the ESO Very Large Telescope, as well as publicly available γ-ray data from the Fermi Space Telescope and the AGILE Mission. The observations confirm previous expectations and reveal a unique type of object. The source, which is likely within the Carina Nebula (NH = 2.6 × 1021 cm-2), has a spectrum that is both thermal and soft, with kT∞ = 135 eV. Non-thermal (magnetospheric) emission is not detected down to 1% (3σ, 0.1-12 keV) of the source luminosity. Significant deviations (absorption features) from a simple blackbody model are identified in the spectrum of the source around energies 0.6 keV and 1.35 keV. While the former deviation is likely related to a local oxygen overabundance in the Carina Nebula, the latter can only be accounted for by an additional spectral component, which is modelled as a Gaussian line in absorption with EW = 91 eV and σ = 0.14 keV (1σ). Furthermore, the optical counterpart is fainter than mV = 27 (2σ) and no γ-ray emission is significantly detected by either the Fermi or AGILE missions. Very interestingly, while these characteristics are remarkably similar to those of the M7 or the only RRAT so far detected in X-rays, which all have spin periods of a few seconds, we found intriguing evidence of very rapid rotation, P = 18.6 ms, at the 4σ confidence level. We interpret
Lifescience Database Archive (English)
Full Text Available YMU001_000113_B06 468 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B06. BP918406 - Show BP918406...is mRNA. clone: YMU001_000113_B06. Accession BP918406 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-vene...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-veneris m
Lifescience Database Archive (English)
Full Text Available YMU001_000108_E11 519 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E11. BP918011 - Show BP91801...is mRNA. clone: YMU001_000108_E11. Accession BP918011 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiant...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiantum cap
2018-01-01
Black phosphorus (bP) has been recently investigated for next generation nanoelectronic multifunctional devices. However, the intrinsic instability of exfoliated bP (the bP nanoflakes) toward both moisture and air has so far overshadowed its practical implementation. In order to contribute to fill this gap, we report here the preparation of new hybrid polymer-based materials where bP nanoflakes (bPn) exhibit a significantly improved stability. The new materials have been prepared by different synthetic paths including: (i) the mixing of conventionally liquid-phase exfoliated bP (in dimethyl sulfoxide, DMSO) with poly(methyl methacrylate) (PMMA) solution; (ii) the direct exfoliation of bP in a polymeric solution; (iii) the in situ radical polymerization after exfoliating bP in the liquid monomer (methyl methacrylate, MMA). This last methodology concerns the preparation of stable suspensions of bPn–MMA by sonication-assisted liquid-phase exfoliation (LPE) of bP in the presence of MMA followed by radical polymerization. The hybrids characteristics have been compared in order to evaluate the bP dispersion and the effectiveness of the bPn interfacial interactions with polymer chains aimed at their long-term environmental stabilization. The passivation of the bPn is particularly effective when the hybrid material is prepared by in situ polymerization. By using this synthetic methodology, the nanoflakes, even if with a gradient of dispersion (size of aggregates), preserve their chemical structure from oxidation (as proved by both Raman and 31P-solid state NMR studies) and are particularly stable to air and UV light exposure. The feasibility of this approach, capable of efficiently exfoliating bP while protecting the bPn, has been then verified by using different vinyl monomers (styrene and N-vinylpyrrolidone), thus obtaining hybrids where the nanoflakes are embedded in polymer matrices with a variety of intriguing thermal, mechanical, and solubility characteristics.
Lifescience Database Archive (English)
Full Text Available YMU001_000009_C12 487 Adiantum capillus-veneris mRNA. clone: YMU001_000009_C12. BP911801 - Show BP911801...is mRNA. clone: YMU001_000009_C12. Accession BP911801 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911801.... 25:3389-3402. Query= BP911801|Adiantum capillus-veneris mRNA, clone: YMU001_000
Kochukhov, O.; Ryabchikova, T. A.
2018-02-01
A series of recent theoretical atomic diffusion studies has address the challenging problem of predicting inhomogeneous vertical and horizontal chemical element distributions in the atmospheres of magnetic ApBp stars. Here we critically assess the most sophisticated of such diffusion models - based on a time-dependent treatment of the atomic diffusion in a magnetized stellar atmosphere - by direct comparison with observations as well by testing the widely used surface mapping tools with the spectral line profiles predicted by this theory. We show that the mean abundances of Fe and Cr are grossly underestimated by the time-dependent theoretical diffusion model, with discrepancies reaching a factor of 1000 for Cr. We also demonstrate that Doppler imaging inversion codes, based either on modelling of individual metal lines or line-averaged profiles simulated according to theoretical three-dimensional abundance distribution, are able to reconstruct correct horizontal chemical spot maps despite ignoring the vertical abundance variation. These numerical experiments justify a direct comparison of the empirical two-dimensional Doppler maps with theoretical diffusion calculations. This comparison is generally unfavourable for the current diffusion theory, as very few chemical elements are observed to form overabundance rings in the horizontal field regions as predicted by the theory and there are numerous examples of element accumulations in the vicinity of radial field zones, which cannot be explained by diffusion calculations.
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E11 274 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E11. BP920145 - Show BP92014...is mRNA. clone: YMU001_000133_E11. Accession BP920145 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E11.... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adian
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E05 486 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E05. BP920142 - Show BP92014...is mRNA. clone: YMU001_000133_E05. Accession BP920142 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris ...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris mRNA, clone: YMU001_0001
Lifescience Database Archive (English)
Full Text Available YMU001_000124_G04 562 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G04. BP919406 - Show BP919406...is mRNA. clone: YMU001_000124_G04. Accession BP919406 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-...ucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-veneris mRNA, c
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D05 407 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D05. BP921000 - Show BP921000...is mRNA. clone: YMU001_000144_D05. Accession BP921000 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum cap...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum capillus-veneris mRN
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C12 350 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C12. BP920995 - Show BP92099...is mRNA. clone: YMU001_000144_C12. Accession BP920995 Tissue type prothallium Developmental stage - Contig I...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F03 437 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F03. BP918015 - Show BP91801...is mRNA. clone: YMU001_000108_F03. Accession BP918015 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP918015|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F03. (437 letters) Data...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F06 436 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F06. BP918018 - Show BP91801...is mRNA. clone: YMU001_000108_F06. Accession BP918018 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP918018|Adiantum capillus-veneris mRNA, clone: YM...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801
Lifescience Database Archive (English)
Full Text Available YMU001_000023_A07 527 Adiantum capillus-veneris mRNA. clone: YMU001_000023_A07. BP912801 - Show BP912801...is mRNA. clone: YMU001_000023_A07. Accession BP912801 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912801...es. 25:3389-3402. Query= BP912801|Adiantum capillus-veneris mRNA, clone: YMU001_0
Strömgren uvby photometry of the peculiar globular cluster NGC 2419
Frank, Matthias J.; Koch, Andreas; Feltzing, Sofia; Kacharov, Nikolay; Wilkinson, Mark I.; Irwin, Mike
2015-09-01
NGC 2419 is a peculiar Galactic globular cluster offset from the others in the size-luminosity diagram, and showing several chemical abundance anomalies. Here, we present Strömgren uvby photometry of the cluster. Using the gravity- and metallicity-sensitive c1 and m1 indices, we identify a sample of likely cluster members extending well beyond the formal tidal radius. The estimated contamination by cluster non-members is only one per cent, making our catalogue ideally suited for spectroscopic follow-up. We derive photometric [Fe/H] of red giants, and depending on which metallicity calibration from the literature we use, we find reasonable to excellent agreement with spectroscopic [Fe/H], both for the cluster mean metallicity and for individual stars. We demonstrate explicitly that the photometric uncertainties are not Gaussian and this must be accounted for in any analysis of the metallicity distribution function. Using a realistic, non-Gaussian model for the photometric uncertainties, we find a formal internal [Fe/H] spread of σ=0.11+0.02-0.01 dex. This is an upper limit to the cluster's true [Fe/H] spread and may partially, and possibly entirely, reflect the limited precision of the photometric metallicity estimation and systematic effects. The lack of correlation between spectroscopic and photometric [Fe/H] of individual stars is further evidence against a [Fe/H] spread on the 0.1 dex level. Finally, the CN-sensitive δ4, among other colour indices, anti-correlates strongly with magnesium abundance, indicating that the second-generation stars are nitrogen enriched. The absence of similar correlations in some other CN-sensitive indices supports the second generation being enriched in He, which in these indices approximately compensates the shift due to CN. Compared to a single continuous distribution with finite dispersion, the observed δ4 distribution of red giants is slightly better fit by two distinct populations with no internal spread, with the nitrogen
A search for the age-dependency of Ap star parameters
International Nuclear Information System (INIS)
Ruediger, G.; Scholz, G.
1988-01-01
Some observational data of the sample of the magnetic chemically peculiar stars (MCP stars) are investigated statistically. For the MCP stars of spectral types later than A2 both the frequency distribution and the R · sin i-values suggest the existence of a linear relation between stellar diameter and rotation period. The MCP stars of spectral types earlier than B9 show an overpopulation of small R · sin i which may indicate the existence of a second group with smaller radius in this sample. The equatorially symmetric rotator is used as the magnetic model. With respect to its temporal behaviour the effective magnetic field is separated into dipolar and quadrupolar contribution. Both signs of the axisymmetric quadrupole moment appear with equal frequency. The dipole moment which produces the amplitude of the B eff (t) curve forms for longer periods two groups which are separated by a distinct gap. Both of the groups exhibit magnetic fields which are the stronger the greater the stellar radius is, contrary to what is expected for frozen-in fields. The dominance of magnetic curves without polarity reversal for longer-period stars is in accordance with predictions of the dynamo theory. (author)
Lifescience Database Archive (English)
Full Text Available YMU001_000039_E04 420 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E04. BP914068 - Show BP91406...is mRNA. clone: YMU001_000039_E04. Accession BP914068 Tissue type prothallium Developmental stage - Contig I...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914068|Adiantum capillus-veneris mRNA, clone:
Lifescience Database Archive (English)
Full Text Available YMU001_000071_B11 433 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B11. BP915406 - Show BP915406...is mRNA. clone: YMU001_000071_B11. Accession BP915406 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: Y...leic Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B11. (433
Lifescience Database Archive (English)
Full Text Available YMU001_000015_B05 315 Adiantum capillus-veneris mRNA. clone: YMU001_000015_B05. BP912099 - Show BP912099...is mRNA. clone: YMU001_000015_B05. Accession BP912099 Tissue type prothallium Developmental stage - Contig I...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099|Adiantum capillus-vene
Lifescience Database Archive (English)
Full Text Available YMU001_000117_F03 542 Adiantum capillus-veneris mRNA. clone: YMU001_000117_F03. BP918801 - Show BP918801...is mRNA. clone: YMU001_000117_F03. Accession BP918801 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum capillus-veneris mRNA, clone: YMU0...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum ca
Lifescience Database Archive (English)
Full Text Available YMU001_000105_F04 280 Adiantum capillus-veneris mRNA. clone: YMU001_000105_F04. BP917801 - Show BP917801...is mRNA. clone: YMU001_000105_F04. Accession BP917801 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-ve... Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-veneris mRNA, clone: YMU001_000105_F04.
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F05 267 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F05. BP918017 - Show BP91801...is mRNA. clone: YMU001_000108_F05. Accession BP918017 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris m...cleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F05. (26
Lifescience Database Archive (English)
Full Text Available YMU001_000077_B02 555 Adiantum capillus-veneris mRNA. clone: YMU001_000077_B02. BP915801 - Show BP915801...is mRNA. clone: YMU001_000077_B02. Accession BP915801 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP915801|Adiantum capillus-veneris mRNA, clone: YMU001_000077_B02. ...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915801|A
Lifescience Database Archive (English)
Full Text Available YMU001_000133_F01 365 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F01. BP920147 - Show BP92014...is mRNA. clone: YMU001_000133_F01. Accession BP920147 Tissue type prothallium Developmental stage - Contig I...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920147|Adiantum capillus-veneris mRNA, clone: YMU001_...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E09 265 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E09. BP920144 - Show BP92014...is mRNA. clone: YMU001_000133_E09. Accession BP920144 Tissue type prothallium Developmental stage - Contig I...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920144|Adiantum capillus-veneris mRNA, clone: YMU001...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E04 528 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E04. BP920141 - Show BP92014...is mRNA. clone: YMU001_000133_E04. Accession BP920141 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (528 lette...cleic Acids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (52
Lifescience Database Archive (English)
Full Text Available YMU001_000029_H06 570 Adiantum capillus-veneris mRNA. clone: YMU001_000029_H06. BP913406 - Show BP913406...is mRNA. clone: YMU001_000029_H06. Accession BP913406 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capillus-veneris mRNA, clone: YMU00...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capil...LDVTRGLVNGARGVVVAFES--GKHG---------------LPH 406 Query: 387 VRFACNRAEIVIGPDRQTVESGGMQVARRIQVPLILAWALSVHKCQGM
Lifescience Database Archive (English)
Full Text Available YMU001_000108_E12 547 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E12. BP918012 - Show BP91801...is mRNA. clone: YMU001_000108_E12. Accession BP918012 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108_E1
Infrared properties of Mira-type variables and other cool stars as determined from JHKL photometry
Energy Technology Data Exchange (ETDEWEB)
Feast, M W; Robertson, B S.C.; Catchpole, R M; Evans, T L; Glass, I S; Carter, B S [South African Astronomical Observatory, Cape
1982-11-01
Extensive infrared photometry of Me(Mira) variables and of C, S, SC and related stars is used to establish two-colour diagrams and period-colour relations. The characteristic areas in these plots occupied by the different classes of objects are delineated. The main aim is to provide a norm with which other stars (e.g. red variables in the Galactic Center and in the Magellanic Clouds and peculiar stars) can be compared. The (J-H) versus period relation offers a method for determining the interstellar reddenings of Me variables. The strong concentration to the longer periods of Miras which are OH masers is probably due primarily to the fact that in the sample surveyed, these stars also have the brightest apparent bolometric magnitudes. Period-amplitude plots are shown for Me variables. The Mira components in symbiotic stars are found to have exceptionally large amplitudes.
Unveiling the molecular bipolar outflow of the peculiar red supergiant VY Canis Majoris
Shinnaga, Hiroko; Claussen, Mark J.; Lim, Jeremy; Dinh-van-Trung; Tsuboi, Masato
2003-04-01
We carried out polarimetric spectral-line imaging of the molecular outflow of the peculiar red supergiant VY Canis Majoris in SiO J=1-0 line in the ground vibrational state, which contains highly linearly-polarized velocity components, using the Very Large Array. We succeeded in unveiling the highly linearly polarized bipolar outflow for the first time at subarcsecond spatial resolution. The results clearly show that the direction of linear polarization of the brightest maser components is parallel to the outflow axis. The results strongly suggest that the linear polarization of the SiO maser is closely related to the outflow phenomena of the star. Furthermore, the results indicate that the linear polarization observed in the optical and infrared also occur due to the outflow phenomena.
Lifescience Database Archive (English)
Full Text Available YMU001_000018_F09 348 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F09. BP912406... CL1894Contig1 Show BP912406 Clone id YMU001_000018_F09 Library YMU01 Length 348 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_F09. Accession BP912406 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406|Adiantum capillus-veneris mRNA...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406
Lifescience Database Archive (English)
Full Text Available YMU001_000100_D10 492 Adiantum capillus-veneris mRNA. clone: YMU001_000100_D10. BP917406... CL2033Contig1 Show BP917406 Clone id YMU001_000100_D10 Library YMU01 Length 492 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_D10. Accession BP917406 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917406...Nucleic Acids Res. 25:3389-3402. Query= BP917406|Adiantum capillus-veneris mRNA,
Lifescience Database Archive (English)
Full Text Available YMU001_000091_G06 127 Adiantum capillus-veneris mRNA. clone: YMU001_000091_G06. BP916801... CL2168Contig1 Show BP916801 Clone id YMU001_000091_G06 Library YMU01 Length 127 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000091_G06. Accession BP916801 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP916801|Adiantum capillus-veneris mRNA, clone: YMU0...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916801
Lifescience Database Archive (English)
Full Text Available YMU001_000035_D11 562 Adiantum capillus-veneris mRNA. clone: YMU001_000035_D11. BP913801... CL482Contig1 Show BP913801 Clone id YMU001_000035_D11 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000035_D11. Accession BP913801 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum capillus-veneris mRNA, clone: YMU0
Lifescience Database Archive (English)
Full Text Available YMU001_000141_G10 454 Adiantum capillus-veneris mRNA. clone: YMU001_000141_G10. BP920801... CL819Contig1 Show BP920801 Clone id YMU001_000141_G10 Library YMU01 Length 454 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000141_G10. Accession BP920801 Tissue type prothallium Developmental stage... Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-veneris mRNA, clone: ...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-
Rotation and magnetism in intermediate-mass stars
Quentin, Léo G.; Tout, Christopher A.
2018-06-01
Rotation and magnetism are increasingly recognized as important phenomena in stellar evolution. Surface magnetic fields from a few to 20 000 G have been observed and models have suggested that magnetohydrodynamic transport of angular momentum and chemical composition could explain the peculiar composition of some stars. Stellar remnants such as white dwarfs have been observed with fields from a few to more than 109 G. We investigate the origin of and the evolution, on thermal and nuclear rather than dynamical time-scales, of an averaged large-scale magnetic field throughout a star's life and its coupling to stellar rotation. Large-scale magnetic fields sustained until late stages of stellar evolution with conservation of magnetic flux could explain the very high fields observed in white dwarfs. We include these effects in the Cambridge stellar evolution code using three time-dependant advection-diffusion equations coupled to the structural and composition equations of stars to model the evolution of angular momentum and the two components of the magnetic field. We present the evolution in various cases for a 3 M_{⊙} star from the beginning to the late stages of its life. Our particular model assumes that turbulent motions, including convection, favour small-scale field at the expense of large-scale field. As a result, the large-scale field concentrates in radiative zones of the star and so is exchanged between the core and the envelope of the star as it evolves. The field is sustained until the end of the asymptotic giant branch, when it concentrates in the degenerate core.
Infrared spectroscopy of four carbon stars with 9.8 micron emission from silicate grains
International Nuclear Information System (INIS)
Lambert, D.L.; Smith, V.V.; Hinkle, K.H.
1990-01-01
High-resolution K band and low resolution 4 micron spectra were obtained for four carbon stars showing IR emission by silicate grains. The results of the analysis of the K band spectra show that they are J-type stars. These results, together with published spectral classifications, show that all known carbon stars with a silicate emission feature are J-type stars. The 4 micron spectra are very similar to the spectra of classical J-type carbon stars, and do not show SiO bands that might come from a M giant companion. A binary model with a luminous M giant companion as a source of the silicate grain is rejected. It is proposed that the silicate grains formed from gas ejecta at or before the He-core flash, and that the flash initiates severe mixing, leading to the star's conversion to a J-type carbon star. The ejecta are stored in an accretion disk around a low mass unevolved companion. If it can be shown that the hypothesized accretion disk is stable and may be heated adequately, this binary model appears to account for these peculiar carbon stars. 41 refs
Oster, Murielle; Hébraud, Anne; Gallet, Sébastien; Lapp, Alain; Pollet, Eric; Avérous, Luc; Schlatter, Guy
2015-02-01
Herein, it is demonstrated that star pseudopolyrotaxanes (star-pPRs) obtained from the inclusion complexation of α-cyclodextrin (CD) and four-branched star poly(ε-caprolactone) (star-PCL) organize into nanoplatelets in dimethyl sulfoxide at 35 °C. This peculiar property, not observed for linear pseudopolyrotaxanes, allows the processing of star-pPRs while preserving their supramolecular assembly. Thus, original PCL:star-pPR core:shell nanofibers are elaborated by coaxial electrospinning. The star-pPR shell ensures the presence of available CD hydroxyl functions on the fiber surface allowing its postfunctionalization. As proof of concept, fluorescein isothiocyanate is grafted. Moreover, the morphology of the fibers is maintained due to the star-pPR shell that acts as a shield, preventing the fiber dissolution during chemical modification. The proposed strategy is simple and avoids the synthesis of polyrotaxanes, i.e., pPR end-capping to prevent the CD dethreading. As PCL is widely used for biomedical applications, this strategy paves the way for simple functionalization with any bioactive molecules. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E03 489 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E03. BP92014...0 CL2574Contig1 Show BP920140 Clone id YMU001_000133_E03 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E03. Accession BP920140 Tissue type prothallium Developmental stag... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920140|Adian... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E07 533 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E07. BP92014...3 CL2377Contig1 Show BP920143 Clone id YMU001_000133_E07 Library YMU01 Length 533 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E07. Accession BP920143 Tissue type prothallium Developmental stag...ms, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E0...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E12 401 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E12. BP92014...6 CL388Contig1 Show BP920146 Clone id YMU001_000133_E12 Library YMU01 Length 401 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_E12. Accession BP920146 Tissue type prothallium Developmental stage...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum ca...rams, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum capillus-veneris mRNA, clone: YMU001_000133_
Lifescience Database Archive (English)
Full Text Available YMU001_000133_F02 429 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F02. BP92014...8 CL3819Contig1 Show BP920148 Clone id YMU001_000133_F02 Library YMU01 Length 429 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F02. Accession BP920148 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920148|Adiantum capillus-vener...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014
Lifescience Database Archive (English)
Full Text Available YMU001_000133_F03 624 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F03. BP92014...9 CL2860Contig1 Show BP920149 Clone id YMU001_000133_F03 Library YMU01 Length 624 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F03. Accession BP920149 Tissue type prothallium Developmental stag...ic Acids Res. 25:3389-3402. Query= BP920149|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F03. (624 l...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014
Lifescience Database Archive (English)
Full Text Available YMU001_000039_E01 548 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E01. BP91406...5 CL604Contig1 Show BP914065 Clone id YMU001_000039_E01 Library YMU01 Length 548 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_E01. Accession BP914065 Tissue type prothallium Developmental stage...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU0...cids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU001_000039_E01. (548 lette
Lifescience Database Archive (English)
Full Text Available YMU001_000039_D09 599 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D09. BP91406...1 CL1730Contig1 Show BP914061 Clone id YMU001_000039_D09 Library YMU01 Length 599 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D09. Accession BP914061 Tissue type prothallium Developmental stag... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adia...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adiantum capillus-veneris mRNA, c
Lifescience Database Archive (English)
Full Text Available YMU001_000039_E05 368 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E05. BP91406...9 CL2761Contig1 Show BP914069 Clone id YMU001_000039_E05 Library YMU01 Length 368 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_E05. Accession BP914069 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001_0000...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001
Lifescience Database Archive (English)
Full Text Available YMU001_000039_D12 560 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D12. BP91406...4 CL532Contig1 Show BP914064 Clone id YMU001_000039_D12 Library YMU01 Length 560 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_D12. Accession BP914064 Tissue type prothallium Developmental stage...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adiantum capillus-vener...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adi
Lifescience Database Archive (English)
Full Text Available YMU001_000087_D01 556 Adiantum capillus-veneris mRNA. clone: YMU001_000087_D01. BP916406... CL1913Contig1 Show BP916406 Clone id YMU001_000087_D01 Library YMU01 Length 556 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000087_D01. Accession BP916406 Tissue type prothallium Developmental stag...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capill...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capillus-veneris mRNA, c
Lifescience Database Archive (English)
Full Text Available YMU001_000058_E09 562 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E09. BP914406... CL513Contig1 Show BP914406 Clone id YMU001_000058_E09 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000058_E09. Accession BP914406 Tissue type prothallium Developmental stage...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406|Adiantum capillus...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406
Lifescience Database Archive (English)
Full Text Available YMU001_000039_D08 539 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D08. BP91406...0 CL1835Contig1 Show BP914060 Clone id YMU001_000039_D08 Library YMU01 Length 539 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D08. Accession BP914060 Tissue type prothallium Developmental stag...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris ...Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris mRNA, clone: YMU001_000039_D08. (539 lett
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D03 529 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D03. BP92099...8 CL1935Contig1 Show BP920998 Clone id YMU001_000144_D03 Library YMU01 Length 529 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_D03. Accession BP920998 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-veneris mRNA, clon... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-ven
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D04 588 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D04. BP92099...9 CL317Contig1 Show BP920999 Clone id YMU001_000144_D04 Library YMU01 Length 588 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D04. Accession BP920999 Tissue type prothallium Developmental stage...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D01 496 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D01. BP92099...6 CL262Contig1 Show BP920996 Clone id YMU001_000144_D01 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D01. Accession BP920996 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920996|Adiantum capillus-ve
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C06 517 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C06. BP92099...3 CL547Contig1 Show BP920993 Clone id YMU001_000144_C06 Library YMU01 Length 517 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_C06. Accession BP920993 Tissue type prothallium Developmental stage...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum capillus-veneris mRNA, clone: YMU001_0001...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C05 525 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C05. BP92099...2 CL2523Contig1 Show BP920992 Clone id YMU001_000144_C05 Library YMU01 Length 525 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C05. Accession BP920992 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C05. (525 lett...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_00014
Lifescience Database Archive (English)
Full Text Available YMU001_000129_C11 513 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C11. BP919801... CL1Contig3 Show BP919801 Clone id YMU001_000129_C11 Library YMU01 Length 513 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000129_C11. Accession BP919801 Tissue type prothallium Developmental stage -...es. 25:3389-3402. Query= BP919801|Adiantum capillus-veneris mRNA, clone: YMU001_000129_C11. (435 letters) Da...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919801|Adiantum capil
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F01 490 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F01. BP918013 - Show BP91801...is mRNA. clone: YMU001_000108_F01. Accession BP918013 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...idylinositol-4-phosphate 5-kinase 1 OS=Oryza sativa subsp. japonica GN=PIPK1 PE=2 SV=2 Length = 801 Score = ..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801
Lifescience Database Archive (English)
Full Text Available YMU001_000063_A07 396 Adiantum capillus-veneris mRNA. clone: YMU001_000063_A07. BP914801... CL1121Contig1 Show BP914801 Clone id YMU001_000063_A07 Library YMU01 Length 396 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000063_A07. Accession BP914801 Tissue type prothallium Developmental stag...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801|Adiantum capillus-veneris mRNA, clone:
Diffuse remnants of supernova explosions of moving massive stars
Gvaramadze, V. V.
The modification of the ambient interstellar medium by the wind of massive stars (the progenitors of most of supernovae) results in that the structure and evolution of diffuse supernova remnants (SNRs) significantly deviate from those derived from standard models of SNRs based of the Sedov-Taylor solution. The stellar proper motion and the regular interstellar magnetic field affect the symmetry of the processed medium and cause the SNR to be non-spherically-symmetric. We show that taking into account these effects allows us to explain the diverse morphologies of the known SNRs (the particular attention is paid to the elongated axisymmetric SNRs and the SNRs consisting of two partially overlapping shells) and to infer the ``true" supernova explosion sites in some peculiar SNRs (therefore to search for new neutron stars associated with them).
The incidence of stellar mergers and mass gainers among massive stars
International Nuclear Information System (INIS)
De Mink, S. E.; Sana, H.; Langer, N.; Izzard, R. G.; Schneider, F. R. N.
2014-01-01
Because the majority of massive stars are born as members of close binary systems, populations of massive main-sequence stars contain stellar mergers and products of binary mass transfer. We simulate populations of massive stars accounting for all major binary evolution effects based on the most recent binary parameter statistics and extensively evaluate the effect of model uncertainties. Assuming constant star formation, we find that 8 −4 +9 % of a sample of early-type stars are the products of a merger resulting from a close binary system. In total we find that 30 −15 +10 % of massive main-sequence stars are the products of binary interaction. We show that the commonly adopted approach to minimize the effects of binaries on an observed sample by excluding systems detected as binaries through radial velocity campaigns can be counterproductive. Systems with significant radial velocity variations are mostly pre-interaction systems. Excluding them substantially enhances the relative incidence of mergers and binary products in the non-radial velocity variable sample. This poses a challenge for testing single stellar evolutionary models. It also raises the question of whether certain peculiar classes of stars, such as magnetic O stars, are the result of binary interaction and it emphasizes the need to further study the effect of binarity on the diagnostics that are used to derive the fundamental properties (star-formation history, initial mass function, mass-to-light ratio) of stellar populations nearby and at high redshift.
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C10 322 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C10. BP92099...4 CL2871Contig1 Show BP920994 Clone id YMU001_000144_C10 Library YMU01 Length 322 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C10. Accession BP920994 Tissue type prothallium Developmental stag...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C03 445 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C03. BP92099...0 CL4123Contig1 Show BP920990 Clone id YMU001_000144_C03 Library YMU01 Length 445 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C03. Accession BP920990 Tissue type prothallium Developmental stag...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9209...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C04 521 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C04. BP92099...1 CL3173Contig1 Show BP920991 Clone id YMU001_000144_C04 Library YMU01 Length 521 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C04. Accession BP920991 Tissue type prothallium Developmental stag...s. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (521 letters) Dat...ucleic Acids Res. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (5
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F04 434 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F04. BP91801...6 CL3779Contig1 Show BP918016 Clone id YMU001_000108_F04 Library YMU01 Length 434 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000108_F04. Accession BP918016 Tissue type prothallium Developmental stag..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...ic Acids Res. 25:3389-3402. Query= BP918016|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F04. (434 l
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F08 47 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F08. BP918019 - Show BP91801... mRNA. clone: YMU001_000108_F08. Accession BP918019 Tissue type prothallium Developmental stage - Contig ID
International Nuclear Information System (INIS)
Mackey, A. D.; Da Costa, G. S.; Yong, D.; Ferguson, A. M. N.
2013-01-01
In this paper we present high-resolution VLT/FLAMES observations of red giant stars in the massive intermediate-age Large Magellanic Cloud star cluster NGC 1846, which, on the basis of its extended main-sequence turnoff (EMSTO), possesses an internal age spread of ≈300 Myr. We describe in detail our target selection and data reduction procedures, and construct a sample of 21 stars possessing radial velocities indicating their membership of NGC 1846 at high confidence. We consider high-resolution spectra of the planetary nebula Mo-17, and conclude that this object is also a member of the cluster. Our measured radial velocities allow us to conduct a detailed investigation of the internal kinematics of NGC 1846, the first time this has been done for an EMSTO system. The key result of this work is that the cluster exhibits a significant degree of systemic rotation, of a magnitude comparable to the mean velocity dispersion. Using an extensive suite of Monte Carlo models we demonstrate that, despite our relatively small sample size and the substantial fraction of unresolved binary stars in the cluster, the rotation signal we detect is very likely to be genuine. Our observations are in qualitative agreement with the predictions of simulations modeling the formation of multiple populations of stars in globular clusters, where a dynamically cold, rapidly rotating second generation is a common feature. NGC 1846 is less than one relaxation time old, so any dynamical signatures encoded during its formation ought to remain present.
Directory of Open Access Journals (Sweden)
Yang Du
2017-11-01
Full Text Available Ultraviolet (UV-absorbing chemicals (UV filters are used in personal care products for the protection of human skin and hair from damage by UV radiation. Although these substances are released into the environment in the production and consumption processes, little is known about their ecotoxicology effects. The acute toxicity and potential ecological risk of UV filters benzophenone-3 (BP-3 and benzophenone-4 (BP-4 on Chlorella vulgaris, Daphnia magna, and Brachydanio rerio were analyzed in the present study. The EC50 values (96 h of BP-3 and BP-4 on C. vulgaris were 2.98 and 201.00 mg/L, respectively. The 48 h-LC50 of BP-3 and BP-4 on D. magna were 1.09 and 47.47 mg/L, respectively. The 96 h-LC50 of BP-3 and BP-4 on B. rerio were 3.89 and 633.00 mg/L, respectively. The toxicity of a mixture of BP-3 and BP-4 on C. vulgaris, D. magna, and B. rerio all showed antagonistic effects. The induced predicted no-effect concentrations of BP-3 and BP-4 by the assessment factor method were 1.80 × 10−3 and 0.47 mg/L, respectively, by assessment factor (AF method, which were both lower than the concentrations detected in the environment at present, verifying that BP-3 and BP-4 remain low-risk chemicals to the aquatic ecosystem.
Directory of Open Access Journals (Sweden)
D. Wong
2013-01-01
Full Text Available The proximal q arm of chromosome 15 contains breakpoint regions BP1–BP5 with the classic deletion of BP1–BP3 best known to be associated with Prader-Willi and Angelman syndromes. The region is approximately 500 kb and microdeletions within the BP1-BP2 region have been reported in patients with developmental delay, behavioral abnormalities, and motor apraxia as well as dysmorphic features including hypertelorism, cleft or narrow palate, ear abnormalities, and recurrent upper airway infections. We report two patients with unique, never-before-reported 15q11.2 BP1-2 microdeletion syndrome findings, one with proximal esophageal atresia and distal tracheoesophageal fistula (type C and one with congenital cataracts. Cataracts have been described in Prader-Willi syndrome but we could not find any description of cataracts in Angelman syndrome. Esophageal atresia and tracheoesophageal fistula have not been reported to our knowledge in either syndrome. A chance exists that both cases are sporadic birth defects; however, the findings of the concomitant microdeletion cannot be overlooked as a possible cause. Based on our review of the literature and the presentation of our patients, we recommend that esophageal atresia and distal tracheoesophageal fistula as well as congenital cataracts be included in the phenotypic spectrum of 15q11.2 BP1-2 microdeletion syndrome.
Stellar parameters of Be stars observed with X-shooter
Shokry, A.; Rivinius, Th.; Mehner, A.; Martayan, C.; Hummel, W.; Townsend, R. H. D.; Mérand, A.; Mota, B.; Faes, D. M.; Hamdy, M. A.; Beheary, M. M.; Gadallah, K. A. K.; Abo-Elazm, M. S.
2018-01-01
Aims: The X-shooter archive of several thousand telluric standard star spectra was skimmed for Be and Be shell stars to derive the stellar fundamental parameters and statistical properties, in particular for the less investigated late-type Be stars and the extension of the Be phenomenon into early A stars. Methods: An adapted version of the BCD method is used, using the Balmer discontinuity parameters to determine effective temperature and surface gravity. This method is optimally suited for late B stars. The projected rotational velocity was obtained by profile fitting to the Mg ii lines of the targets, and the spectra were inspected visually for the presence of peculiar features such as the infrared Ca ii triplet or the presence of a double Balmer discontinuity. The Balmer line equivalent widths were measured, but they are only useful for determining the pure emission contribution in a subsample of Be stars owing to uncertainties in determining the photospheric contribution. Results: A total of 78, mostly late-type, Be stars, were identified in the X-shooter telluric standard star archive, out of which 48 had not been reported before. We confirm the general trend that late-type Be stars have more tenuous disks and are less variable than early-type Be stars. The relatively large number (48) of relatively bright (V> 8.5) additional Be stars casts some doubt on the statistics of late-type Be stars; they are more common than currently thought. The Be/B star fraction may not strongly depend on spectral subtype. Based on observations made with ESO Telescopes at the La Silla Paranal Observatory under program IDs 60.A-9022, 60.A-9024, 077.D-0085, 085.A-0962, 185.D-0056, 091.B-0900, and 093.D-0415.Table 6 is only available at the CDS via anonymous ftp to cdsarc.u-strasbg.fr (130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/609/A108
Lifescience Database Archive (English)
Full Text Available YMU001_000020_H07 512 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H07. BP912612 - Show BP912612... Clone id YMU001_000020_H07 Library YMU01 Length 512 Definition Adiantum capillus-vener...is mRNA. clone: YMU001_000020_H07. Accession BP912612 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912612|Adiantum cap...illus-veneris mRNA, clone: YMU001_000020_H07. (512 letters) Database: uniprot_sprot.fasta 412,525 sequences;
Lifescience Database Archive (English)
Full Text Available YMU001_000022_A07 476 Adiantum capillus-veneris mRNA. clone: YMU001_000022_A07. BP912712 - Show BP912712...is mRNA. clone: YMU001_000022_A07. Accession BP912712 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP912712|Adiantum capillus-veneris mRNA, cl...one: YMU001_000022_A07. (476 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...8%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Frame = +3 Query: 123 TSRRKSNHDQY--LPNYKVGTVHLLLGVKDQHLVSKIDI
Lifescience Database Archive (English)
Full Text Available YMU001_000016_D11 457 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D11. BP912212... CL1085Contig1 Show BP912212 Clone id YMU001_000016_D11 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_D11. Accession BP912212 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912212...|Adiantum capillus-veneris mRNA, clone: YMU001_000016_D11. (457 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000017_F01 489 Adiantum capillus-veneris mRNA. clone: YMU001_000017_F01. BP912312... CL1779Contig1 Show BP912312 Clone id YMU001_000017_F01 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000017_F01. Accession BP912312 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912312...|Adiantum capillus-veneris mRNA, clone: YMU001_000017_F01. (489 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D10 477 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D10. BP91212...8 CL2328Contig1 Show BP912128 Clone id YMU001_000015_D10 Library YMU01 Length 477 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D10. Accession BP912128 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...8|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D10. (461 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000024_C05 413 Adiantum capillus-veneris mRNA. clone: YMU001_000024_C05. BP912912... CL1433Contig1 Show BP912912 Clone id YMU001_000024_C05 Library YMU01 Length 413 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000024_C05. Accession BP912912 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912912|Adiantum capillus-ven...eris mRNA, clone: YMU001_000024_C05. (413 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000131_G09 554 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G09. BP919999... CL2968Contig1 Show BP919999 Clone id YMU001_000131_G09 Library YMU01 Length 554 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_G09. Accession BP919999 Tissue type prothallium Developmental stag...b Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generatio...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919999|Adiantum capillus-ve
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D02. BP92099...7 CL10Contig1 Show BP920997 Clone id YMU001_000144_D02 Library YMU01 Length 534 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000144_D02. Accession BP920997 Tissue type prothallium Developmental stage ...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920997|Adian...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2
Energy Technology Data Exchange (ETDEWEB)
Fernández-Trincado, J. G.; Geisler, D.; Tang, B.; Villanova, S.; Mennickent, R. E. [Departamento de Astronomía, Universidad de Concepción, Casilla 160-C, Concepción (Chile); Zamora, O.; García-Hernández, D. A.; Dell’Agli, F.; Prieto, Carlos Allende [Instituto de Astrofísica de Canarias, E-38205 La Laguna, Tenerife (Spain); Souto, Diogo; Cunha, Katia [Observatório Nacional, Rua Gal. José Cristino 77, Rio de Janeiro, RJ—20921-400 (Brazil); Schiavon, R. P. [Astrophysics Research Institute, Liverpool John Moores University, 146 Brownlow Hill, Liverpool L3 5RF (United Kingdom); Hasselquist, Sten [New Mexico State University, Las Cruces, NM 88003 (United States); Shetrone, M. [University of Texas at Austin, McDonald Observatory, Fort Davis, TX 79734 (United States); Vieira, K. [Centro de Investigaciones de Astronomía, AP 264, Mérida 5101-A (Venezuela, Bolivarian Republic of); Zasowski, G. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Sobeck, J.; Hayes, C. R.; Majewski, S. R. [Department of Astronomy, University of Virginia, Charlottesville, VA 22903 (United States); Placco, V. M., E-mail: jfernandezt@astro-udec.cl, E-mail: jfernandezt87@gmail.com [Department of Physics and JINA Center for the Evolution of the Elements, University of Notre Dame, Notre Dame, IN 46556 (United States); and others
2017-09-01
We report the peculiar chemical abundance patterns of 11 atypical Milky Way (MW) field red giant stars observed by the Apache Point Observatory Galactic Evolution Experiment (APOGEE). These atypical giants exhibit strong Al and N enhancements accompanied by C and Mg depletions, strikingly similar to those observed in the so-called second-generation (SG) stars of globular clusters (GCs). Remarkably, we find low Mg abundances ([Mg/Fe] < 0.0) together with strong Al and N overabundances in the majority (5/7) of the metal-rich ([Fe/H] ≳ −1.0) sample stars, which is at odds with actual observations of SG stars in Galactic GCs of similar metallicities. This chemical pattern is unique and unprecedented among MW stars, posing urgent questions about its origin. These atypical stars could be former SG stars of dissolved GCs formed with intrinsically lower abundances of Mg and enriched Al (subsequently self-polluted by massive AGB stars) or the result of exotic binary systems. We speculate that the stars Mg-deficiency as well as the orbital properties suggest that they could have an extragalactic origin. This discovery should guide future dedicated spectroscopic searches of atypical stellar chemical patterns in our Galaxy, a fundamental step forward to understanding the Galactic formation and evolution.
WHEELS OF FIRE. IV. STAR FORMATION AND THE NEUTRAL INTERSTELLAR MEDIUM IN THE RING GALAXY AM0644-741
International Nuclear Information System (INIS)
Higdon, James L.; Higdon, Sarah J. U.; Rand, Richard J.
2011-01-01
We combine data from the Australia Telescope National Facility and Swedish ESO Submillimeter Telescope to investigate the neutral interstellar medium (ISM) in AM0644-741, a large and robustly star-forming ring galaxy. The galaxy's ISM is concentrated in the 42 kpc diameter starburst ring, but appears dominated by atomic gas, with a global molecular fraction (f mol ) of only 0.062 ± 0.005. Apart from the starburst peak, the gas ring appears stable against the growth of gravitational instabilities (Q gas = 3-11). Including the stellar component lowers Q overall, but not enough to make Q 2 content. AM0644-741's star formation law is highly peculiar: H I obeys a Schmidt law while H 2 is uncorrelated with star formation rate density. Photodissociation models yield low volume densities in the ring, especially in the starburst quadrant (n ∼ 2 cm -3 ), implying a warm neutral medium dominated ISM. At the same time, the ring's pressure and ambient far-ultraviolet radiation field lead to the expectation of a predominantly molecular ISM. We argue that the ring's high SFE, low f mol and n, and peculiar star formation law follow from the ISM's ∼> 100 Myr confinement time in the starburst ring, which amplifies the destructive effects of embedded massive stars and supernovae. As a result, the ring's molecular ISM becomes dominated by small clouds, causing M H 2 to be significantly underestimated by 12 CO line fluxes: in effect, X CO >> X Gal despite the ring's ≥solar metallicity. The observed H I is primarily a low-density photodissociation product, i.e., a tracer rather than a precursor of massive star formation. Such an 'over-cooked' ISM may be a general characteristic of evolved starburst ring galaxies.
Garduno, Sylvia Aide Figueroa; Kovacova, Nikola; Arjona, Ruben Campos
2017-01-01
This project challenges the essentialist notions of gender in fantasy genre. The trilogy of Miss Peregrine’s Peculiar Children will shed light on the shifting patterns of gender performativity in fantasy. To drive our analysis, we will resort to Judith Butler’s theory of gender performativity, Joseph Campbell’s monomyth and William Indick’s study of fantasy and myth.
International Nuclear Information System (INIS)
Gago-Ferrero, Pablo; Badia-Fabregat, Marina; Olivares, Alba; Piña, Benjamin; Blánquez, Paqui; Vicent, Teresa; Caminal, Gloria; Díaz-Cruz, M. Silvia
2012-01-01
Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: ► Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. ► BP3 is not degraded under simulated sunlight. ► Glycoconjugates have been identified as the main intermediate metabolites. ► Decrease in endocrine activity was found in both photodegradation and biodegradation.
Lifescience Database Archive (English)
Full Text Available YMU001_000032_E04 520 Adiantum capillus-veneris mRNA. clone: YMU001_000032_E04. BP913636... CL2643Contig1 Show BP913636 Clone id YMU001_000032_E04 Library YMU01 Length 520 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000032_E04. Accession BP913636 Tissue type prothallium Developmental stag...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP913636|Adiantum capillus-veneris mRNA, clone: YMU001_00003...tative phospholipid-transporting ATPase ... 149 8e-36 sp|Q9LNQ4|ALA4_ARATH Putati
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D06 531 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D06. BP91212...4 CL2988Contig1 Show BP912124 Clone id YMU001_000015_D06 Library YMU01 Length 531 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D06. Accession BP912124 Tissue type prothallium Developmental stag...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912124|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D06. (531 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D07 558 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D07. BP912125 - Show BP91212...is mRNA. clone: YMU001_000015_D07. Accession BP912125 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912125|Adiantum capillus-veneris mRN...A, clone: YMU001_000015_D07. (558 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...copeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D01 500 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D01. BP912120 - Show BP91212...is mRNA. clone: YMU001_000015_D01. Accession BP912120 Tissue type prothallium Developmental stage - Contig I...elated Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum Align length 130 Score (bit) 124.0 E-va...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...0|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D01. (500 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000147_A09 361 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A09. BP921212 - Show BP921212...is mRNA. clone: YMU001_000147_A09. Accession BP921212 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921212|Adiantum capillus-veneris... mRNA, clone: YMU001_000147_A09. (361 letters) Database: uniprot_sprot.fasta 412,...itol-4,5-bisphosphate 3-ki... 30 2.9 sp|O14338|YB33_SCHPO Uncharacterized serine-rich protein C2F12.0... 29
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D08 484 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D08. BP912126 CL412...4Contig1 Show BP912126 Clone id YMU001_000015_D08 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D08. Accession BP912126 Tissue type prothallium Developmental stage - Contig ID CL412...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...25:3389-3402. Query= BP912126|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D08. (484 letters) Databa
Lifescience Database Archive (English)
Full Text Available YMU001_000023_B07 575 Adiantum capillus-veneris mRNA. clone: YMU001_000023_B07. BP912812... CL2610Contig1 Show BP912812 Clone id YMU001_000023_B07 Library YMU01 Length 575 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000023_B07. Accession BP912812 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912812|Adiant...um capillus-veneris mRNA, clone: YMU001_000023_B07. (575 letters) Database: uniprot_sprot.fasta 412,525 sequ
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D04 544 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D04. BP91212...2 CL3363Contig1 Show BP912122 Clone id YMU001_000015_D04 Library YMU01 Length 544 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D04. Accession BP912122 Tissue type prothallium Developmental stag...obium aromaticivorans (strain DSM 12444) Align length 58 Score (bit) 33.1 E-value 0.89 Report BLASTX 2.2.19 ...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912122|Adiantum
Lifescience Database Archive (English)
Full Text Available YMU001_000018_G03 551 Adiantum capillus-veneris mRNA. clone: YMU001_000018_G03. BP912412... CL4248Contig1 Show BP912412 Clone id YMU001_000018_G03 Library YMU01 Length 551 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_G03. Accession BP912412 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912412|Adiantum capillus-veneris mR...NA, clone: YMU001_000018_G03. (551 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tot
Lifescience Database Archive (English)
Full Text Available YMU001_000012_A06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A06. BP912012... CL2421Contig1 Show BP912012 Clone id YMU001_000012_A06 Library YMU01 Length 542 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A06. Accession BP912012 Tissue type prothallium Developmental stag...rams, Nucleic Acids Res. 25:3389-3402. Query= BP912012|Adiantum capillus-veneris ...mRNA, clone: YMU001_000012_A06. (542 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 t
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D05 496 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D05. BP91212...3 CL498Contig1 Show BP912123 Clone id YMU001_000015_D05 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D05. Accession BP912123 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...3|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D05. (478 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000019_D01 513 Adiantum capillus-veneris mRNA. clone: YMU001_000019_D01. BP912512... CL17Contig1 Show BP912512 Clone id YMU001_000019_D01 Library YMU01 Length 513 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000019_D01. Accession BP912512 Tissue type prothallium Developmental stage ...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP912512|Adiantum capillus-veneris mRNA, clone: YMU0...01_000019_D01. (489 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Sear
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D11 268 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D11. BP91212...9 CL691Contig1 Show BP912129 Clone id YMU001_000015_D11 Library YMU01 Length 268 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D11. Accession BP912129 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912129|Adiantum capillus-veneris mRNA, clo...ne: YMU001_000015_D11. (268 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total lett
Lifescience Database Archive (English)
Full Text Available YMU001_000100_A08 270 Adiantum capillus-veneris mRNA. clone: YMU001_000100_A08. BP917373 CL2373...Contig1 Show BP917373 Clone id YMU001_000100_A08 Library YMU01 Length 270 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_A08. Accession BP917373 Tissue type prothallium Developmental stage - Contig ID CL2373...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917373|Adiantum capillus-veneris mRNA, clone: YMU...EGAVKHVGVLSS 206 K+ GC+S G SRHGES V KE H SS Sbjct: 473 KKEKGCSSPGSSRHGESHKGVSHTPI
SPECTROSCOPIC ANALYSIS OF METAL-POOR STARS FROM LAMOST: EARLY RESULTS
International Nuclear Information System (INIS)
Li, Hai-Ning; Zhao, Gang; Wang, Liang; Wang, Wei; Yuan, Hailong; Christlieb, Norbert; Zhang, Yong; Hou, Yonghui
2015-01-01
We report on early results from a pilot program searching for metal-poor stars with LAMOST and follow-up high-resolution observation acquired with the MIKE spectrograph attached to the Magellan II telescope. We performed detailed abundance analysis for eight objects with iron abundances [Fe/H] < -2.0, including five extremely metal-poor (EMP; [Fe/H] < -3.0) stars with two having [Fe/H] < -3.5. Among these objects, three are newly discovered EMP stars, one of which is confirmed for the first time with high-resolution spectral observations. Three program stars are regarded as carbon-enhanced metal-poor (CEMP) stars, including two stars with no enhancement in their neutron-capture elements, which thus possibly belong to the class of CEMP-no stars; one of these objects also exhibits significant enhancement in nitrogen, and is thus a potential carbon and nitrogen-enhanced metal-poor star. The [X/Fe] ratios of the sample stars generally agree with those reported in the literature for other metal-poor stars in the same [Fe/H] range. We also compared the abundance patterns of individual program stars with the average abundance pattern of metal-poor stars and find only one chemically peculiar object with abundances of at least two elements (other than C and N) showing deviations larger than 0.5 dex. The distribution of [Sr/Ba] versus [Ba/H] agrees that an additional nucleosynthesis mechanism is needed aside from a single r-process. Two program stars with extremely low abundances of Sr and Ba support the prospect that both main and weak r-processes may have operated during the early phase of Galactic chemical evolution. The distribution of [C/N] shows that there are two groups of carbon-normal giants with different degrees of mixing. However, it is difficult to explain the observed behavior of the [C/N] of the nitrogen-enhanced unevolved stars based on current data
Radio emission in peculiar galaxies
Demellorabaca, Dulia F.; Abraham, Zulema
1990-01-01
During the last decades a number of surveys of peculiar galaxies have been carried out and accurate positions become available. Since peculiarities are a possible evidence of radio emission (Wright, 1974; Sulentic, 1976; Stocke et al., 1978), the authors selected a sample of 24 peculiar galaxies with optical jet-like features or extensions in different optical catalogues, mainly the Catalogue of Southern Peculiar Galaxies and Associations (Arp and Madore, 1987) and the ESO/Uppsala Survey of the ESO(B) Atlas (Lauberts, 1982) for observation at the radio continuum frequency of 22 GHz. The sample is listed in a table. Sol (1987) studied this sample and concluded that the majority of the jet-like features seem to admit an explanation in terms of interactive galaxies with bridges and/or tails due to tidal effects. Only in a few cases do the jets seem to be possibly linked to some nuclear activity of the host galaxy. The observations were made with the 13.7m-radome enclosed Itapetinga Radiotelescope (HPBW of 4.3 arcmin), in Brazil. The receiver was a 1 GHz d.s.b. super-heterodine mixer operated in total-power mode, with a system temperature of approximately 800 K. The observational technique consisted in scans in right ascention, centralized in the optical position of the galaxy. The amplitude of one scan was 43 arcmin, and its duration time was 20 seconds. The integration time was at least 2 hours (12 ten-minute observations) and the sensibility limit adopted was an antenna temperature greater than 3 times the r.m.s. error of the baseline determination. Virgo A was used as the calibrator source. Three galaxies were detected for the first time as radio sources and four other known galaxies at low frequencies had their flux densities measured at 22 GHz. The results for these sources are presented.
A search for strong, ordered magnetic fields in Herbig Ae/Be stars
Wade, G. A.; Bagnulo, S.; Drouin, D.; Landstreet, J. D.; Monin, D.
2007-04-01
The origin of magnetic fields in intermediate- and high-mass stars is fundamentally a mystery. Clues towards solving this basic astrophysical problem can likely be found at the pre-main-sequence (PMS) evolutionary stage. With this work, we perform the largest and most sensitive search for magnetic fields in PMS Herbig Ae/Be (HAeBe) stars. We seek to determine whether strong, ordered magnetic fields, similar to those of main-sequence Ap/Bp stars, can be detected in these objects, and if so, to determine the intensities, geometrical characteristics, and statistical incidence of such fields. 68 observations of 50 HAeBe stars have been obtained in circularly polarized light using the FORS1 spectropolarimeter at the ESO VLT. An analysis of both Balmer and metallic lines reveals the possible presence of weak longitudinal magnetic fields in photospheric lines of two HAeBe stars, HD 101412 and BF Ori. Results for two additional stars, CPD-53 295 and HD 36112, are suggestive of the presence of magnetic fields, but no firm conclusions can be drawn based on the available data. The intensity of the longitudinal fields detected in HD 101412 and BF Ori suggest that they correspond to globally ordered magnetic fields with surface intensities of order 1 kG. On the other hand, no magnetic field is detected in 4 other HAeBe stars in our sample in which magnetic fields had previously been confirmed. Monte Carlo simulations of the longitudinal field measurements of the undetected stars allow us to place an upper limit of about 300 G on the general presence of aligned magnetic dipole magnetic fields, and of about 500 G on perpendicular dipole fields. Taking into account the results of our survey and other published results, we find that the observed bulk incidence of magnetic HAeBe stars in our sample is 8-12 per cent, in good agreement with that of magnetic main-sequence stars of similar masses. We also find that the rms longitudinal field intensity of magnetically detected HAe
TRIGONOMETRIC PARALLAXES OF MASSIVE STAR-FORMING REGIONS. II. CEP A AND NGC 7538
International Nuclear Information System (INIS)
Moscadelli, L.; Reid, M. J.; Menten, K. M.; Brunthaler, A.; Xu, Y.; Zheng, X. W.
2009-01-01
We report trigonometric parallaxes for the sources NGC 7538 and Cep A, corresponding to distances of 2.65 +0.12 -0.11 and 0.70 +0.04 -0.04 kpc, respectively. The distance to NGC 7538 is considerably smaller than its kinematic distance and places it in the Perseus spiral arm. The distance to Cep A is also smaller than its kinematic distance and places it in the L ocalarm or spur. Combining the distance and proper motions with observed radial velocities gives the location and full space motion of the star-forming regions. We find significant deviations from circular galactic orbits for these sources: both sources show large peculiar motions (greater than 10 km s -1 ) counter to galactic rotation and NGC 7538 has a comparable peculiar motion toward the Galactic center.
THE EXTENDED He IIλ4686-EMITTING REGION IN IZw 18 UNVEILED: CLUES FOR PECULIAR IONIZING SOURCES
Energy Technology Data Exchange (ETDEWEB)
Kehrig, C.; Vílchez, J. M.; Pérez-Montero, E.; Iglesias-Páramo, J.; Bayo, F. M. [Instituto de Astrofísica de Andalucía (CSIC), Glorieta de la Astronomía s/n, E-18008 Granada (Spain); Brinchmann, J. [Leiden Observatory, Leiden University, P.O. Box 9513, NL-2300 RA Leiden (Netherlands); Kunth, D.; Durret, F. [Institut d’Astrophysique de Paris, UMR 7095, CNRS and UPMC, 98 bis Bd Arago, F-75014 Paris (France)
2015-03-10
New integral field spectroscopy has been obtained for IZw 18, the nearby lowest-metallicity galaxy considered to be our best local analog of systems forming at high redshift (z). Here we report the spatially resolved spectral map of the nebular He ii λ4686 emission in IZw 18, from which we derived for the first time its total He ii-ionizing flux. Nebular He ii emission implies the existence of a hard radiation field. He ii-emitters are observed to be more frequent among high-z galaxies than for local objects. Therefore, investigating the He ii-ionizing source(s) in IZw 18 may reveal the ionization processes at high z. He ii emission in star-forming galaxies has been suggested to be mainly associated with Wolf–Rayet stars (WRs), but WRs cannot satisfactorily explain the He ii-ionization at all times, particularly at the lowest metallicities. Shocks from supernova remnants, or X-ray binaries, have been proposed as additional potential sources of He ii-ionizing photons. Our data indicate that conventional He ii-ionizing sources (WRs, shocks, X-ray binaries) are not sufficient to explain the observed nebular He iiλ4686 emission in IZw 18. We find that the He ii-ionizing radiation expected from models for either low-metallicity super-massive O stars or rotating metal-free stars could account for the He ii-ionization budget measured, while only the latter models could explain the highest values of He iiλ4686/Hβ observed. The presence of such peculiar stars in IZw 18 is suggestive and further investigation in this regard is needed. This letter highlights that some of the clues of the early universe can be found here in our cosmic backyard.
The Peculiar Filamentary H i Structure of NGC 6145
Energy Technology Data Exchange (ETDEWEB)
Wang, Enci; Kong, Xu; Mou, Guobin [CAS Key Laboratory for Research in Galaxies and Cosmology, Department of Astronomy, University of Science and Technology of China, Hefei, Anhui 230026 (China); Wang, Jing [Australia Telescope National Facility, CSIRO Astronomy and Space Science, P.O. Box 76, Epping, NSW 1710 (Australia); Guo, Fulai; Lin, Lin; Li, Cheng; Xiao, Ting, E-mail: ecwang16@ustc.edu.cn, E-mail: xkong@ustc.edu.cn [Key Laboratory for Research in Galaxies and Cosmology, Shanghai Astronomical Observatory, Chinese Astronomical Society, 80 Nandan Road, Shanghai 200030 (China)
2017-08-01
In this paper, we report the peculiar H i morphology of the cluster spiral galaxy NGC 6145, which has a 150 kpc H i filament on one side that is nearly parallel to its major axis. This filament is made up of several H i clouds and the diffuse H i gas between them, with no optical counterparts. We compare its H i distribution with other one-sided H i distributions in the literature and find that the overall H i distribution is very different from the typical tidal and ram-pressure stripped H i shape, and that its morphology is inconsistent with that of a pure accretion event. Only ∼30% of the total H i gas is anchored on the stellar disk, while most of the H i gas forms the filament in the west. At a projected distance of 122 kpc, we find a massive elliptical companion (NGC 6146) with extended radio emission whose axis points to an H i gap in NGC 6145. The velocity of the H i filament shows an overall line-of-sight motion of 80–180 km s{sup −1} with respect to NGC 6145. Using the long-slit spectra of NGC 6145 along its major stellar axis, we find that some outer regions show enhanced star formation, while in contrast, almost no star formation activities are found in its center (<2 kpc). Pure accretion, tidal, or ram-pressure stripping are not likely to produce the observed H i filament. An alternative explanation is the jet stripping from NGC 6146, although direct evidence for a jet-cold gas interaction has not been found.
Alpert, Bruce S
2011-04-01
We evaluated two new Welch Allyn automated blood pressure (BP) algorithms. The first, SureBP, estimates BP during cuff inflation; the second, StepBP, does so during deflation. We followed the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard for testing and data analysis. The data were also analyzed using the British Hypertension Society analysis strategy. We tested children, adolescents, and adults. The requirements of the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard were fulfilled with respect to BP levels, arm sizes, and ages. Association for the Advancement of Medical Instrumentation SP10 Method 1 data analysis was used. The mean±standard deviation for the device readings compared with auscultation by paired, trained, blinded observers in the SureBP mode were -2.14±7.44 mmHg for systolic BP (SBP) and -0.55±5.98 mmHg for diastolic BP (DBP). In the StepBP mode, the differences were -3.61±6.30 mmHg for SBP and -2.03±5.30 mmHg for DBP. Both algorithms achieved an A grade for both SBP and DBP by British Hypertension Society analysis. The SureBP inflation-based algorithm will be available in many new-generation Welch Allyn monitors. Its use will reduce the time it takes to estimate BP in critical patient care circumstances. The device will not need to inflate to excessive suprasystolic BPs to obtain the SBP values. Deflation is rapid once SBP has been determined, thus reducing the total time of cuff inflation and reducing patient discomfort. If the SureBP fails to obtain a BP value, the StepBP algorithm is activated to estimate BP by traditional deflation methodology.
Lifescience Database Archive (English)
Full Text Available YMU001_000038_B01 468 Adiantum capillus-veneris mRNA. clone: YMU001_000038_B01. BP913939 - Show BP913939...is mRNA. clone: YMU001_000038_B01. Accession BP913939 Tissue type prothallium Developmental stage - Contig I...Nucleic Acids Res. 25:3389-3402. Query= BP913939|Adiantum capillus-veneris mRNA, ... F member 3... 86 9e-17 sp|Q66H39|ABCF3_RAT ATP-binding cassette sub-family F member 3 O... 85 1e-16 sp|Q5R9...aracterized ABC transporter ATP-binding... 56 6e-08 sp|P63390|YHES_ECO57 Uncharacterized ABC transporter ATP
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D09 582 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D09. BP912127 - Show BP91212...is mRNA. clone: YMU001_000015_D09. Accession BP912127 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912127|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D09. (582 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total ...p|P42825|DNAJ2_ARATH Chaperone protein dnaJ 2 OS=Arabidopsis th... 79 2e-14 sp|Q09912|PSI1_SCHPO Protein psi
Lifescience Database Archive (English)
Full Text Available YMU001_000015_C08 546 Adiantum capillus-veneris mRNA. clone: YMU001_000015_C08. BP912112 - Show BP912112...is mRNA. clone: YMU001_000015_C08. Accession BP912112 Tissue type prothallium Developmental stage - Contig I...Arabidopsis thaliana Align length 171 Score (bit) 121.0 E-value 3.0e-27 Report BLASTX 2.2.19 [Nov-02-2008] R... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912112|Adiantum capillus-veneri...s mRNA, clone: YMU001_000015_C08. (546 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765
Energy Technology Data Exchange (ETDEWEB)
Gago-Ferrero, Pablo, E-mail: pablo.gago@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Badia-Fabregat, Marina, E-mail: marina.badia@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Olivares, Alba, E-mail: esalba.olivares@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Pina, Benjamin, E-mail: benjami.pina@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Blanquez, Paqui, E-mail: paqui.blanquez@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Vicent, Teresa, E-mail: teresa.vicent@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Caminal, Gloria, E-mail: gloria.caminal@uab.cat [Unitat de Biocatalisi Aplicada associada al IQAC (CSIC-UAB). Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Diaz-Cruz, M. Silvia, E-mail: silvia.diaz@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); and others
2012-06-15
Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: Black-Right-Pointing-Pointer Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. Black-Right-Pointing-Pointer BP3 is not degraded under simulated sunlight. Black-Right-Pointing-Pointer Glycoconjugates have been identified as the main intermediate metabolites. Black-Right-Pointing-Pointer Decrease in endocrine activity
Peculiarities of clinical course of children skin cancer
International Nuclear Information System (INIS)
Zikiryakhodjaev, D.Z.; Sanginov, D.R.
2001-01-01
In this chapter of book authors investigated the peculiarities of clinical course of children skin cancer. They noted that comprehensive studying of peculiarities of clinical course of children skin cancer proved that they depend not only from age, but from morphologic structure, previous skin illness which was cause of skin cancer
Directory of Open Access Journals (Sweden)
Azamat Aslanukov
2006-10-01
Full Text Available The Ran-binding protein 2 (RanBP2 is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/- are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/- mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.
Aslanukov, Azamat; Bhowmick, Reshma; Guruju, Mallikarjuna; Oswald, John; Raz, Dorit; Bush, Ronald A; Sieving, Paul A; Lu, Xinrong; Bock, Cheryl B; Ferreira, Paulo A
2006-10-01
The Ran-binding protein 2 (RanBP2) is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s) of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI) via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/-) are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/-) mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.
Discovery of a magnetic field in the δ Scuti F2m star ρ Pup
Neiner, C.; Wade, G. A.; Sikora, J.
2017-06-01
ρ Pup is a δ Scuti F2 pulsator, known to host a main radial mode as well as non-radial pulsations, with chemical peculiarities typical of evolved Am stars. We present a high-precision spectropolarimetric observations of this star, obtained with ESPaDOnS at the Canada-France-Hawaii Telescope in the frame of the BRITE spectropolarimetric survey. A magnetic field is clearly detected in ρ Pup, with a longitudinal field strength below 1 G. This makes ρ Pup the second known magnetic δ Scuti discovered, after HD 188774, and a possible cool evolved counterpart of the recently discovered ultraweakly magnetic Am family.
Strong late-time circumstellar interaction in the peculiar supernova iPTF14hls
Andrews, Jennifer E.; Smith, Nathan
2018-06-01
We present a moderate-resolution spectrum of the peculiar Type II supernova (SN) iPTF14hls taken on day 1153 after discovery. This spectrum reveals the clear signature of shock interaction with dense circumstellar material (CSM). We suggest that this CSM interaction may be an important clue for understanding the extremely unusual photometric and spectroscopic evolution seen over the first 600 d of iPTF14hls. The late-time spectrum shows a double-peaked intermediate-width H α line indicative of expansion speeds around 1000 km s-1, with the double-peaked shape hinting at a disc-like geometry in the CSM. If the CSM were highly asymmetric, perhaps in a disc or torus that was ejected from the star 3-6 yr prior to explosion, the CSM interaction could have been overrun and hidden below the SN ejecta photosphere from a wide range of viewing angles. In that case, CSM interaction luminosity would have been thermalized well below the photosphere, potentially sustaining the high luminosity without exhibiting the traditional observational signatures of strong CSM interaction (narrow H α emission and X-rays). Variations in density structure of the CSM could account for the multiple rebrightenings of the light curve. We propose that a canonical 1 × 1051 erg explosion energy with enveloped CSM interaction as seen in some recent SNe, rather than an entirely new explosion mechanism, may be adequate to explain the peculiar evolution of iPTF14hls.
The Dilemma for USSOCOM: Transitioning SOF-Peculiar to Service-Common
2012-02-15
Operations-peculiar (SO-peculiar or SOF-peculiar) to Service-common, while the third implication suggests a lack of “ advertising ”, i.e. the need for a...Portfolio Management ( CPM ) system which seeks to optimize capability investments across the defense enterprise.59 Though CPMs are charged to identify...capabilities as Service-common. Collectively though they do offer several avenues in which SOCOM can “ advertise ” them, and whereby through mutual
Rappenglück, Michael A.
Decades of research work done by several scientists all over the world since the beginning of the 20th century confirmed the idea, that Palaeolithic man looked up to the starry sky and recognized prominent patterns of stars as well as the course of the celestial bodies. Though sometimes highly speculative, the investigations made clear, that time-factored notations played an important role in the archaic cultures of Palaeolithic epochs (from 33,000 to 10,000 BP). There are some distinct and detailed examples of lunar-, solar- and lunisolar-calendars sometimes combined with pictures of seasonality, mostly discovered on transportable bones and stones, but also on the fixed walls of certain caves. The investigations showed that in Palaeolithic epochs time-reckoning, in particular the lunar cycle, had been related to the pregnancy of women too (Figure 2a-d). Recently I showed, that in the Magdalenian time (16,000-12,000 BP) man also recognized single and very complex star patterns, including the Milky Way: the Northern Crown in the cave of El Castillo (Spain), the Pleiades in the cave of Lascaux (France) and the main constellations of the sky at the same location. They were used by the Palaeolithic hunter-gatherers for orientation in space and for time-reckoning. These star patterns also played an important role in the cosmovisions of archaic cultures. Together with the depictions of the course of the moon and the sun, they helped to organize the spatiotemporal structure of daily and spiritual life of Palaeolithic man. Now I present a rock panel in the cave of La-T^ete-du-Lion (France) that shows the combination of a star pattern - Aldebaran in the Bull and the Pleiades - with a drawing of the moons cycle above. This picture comes from the Solutrean epoch ca 21,000-22,000 BP. It shows not only a remarkable similarity with the representation in the Lascaux cave, but clearly connects the star pattern with a part of the lunar cycle.
SPITZER SAGE-SMC INFRARED PHOTOMETRY OF MASSIVE STARS IN THE SMALL MAGELLANIC CLOUD
International Nuclear Information System (INIS)
Bonanos, A. Z.; Lennon, D. J.; Massa, D. L.
2010-01-01
We present a catalog of 5324 massive stars in the Small Magellanic Cloud (SMC), with accurate spectral types compiled from the literature, and a photometric catalog for a subset of 3654 of these stars, with the goal of exploring their infrared properties. The photometric catalog consists of stars with infrared counterparts in the Spitzer SAGE-SMC survey database, for which we present uniform photometry from 0.3to24 μm in the UBVIJHK s +IRAC+MIPS24 bands. We compare the color-magnitude diagrams and color-color diagrams to those of stars in the Large Magellanic Cloud (LMC), finding that the brightest infrared sources in the SMC are also the red supergiants, supergiant B[e] (sgB[e]) stars, luminous blue variables, and Wolf-Rayet stars, with the latter exhibiting less infrared excess, the red supergiants being less dusty and the sgB[e] stars being on average less luminous. Among the objects detected at 24 μm in the SMC are a few very luminous hypergiants, four B-type stars with peculiar, flat spectral energy distributions, and all three known luminous blue variables. We detect a distinct Be star sequence, displaced to the red, and suggest a novel method of confirming Be star candidates photometrically. We find a higher fraction of Oe and Be stars among O and early-B stars in our SMC catalog, respectively, when compared to the LMC catalog, and that the SMC Be stars occur at higher luminosities. We estimate mass-loss rates for the red supergiants, confirming the correlation with luminosity even at the metallicity of the SMC. Finally, we confirm the new class of stars displaying composite A and F type spectra, the sgB[e] nature of 2dFS1804 and find the F0 supergiant 2dFS3528 to be a candidate luminous blue variable with cold dust.
Spectroscopic abundance analyses of the 3He stars HD 185330 and 3 Cen A
Sadakane, Kozo; Nishimura, Masayoshi
2018-04-01
Abundances of 21 elements in two 3He stars, HD 185330 and 3 Cen A, have been analysed relative to the well-studied sharp-lined B3 V star ι Her. Six elements (P, Ti, Mn, Fe, Ni, and Br) are over-abundant in these two peculiar stars, while six elements (C, O, Mg, Al, S, and Cl) are under-abundant. Absorption lines of the two rarely observed heavy elements Br II and Kr II are detected in both stars and these elements are both over-abundant. The centroid wavelengths of the Ca II infrared triplet lines in these stars are redshifted relative to those lines in ι Her and the presence of heavy isotopes of Ca (mass number 44-46) in these two stars is confirmed. In spite of these similarities, there are several remarkable differences in abundance pattern between these two stars. N is under-abundant in HD 185330, as in many Hg-Mn stars, while it is significantly over-abundant in 3 Cen A. P and Ga are both over-abundant in 3 Cen A, while only P is over-abundant and no trace of absorption line of Ga II can be found in HD 185330. Large over-abundances of Kr and Xe are found in both stars, while the abundance ratio Kr/Xe is significantly different between them (-1.4 dex in HD 185330 and +1.2 dex in 3 Cen A). Some physical explanations are needed to account for these qualitative differences.
THE ORIGIN OF HVS17, AN UNBOUND MAIN SEQUENCE B STAR AT 50 kpc
Energy Technology Data Exchange (ETDEWEB)
Brown, Warren R.; Geller, Margaret J.; Kenyon, Scott J. [Smithsonian Astrophysical Observatory, 60 Garden Street, Cambridge, MA 02138 (United States); Cohen, Judith G., E-mail: wbrown@cfa.harvard.edu, E-mail: mgeller@cfa.harvard.edu, E-mail: skenyon@cfa.harvard.edu, E-mail: jlc@astro.caltech.edu [Palomar Observatory, Mail Stop 249-17, California Institute of Technology, Pasadena, CA 91125 (United States)
2013-09-20
We analyze Keck Echellette Spectrograph and Imager spectroscopy of HVS17, a B-type star traveling with a Galactic rest frame radial velocity of +445 km s{sup –1} in the outer halo of the Milky Way. HVS17 has the projected rotation of a main sequence B star and is chemically peculiar, with solar iron abundance and sub-solar alpha abundance. Comparing measured T{sub eff} and log g with stellar evolution tracks implies that HVS17 is a 3.91 ± 0.09 M{sub ☉}, 153 ± 9 Myr old star at a Galactocentric distance of r = 48.5 ± 4.6 kpc. The time between its formation and ejection significantly exceeds 10 Myr and thus is difficult to reconcile with any Galactic disk runaway scenario involving massive stars. The observations are consistent, on the other hand, with a hypervelocity star ejection from the Galactic center. We show that Gaia proper motion measurements will easily discriminate between a disk and Galactic center origin, thus allowing us to use HVS17 as a test particle to probe the shape of the Milky Way's dark matter halo.
THE ORIGIN OF HVS17, AN UNBOUND MAIN SEQUENCE B STAR AT 50 kpc
International Nuclear Information System (INIS)
Brown, Warren R.; Geller, Margaret J.; Kenyon, Scott J.; Cohen, Judith G.
2013-01-01
We analyze Keck Echellette Spectrograph and Imager spectroscopy of HVS17, a B-type star traveling with a Galactic rest frame radial velocity of +445 km s –1 in the outer halo of the Milky Way. HVS17 has the projected rotation of a main sequence B star and is chemically peculiar, with solar iron abundance and sub-solar alpha abundance. Comparing measured T eff and log g with stellar evolution tracks implies that HVS17 is a 3.91 ± 0.09 M ☉ , 153 ± 9 Myr old star at a Galactocentric distance of r = 48.5 ± 4.6 kpc. The time between its formation and ejection significantly exceeds 10 Myr and thus is difficult to reconcile with any Galactic disk runaway scenario involving massive stars. The observations are consistent, on the other hand, with a hypervelocity star ejection from the Galactic center. We show that Gaia proper motion measurements will easily discriminate between a disk and Galactic center origin, thus allowing us to use HVS17 as a test particle to probe the shape of the Milky Way's dark matter halo
Cosmic string induced peculiar velocities
International Nuclear Information System (INIS)
van Dalen, A.; Schramm, D.N.
1987-02-01
We calculate analytically the probability distribution for peculiar velocities on scales from 10h -1 to 60h -1 Mpc with cosmic string loops as the dominant source of primordial gravitational perturbations. We consider a range of parameters βGμ appropriate for both hot (HDM) and cold (CDM) dark matter scenarios. An Ω = 1 CDM Universe is assumed with the loops randomly placed on a smooth background. It is shown how the effects can be estimated of loops breaking up and being born with a spectrum of sizes. It is found that to obtain large scale streaming velocities of at least 400 km/s it is necessary that either a large value for βGμ or the effect of loop fissioning and production details be considerable. Specifically, for optimal CDM string parameters Gμ = 10 -6 , β = 9, h = .5, and scales of 60h -1 Mpc, the parent size spectrum must be 36 times larger than the evolved daughter spectrum to achieve peculiar velocities of at least 400 km/s with a probability of 63%. With this scenario the microwave background dipole will be less than 800 km/s with only a 10% probability. The string induced velocity spectrum is relatively flat out to scales of about 2t/sub eq//a/sub eq/ and then drops off rather quickly. The flatness is a signature of string models of galaxy formation. With HDM a larger value of βGμ is necessary for galaxy formation since accretion on small scales starts later. Hence, with HDM, the peculiar velocity spectrum will be larger on large scales and the flat region will extend to larger scales. If large scale peculiar velocities greater than 400 km/s are real then it is concluded that strings plus CDM have difficulties. The advantages of strings plus HDM in this regard will be explored in greater detail in a later paper. 27 refs., 4 figs., 1 tab
Parkhomenko, A. I.; Shalagin, A. M.
2018-06-01
A mechanism for the segregation of calcium isotopes in the atmospheres of chemically peculiar (CP) stars due to light-induced drift (LID) of singly charged 48Ca+ ions is discussed. One peculiarity of Ca+ is that an adequate description of the effect of LID requires taking into account several energy levels of Ca+, and thus several pairs of relative differences ( ν i - ν k )/ ν i for the transport frequencies for collisions of levels i and k with neutral atoms (hydrogen, helium). The known real (calculated ab initio) interaction potentials are used to numerically calculate the factors ( ν i - ν k )/ ν i for several states of Ca+ for collisions with H and He atoms. These computations show that, at the temperatures characteristic of the atmospheres of CP stars, T = 6600-12 000 K, fairly high values are obtained for Ca+ ions, ( ν i - ν k )/ ν i ≈ 0.4-0.6. Simple, transparent computations demonstrate that the LID rates of Ca+ ions in the atmospheres of cool CP stars ( T eff = 6600 K) exceed the drift rate due to light pressure by two orders of magnitude. The LID is directed upward in the stellar atmosphere, and the heavy isotope 48Ca is pushed into upper layers of the atmosphere. This can explain the observed predominance of the heavy isotope 48Ca in the upper atmospheric layers of CP stars; according to the radiative-diffusion theory, the action of light pressure alone (in the absence of LID) would lead to sinking of the isotope 48Ca deeper into stellar atmosphere, following the lighter main isotope 40Ca. The 48Ca+ LIDrate decreases and its drift rate due to light pressure increases with growth of the effective temperatures in the atmospheres of CP stars. The manifestations of LID and light pressure are roughly comparable in the atmospheres of CP stars with effective temperatures near T eff = 9500 K.
Tunneling in BP-MoS2 heterostructure
Liu, Xiaochi; Qu, Deshun; Kim, Changsik; Ahmed, Faisal; Yoo, Won Jong
Tunnel field effect transistor (TFET) is considered to be a leading option for achieving SS mV/dec. In this work, black phosphorus (BP) and molybdenum disulfide (MoS2) heterojunction devices are fabricated. We find that thin BP flake and MoS2 form normal p-n junctions, tunneling phenomena can be observed when BP thickness increases to certain level. PEO:CsClO4 is applied on the surface of the device together with a side gate electrode patterned together with source and drain electrodes. The Fermi level of MoS2 on top of BP layer can be modulated by the side gating, and this enables to vary the MoS2-BP tunnel diode property from off-state to on-state. Since tunneling is the working mechanism of MoS2-BP junction, and PEO:CsClO4\\ possesses ultra high dielectric constant and small equivalent oxide thickness (EOT), a low SS of 55 mV/dec is obtained from MoS2-BP TFET. This work was supported by the Global Research Laboratory and Global Frontier R&D Programs at the Center for Hybrid Interface Materials, both funded by the Ministry of Science, ICT & Future Planning via the National Research Foundation of Korea (NRF).
Velocity-mass correlation of the O-type stars: model results
International Nuclear Information System (INIS)
Stone, R.C.
1982-01-01
This paper presents new model results describing the evolution of massive close binaries from their initial ZAMS to post-supernova stages. Unlike the previous conservative study by Stone [Astrophys. J. 232, 520 (1979) (Paper II)], these results allow explicitly for mass loss from the binary system occurring during the core hydrogen- and helium-burning stages of the primary binary star as well as during the Roche lobe overflow. Because of uncertainties in these rates, model results are given for several reasonable choices for these rates. All of the models consistently predict an increasing relation between the peculiar space velocities and masses for runaway OB stars which agrees well with the observed correlations discussed in Stone [Astron. J. 86, 544 (1981) (Paper III)] and also predict a lower limit at Mroughly-equal11M/sub sun/ for the masses of runaway stars, in agreement with the observational limit found by A. Blaauw (Bull. Astron. Inst. Neth. 15, 265, 1961), both of which support the binary-supernova scenario described by van den Heuvel and Heise for the origin of runaway stars. These models also predict that the more massive O stars will produce correspondingly more massive compact remnants, and that most binaries experiencing supernova-induced kick velocities of magnitude V/sub k/> or approx. =300 km s -1 will disrupt following the explosions. The best estimate for this velocity as established from pulsar observations is V/sub k/roughly-equal150 km s -1 , in which case probably only 15% if these binaries will be disrupted by the supernova explosions, and therefore, almost all runaway stars should have either neutron star or black hole companions
The photosphere of T. Tauri Stars
International Nuclear Information System (INIS)
Calvet, Nuria; Marin, Zaida
1987-01-01
We have calculated the absorption spectrum in the wavelength interval 4880-5025A for a set of models with Teff = 4000K and log g = 3.5 and a chromospheric temperature rise. These models are considered as representative of the atmosphere of T Tauri stars. The position of the temperature minimum goes from 0.1 to 2 gr cm -2 in the models. Populations are in LTE and the two level plus continuum approximation is used for the source function. We have compared the calculated spectra with those observed in the program of rotational velocity determination by Vogel and Kuhi (1981). Differences between the spectrum of T Tauri stars can be understood in first approximation in terms of differences in the position of the temperature minimum. In particular, we find that at the moment of the observation, the minimum in BP Tau was located between 1 and 2 cm -2 and in AA Tau between 0.3 and 0.6 gr cm -2 . (Author)
Structural peculiarities in magnetic small particles
International Nuclear Information System (INIS)
Haneda, K.; Morrish, A.H.
1993-01-01
Nanostructured magnetic materials, consisting of nanometer-sized crystallites, are currently a developing subject. Evidence has been accumulating that they possess properties that can differ substantially from those of bulk materials. This paper illustrates how Moessbauer spectroscopy can yield useful information on the structural peculiarities associated with these small particles. As illustrations, metallic iron and iron-oxide systems are considered in detail. The subjects discussed include: (1) Phase stabilities in small particles, (2) deformed or nonsymmetric atomic arrangements in small particles, and (3) peculiar magnetic structures or non-collinear spin arrangements in small magnetic oxide particles that are correlated with lower specific magnetizations as compared to the bulk values. (orig.)
International Nuclear Information System (INIS)
Carruba, V.; Aljbaae, S.; Souami, D.
2014-01-01
The asteroid (31) Euphrosyne is the largest body of its namesake family, and it contains more than 99% of the family mass. Among large asteroid families, the Euphrosyne group is peculiar because of its quite steep size-frequency distribution (SFD), significantly depleted in large- and medium-sized asteroids (8 < D < 12 km). The current steep SFD of the Euphrosyne family has been suggested to be the result of a grazing impact in which only the farthest, smallest members failed to accrete. The Euphrosyne family is, however, also very peculiar because of its dynamics: near its center it is crossed by the ν 6 = g – g 6 linear secular resonance, and it hosts the largest population (140 bodies) of asteroids in ν 6 antialigned librating states (or Tina-like asteroids) in the main belt. In this work we investigated the orbital evolution of newly obtained members of the dynamical family, with an emphasis on its interaction with the ν 6 resonance. Because of its unique resonant configuration, large- and medium-sized asteroids tend to migrate away from the family orbital region faster than small-sized objects, which were ejected farther away from the family center. As a consequence, the SFD of the Euphrosyne family becomes steeper in time with a growing depletion in the number of the largest family members. We estimate that the current SFD could be attained from a typical, initial SFD on timescales of 500 Myr, consistent with estimates of the family age obtained with other independent methods.
Carruba, V.; Aljbaae, S.; Souami, D.
2014-09-01
The asteroid (31) Euphrosyne is the largest body of its namesake family, and it contains more than 99% of the family mass. Among large asteroid families, the Euphrosyne group is peculiar because of its quite steep size-frequency distribution (SFD), significantly depleted in large- and medium-sized asteroids (8 < D < 12 km). The current steep SFD of the Euphrosyne family has been suggested to be the result of a grazing impact in which only the farthest, smallest members failed to accrete. The Euphrosyne family is, however, also very peculiar because of its dynamics: near its center it is crossed by the ν6 = g - g 6 linear secular resonance, and it hosts the largest population (140 bodies) of asteroids in ν6 antialigned librating states (or Tina-like asteroids) in the main belt. In this work we investigated the orbital evolution of newly obtained members of the dynamical family, with an emphasis on its interaction with the ν6 resonance. Because of its unique resonant configuration, large- and medium-sized asteroids tend to migrate away from the family orbital region faster than small-sized objects, which were ejected farther away from the family center. As a consequence, the SFD of the Euphrosyne family becomes steeper in time with a growing depletion in the number of the largest family members. We estimate that the current SFD could be attained from a typical, initial SFD on timescales of 500 Myr, consistent with estimates of the family age obtained with other independent methods.
Energy Technology Data Exchange (ETDEWEB)
Carruba, V.; Aljbaae, S. [UNESP, Univ. Estadual Paulista, Grupo de dinâmica Orbital e Planetologia, Guaratinguetá, SP, 12516-410 (Brazil); Souami, D., E-mail: vcarruba@feg.unesp.br [NAXYS, Namur Center for Complex Systems, Department of Mathematics, University of Namur, B-5000 Namur (Belgium)
2014-09-01
The asteroid (31) Euphrosyne is the largest body of its namesake family, and it contains more than 99% of the family mass. Among large asteroid families, the Euphrosyne group is peculiar because of its quite steep size-frequency distribution (SFD), significantly depleted in large- and medium-sized asteroids (8 < D < 12 km). The current steep SFD of the Euphrosyne family has been suggested to be the result of a grazing impact in which only the farthest, smallest members failed to accrete. The Euphrosyne family is, however, also very peculiar because of its dynamics: near its center it is crossed by the ν{sub 6} = g – g {sub 6} linear secular resonance, and it hosts the largest population (140 bodies) of asteroids in ν{sub 6} antialigned librating states (or Tina-like asteroids) in the main belt. In this work we investigated the orbital evolution of newly obtained members of the dynamical family, with an emphasis on its interaction with the ν{sub 6} resonance. Because of its unique resonant configuration, large- and medium-sized asteroids tend to migrate away from the family orbital region faster than small-sized objects, which were ejected farther away from the family center. As a consequence, the SFD of the Euphrosyne family becomes steeper in time with a growing depletion in the number of the largest family members. We estimate that the current SFD could be attained from a typical, initial SFD on timescales of 500 Myr, consistent with estimates of the family age obtained with other independent methods.
Discovery of a new Wolf-Rayet star and its ring nebula in Cygnus
Gvaramadze, V. V.; Fabrika, S.; Hamann, W.-R.; Sholukhova, O.; Valeev, A. F.; Goranskij, V. P.; Cherepashchuk, A. M.; Bomans, D. J.; Oskinova, L. M.
2009-11-01
We report the serendipitous discovery of a ring nebula around a candidate Wolf-Rayet (WR) star, HBHA4202-22, in Cygnus using the Spitzer Space Telescope archival data. Our spectroscopic follow-up observations confirmed the WR nature of this star (we named it WR138a) and showed that it belongs to the WN8-9h subtype. We thereby add a new example to the known sample of late WN stars with circumstellar nebulae. We analysed the spectrum of WR138a by using the Potsdam Wolf-Rayet (PoWR) model atmospheres, obtaining a stellar temperature of 40kK. The stellar wind composition is dominated by helium with 20 per cent of hydrogen. The stellar spectrum is highly reddened and absorbed (EB- V = 2.4mag, AV = 7.4mag). Adopting a stellar luminosity of logL/Lsolar = 5.3, the star has a mass-loss rate of 10-4.7Msolaryr-1, and resides in a distance of 4.2 kpc. We measured the proper motion for WR138a and found that it is a runaway star with a peculiar velocity of ~=50kms-1. Implications of the runaway nature of WR138a for constraining the mass of its progenitor star and understanding the origin of its ring nebula are discussed.
Abundances in normal and chemically peculiar B, A and F stars: hortatory remarks and prospectus
International Nuclear Information System (INIS)
Cowley, C.R.
1983-01-01
A variety of new techniques are discussed which make it possible to determine considerably more accurate abundances than are now available for stars near spectral type A. Specific suggestions are made for implementing them. Adoption of the critically evaluated oscillator strengths by the NBS is recommended as a standard. Many references are given to data sources, both physical and astronomical. Suggestions are made for avoiding the most common sources of error in abundance work. (author)
Variations of the high-level Balmer line spectrum of the helium-strong star σ Orionis E
Smith, M. A.; Bohlender, D. A.
2007-12-01
Using the high-level Balmer lines and continuum, we trace the density structure of two magnetospheric disk segments of the prototypical Bp star σ Orionis E (B2p) as these segments occult portions of the star during the rotational cycle. High-resolution spectra of the Balmer lines ≥H9 and Balmer edge were obtained on seven nights in January-February 2007 at an average sampling of 0.01 cycles. We measured equivalent width variations due to the star occultations by two disk segments 0.4 cycles apart and constructed differential spectra of the migrations of the corresponding absorptions across the Balmer line profiles. We first estimated the rotational and magnetic obliquity angles. We then simulated the observed Balmer jump variation using the model atmosphere codes synspec/circus and evaluated the disk geometry and gas thermodynamics. We find that the two occultations are caused by two disk segments. The first of these transits quickly, indicating that the segment resides in a range of distances, perhaps 2.5-6 R*, from the star. The second consists of a more slowly moving segment situated closer to the surface and causing two semi-resolved absorbing maxima. During its transit this segment brushes across the star's “lower” limb. Judging from the line visibility up to H23-H24 during the occultations, both disk segments have mean densities near 1012 cm-3 and are opaque in the lines and continuum. They have semiheights less than 1/2 R*, and their temperatures are near 10 500 K and 12 000 K, respectively. In all, the disks of Bp stars have a much more complicated geometry than has been anticipated, as evidenced by their (sometimes) non-coplanarity, de-centerness, and from star to star, differences in disk height. Based on observations obtained at the the Dominion Astrophysical Observatory, Herzberg Institute of Astrophysics, National Research Council of Canada.
BP180 dysfunction triggers spontaneous skin inflammation in mice.
Zhang, Yang; Hwang, Bin-Jin; Liu, Zhen; Li, Ning; Lough, Kendall; Williams, Scott E; Chen, Jinbo; Burette, Susan W; Diaz, Luis A; Su, Maureen A; Xiao, Shengxiang; Liu, Zhi
2018-06-04
BP180, also known as collagen XVII, is a hemidesmosomal component and plays a key role in maintaining skin dermal/epidermal adhesion. Dysfunction of BP180, either through genetic mutations in junctional epidermolysis bullosa (JEB) or autoantibody insult in bullous pemphigoid (BP), leads to subepidermal blistering accompanied by skin inflammation. However, whether BP180 is involved in skin inflammation remains unknown. To address this question, we generated a BP180-dysfunctional mouse strain and found that mice lacking functional BP180 (termed Δ NC16A ) developed spontaneous skin inflammatory disease, characterized by severe itch, defective skin barrier, infiltrating immune cells, elevated serum IgE levels, and increased expression of thymic stromal lymphopoietin (TSLP). Severe itch is independent of adaptive immunity and histamine, but dependent on increased expression of TSLP by keratinocytes. In addition, a high TSLP expression is detected in BP patients. Our data provide direct evidence showing that BP180 regulates skin inflammation independently of adaptive immunity, and BP180 dysfunction leads to a TSLP-mediated itch. The newly developed mouse strain could be a model for elucidation of disease mechanisms and development of novel therapeutic strategies for skin inflammation and BP180-related skin conditions.
International Nuclear Information System (INIS)
Tinsley, B.M.
1975-01-01
A variety of empirical lines of evidence is assembled on the masses and stellar population types of stars that trigger supernova (SN) explosions. The main theoretical motivations are to determine whether type I supernovae (SN I) can have massive precursors, and whether there is an interval of stellar mass, between the masses of precursors of pulsars and white dwarfs, that is disrupted by carbon detonation. Statistical and other uncertainties in the empirical arguments are given particular attention, and are found to be more important than generally realized. Relatively secure conclusions include the following. Statistics of stellar birthrates, SN, pulsars, and SN remnants in the Galaxy show that SN II (or all SN) could arise from stars with masses greater than M/sub s/ where M/sub s/ approximately 49 to 12 M solar mass; the precursor mass range cannot be more closely defined from present data; nor can it be said whether all SN leave pulsars and/or extended radio remnants. Several methods of estimating the masses of stars that become white dwarfs are consistent with a lower limit, M/sub s/ greater than or equal to 5 M solar mass, so carbon detonation may indeed be avoided, although this conclusion is not secure. Studies of the properties of galaxies in which SN occur, and their distributions within galaxies, support the usual views that SN I have low-mass precursors (less than or equal to 5 M solar mass and typically less than or equal to 1 M solar mass) and SN II have massive precursors (greater than or equal to 5 M solar mass); the restriction of known SN II to Sc and Sb galaxies, to date, is shown to be consistent, statistically, with massive stars in other galaxies also dying as SN II. Possible implications of the peculiarities of some SN-producing galaxies are discussed. Suggestions are made for observational and theoretical studies that would help answer important remaining questions on the nature of SN precursors
BP - bisnis põhjas? / Erik Aru
Aru, Erik
2010-01-01
Seoses Mehhiko lahe naftareostusega ootab BP-d kuni 21 mld. dollari suurune trahv, kahjude hüvitamiseks peab BP müüma osa oma varast. Ekspertide hinnangul tähendavad Mehhiko lahe sündmused suuri muutusi kogu naftaäris
Multivalent display of the antimicrobial peptides BP100 and BP143
Directory of Open Access Journals (Sweden)
Imma Güell
2012-12-01
Full Text Available Carbohydrates are considered as promising templates for the display of multiple copies of antimicrobial peptides. Herein, we describe the design and synthesis of chimeric structures containing two or four copies of the antimicrobial peptides KKLFKKILKYL-NH2 (BP100 and KKLfKKILKYL-NH2 (BP143 attached to the carbohydrate template cyclodithioerythritol (cDTE or α-D-galactopyranoside (Galp. The synthesis involved the preparation of the corresponding peptide aldehyde followed by coupling to an aminooxy-functionalized carbohydrate template. After purification, the multivalent display systems were obtained in high purities (90–98% and in good yields (42–64%. These compounds were tested against plant and human pathogenic bacteria and screened for their cytotoxicity on eukaryotic cells. They showed lower MIC values than the parent peptides against the bacteria analyzed. In particular, the carbopeptides derived from cDTE and Galp, which contained two or four copies of BP100, respectively, were 2- to 8-fold more active than the monomeric peptide against the phytopathogenic bacteria. These results suggest that preassembling antimicrobial peptides to multimeric structures is not always associated with a significant improvement of the activity. In contrast, the carbopeptides synthesized were active against human red blood cells pointing out that peptide preassembly is critical for the hemolytic activity. Notably, peptide preassembly resulted in an enhanced bactericidal effect.
Fluorine and Sodium in C-rich Low-metallicity Stars
Lucatello, Sara; Masseron, Thomas; Johnson, Jennifer A.; Pignatari, Marco; Herwig, Falk
2011-03-01
We present the N, O, F, and Na abundance and 12C/13C isotopic ratio measurements or upper limits for a sample of 10 C-rich, metal-poor giant stars: 8 enhanced in s-process (CEMP-s) elements and 2 poor in n-capture elements (CEMP-no). The abundances are derived from IR, K-band, high-resolution CRIRES@VLT obtained spectra. The metallicity of our sample ranges from [Fe/H] = -3.4 to -1.3. F abundance could be measured only in two CEMP-s stars. With [F/Fe] = 0.64, one is mildly F-overabundant, while the other is F-rich, at [F/Fe] = 1.44. For the remaining eight objects, including both CEMP-no stars in our sample, only upper limits on F abundance could be placed. Our measurements and upper limits show that there is a spread in the [F/C+N] ratio in CEMP-s stars as predicted by theory. Predictions from nucleosynthetic models for low-mass, low-metallicity asymptotic giant branch (AGB) stars account for the derived F abundances, while the upper limits on F content derived for most of the stars are lower than the predicted values. The measured Na content is accounted for by AGB models in the 1.25-1.75 M sun range, confirming that the stars responsible for the peculiar abundance pattern observed in CEMP-s stars are low-mass, low-metallicity AGB stars in agreement with the most accepted astrophysical scenario. We conclude that the mechanism of F production in current state-of-the-art low-metallicity low-mass AGB models needs further scrutiny and that F measurements in a larger number of metal-poor stars are needed to better constrain the models. Based on observations made with ESO Telescopes at Paranal Observatories under program ID 080.D-0606A. This publication makes use of data products from the Two Micron All Sky Survey, which is a joint project of the University of Massachusetts and the Infrared Processing and Analysis Center, funded by the National Aeronautics and Space Administration and the National Science Foundation.
BP report of the business year 1979
Energy Technology Data Exchange (ETDEWEB)
1980-01-01
The paper presents a survey about the development of the energy- and petroleum market during the year 1979. A commentary of the German BP A.G. and its activities is given here: personnel- and management policy, exploration, supply, refining and distribution, investigation, and development. After a survey about the business situation of the German BP A.G. the detailed annual balance sheets of 1979 of the German BP and of the whole enterprise are given.
Face recognition based on improved BP neural network
Directory of Open Access Journals (Sweden)
Yue Gaili
2017-01-01
Full Text Available In order to improve the recognition rate of face recognition, face recognition algorithm based on histogram equalization, PCA and BP neural network is proposed. First, the face image is preprocessed by histogram equalization. Then, the classical PCA algorithm is used to extract the features of the histogram equalization image, and extract the principal component of the image. And then train the BP neural network using the trained training samples. This improved BP neural network weight adjustment method is used to train the network because the conventional BP algorithm has the disadvantages of slow convergence, easy to fall into local minima and training process. Finally, the BP neural network with the test sample input is trained to classify and identify the face images, and the recognition rate is obtained. Through the use of ORL database face image simulation experiment, the analysis results show that the improved BP neural network face recognition method can effectively improve the recognition rate of face recognition.
Burnside, Rachel D; Pasion, Romela; Mikhail, Fady M; Carroll, Andrew J; Robin, Nathaniel H; Youngs, Erin L; Gadi, Inder K; Keitges, Elizabeth; Jaswaney, Vikram L; Papenhausen, Peter R; Potluri, Venkateswara R; Risheg, Hiba; Rush, Brooke; Smith, Janice L; Schwartz, Stuart; Tepperberg, James H; Butler, Merlin G
2011-10-01
The proximal long arm of chromosome 15 has segmental duplications located at breakpoints BP1-BP5 that mediate the generation of NAHR-related microdeletions and microduplications. The classical Prader-Willi/Angelman syndrome deletion is flanked by either of the proximal BP1 or BP2 breakpoints and the distal BP3 breakpoint. The larger Type I deletions are flanked by BP1 and BP3 in both Prader-Willi and Angelman syndrome subjects. Those with this deletion are reported to have a more severe phenotype than individuals with either Type II deletions (BP2-BP3) or uniparental disomy 15. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes that are not imprinted. Reports of mutations or disturbed expression of these genes appear to impact behavioral and neurological function in affected individuals. Recently, reports of deletions and duplications flanked by BP1 and BP2 suggest an association with speech and motor delays, behavioral problems, seizures, and autism. We present a large cohort of subjects with copy number alteration of BP1 to BP2 with common phenotypic features. These include autism, developmental delay, motor and language delays, and behavioral problems, which were present in both cytogenetic groups. Parental studies demonstrated phenotypically normal carriers in several instances, and mildly affected carriers in others, complicating phenotypic association and/or causality. Possible explanations for these results include reduced penetrance, altered gene dosage on a particular genetic background, or a susceptibility region as reported for other areas of the genome implicated in autism and behavior disturbances.
Profile of NF-κBp(65/NFκBp50) among prostate specific antigen sera levels in prostatic pathologies.
Bouraoui, Y; Ben Jemaa, A; Rodriguez, G; Ben Rais, N; Fraile, B; Paniagua, R; Sellemi, S; Royuela, M; Oueslati, R
2012-10-01
The aim of this work was to characterise the immunoexpression of NF-κB (p50/p65) in human prostatic pathologies and to study its profiles of activation among sera prostate specific antigen antigen (PSA) according the three groups: 0-4ng/mL, 4-20ng/mL and >20ng/mL. Twenty-four men with benign prostate hyperplasia (BPH); 19 men with prostate cancer (PC) and five men with normal prostates (NP). Immunohistochemical and western blot analysis was performed. Serum levels of PSA were assayed by immulite autoanalyser. In BPH and PC samples, immunoexpressions were observed for NF-κBp65 and NF-κBp50; while in NP samples, only were detected NF-κBp50. PC samples showed immunoreactions to NF-κBp65 and NF-κBp50 more intense (respectively 24.18±0.67 and 28.23±2.01) than that observed in BPH samples (respectively18.46±2.04 and 18.66±1.59) with special localisation in the nucleus. Different profiles of NF-κBp65 immunoexpressions were observed and BPH patients with sera PSA levels between 0-4ng/mL presented a significant weak percentage compared to BPH patients with sera PSA levels between 4-20ng/mL and >20ng/mL. No immunoreactions to NF-κBp65 were observed in PC patients with sera PSA levels between 4-20ng/mL. The sensibility of both NF-κB and PSA to inflammation allowed confirming the relationship between these two molecules and its involvement in prostatic diseases progression (inflammatory and neoplasic). Copyright © 2011 Elsevier Masson SAS. All rights reserved.
Supernovae from massive stars with extended tenuous envelopes
Dessart, Luc; Yoon, Sung-Chul; Livne, Eli; Waldman, Roni
2018-04-01
Massive stars with a core-halo structure are interesting objects for stellar physics and hydrodynamics. Using simulations for stellar evolution, radiation hydrodynamics, and radiative transfer, we study the explosion of stars with an extended and tenuous envelope (i.e. stars in which 95% of the mass is contained within 10% or less of the surface radius). We consider both H-rich supergiant and He-giant progenitors resulting from close-binary evolution and dying with a final mass of 2.8-5 M⊙. An extended envelope causes the supernova (SN) shock to brake and a reverse shock to form, sweeping core material into a dense shell. The shock-deposited energy, which suffers little degradation from expansion, is trapped in ejecta layers of moderate optical depth, thereby enhancing the SN luminosity at early times. With the delayed 56Ni heating, we find that the resulting optical and near-IR light curves all exhibit a double-peak morphology. We show how an extended progenitor can explain the blue and featureless optical spectra of some Type IIb and Ib SNe. The dense shell formed by the reverse shock leads to line profiles with a smaller and near-constant width. This ejecta property can explain the statistically narrower profiles of Type IIb compared to Type Ib SNe, as well as the peculiar Hα profile seen in SN 1993J. At early times, our He-giant star explosion model shows a high luminosity, a blue colour, and featureless spectra reminiscent of the Type Ib SN 2008D, suggesting a low-mass progenitor.
Personal peculiarities in patients with middle cerebral artery infarction
Directory of Open Access Journals (Sweden)
Antonova N.A.
2013-12-01
Full Text Available The purpose of the work is to reveal personal peculiarities in patients who have suffered middle cerebral artery infarction. Material and Methods. 39 patients with middle cerebral artery infarction have been under the study. All patients have received clinical instrumental inspection (neurologic survey, duplex ultrasound investigation of vessels of neck, head and brain, the research CT or MRT. Personal peculiarities have been studied by "The standard multiple-factor method of research of the personality" (PITCHES. Results. Psychological reactions for the disease have been determined. They include hypochondria, depression, psychasthenia and anxiety. Conclusion. Personal peculiarities in patients suffered from middle cerebral artery infarction may be characterized by the appearance of psychological response to the psychotraumatic situation. Therefore it is necessary to give psychotherapeutic aid.
Energy Technology Data Exchange (ETDEWEB)
Cheng, Kwang-Ping; Johnson, Dustin M.; Tarbell, Erik S.; Romo, Christopher A.; Prabhaker, Arvind [Cal. State Univ., Fullerton, Fullerton, CA (United States); Neff, James E.; Steele, Patricia A. [College of Charleston, Charleston, SC (United States); Gray, Richard O. [Appalachian State Univ., Boone, NC (United States); Corbally, Christopher J. [Vatican Observatory, Tucson, AZ (United States)
2016-04-15
Lambda Boo-type stars are a group of late B to early F-type Population I dwarfs that show mild to extreme deficiencies of iron-peak elements (up to 2 dex), but their C, N, O, and S abundances are near solar. This intriguing stellar class has recently regained the spotlight because of the directly imaged planets around a confirmed Lambda Boo star, HR 8799, and a suggested Lambda Boo star, Beta Pictoris. The discovery of a giant asteroid belt around Vega, another possible Lambda Boo star, also suggests hidden planets. The possible link between Lambda Boo stars and planet-bearing stars motivates us to study Lambda Boo stars systematically. Since the peculiar nature of the prototype Lambda Boötis was first noticed in 1943, Lambda Boo candidates published in the literature have been selected using widely different criteria. In order to determine the origin of Lambda Boo stars’ unique abundance pattern and to better discriminate between theories explaining the Lambda Boo phenomenon, a consistent working definition of Lambda Boo stars is needed. We have re-evaluated all published Lambda Boo candidates and their available ultraviolet and visible spectra. In this paper, using observed and synthetic spectra, we explore the physical basis for the classification of Lambda Boo stars, and develop quantitative criteria that discriminate metal-poor stars from bona fide Lambda Boo stars. Based on these stricter Lambda Boo classification criteria, we conclude that neither Beta Pictoris nor Vega should be classified as Lambda Boo stars.
International Nuclear Information System (INIS)
Cheng, Kwang-Ping; Johnson, Dustin M.; Tarbell, Erik S.; Romo, Christopher A.; Prabhaker, Arvind; Neff, James E.; Steele, Patricia A.; Gray, Richard O.; Corbally, Christopher J.
2016-01-01
Lambda Boo-type stars are a group of late B to early F-type Population I dwarfs that show mild to extreme deficiencies of iron-peak elements (up to 2 dex), but their C, N, O, and S abundances are near solar. This intriguing stellar class has recently regained the spotlight because of the directly imaged planets around a confirmed Lambda Boo star, HR 8799, and a suggested Lambda Boo star, Beta Pictoris. The discovery of a giant asteroid belt around Vega, another possible Lambda Boo star, also suggests hidden planets. The possible link between Lambda Boo stars and planet-bearing stars motivates us to study Lambda Boo stars systematically. Since the peculiar nature of the prototype Lambda Boötis was first noticed in 1943, Lambda Boo candidates published in the literature have been selected using widely different criteria. In order to determine the origin of Lambda Boo stars’ unique abundance pattern and to better discriminate between theories explaining the Lambda Boo phenomenon, a consistent working definition of Lambda Boo stars is needed. We have re-evaluated all published Lambda Boo candidates and their available ultraviolet and visible spectra. In this paper, using observed and synthetic spectra, we explore the physical basis for the classification of Lambda Boo stars, and develop quantitative criteria that discriminate metal-poor stars from bona fide Lambda Boo stars. Based on these stricter Lambda Boo classification criteria, we conclude that neither Beta Pictoris nor Vega should be classified as Lambda Boo stars
HUBBLE CAPTURES THE HEART OF STAR BIRTH
2002-01-01
NASA Hubble Space Telescope's Wide Field and Planetary Camera 2 (WFPC2) has captured a flurry of star birth near the heart of the barred spiral galaxy NGC 1808. On the left are two images, one superimposed over the other. The black-and-white picture is a ground-based view of the entire galaxy. The color inset image, taken with the Hubble telescope's Wide Field and Planetary Camera 2 (WFPC2), provides a close-up view of the galaxy's center, the hotbed of vigorous star formation. The ground-based image shows that the galaxy has an unusual, warped shape. Most spiral galaxies are flat disks, but this one has curls of dust and gas at its outer spiral arms (upper right-hand corner and lower left-hand corner). This peculiar shape is evidence that NGC 1808 may have had a close interaction with another nearby galaxy, NGC 1792, which is not in the picture Such an interaction could have hurled gas towards the nucleus of NGC 1808, triggering the exceptionally high rate of star birth seen in the WFPC2 inset image. The WFPC2 inset picture is a composite of images using colored filters that isolate red and infrared light as well as light from glowing hydrogen. The red and infrared light (seen as yellow) highlight older stars, while hydrogen (seen as blue) reveals areas of star birth. Colors were assigned to this false-color image to emphasize the vigorous star formation taking place around the galaxy's center. NGC 1808 is called a barred spiral galaxy because of the straight lines of star formation on both sides of the bright nucleus. This star formation may have been triggered by the rotation of the bar, or by matter which is streaming along the bar towards the central region (and feeding the star burst). Filaments of dust are being ejected from the core into a faint halo of stars surrounding the galaxy's disk (towards the upper left corner) by massive stars that have exploded as supernovae in the star burst region. The portion of the galaxy seen in this 'wide-field' image is
Zhang, Yanghai; Cui, Yang; Zhang, Xuelian; Wang, Yimin; Gao, Jiayang; Yu, Ting; Lv, Xiaoyan; Pan, Chuanying
2018-05-31
Steroidogenic acute regulatory protein (StAR), primarily expressed in Leydig cells (LCs) in the mammalian testes, is essential for testosterone biosynthesis and male fertility. However, no previous reports have explored the expression profiles, alternative splicing and genetic variations of StAR gene in pig. The aim of current study was to explore the expression profiles in different tissues and different types of testicular cells (LCs; spermatogonial stem cells, SSCs; Sertoli cells, SCs), to identify different splice variants and their expression levels, as well as to detect the indel polymorphism in pig StAR gene. Expression analysis results revealed that StAR was widely expressed in all tested tissues and the expression level in testis was significantly higher than that in other tissues (P StAR mRNA expression level was significantly higher in LCs than others (P StAR-a, StAR-b and StAR-c, were first found in pig. Further study showed StAR-a was highly expressed in both testis and LCs when compared with other variants (P StAR-a was the primary variant at StAR gene post-transcription and may facilitate the combination and transportation of cholesterol with StAR. In addition, a 5-bp duplicated deletion (NC_010457.5:g.5524-5528 delACTTG) was verified in the porcine StAR gene, which was closely related to male testicular morphology traits (P StAR gene might be a positive allele. Briefly, the current findings suggest that StAR and StAR-a play imperative roles in male fertility and the 5-bp indel can be a potential DNA marker for the marker-assisted selection in boar. Copyright © 2018 Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Antoci, V.; Houdek, G.; Kjeldsen, H.; Trampedach, R.; Arentoft, T. [Stellar Astrophysics Centre, Aarhus University, Ny Munkegade 120, DK-8000 Aarhus C (Denmark); Cunha, M. [Centro de Astrofísca e Faculdade de Ciências, Universidade do Porto, Rua das Estrelas 4150-762 (Portugal); Handler, G. [Copernicus Astronomical Center, Bartycka 18, 00-716 Warsaw (Poland); Lüftinger, T. [Institute for Astronomy, University of Vienna, Türkenschanzstr. 17, A-1180 Vienna (Austria); Murphy, S., E-mail: antoci@phys.au.dk [Sydney Institute for Astronomy (SIfA), School of Physics, University of Sydney, Sydney, NSW 2006 (Australia)
2014-12-01
HD 187547 was the first candidate that led to the suggestion that solar-like oscillations are present in δ Scuti stars. Longer observations, however, show that the modes interpreted as solar-like oscillations have either very long mode lifetimes, longer than 960 days, or are coherent. These results are incompatible with the nature of 'pure' stochastic excitation as observed in solar-like stars. Nonetheless, one point is certain: the opacity mechanism alone cannot explain the oscillation spectrum of HD 187547. Here we present new theoretical investigations showing that convection dynamics can intrinsically excite coherent pulsations in the chemically peculiar δ Scuti star HD 187547. More precisely, it is the perturbations of the mean Reynold stresses (turbulent pressure) that drives the pulsations and the excitation takes place predominantly in the hydrogen ionization zone.
RECENT STAR FORMATION IN THE LEADING ARM OF THE MAGELLANIC STREAM
Energy Technology Data Exchange (ETDEWEB)
Casetti-Dinescu, Dana I. [Department of Physics, Southern Connecticut State University, 501 Crescent Street, New Haven, CT 06515 (United States); Bidin, Christian Moni [Instituto de Astronomía, Universidad Católica del Norte, Avenue Angamos 0610, Antofagasta (Chile); Girard, Terrence M.; Van Altena, William F. [Astronomy Department, Yale University, 260 Whitney Avenue, New Haven, CT 06511 (United States); Méndez, Réne A. [Departmento de Astronomía, Universidad de Chile, Casilla 36-D, Santiago (Chile); Vieira, Katherine [Centro de Investigaciones de Astronomía, Apartado Postal 264, Mérida 5101-A (Venezuela, Bolivarian Republic of); Korchagin, Vladimir I., E-mail: casettid1@southernct.edu, E-mail: dana.casetti@yale.edu, E-mail: terry.girard@yale.edu, E-mail: william.vanaltena@yale.edu, E-mail: chr.moni.bidin@gmail.com, E-mail: ramendez.uchile@gmail.com, E-mail: kvieira@cida.ve, E-mail: vkorchagin@sfedu.ru [Institute of Physics, Southern Federal University, Stachki Street 124, 344090, Rostov-on-Don (Russian Federation)
2014-04-01
Strongly interacting galaxies undergo a short-lived but dramatic phase of evolution characterized by enhanced star formation, tidal tails, bridges, and other morphological peculiarities. The nearest example of a pair of interacting galaxies is the Magellanic Clouds, whose dynamical interaction produced the gaseous features known as the Magellanic Stream trailing the pair's orbit about the Galaxy, the bridge between the Clouds, and the leading arm (LA), a wide and irregular feature leading the orbit. Young, newly formed stars in the bridge are known to exist, giving witness to the recent interaction between the Clouds. However, the interaction of the Clouds with the Milky Way (MW) is less well understood. In particular, the LA must have a tidal origin; however, no purely gravitational model is able to reproduce its morphology and kinematics. A hydrodynamical interaction with the gaseous hot halo and disk of the Galaxy is plausible as suggested by some models and supporting neutral hydrogen (H I) observations. Here we show for the first time that young, recently formed stars exist in the LA, indicating that the interaction between the Clouds and our Galaxy is strong enough to trigger star formation in certain regions of the LA—regions in the outskirts of the MW disk (R ∼ 18 kpc), far away from the Clouds and the bridge.
RECENT STAR FORMATION IN THE LEADING ARM OF THE MAGELLANIC STREAM
International Nuclear Information System (INIS)
Casetti-Dinescu, Dana I.; Bidin, Christian Moni; Girard, Terrence M.; Van Altena, William F.; Méndez, Réne A.; Vieira, Katherine; Korchagin, Vladimir I.
2014-01-01
Strongly interacting galaxies undergo a short-lived but dramatic phase of evolution characterized by enhanced star formation, tidal tails, bridges, and other morphological peculiarities. The nearest example of a pair of interacting galaxies is the Magellanic Clouds, whose dynamical interaction produced the gaseous features known as the Magellanic Stream trailing the pair's orbit about the Galaxy, the bridge between the Clouds, and the leading arm (LA), a wide and irregular feature leading the orbit. Young, newly formed stars in the bridge are known to exist, giving witness to the recent interaction between the Clouds. However, the interaction of the Clouds with the Milky Way (MW) is less well understood. In particular, the LA must have a tidal origin; however, no purely gravitational model is able to reproduce its morphology and kinematics. A hydrodynamical interaction with the gaseous hot halo and disk of the Galaxy is plausible as suggested by some models and supporting neutral hydrogen (H I) observations. Here we show for the first time that young, recently formed stars exist in the LA, indicating that the interaction between the Clouds and our Galaxy is strong enough to trigger star formation in certain regions of the LA—regions in the outskirts of the MW disk (R ∼ 18 kpc), far away from the Clouds and the bridge
The preliminary study on peculiar flavor from irradiated dried duck
International Nuclear Information System (INIS)
Li Zongju; Chen Zongdao; Xu Denyi
1992-01-01
Peculiar flavor may be induced from irradiative preservation of meat with higher dose. The study on the irradiation of dried duck indicated that peculiar flavor is produced by a threshold of 1.5 kGy and intensifies with the increase of dose. The flavor primarily comes from muscle of dried duck especially from its water soluble protein. With the increase of dose, volatile carbonyl compounds, amines and sulfur compounds increased significantly. Paper chromatography analysis shows that two new volatile carbonyl compounds (R f =0.23 and 0.28) and a new volatile amine-propamine are induced by irradiation. This compounds may be the source of peculiar flavor in irradiated dried duck
Atmospheric Composition of Weak G Band Stars: CNO and Li Abundances
Adamczak, Jens; Lambert, David L.
2013-03-01
We determined the chemical composition of a large sample of weak G band stars—a rare class of G and K giants of intermediate mass with unusual abundances of C, N, and Li. We have observed 24 weak G band stars with the 2.7 m Harlan J. Smith Telescope at the McDonald Observatory and derived spectroscopic abundances for C, N, O, and Li, as well as for selected elements from Na-Eu. The results show that the atmospheres of weak G band stars are highly contaminated with CN-cycle products. The C underabundance is about a factor of 20 larger than for normal giants and the 12C/13C ratio approaches the CN-cycle equilibrium value. In addition to the striking CN-cycle signature the strong N overabundance may indicate the presence of partially ON-cycled material in the atmospheres of the weak G band stars. The exact mechanism responsible for the transport of the elements to the surface has yet to be identified but could be induced by rapid rotation of the main sequence progenitors of the stars. The unusually high Li abundances in some of the stars are an indicator for Li production by the Cameron-Fowler mechanism. A quantitative prediction of a weak G band star's Li abundance is complicated by the strong temperature sensitivity of the mechanism and its participants. In addition to the unusual abundances of CN-cycle elements and Li, we find an overabundance of Na that is in accordance with the NeNa chain running in parallel with the CN cycle. Apart from these peculiarities, the element abundances in a weak G band star's atmosphere are consistent with those of normal giants.
ATMOSPHERIC COMPOSITION OF WEAK G BAND STARS: CNO AND Li ABUNDANCES
International Nuclear Information System (INIS)
Adamczak, Jens; Lambert, David L.
2013-01-01
We determined the chemical composition of a large sample of weak G band stars—a rare class of G and K giants of intermediate mass with unusual abundances of C, N, and Li. We have observed 24 weak G band stars with the 2.7 m Harlan J. Smith Telescope at the McDonald Observatory and derived spectroscopic abundances for C, N, O, and Li, as well as for selected elements from Na-Eu. The results show that the atmospheres of weak G band stars are highly contaminated with CN-cycle products. The C underabundance is about a factor of 20 larger than for normal giants and the 12 C/ 13 C ratio approaches the CN-cycle equilibrium value. In addition to the striking CN-cycle signature the strong N overabundance may indicate the presence of partially ON-cycled material in the atmospheres of the weak G band stars. The exact mechanism responsible for the transport of the elements to the surface has yet to be identified but could be induced by rapid rotation of the main sequence progenitors of the stars. The unusually high Li abundances in some of the stars are an indicator for Li production by the Cameron-Fowler mechanism. A quantitative prediction of a weak G band star's Li abundance is complicated by the strong temperature sensitivity of the mechanism and its participants. In addition to the unusual abundances of CN-cycle elements and Li, we find an overabundance of Na that is in accordance with the NeNa chain running in parallel with the CN cycle. Apart from these peculiarities, the element abundances in a weak G band star's atmosphere are consistent with those of normal giants.
Smith, Nathan; Götberg, Ylva; de Mink, Selma E.
2018-03-01
Recent surveys of the Magellanic Clouds have revealed a subtype of Wolf-Rayet (WR) star with peculiar properties. WN3/O3 spectra exhibit both WR-like emission and O3 V-like absorption - but at lower luminosity than O3 V or WN stars. We examine the projected spatial distribution of WN3/O3 stars in the Large Magellanic Cloud as compared to O-type stars. Surprisingly, WN3/O3 stars are among the most isolated of all classes of massive stars; they have a distribution similar to red supergiants dominated by initial masses of 10-15 M⊙, and are far more dispersed than classical WR stars or luminous blue variables. Their lack of association with clusters of O-type stars suggests strongly that WN3/O3 stars are not the descendants of single massive stars (30 M⊙ or above). Instead, they are likely products of interacting binaries at lower initial mass (10-18 M⊙). Comparison with binary models suggests a probable origin with primaries in this mass range that were stripped of their H envelopes through non-conservative mass transfer by a low-mass secondary. We show that model spectra and positions on the Hertzsprung-Russell diagram for binary-stripped stars are consistent with WN3/O3 stars. Monitoring radial velocities with high-resolution spectra can test for low-mass companions or runaway velocities. With lower initial mass and environments that avoid very massive stars, the WN3/O3 stars fit expectations for progenitors of Type Ib and possibly Type Ibn supernovae.
Sacchi, E.; Cignoni, M.; Aloisi, A.; Tosi, M.; Calzetti, D.; Lee, J. C.; Adamo, A.; Annibali, F.; Dale, D. A.; Elmegreen, B. G.; Gouliermis, D. A.; Grasha, K.; Grebel, E. K.; Hunter, D. A.; Sabbi, E.; Smith, L. J.; Thilker, D. A.; Ubeda, L.; Whitmore, B. C.
2018-04-01
We present a detailed study of the Magellanic irregular galaxy NGC 4449 based on both archival and new photometric data from the Legacy Extragalactic UV Survey, obtained with the Hubble Space Telescope Advanced Camera for Surveys and Wide Field Camera 3. Thanks to its proximity (D = 3.82 ± 0.27 Mpc), we reach stars 3 mag fainter than the tip of the red giant branch in the F814W filter. The recovered star formation history (SFH) spans the whole Hubble time, but due to the age–metallicity degeneracy of the red giant branch stars, it is robust only over the lookback time reached by our photometry, i.e., ∼3 Gyr. The most recent peak of star formation (SF) is around 10 Myr ago. The average surface density SF rate over the whole galaxy lifetime is 0.01 M ⊙ yr‑1 kpc‑2. From our study, it emerges that NGC 4449 has experienced a fairly continuous SF regime in the last 1 Gyr, with peaks and dips whose SF rates differ only by a factor of a few. The very complex and disturbed morphology of NGC 4449 makes it an interesting galaxy for studies of the relationship between interactions and starbursts, and our detailed and spatially resolved analysis of its SFH does indeed provide some hints on the connection between these two phenomena in this peculiar dwarf galaxy. Based on observations obtained with the NASA/ESA Hubble Space Telescope at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy under NASA contract NAS 5-26555.
Fundamental parameters of He-weak and He-strong stars
Cidale, L. S.; Arias, M. L.; Torres, A. F.; Zorec, J.; Frémat, Y.; Cruzado, A.
2007-06-01
Context: He-weak and He-strong stars are chemically peculiar AB objects whose He lines are anomalously weak or strong for their MK spectral type. The determination of fundamental parameters for these stars is often more complex than for normal stars due to their abundance anomalies. Aims: We discuss the determination of fundamental parameters: effective temperature, surface gravity, and visual and bolometric absolute magnitudes of He-weak and He-strong stars. We compare our values with those derived independently from methods based on photometry and model fitting. Methods: We carried out low resolution spectroscopic observations in the wavelength range 3400-4700 Å of 20 He-weak and 8 He-strong stars to determine their fundamental parameters by means of the Divan-Chalonge-Barbier (BCD) spectrophotometric system. This system is based on the measurement of the continuum energy distribution around the Balmer discontinuity (BD). For a few He-weak stars we also estimate the effective temperatures and the angular diameters by integrating absolute fluxes observed over a wide spectral range. Non-LTE model calculations are carried out to study the influence of the He/H abundance ratio on the emergent radiation of He-strong stars and on their T_eff determination. Results: We find that the effective temperatures, surface gravities and bolometric absolute magnitudes of He-weak stars estimated with the BCD system and the integrated flux method are in good agreement between each other, and they also agree with previous determinations based on several different methods. The mean discrepancy between the visual absolute magnitudes derived using the hipparcos parallaxes and the BCD values is on average ±0.3 mag for He-weak stars, while it is ±0.5 mag for He-strong stars. For He-strong stars, we note that the BCD calibration, based on stars in the solar environment, leads to overestimated values of T_eff. By means of model atmosphere calculations with enhanced He/H abundance ratios
Assembly of human C-terminal binding protein (CtBP) into tetramers.
Bellesis, Andrew G; Jecrois, Anne M; Hayes, Janelle A; Schiffer, Celia A; Royer, William E
2018-06-08
C-terminal binding protein 1 (CtBP1) and CtBP2 are transcriptional coregulators that repress numerous cellular processes, such as apoptosis, by binding transcription factors and recruiting chromatin-remodeling enzymes to gene promoters. The NAD(H)-linked oligomerization of human CtBP is coupled to its co-transcriptional activity, which is implicated in cancer progression. However, the biologically relevant level of CtBP assembly has not been firmly established; nor has the stereochemical arrangement of the subunits above that of a dimer. Here, multi-angle light scattering (MALS) data established the NAD + - and NADH-dependent assembly of CtBP1 and CtBP2 into tetramers. An examination of subunit interactions within CtBP1 and CtBP2 crystal lattices revealed that both share a very similar tetrameric arrangement resulting from assembly of two dimeric pairs, with specific interactions probably being sensitive to NAD(H) binding. Creating a series of mutants of both CtBP1 and CtBP2, we tested the hypothesis that the crystallographically observed interdimer pairing stabilizes the solution tetramer. MALS data confirmed that these mutants disrupt both CtBP1 and CtBP2 tetramers, with the dimer generally remaining intact, providing the first stereochemical models for tetrameric assemblies of CtBP1 and CtBP2. The crystal structure of a subtle destabilizing mutant suggested that small structural perturbations of the hinge region linking the substrate- and NAD-binding domains are sufficient to weaken the CtBP1 tetramer. These results strongly suggest that the tetramer is important in CtBP function, and the series of CtBP mutants reported here can be used to investigate the physiological role of the tetramer. © 2018 Bellesis et al.
The preliminary study on peculiar flavor from irradiated dried duck
Energy Technology Data Exchange (ETDEWEB)
Zongju, Li; Zongdao, Chen; Denyi, Xu [Southwest Agricultural Univ., Chongqing, SC (China)
1992-11-01
Peculiar flavor may be induced from irradiative preservation of meat with higher dose. The study on the irradiation of dried duck indicated that peculiar flavor is produced by a threshold of 1.5 kGy and intensifies with the increase of dose. The flavor primarily comes from muscle of dried duck especially from its water soluble protein. With the increase of dose, volatile carbonyl compounds, amines and sulfur compounds increased significantly. Paper chromatography analysis shows that two new volatile carbonyl compounds (R[sub f] =0.23 and 0.28) and a new volatile amine-propamine are induced by irradiation. This compounds may be the source of peculiar flavor in irradiated dried duck.
DEFF Research Database (Denmark)
Antoci, V.; Cunha, M.; Houdek, G.
2014-01-01
are incompatible with the nature of "pure" stochastic excitation as observed in solar-like stars. Nonetheless, one point is certain: the opacity mechanism alone cannot explain the oscillation spectrum of HD 187547. Here we present new theoretical investigations showing that convection dynamics can intrinsically......HD 187547 was the first candidate that led to the suggestion that solar-like oscillations are present in δ Scuti stars. Longer observations, however, show that the modes interpreted as solar-like oscillations have either very long mode lifetimes, longer than 960 days, or are coherent. These results...... excite coherent pulsations in the chemically peculiar δ Scuti star HD 187547. More precisely, it is the perturbations of the mean Reynold stresses (turbulent pressure) that drives the pulsations and the excitation takes place predominantly in the hydrogen ionization zone....
Studying the complex spectral line profiles in the spectra of hot emission stars and quasars .
Danezis, E.; Lyratzi, E.; Antoniou, A.; Popović, L. Č.; Dimitrijević, M. S.
Some Hot Emission Stars and AGNs present peculiar spectral line profiles which are due to DACs and SACs phenomena. The origin and the mechanisms which are responsible for the creation of DACs/SACs is an important problem that has been studied by many researchers. This paper is a review of our efforts to study the origin and the mechanisms of these phenomena. At first we present a theoretic ad hoc picture for the structure of the plasma that surrounds the specific category of hot emission stars that present DACs or SACs. Then we present the mathematical model that we constructed, which is based on the properties of the above ad hoc theoretical structure. Finally, we present some results from our statistical studies that prove the consistency of our model with the classical physical theory.
Around and beyond 53BP1 Nuclear Bodies.
Fernandez-Vidal, Anne; Vignard, Julien; Mirey, Gladys
2017-12-05
Within the nucleus, sub-nuclear domains define territories where specific functions occur. Nuclear bodies (NBs) are dynamic structures that concentrate nuclear factors and that can be observed microscopically. Recently, NBs containing the p53 binding protein 1 (53BP1), a key component of the DNA damage response, were defined. Interestingly, 53BP1 NBs are visualized during G1 phase, in daughter cells, while DNA damage was generated in mother cells and not properly processed. Unlike most NBs involved in transcriptional processes, replication has proven to be key for 53BP1 NBs, with replication stress leading to the formation of these large chromatin domains in daughter cells. In this review, we expose the composition and organization of 53BP1 NBs and focus on recent findings regarding their regulation and dynamics. We then concentrate on the importance of the replication stress, examine the relation of 53BP1 NBs with DNA damage and discuss their dysfunction.
Around and beyond 53BP1 Nuclear Bodies
Directory of Open Access Journals (Sweden)
Anne Fernandez-Vidal
2017-12-01
Full Text Available Within the nucleus, sub-nuclear domains define territories where specific functions occur. Nuclear bodies (NBs are dynamic structures that concentrate nuclear factors and that can be observed microscopically. Recently, NBs containing the p53 binding protein 1 (53BP1, a key component of the DNA damage response, were defined. Interestingly, 53BP1 NBs are visualized during G1 phase, in daughter cells, while DNA damage was generated in mother cells and not properly processed. Unlike most NBs involved in transcriptional processes, replication has proven to be key for 53BP1 NBs, with replication stress leading to the formation of these large chromatin domains in daughter cells. In this review, we expose the composition and organization of 53BP1 NBs and focus on recent findings regarding their regulation and dynamics. We then concentrate on the importance of the replication stress, examine the relation of 53BP1 NBs with DNA damage and discuss their dysfunction.
Evidence for circumstellar obscuration of OB stars
International Nuclear Information System (INIS)
Bohannan, B.
1975-01-01
Reddish found a strong increase of color excess with increasing stellar luminosity: here referred to as the Reddish Effect: in ten young galactic clusters and associations. New photometric and spectroscopic observations drawn from the literature are combined with data used by Reddish to reconsider the color excess versus intrinsic magnitude diagrams of the same ten stellar groups. The reality of the Effect is questioned in all but one of the systems; this was accomplished by identifying possible foreground stars and by recognizing some of the brightest stars as supergiants, then applying correct intrinsic color indices. After careful reanalysis, the one stellar group to retain an indication of the Reddish Effect is Cygnus OB2. No correlation of reddening with luminosity was found for five additional very young stellar groups in the southern hemisphere; these groups should exhibit the Effect if it is a natural consequence of stellar evolution. Reddish ascribed the correlation to massive circumstellar remnants of material from which the stars formed. However, a peculiar dispersion in color excess could also be attributed to patchy dust within the stellar group. In several stellar systems previously identified as displaying the Reddish Effect, a correlation of observed color excess with dust and gas concentrations is noted on Palomar Sky Survey prints. If present, circumstellar dust clouds should []anifest their existence in modes other than a correlation of color excess with luminosity. The following possibilities are considered and all show negative results: correlation of color excess with spectral type; correlation of reddening slope E/subU//sub -//subB//E/subB//sub -//subV/ with spectral type; observable infrared excess. The preceding astrophysical arguments strongly imply that circumstellar dust remnants from stellar formation do not remain around stars during their main-sequence lifetimes. (auth)
The peculiar velocities of rich clusters in the hot and cold dark matter scenarios
Rhee, George F.; West, Michael J.; Villumsen, Jens V.
1993-01-01
We present the results of a study of the peculiar velocities of rich clusters of galaxies. The peculiar motion of rich clusters in various cosmological scenarios is of interest for a number of reasons. Observationally, one can measure the peculiar motion of clusters to greater distances than galaxies because cluster peculiar motions can be determined to greater accuracy. One can also test the slope of distance indicator relations using clusters to see if galaxy properties vary with environment. We have used N-body simulations to measure the amplitude and rms cluster peculiar velocity as a function of bias parameter in the hot and cold dark matter scenarios. In addition to measuring the mean and rms peculiar velocity of clusters in the two models, we determined whether the peculiar velocity vector of a given cluster is well aligned with the gravity vector due to all the particles in the simulation and the gravity vector due to the particles present only in the clusters. We have investigated the peculiar velocities of rich clusters of galaxies in the cold dark matter and hot dark matter galaxy formation scenarios. We have derived peculiar velocities and associated errors for the scenarios using four values of the bias parameter ranging from b = 1 to b = 2.5. The growth of the mean peculiar velocity with scale factor has been determined and compared to that predicted by linear theory. In addition, we have compared the orientation of force and velocity in these simulations to see if a program such as that proposed by Bertschinger and Dekel (1989) for elliptical galaxy peculiar motions can be applied to clusters. The method they describe enables one to recover the density field from large scale redshift distance samples. The method makes it possible to do this when only radial velocities are known by assuming that the velocity field is curl free. Our analysis suggests that this program if applied to clusters is only realizable for models with a low value of the bias
CHLOE: A tool for automatic detection of peculiar galaxies
Shamir, Lior; Manning, Saundra; Wallin, John
2014-09-01
CHLOE is an image analysis unsupervised learning algorithm that detects peculiar galaxies in datasets of galaxy images. The algorithm first computes a large set of numerical descriptors reflecting different aspects of the visual content, and then weighs them based on the standard deviation of the values computed from the galaxy images. The weighted Euclidean distance of each galaxy image from the median is measured, and the peculiarity of each galaxy is determined based on that distance.
Age peculiarities of the structure of senior pupils' and students' initiativity
Directory of Open Access Journals (Sweden)
V V Alekseyeva
2009-03-01
Full Text Available The results of this research of age peculiarities of senior pupils' and students' initiativity based on multimeasureble-functional model of personal structure of their qualities, which gives an opportunity to study, the display of individual peculiarities of initiativity are considered in this article.
Defining photometric peculiar type Ia supernovae
Energy Technology Data Exchange (ETDEWEB)
González-Gaitán, S.; Pignata, G.; Förster, F.; Gutiérrez, C. P.; Bufano, F.; Galbany, L.; Hamuy, M.; De Jaeger, T. [Millennium Institute of Astrophysics, Casilla 36-D, Santiago (Chile); Hsiao, E. Y.; Phillips, M. M. [Carnegie Observatories, Las Campanas Observatory, Casilla 601, La Serena (Chile); Folatelli, G. [Kavli Institute for the Physics and Mathematics of the Universe, the University of Tokyo, Kashiwa 277-8583 (Kavli IPMU, WPI) (Japan); Anderson, J. P., E-mail: sgonzale@das.uchile.cl [European Southern Observatory, Alonso de Córdova 3107, Casilla 19, Santiago (Chile)
2014-11-10
We present a new photometric identification technique for SN 1991bg-like type Ia supernovae (SNe Ia), i.e., objects with light curve characteristics such as later primary maxima and the absence of a secondary peak in redder filters. This method is capable of selecting this sub-group from the normal type Ia population. Furthermore, we find that recently identified peculiar sub-types such as SNe Iax and super-Chandrasekhar SNe Ia have photometric characteristics similar to 91bg-like SNe Ia, namely, the absence of secondary maxima and shoulders at longer wavelengths, and can also be classified with our technique. The similarity of these different SN Ia sub-groups perhaps suggests common physical conditions. This typing methodology permits the photometric identification of peculiar SNe Ia in large upcoming wide-field surveys either to study them further or to obtain a pure sample of normal SNe Ia for cosmological studies.
Ages and Heavy Element Abundances from Very Metal-poor Stars in the Sagittarius Dwarf Galaxy
Hansen, Camilla Juul; El-Souri, Mariam; Monaco, Lorenzo; Villanova, Sandro; Bonifacio, Piercarlo; Caffau, Elisabetta; Sbordone, Luca
2018-03-01
Sagittarius (Sgr) is a massive disrupted dwarf spheroidal galaxy in the Milky Way halo that has undergone several stripping events. Previous chemical studies were restricted mainly to a few, metal-rich ([Fe/H] \\gtrapprox -1) stars that suggested a top-light initial mass function (IMF). Here we present the first high-resolution, very metal-poor ([Fe/H] =‑1 to ‑3) sample of 13 giant stars in the main body of Sgr. We derive abundances of 13 elements, namely C, Ca, Co, Fe, Sr, Ba, La, Ce, Nd, Eu, Dy, Pb, and Th, that challenge the interpretation based on previous studies. Our abundances from Sgr mimic those of the metal-poor halo, and our most metal-poor star ([Fe/H] ∼ -3) indicates a pure r-process pollution. Abundances of Sr, Pb, and Th are presented for the first time in Sgr, allowing for age determination using nuclear cosmochronology. We calculate ages of 9+/- 2.5 {Gyr}. Most of the sample stars have been enriched by a range of asymptotic giant branch (AGB) stars with masses between 1.3 and 5 M ⊙. Sgr J190651.47–320147.23 shows a large overabundance of Pb (2.05 dex) and a peculiar abundance pattern best fit by a 3 M ⊙ AGB star. Based on star-to-star scatter and observed abundance patterns, a mixture of low- and high-mass AGB stars and supernovae (15–25 M ⊙) is necessary to explain these patterns. The high level (0.29 ± 0.05 dex) of Ca indicates that massive supernovae must have existed and polluted the early ISM of Sgr before it lost its gas. This result is in contrast with a top-light IMF with no massive stars polluting Sgr. Based on data obtained UVES/VLT ID: 083.B-0774, 075.B-0127.
HD 66051: the first eclipsing binary hosting an early-type magnetic star
Kochukhov, O.; Johnston, C.; Alecian, E.; Wade, G. A.
2018-05-01
Early-type magnetic stars are rarely found in close binary systems. No such objects were known in eclipsing binaries prior to this study. Here we investigated the eclipsing, spectroscopic double-lined binary HD 66051, which exhibits out-of-eclipse photometric variations suggestive of surface brightness inhomogeneities typical of early-type magnetic stars. Using a new set of high-resolution spectropolarimetric observations, we discovered a weak magnetic field on the primary and found intrinsic, element-dependent variability in its spectral lines. The magnetic field structure of the primary is dominated by a nearly axisymmetric dipolar component with a polar field strength Bd ≈ 600 G and an inclination with respect to the rotation axis of βd = 13°. A weaker quadrupolar component is also likely to be present. We combined the radial velocity measurements derived from our spectra with archival optical photometry to determine fundamental masses (3.16 and 1.75 M⊙) and radii (2.78 and 1.39 R⊙) with a 1-3% precision. We also obtained a refined estimate of the effective temperatures (13000 and 9000 K) and studied chemical abundances for both components with the help of disentangled spectra. We demonstrate that the primary component of HD 66051 is a typical late-B magnetic chemically peculiar star with a non-uniform surface chemical abundance distribution. It is not an HgMn-type star as suggested by recent studies. The secondary is a metallic-line star showing neither a strong, global magnetic field nor intrinsic spectral variability. Fundamental parameters provided by our work for this interesting system open unique possibilities for probing interior structure, studying atomic diffusion, and constraining binary star evolution.
Stars and Seasons in Southern Africa
Snedegar, K. V.
Although the indigenous people of Southern Africa traditionally viewed the sky as a place quite apart from the Earth, they believed celestial phenomena to be natural signs united with those of the Earth in a harmonious synchronicity. There is no substantial evidence that the precolonial Africans imagined a casual relationship between celestial bodies and the seasonal patterns of life on Earth. They did, however, recognize a coincidental relationship. The traditional African cosmos, then, worked as a noetic principle unifying the observed motions of celestial bodies, the sequence of seasons, and the behavior of plants and animals. Such a cosmos, with local peculiarities, was widely understood in Southern Africa before the end of the last century. By the early 20th century European colonial paradigms had largely obliterated this African worldview. This paper will offer a partial reconstruction. Pre-colonial South African people viewed time as a sequence of discrete natural events; through annual repetition these events served as a guide for proper human action. The South Africans analyzed the passage of time in terms of the motions of celestial bodies, the maturation of beneficial plants, and the mating patterns of animals. The rightful course of human life was seen to fit within the seasonal context of these natural phenomena. The visibility of conspicuous stars and asterisms marked significant times of year. For instance, the Lovedu people greeted the dawn rising of Canopus with joy: "The boy has come out." The star was a signal for rainmaking and boys' initiation ceremonies to proceed. The Venda constellation Thutlwa, the giraffes, comprises α and β Crucis and α and β Centauri. In October Thutlwa skims the trees of the evening horizon. The Venda Thutlwa literally means 'rising above the trees,' an allusion to the majestic vegetarian creatures and the stars advising the people to be done with their spring planting. This paper will describe stellar associations
MASSIVE INFANT STARS ROCK THEIR CRADLE
2002-01-01
Extremely intense radiation from newly born, ultra-bright stars has blown a glowing spherical bubble in the nebula N83B, also known as NGC 1748. A new NASA Hubble Space Telescope image has helped to decipher the complex interplay of gas and radiation of a star-forming region in a nearby galaxy. The image graphically illustrates just how these massive stars sculpt their environment by generating powerful winds that alter the shape of the parent gaseous nebula. These processes are also seen in our Milky Way in regions like the Orion Nebula. The Hubble telescope is famous for its contribution to our knowledge about star formation in very distant galaxies. Although most of the stars in the Universe were born several billions of years ago, when the Universe was young, star formation still continues today. This new Hubble image shows a very compact star-forming region in a small part of one of our neighboring galaxies - the Large Magellanic Cloud. This galaxy lies only 165,000 light-years from our Milky Way and can easily be seen with the naked eye from the Southern Hemisphere. Young, massive, ultra-bright stars are seen here just as they are born and emerge from the shelter of their pre-natal molecular cloud. Catching these hefty stars at their birthplace is not as easy as it may seem. Their high mass means that the young stars evolve very rapidly and are hard to find at this critical stage. Furthermore, they spend a good fraction of their youth hidden from view, shrouded by large quantities of dust in a molecular cloud. The only chance is to observe them just as they start to emerge from their cocoon - and then only with very high-resolution telescopes. Astronomers from France, the U.S., and Germany have used Hubble to study the fascinating interplay between gas, dust, and radiation from the newly born stars in this nebula. Its peculiar and turbulent structure has been revealed for the first time. This high-resolution study has also uncovered several individual stars
He 2-467 = LT Del - the yellow symbiotic star with a period about 500 days
International Nuclear Information System (INIS)
Arkhipova, V.P.; Noskova, R.I.
1988-01-01
By means of broad and narrow-band photometry in UBV spectral region the variability of the object He 2-467 earlier classified as peculiar cenral star of planetary nebyla has been revealed. The brightness amplitude significantly decreases with the wavelength from 1 m .9 in u-band to 0 m .3 in V. The brightness variations were found to be periodic, with P=488 days. The observations of He2-467 were interpreted using the model of binary consisting of very hot subdwarf and G511-giant. The parameters of both components have been derived. The hot star is probably the evolved low mass nucleus of planetary nebula already dissipated. The periodic variations in U-band may be the result of the reflection effect due to the presence of hot extended region on the side of cold star facing the subdwarf. The subdwarf UV-flux can heat and ionize the upper atmosphere of the giant giving birth to the emission lines and Balmer continuum. The yellow symbiotics to which He 2-467 belong may be predecessors of red symbiotics with M giants
TIDAL TAILS OF MINOR MERGERS. II. COMPARING STAR FORMATION IN THE TIDAL TAILS OF NGC 2782
Energy Technology Data Exchange (ETDEWEB)
Knierman, Karen A.; Scowen, Paul; Veach, Todd; Groppi, Christopher [School of Earth and Space Exploration, Arizona State University, 550 E. Tyler Mall, Room PSF-686 (P.O. Box 871404), Tempe, AZ 85287-1404 (United States); Mullan, Brendan; Charlton, Jane [Department of Astronomy and Astrophysics, Penn State University, 525 Davey Lab, University Park, PA (United States); Konstantopoulos, Iraklis [Australian Astronomical Observatory, P.O. Box 915, North Ryde NSW 1670 (Australia); Knezek, Patricia M., E-mail: karen.knierman@asu.edu, E-mail: paul.scowen@asu.edu, E-mail: tveach@asu.edu, E-mail: cgroppi@asu.edu, E-mail: mullan@astro.psu.edu, E-mail: iraklis@aao.gov.au, E-mail: pknezek@noao.edu [WIYN Consortium, Inc., 950 N. Cherry Avenue, Tucson, AZ 85719 (United States)
2013-09-10
The peculiar spiral NGC 2782 is the result of a minor merger with a mass ratio {approx}4: 1 occurring {approx}200 Myr ago. This merger produced a molecular and H I-rich, optically bright eastern tail and an H I-rich, optically faint western tail. Non-detection of CO in the western tail by Braine et al. suggested that star formation had not yet begun. However, deep UBVR and H{alpha} narrowband images show evidence of recent star formation in the western tail, though it lacks massive star clusters and cluster complexes. Using Herschel PACS spectroscopy, we discover 158 {mu}m [C II] emission at the location of the three most luminous H{alpha} sources in the eastern tail, but not at the location of the even brighter H{alpha} source in the western tail. The western tail is found to have a normal star formation efficiency (SFE), but the eastern tail has a low SFE. The lack of CO and [C II] emission suggests that the western tail H II region may have a low carbon abundance and be undergoing its first star formation. The western tail is more efficient at forming stars, but lacks massive clusters. We propose that the low SFE in the eastern tail may be due to its formation as a splash region where gas heating is important even though it has sufficient molecular and neutral gas to make massive star clusters. The western tail, which has lower gas surface density and does not form high-mass star clusters, is a tidally formed region where gravitational compression likely enhances star formation.
TIDAL TAILS OF MINOR MERGERS. II. COMPARING STAR FORMATION IN THE TIDAL TAILS OF NGC 2782
International Nuclear Information System (INIS)
Knierman, Karen A.; Scowen, Paul; Veach, Todd; Groppi, Christopher; Mullan, Brendan; Charlton, Jane; Konstantopoulos, Iraklis; Knezek, Patricia M.
2013-01-01
The peculiar spiral NGC 2782 is the result of a minor merger with a mass ratio ∼4: 1 occurring ∼200 Myr ago. This merger produced a molecular and H I-rich, optically bright eastern tail and an H I-rich, optically faint western tail. Non-detection of CO in the western tail by Braine et al. suggested that star formation had not yet begun. However, deep UBVR and Hα narrowband images show evidence of recent star formation in the western tail, though it lacks massive star clusters and cluster complexes. Using Herschel PACS spectroscopy, we discover 158 μm [C II] emission at the location of the three most luminous Hα sources in the eastern tail, but not at the location of the even brighter Hα source in the western tail. The western tail is found to have a normal star formation efficiency (SFE), but the eastern tail has a low SFE. The lack of CO and [C II] emission suggests that the western tail H II region may have a low carbon abundance and be undergoing its first star formation. The western tail is more efficient at forming stars, but lacks massive clusters. We propose that the low SFE in the eastern tail may be due to its formation as a splash region where gas heating is important even though it has sufficient molecular and neutral gas to make massive star clusters. The western tail, which has lower gas surface density and does not form high-mass star clusters, is a tidally formed region where gravitational compression likely enhances star formation
An expert computer program for classifying stars on the MK spectral classification system
International Nuclear Information System (INIS)
Gray, R. O.; Corbally, C. J.
2014-01-01
This paper describes an expert computer program (MKCLASS) designed to classify stellar spectra on the MK Spectral Classification system in a way similar to humans—by direct comparison with the MK classification standards. Like an expert human classifier, the program first comes up with a rough spectral type, and then refines that spectral type by direct comparison with MK standards drawn from a standards library. A number of spectral peculiarities, including barium stars, Ap and Am stars, λ Bootis stars, carbon-rich giants, etc., can be detected and classified by the program. The program also evaluates the quality of the delivered spectral type. The program currently is capable of classifying spectra in the violet-green region in either the rectified or flux-calibrated format, although the accuracy of the flux calibration is not important. We report on tests of MKCLASS on spectra classified by human classifiers; those tests suggest that over the entire HR diagram, MKCLASS will classify in the temperature dimension with a precision of 0.6 spectral subclass, and in the luminosity dimension with a precision of about one half of a luminosity class. These results compare well with human classifiers.
An expert computer program for classifying stars on the MK spectral classification system
Energy Technology Data Exchange (ETDEWEB)
Gray, R. O. [Department of Physics and Astronomy, Appalachian State University, Boone, NC 26808 (United States); Corbally, C. J. [Vatican Observatory Research Group, Tucson, AZ 85721-0065 (United States)
2014-04-01
This paper describes an expert computer program (MKCLASS) designed to classify stellar spectra on the MK Spectral Classification system in a way similar to humans—by direct comparison with the MK classification standards. Like an expert human classifier, the program first comes up with a rough spectral type, and then refines that spectral type by direct comparison with MK standards drawn from a standards library. A number of spectral peculiarities, including barium stars, Ap and Am stars, λ Bootis stars, carbon-rich giants, etc., can be detected and classified by the program. The program also evaluates the quality of the delivered spectral type. The program currently is capable of classifying spectra in the violet-green region in either the rectified or flux-calibrated format, although the accuracy of the flux calibration is not important. We report on tests of MKCLASS on spectra classified by human classifiers; those tests suggest that over the entire HR diagram, MKCLASS will classify in the temperature dimension with a precision of 0.6 spectral subclass, and in the luminosity dimension with a precision of about one half of a luminosity class. These results compare well with human classifiers.
Le Bacquer, Olivier; Petroulakis, Emmanuel; Paglialunga, Sabina; Poulin, Francis; Richard, Denis; Cianflone, Katherine; Sonenberg, Nahum
2007-02-01
The most common pathology associated with obesity is insulin resistance, which results in the onset of type 2 diabetes mellitus. Several studies have implicated the mammalian target of rapamycin (mTOR) signaling pathway in obesity. Eukaryotic translation initiation factor 4E-binding (eIF4E-binding) proteins (4E-BPs), which repress translation by binding to eIF4E, are downstream effectors of mTOR. We report that the combined disruption of 4E-BP1 and 4E-BP2 in mice increased their sensitivity to diet-induced obesity. Increased adiposity was explained at least in part by accelerated adipogenesis driven by increased expression of CCAAT/enhancer-binding protein delta (C/EBPdelta), C/EBPalpha, and PPARgamma coupled with reduced energy expenditure, reduced lipolysis, and greater fatty acid reesterification in the adipose tissue of 4E-BP1 and 4E-BP2 double KO mice. Increased insulin resistance in 4E-BP1 and 4E-BP2 double KO mice was associated with increased ribosomal protein S6 kinase (S6K) activity and impairment of Akt signaling in muscle, liver, and adipose tissue. These data clearly demonstrate the role of 4E-BPs as a metabolic brake in the development of obesity and reinforce the idea that deregulated mTOR signaling is associated with the development of the metabolic syndrome.
Air Sampling Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Waste Sampling Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Air Monitoring Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Water Sampling Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Sediment Sampling Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Symbiotic star CI Cygni: S-process episode or accretion event
Energy Technology Data Exchange (ETDEWEB)
Kenyon, S J; Webbink, R F; Gallagher, J S; Truran, J W
1982-02-01
Evidence that the symbiotic star C I Cygni is an eclipsing binary is reviewed. It is shown that the s-process episode described by Audouze et al. (1981) during its 1975 outburst arises from superposition of normal gM4 absorption features on the continuum of the hot component during eclipse ingress, and not to sudden enhancements of rare earth elements. The peculiar velocity displacements of absorption lines with different excitation potentials during this episode are identified as signatures of an optically thick accretion disk, which dominates the visible spectrum during outburst. The data presented by Audouze et al., and the shape of the light curve thus provide evidence that the outburst is accretion-powered.
CacyBP/SIP promotes the proliferation of colon cancer cells.
Directory of Open Access Journals (Sweden)
Huihong Zhai
Full Text Available CacyBP/SIP is a component of the ubiquitin pathway and is overexpressed in several transformed tumor tissues, including colon cancer, which is one of the most common cancers worldwide. It is unknown whether CacyBP/SIP promotes the proliferation of colon cancer cells. This study examined the expression level, subcellular localization, and binding activity of CacyBP/SIP in human colon cancer cells in the presence and absence of the hormone gastrin. We found that CacyBP/SIP was expressed in a high percentage of colon cancer cells, but not in normal colonic surface epithelium. CacyBP/SIP promoted the cell proliferation of colon cancer cells under both basal and gastrin stimulated conditions as shown by knockdown studies. Gastrin stimulation triggered the translocation of CacyBP/SIP to the nucleus, and enhanced interaction between CacyBP/SIP and SKP1, a key component of ubiquitination pathway which further mediated the proteasome-dependent degradation of p27kip1 protein. The gastrin induced reduction in p27kip1 was prevented when cells were treated with the proteasome inhibitor MG132. These results suggest that CacyBP/SIP may be promoting growth of colon cancer cells by enhancing ubiquitin-mediated degradation of p27kip1.
THE TRANSVERSE PECULIAR VELOCITY OF THE Q2237+0305 LENS GALAXY AND THE MEAN MASS OF ITS STARS
International Nuclear Information System (INIS)
Poindexter, Shawn; Kochanek, Christopher S.
2010-01-01
Using 11 years of OGLE V-band photometry of Q2237+0305, we measure the transverse velocity of the lens galaxy and the mean mass of its stars. We can do so because, for the first time, we fully include the random motions of the stars in the lens galaxy in the analysis of the light curves. In doing so, we are also able to correctly account for Earth's parallax motion and the rotation of the lens galaxy, further reducing systematic errors. We measure a lower limit on the transverse speed of the lens galaxy, v t > 338 km s -1 (68% confidence) and find a preferred direction to the east. The mean stellar mass estimate, including a well-defined velocity prior, is 0.12 ≤ (M/M sun ) ≤ 1.94 at 68% confidence, with a median of 0.52 M sun . We also show for the first time that analyzing subsets of a microlensing light curve, in this case the first and second halves of the OGLE V-band light curve, gives mutually consistent physical results.
MAGNETIC ACTIVITY CYCLES IN THE EXOPLANET HOST STAR ε ERIDANI
International Nuclear Information System (INIS)
Metcalfe, T. S.; Mathur, S.; Buccino, A. P.; Mauas, P. J. D.; Petrucci, R.; Brown, B. P.; Soderblom, D. R.; Henry, T. J.; Hall, J. C.; Basu, S.
2013-01-01
The active K2 dwarf ε Eri has been extensively characterized both as a young solar analog and more recently as an exoplanet host star. As one of the nearest and brightest stars in the sky, it provides an unparalleled opportunity to constrain stellar dynamo theory beyond the Sun. We confirm and document the 3-year magnetic activity cycle in ε Eri originally reported by Hatzes and coworkers, and we examine the archival data from previous observations spanning 45 years. The data show coexisting 3-year and 13-year periods leading into a broad activity minimum that resembles a Maunder minimum-like state, followed by the resurgence of a coherent 3-year cycle. The nearly continuous activity record suggests the simultaneous operation of two stellar dynamos with cycle periods of 2.95 ± 0.03 years and 12.7 ± 0.3 years, which, by analogy with the solar case, suggests a revised identification of the dynamo mechanisms that are responsible for the so-called 'active' and 'inactive' sequences as proposed by Böhm-Vitense. Finally, based on the observed properties of ε Eri, we argue that the rotational history of the Sun is what makes it an outlier in the context of magnetic cycles observed in other stars (as also suggested by its Li depletion), and that a Jovian-mass companion cannot be the universal explanation for the solar peculiarities.
Fractographic peculiarities of cermet tungsten fracture
International Nuclear Information System (INIS)
Stepanenko, V.A.; Babak, A.V.; Uskov, E.I.
1982-01-01
Effect of test temperature on fracture peculiarities of cermets tungsten with initial cellular structure of deformation is shown. Tungsten crack resistance increases at temperatures to Tsub(x) (ductile-brittle transition temperature) and decreases at temperatures above Tsub(x). The degree of ceramics tungsten plasticity realization depends on its crack resistance
76 FR 69712 - Application To Export Electric Energy; BP Energy Company
2011-11-09
... DEPARTMENT OF ENERGY [OE Docket No. EA-315-A] Application To Export Electric Energy; BP Energy.... SUMMARY: BP Energy Company (BP Energy) has applied to renew its authority to transmit electric energy from... BP Energy to transmit electric energy from the United States to Canada as a power marketer for a five...
Evidence of the evolved nature of the B[e] star MWC 137
Energy Technology Data Exchange (ETDEWEB)
Muratore, M. F.; Arias, M. L.; Cidale, L. [Departamento de Espectroscopía Estelar, Facultad de Ciencias Astronómicas y Geofísicas, Universidad Nacional de La Plata, and Instituto de Astrofísica de La Plata, CCT La Plata, CONICET-UNLP, Paseo del Bosque S/N, B1900FWA, La Plata (Argentina); Kraus, M.; Oksala, M. E. [Astronomický ústav, Akademie věd České Republiky, Fričova 298, 251 65 Ondřejov (Czech Republic); Fernandes, M. Borges [Observatório Nacional, Rua General José Cristino 77, 20921-400 São Cristovão, Rio de Janeiro (Brazil); Liermann, A., E-mail: fmuratore@carina.fcaglp.unlp.edu.ar [Leibniz-Institut für Astrophysik Potsdam (AIP), An der Sternwarte 16, D-14482 Potsdam (Germany)
2015-01-01
The evolutionary phase of B[e] stars is difficult to establish due to the uncertainties in their fundamental parameters. For instance, possible classifications for the Galactic B[e] star MWC 137 include pre-main-sequence and post-main-sequence phases, with a large range in luminosity. Our goal is to clarify the evolutionary stage of this peculiar object, and to study the CO molecular component of its circumstellar medium. To this purpose, we modeled the CO molecular bands using high-resolution K-band spectra. We find that MWC 137 is surrounded by a detached cool (T=1900±100 K) and dense (N=(3±1)×10{sup 21} cm{sup −2}) ring of CO gas orbiting the star with a rotational velocity, projected to the line of sight, of 84 ± 2 km s{sup −1}. We also find that the molecular gas is enriched in the isotope {sup 13}C, excluding the classification of the star as a Herbig Be. The observed isotopic abundance ratio ({sup 12}C/{sup 13}C = 25 ± 2) derived from our modeling is compatible with a proto-planetary nebula, main-sequence, or supergiant evolutionary phase. However, based on some observable characteristics of MWC 137, we propose that the supergiant scenario seems to be the most plausible. Hence, we suggest that MWC 137 could be in an extremely short-lived phase, evolving from a B[e] supergiant to a blue supergiant with a bipolar ring nebula.
A young contracting white dwarf in the peculiar binary HD 49798/RX J0648.0-4418?
Popov, S. B.; Mereghetti, S.; Blinnikov, S. I.; Kuranov, A. G.; Yungelson, L. R.
2018-02-01
HD 49798/RX J0648.0-4418 is a peculiar X-ray binary with a hot subdwarf (sdO) mass donor. The nature of the accreting compact object is not known, but its spin period P = 13.2 s and \\dot{P} =-2.15 × 10^{-15} s s-1 proves that it can be only either a white dwarf or a neutron star. The spin-up has been very stable for more than 20 yr. We demonstrate that the continuous stable spin-up of the compact companion of HD 49798 can be best explained by contraction of a young white dwarf with an age ˜2 Myr. This allows us to interpret all the basic parameters of the system in the framework of an accreting white dwarf. We present examples of binary evolution, which result in such systems. If correct, this is the first direct evidence for a white dwarf contraction in early evolutionary stages.
BP1 Homeoprotein Enhances Metastatic Potential in ER-negative Breast Cancer
Fu, Yebo; Lian, Yi; Kim, Kyung Soon; Zhang, Lei; Hindle, A. Katharine; Brody, Fred; Siegel, Robert S.; McCaffrey, Timothy A.; Fu, Sidney W.
2010-01-01
Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER-) tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. We sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target for ER- breast cancer. PMID:20842225
TIDAL TAILS OF MINOR MERGERS: STAR FORMATION EFFICIENCY IN THE WESTERN TAIL OF NGC 2782
Energy Technology Data Exchange (ETDEWEB)
Knierman, Karen; Scowen, Paul; Jansen, Rolf A. [School of Earth and Space Exploration, Arizona State University, 550 East Tyler Mall, Room PSF-686 (P.O. Box 871404), Tempe, AZ 85287-1404 (United States); Knezek, Patricia M. [WIYN Consortium, Inc., 950 North Cherry Avenue, Tucson, AZ 85719 (United States); Wehner, Elizabeth, E-mail: karen.knierman@asu.edu, E-mail: paul.scowen@asu.edu, E-mail: rolf.jansen@asu.edu, E-mail: pknezek@noao.edu, E-mail: ewehner@haverford.edu [Department of Astronomy, Haverford College, Haverford, PA 19041 (United States)
2012-04-10
While major mergers and their tidal debris are well studied, they are less common than minor mergers (mass ratios {approx}< 0.3). The peculiar spiral NGC 2782 is the result of a merger between two disk galaxies with a mass ratio of {approx}4: 1 occurring {approx}200 Myr ago. This merger produced a molecular and H I-rich, optically bright eastern tail and an H I-rich, optically faint western tail. Non-detection of CO in the western tail by Braine et al. suggested that star formation had not yet begun to occur in that tidal tail. However, deep H{alpha} narrowband images show evidence of recent star formation in the western tail. Across the entire western tail, we find the global star formation rate per unit area ({Sigma}{sub SFR}) to be several orders of magnitude less than expected from the total gas density. Together with extended FUV+NUV emission from Galaxy Evolution Explorer along the tail, this indicates a low global star formation efficiency in the tidal tail producing lower mass star clusters. The H II region that we observed has a local (few-kiloparsec scale) {Sigma}{sub SFR} from H{alpha} that is less than that expected from the total gas density, which is consistent with other observations of tidal debris. The star formation efficiency of this H II region inferred from the total gas density is low, but normal when inferred from the molecular gas density. These results suggest the presence of a very small, locally dense region in the western tail of NGC 2782 or of a low-metallicity and/or low-pressure star-forming region.
4E-BP1 regulates the differentiation of white adipose tissue.
Tsukiyama-Kohara, Kyoko; Katsume, Asao; Kimura, Kazuhiro; Saito, Masayuki; Kohara, Michinori
2013-07-01
4E Binding protein 1 (4E-BP1) suppresses translation initiation. The absence of 4E-BP1 drastically reduces the amount of adipose tissue in mice. To address the role of 4E-BP1 in adipocyte differentiation, we characterized 4E-BP1(-/-) mice in this study. The lack of 4E-BP1 decreased the amount of white adipose tissue and increased the amount of brown adipose tissue. In 4E-BP1(-/-) MEF cells, PPARγ coactivator 1 alpha (PGC-1α) expression increased and exogenous 4E-BP1 expression suppressed PGC-1α expression. The level of 4E-BP1 expression was higher in white adipocytes than in brown adipocytes and showed significantly greater up-regulation in white adipocytes than in brown adipocytes during preadipocyte differentiation into mature adipocytes. The amount of PGC-1α was consistently higher in HB cells (a brown preadipocyte cell line) than in HW cells (a white preadipocyte cell line) during differentiation. Moreover, the ectopic over-expression of 4E-BP1 suppressed PGC-1α expression in white adipocytes, but not in brown adipocytes. Thus, the results of our study indicate that 4E-BP1 may suppress brown adipocyte differentiation and PGC-1α expression in white adipose tissues. © 2013 The Authors Genes to Cells © 2013 by the Molecular Biology Society of Japan and Wiley Publishing Asia Pty Ltd.
CHEMICAL COMPOSITION OF INTERMEDIATE-MASS STAR MEMBERS OF THE M6 (NGC 6405) OPEN CLUSTER
Energy Technology Data Exchange (ETDEWEB)
Kılıçoğlu, T.; Albayrak, B. [Ankara University, Faculty of Science, Department of Astronomy and Space Sciences, 06100, Tandoğan, Ankara (Turkey); Monier, R. [LESIA, UMR 8109, Observatoire de Paris Meudon, Place J. Janssen, Meudon (France); Richer, J. [Département de physique, Université de Montréal, 2900, Boulevard Edouard-Montpetit, Montréal QC, H3C 3J7 (Canada); Fossati, L., E-mail: tkilicoglu@ankara.edu.tr, E-mail: balbayrak@ankara.edu.tr, E-mail: Richard.Monier@obspm.fr, E-mail: Jacques.Richer@umontreal.ca, E-mail: lfossati@astro.uni-bonn.de [Argelander-Institut für Astronomie der Universität Bonn, Auf dem Hügel 71, D-53121, Bonn (Germany)
2016-03-15
We present here the first abundance analysis of 44 late B-, A-, and F-type members of the young open cluster M6 (NGC 6405, age about 75 Myr). Low- and medium-resolution spectra, covering the 4500–5840 Å wavelength range, were obtained using the FLAMES/GIRAFFE spectrograph attached to the ESO Very Large Telescopes. We determined the atmospheric parameters using calibrations of the Geneva photometry and by adjusting the H{sub β} profiles to synthetic ones. The abundances of up to 20 chemical elements, from helium to mercury, were derived for 19 late B, 16 A, and 9 F stars by iteratively adjusting synthetic spectra to the observations. We also derived a mean cluster metallicity of [Fe/H] = 0.07 ± 0.03 dex from the iron abundances of the F-type stars. We find that for most chemical elements, the normal late B- and A-type stars exhibit larger star-to-star abundance variations than the F-type stars probably because of the faster rotation of the B and A stars. The abundances of C, O, Mg, Si, and Sc appear to be anticorrelated with that of Fe, while the opposite holds for the abundances of Ca, Ti, Cr, Mn, Ni, Y, and Ba as expected if radiative diffusion is efficient in the envelopes of these stars. In the course of this analysis, we discovered five new peculiar stars: one mild Am, one Am, and one Fm star (HD 318091, CD-32 13109, GSC 07380-01211, CP1), one HgMn star (HD 318126, CP3), and one He-weak P-rich (HD 318101, CP4) star. We also discovered a new spectroscopic binary, most likely a SB2. We performed a detailed modeling of HD 318101, the new He-weak P-rich CP star, using the Montréal stellar evolution code XEVOL which self-consistently treats all particle transport processes. Although the overall abundance pattern of this star is properly reproduced, we find that detailed abundances (in particular the high P excess) resisted modeling attempts even when a range of turbulence profiles and mass-loss rates were considered. Solutions are proposed which are
Lithium abundance patterns of late-F stars: an in-depth analysis of the lithium desert
Aguilera-Gómez, Claudia; Ramírez, Iván; Chanamé, Julio
2018-06-01
Aims: We address the existence and origin of the lithium (Li) desert, a region in the Li-Teff plane sparsely populated by stars. Here we analyze some of the explanations that have been suggested for this region, including mixing in the late main sequence, a Li dip origin for stars with low Li abundances in the region, and a possible relation with the presence of planets. Methods: To study the Li desert, we measured the atmospheric parameters and Li abundance of 227 late-F dwarfs and subgiants, chosen to be in the Teff range of the desert and without previous Li abundance measurements. Subsequently, we complemented those with literature data to obtain a homogeneous catalog of 2318 stars, for which we compute masses and ages. We characterize stars surrounding the region of the Li desert. Results: We conclude that stars with low Li abundances below the desert are more massive and more evolved than stars above the desert. Given the unexpected presence of low Li abundance stars in this effective temperature range, we concentrate on finding their origin. We conclude that these stars with low Li abundance do not evolve from stars above the desert: at a given mass, stars with low Li (i.e., below the desert) are more metal-poor. Conclusions: Instead, we suggest that stars below the Li desert are consistent with having evolved from the Li dip, discarding the need to invoke additional mixing to explain this feature. Thus, stars below the Li desert are not peculiar and are only distinguished from other subgiants evolved from the Li dip in that their combination of atmospheric parameters locates them in a range of effective temperatures where otherwise only high Li abundance stars would be found (i.e., stars above the desert). Full Tables 1 and 3 are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/614/A55This paper includes observations collected at The McDonald Observatory and
Some new ideas for the study of the complex spectral line profiles of hot emission stars and quasars
Danezis, E.
2013-01-01
Some Hot Emission Stars and AGNs present peculiar spectral line profiles which are due to DACs and SACs phenomena. The origin and the mechanisms which are responsible for the creation of DACs/SACs is an important problem that has been studied by many researchers. This paper is a review of our efforts to study the origin and the mechanisms of these phenomena. At first we present a theoretic ad hoc picture for the structure of the plasma that surrounds the specific category of hot emission stars that present DACs or SACs. Then we present the mathematical model that we constructed, which is based on the properties of the above ad hoc theoretical structure. Finally, we present some results from our statistical studies that prove the consistency of our model with the classical physical theory.
The symbiotic star CI Cygni: S-process episode or accretion event
International Nuclear Information System (INIS)
Kenyon, S.J.; Webbink, R.F.; Gallagher, J.S.; Truran, J.W.
1982-01-01
Evidence that the symbiotic star C I Cygni is an eclipsing binary is reviewed. It is shown that the 's-process episode' described by Audouze et al. (1981) during its 1975 outburst arises from superposition of normal gM4 absorption features on the continuum of the hot component during eclipse ingress, and not to sudden enhancements of rare earth elements. The peculiar velocity displacements of absorption lines with different excitation potentials during this episode are identified as signatures of an optically thick accretion disk, which dominates the visible spectrum during outburst. The data presented by Audouze et al., and the shape of the light curve thus provide evidence that the outburst is accretion-powered. (orig.)
BP1 Homeoprotein Enhances Metastatic Potential in Er-Negative Breast Cancer
Directory of Open Access Journals (Sweden)
Yebo Fu, Yi Lian, Kyung Soon Kim, Lei Zhang, A. Katharine Hindle, Fred Brody, Robert S. Siegel, Timothy A. McCaffrey, Sidney W. Fu
2010-01-01
Full Text Available Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER- tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. I sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p<0.005, and enhanced the in vitro invasive activity by 25-65 fold (p<0.001. Microarray experiments were performed to identify differentially expressed genes when BP1 is overexpressed. The gene expression profile of the transfected cell lines were compared, resulting in 71 differentially expressed genes with a fold-change of >=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target.
Bhalerao, Varun
2012-05-01
My thesis centers around the study of neutron stars, especially those in massive binary systems. To this end, it has two distinct components: the observational study of neutron stars in massive binaries with a goal of measuring neutron star masses and participation in NuSTAR, the first imaging hard X-ray mission, one that is extremely well suited to the study of massive binaries and compact objects in our Galaxy. The Nuclear Spectroscopic Telescope Array (NuSTAR) is a NASA Small Explorer mission that will carry the first focusing high energy X-ray telescope to orbit. NuSTAR has an order-of-magnitude better angular resolution and has two orders of magnitude higher sensitivity than any currently orbiting hard X-ray telescope. I worked to develop, calibrate, and test CdZnTe detectors for NuSTAR. I describe the CdZnTe detectors in comprehensive detail here - from readout procedures to data analysis. Detailed calibration of detectors is necessary for analyzing astrophysical source data obtained by the NuSTAR. I discuss the design and implementation of an automated setup for calibrating flight detectors, followed by calibration procedures and results. Neutron stars are an excellent probe of fundamental physics. The maximum mass of a neutron star can put stringent constraints on the equation of state of matter at extreme pressures and densities. From an astrophysical perspective, there are several open questions in our understanding of neutron stars. What are the birth masses of neutron stars? How do they change in binary evolution? Are there multiple mechanisms for the formation of neutron stars? Measuring masses of neutron stars helps answer these questions. Neutron stars in high-mass X-ray binaries have masses close to their birth mass, providing an opportunity to disentangle the role of "nature" and "nurture" in the observed mass distributions. In 2006, masses had been measured for only six such objects, but this small sample showed the greatest diversity in masses
International Nuclear Information System (INIS)
Tjin, A.; Djie, H.R.E.; The, P.S.; Andersen, J.; Nordstroem, B.; Finkenzeller, U.; Jankovics, I.
1989-01-01
Visual spectroscopy of the irregularly variable Herbig Ae star HR 5999 over the past 15 years is summarised. The general features of the spectrum indicate that HR 5999 is an A5-7 III-IVe star with an extended circumstellar atmosphere. Typical lines have a rotationally broadened photospheric component and one or two blue-shifted ''shell'' components. The average radial velocity of the photospheric components, together with the common proper motions of the stars strongly suggest that HR 5999 and the peculiar B6 star HR 6000 from a physical pair, with common age. In order to study the relation between variations in the spectrum and in the brightness of the star, three sequences of simultaneous spectroscopic and photometric observations have been obtained during the past decade. From these and other (isolated) simultaneous observations we concluded that: (a) the photospheric radial velocity component is variable, possibly with a period of about 14 days, which could point to the presence of a close companion, (b) occasionally, sudden variations may occur (within one night) either in the photospheric line components,or in the shell (absorption or emission) components or both; (c) a decreasing brightness is correlated with increasing Hα-emission flux and a decreasing wind velocity in the shell region. An interpretation of these correlations in terms of magnetic activity is proposed
The Milky Way's Circular Velocity Curve and Its Constraint on the Galactic Mass with RR Lyrae Stars
Energy Technology Data Exchange (ETDEWEB)
Ablimit, Iminhaji; Zhao, Gang, E-mail: iminhaji@nao.cas.cn, E-mail: gzhao@nao.cas.cn [Key Laboratory of Optical Astronomy, National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China)
2017-09-01
We present a sample of 1148 ab-type RR Lyrae (RRLab) variables identified from Catalina Surveys Data Release 1, combined with SDSS DR8 and LAMOST DR4 spectral data. We first use a large sample of 860 Galactic halo RRLab stars and derive the circular velocity distributions for the stellar halo. With the precise distances and carefully determined radial velocities (the center-of-mass radial velocities) and by considering the pulsation of the RRLab stars in our sample, we can obtain a reliable and comparable stellar halo circular velocity curve. We follow two different prescriptions for the velocity anisotropy parameter β in the Jeans equation to study the circular velocity curve and mass profile. Additionally, we test two different solar peculiar motions in our calculation. The best result we obtained with the adopted solar peculiar motion 1 of ( U , V , W ) = (11.1, 12, 7.2) km s{sup −1} is that the enclosed mass of the Milky Way within 50 kpc is (3.75 ± 1.33) × 10{sup 11} M {sub ⊙} based on β = 0 and the circular velocity 180 ± 31.92 (km s{sup −1}) at 50 kpc. This result is consistent with dynamical model results, and it is also comparable to the results of previous similar works.
BP/Mobil. Joint-venture directions for use
International Nuclear Information System (INIS)
Anon.
1997-01-01
This paper analyzes the economical reasons which have led BP and Mobil companies to join their forces in 1996. Thanks to their complementarity and to their European implantation, the two companies could win the first or second position in petroleum products marketing in 8 European countries. The cumulated petrol sales and the number of petrol stations of the BP/Mobil joint venture are the highest in Europe (800 petrol stations in France). (J.S.)
A rare encounter with very massive stars in NGC 3125-A1
Energy Technology Data Exchange (ETDEWEB)
Wofford, Aida [UPMC-CNRS, UMR7095, Institut d' Astrophysique de Paris, F-75014 Paris (France); Leitherer, Claus [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Chandar, Rupali [University of Toledo, Department of Physics and Astronomy, Toledo, OH 43606 (United States); Bouret, Jean-Claude, E-mail: wofford@iap.edu [Aix Marseille Universite, CNRS, LAM (Laboratoire d' Astrophysique de Marseille) UMR 7326, F-13388 Marseille (France)
2014-02-01
Super star cluster A1 in the nearby starburst galaxy NGC 3125 is characterized by broad He II λ1640 emission (FWHM ∼ 1200 km s{sup –1}) of unprecedented strength (equivalent width, EW = 7.1 ± 0.4 Å). Previous attempts to characterize the massive star content in NGC 3125-A1 were hampered by the low resolution of the UV spectrum and the lack of co-spatial panchromatic data. We obtained far-UV to near-IR spectroscopy of the two principal emitting regions in the galaxy with the Space Telescope Imaging Spectrograph and the Cosmic Origins Spectrograph on board the Hubble Space Telescope. We use these data to study three clusters in the galaxy, A1, B1, and B2. We derive cluster ages of 3-4 Myr, intrinsic reddenings of E(B – V) = 0.13, 0.15, and 0.13, and cluster masses of 1.7 × 10{sup 5}, 1.4 × 10{sup 5}, and 1.1 × 10{sup 5} M {sub ☉}, respectively. A1 and B2 show O V λ1371 absorption from massive stars, which is rarely seen in star-forming galaxies, and have Wolf-Rayet (WR) to O star ratios of N(WN5-6)/N(O) = 0.23 and 0.10, respectively. The high N(WN5-6)/N(O) ratio of A1 cannot be reproduced by models that use a normal initial mass function (IMF) and generic WR star line luminosities. We rule out that the extraordinary He II λ1640 emission and O V λ1371 absorption of A1 are due to an extremely flat upper IMF exponent, and suggest that they originate in the winds of very massive (>120 M {sub ☉}) stars. In order to reproduce the properties of peculiar clusters such as A1, the present grid of stellar evolution tracks implemented in Starburst99 needs to be extended to masses >120 M {sub ☉}.
AMP-activated protein kinase phosphorylates CtBP1 and down-regulates its activity
Energy Technology Data Exchange (ETDEWEB)
Kim, Jae-Hwan; Choi, Soo-Youn; Kang, Byung-Hee; Lee, Soon-Min [National Creative Research Center for Epigenome Reprogramming Network, Departments of Biomedical Sciences and Biochemistry and Molecular Biology, Ischemic/Hypoxic Disease Institute, Seoul National University College of Medicine, Seoul 110-799 (Korea, Republic of); Park, Hyung Soon; Kang, Gum-Yong; Bang, Joo Young [Center for Biomedical Mass Spectrometry, Diatech Korea Co., Ltd., Seoul (Korea, Republic of); Cho, Eun-Jung [National Research Laboratory for Chromatin Dynamics, College of Pharmacy, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of); Youn, Hong-Duk, E-mail: hdyoun@snu.ac.kr [National Creative Research Center for Epigenome Reprogramming Network, Departments of Biomedical Sciences and Biochemistry and Molecular Biology, Ischemic/Hypoxic Disease Institute, Seoul National University College of Medicine, Seoul 110-799 (Korea, Republic of); WCU Department of Molecular Medicine and Biopharmaceutical Sciences, Graduate School of Convergence and Technology, Seoul National University, Seoul (Korea, Republic of)
2013-02-01
Highlights: ► AMPK phosphorylates CtBP1 on serine 158. ► AMPK-mediated phosphorylation of CtBP1 causes the ubiquitination and nuclear export of CtBP1. ► AMPK downregulates the CtBP1-mediated repression of Bax transcription. -- Abstract: CtBP is a transcriptional repressor which plays a significant role in the regulation of cell proliferation and tumor progression. It was reported that glucose withdrawal causes induction of Bax due to the dissociation of CtBP from the Bax promoter. However, the precise mechanism involved in the regulation of CtBP still remains unclear. In this study, we found that an activated AMP-activated protein kinase (AMPK) phosphorylates CtBP1 on Ser-158 upon metabolic stresses. Moreover, AMPK-mediated phosphorylation of CtBP1 (S158) attenuates the repressive function of CtBP1. We also confirmed that triggering activation of AMPK by various factors resulted in an increase of Bax gene expression. These findings provide connections of AMPK with CtBP1-mediated regulation of Bax expression for cell death under metabolic stresses.
Surface Water Sampling Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
MAGNETIC ACTIVITY CYCLES IN THE EXOPLANET HOST STAR {epsilon} ERIDANI
Energy Technology Data Exchange (ETDEWEB)
Metcalfe, T. S.; Mathur, S. [Space Science Institute, 4750 Walnut Street, Suite 205, Boulder, CO 80301 (United States); Buccino, A. P.; Mauas, P. J. D.; Petrucci, R. [Instituto de Astronomia y Fisica del Espacio (CONICET), C.C. 67 Sucursal 28, C1428EHA-Buenos Aires (Argentina); Brown, B. P. [Department of Astronomy and Center for Magnetic Self-Organization, University of Wisconsin, Madison, WI 53706-1582 (United States); Soderblom, D. R. [Space Telescope Science Institute, 3700 San Martin Dr., Baltimore, MD 21218 (United States); Henry, T. J. [Department of Physics and Astronomy, Georgia State University, Atlanta, GA 30302 (United States); Hall, J. C. [Lowell Observatory, 1400 West Mars Hill Road, Flagstaff, AZ 86001 (United States); Basu, S. [Department of Astronomy, Yale University, P.O. Box 208101, New Haven, CT 06520 (United States)
2013-02-01
The active K2 dwarf {epsilon} Eri has been extensively characterized both as a young solar analog and more recently as an exoplanet host star. As one of the nearest and brightest stars in the sky, it provides an unparalleled opportunity to constrain stellar dynamo theory beyond the Sun. We confirm and document the 3-year magnetic activity cycle in {epsilon} Eri originally reported by Hatzes and coworkers, and we examine the archival data from previous observations spanning 45 years. The data show coexisting 3-year and 13-year periods leading into a broad activity minimum that resembles a Maunder minimum-like state, followed by the resurgence of a coherent 3-year cycle. The nearly continuous activity record suggests the simultaneous operation of two stellar dynamos with cycle periods of 2.95 {+-} 0.03 years and 12.7 {+-} 0.3 years, which, by analogy with the solar case, suggests a revised identification of the dynamo mechanisms that are responsible for the so-called 'active' and 'inactive' sequences as proposed by Boehm-Vitense. Finally, based on the observed properties of {epsilon} Eri, we argue that the rotational history of the Sun is what makes it an outlier in the context of magnetic cycles observed in other stars (as also suggested by its Li depletion), and that a Jovian-mass companion cannot be the universal explanation for the solar peculiarities.
The puzzle of the CNO isotope ratios in asymptotic giant branch carbon stars
Abia, C.; Hedrosa, R. P.; Domínguez, I.; Straniero, O.
2017-03-01
. Excluding these peculiar stars, AGB carbon stars occupy the same region as pre-solar type I oxide grains in a 17O/16O vs. 18O/16O diagram, showing little spread. This reinforces the idea that these grains were probably formed in low-mass stars during the previous O-rich phases.
Energy Technology Data Exchange (ETDEWEB)
Herman, B. [BP Canada Energy Company, Calgary, AB (Canada)
2006-07-01
This presentation focused on why it is important to drive safely. It addressed driver fatigue as well as BP's global driving standard. The Standard applies to all BP employees and contractors that drive any vehicle on BP business and consists of 10 mandatory elements focusing on safety of the driver, the safety of the journey, and the safety of the vehicle. The driving standards focus on several themes, including skill and competency of the driver, safety of the journey, and safety of the vehicle. Fatigue causes more than 20 per cent of motorway accidents and is the most frequent cause of accidental death of truck drivers. The presentation also discussed vehicle data recorders, driving immersion, and Driving Safety Program results. Journey management, driver training, vehicle inspections and policies, and statistics on vehicle incidents were also provided. The presentation revealed that a lack of pre-trip journey management, inadequate training or recall of training, and not following safe driving practices were major contributors to incident occurrences. It also revealed that traveling on gravel or ice and avoiding wildlife were factors in many vehicle incidents. 1 tab., 1 fig.
Leconte, Jérémy; Wu, Hanbo; Menou, Kristen; Murray, Norman
2015-02-06
Planets in the habitable zone of lower-mass stars are often assumed to be in a state of tidally synchronized rotation, which would considerably affect their putative habitability. Although thermal tides cause Venus to rotate retrogradely, simple scaling arguments tend to attribute this peculiarity to the massive Venusian atmosphere. Using a global climate model, we show that even a relatively thin atmosphere can drive terrestrial planets' rotation away from synchronicity. We derive a more realistic atmospheric tide model that predicts four asynchronous equilibrium spin states, two being stable, when the amplitude of the thermal tide exceeds a threshold that is met for habitable Earth-like planets with a 1-bar atmosphere around stars more massive than ~0.5 to 0.7 solar mass. Thus, many recently discovered terrestrial planets could exhibit asynchronous spin-orbit rotation, even with a thin atmosphere. Copyright © 2015, American Association for the Advancement of Science.
Chantereau, W.; Charbonnel, C.; Meynet, G.
2016-08-01
Context. Globular clusters host multiple populations of long-lived low-mass stars whose origin remains an open question. Several scenarios have been proposed to explain the associated photometric and spectroscopic peculiarities. They differ, for instance, in the maximum helium enrichment they predict for stars of the second population, which these stars can inherit at birth as the result of the internal pollution of the cluster by different types of stars of the first population. Aims: We present the distribution of helium-rich stars in present-day globular clusters as it is expected in the original framework of the fast-rotating massive stars scenario (FRMS) as first-population polluters. We focus on NGC 6752. Methods: We completed a grid of 330 stellar evolution models for globular cluster low-mass stars computed with different initial chemical compositions corresponding to the predictions of the original FRMS scenario for [Fe/H] = -1.75. Starting from the initial helium-sodium relation that allows reproducing the currently observed distribution of sodium in NGC 6752, we deduce the helium distribution expected in that cluster at ages equal to 9 and 13 Gyr. We distinguish the stars that are moderately enriched in helium from those that are very helium-rich (initial helium mass fraction below and above 0.4, respectively), and compare the predictions of the FRMS framework with other scenarios for globular cluster enrichment. Results: The effect of helium enrichment on the stellar lifetime and evolution reduces the total number of very helium-rich stars that remain in the cluster at 9 and 13 Gyr to only 12% and 10%, respectively, from an initial fraction of 21%. Within this age range, most of the stars still burn their hydrogen in their core, which widens the MS band significantly in effective temperature. The fraction of very helium-rich stars drops in the more advanced evolution phases, where the associated spread in effective temperature strongly decreases. These
InterProScan Result: BP184018 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP184018 BP184018_2_ORF2 4FEA411FDBEADEDD PANTHER PTHR21347 CLEFT LIP AND PALATE ASSOCIATED TRANSME...MBRANE PROTEIN-RELATED 6.1e-73 T IPR008429 Cleft lip and palate transmembrane 1 ...
Monte Carlo simulation of star/linear and star/star blends with chemically identical monomers
Energy Technology Data Exchange (ETDEWEB)
Theodorakis, P E [Department of Materials Science and Engineering, University of Ioannina, 45110 Ioannina (Greece); Avgeropoulos, A [Department of Materials Science and Engineering, University of Ioannina, 45110 Ioannina (Greece); Freire, J J [Departamento de Ciencias y Tecnicas FisicoquImicas, Universidad Nacional de Educacion a Distancia, Facultad de Ciencias, Senda del Rey 9, 28040 Madrid (Spain); Kosmas, M [Department of Chemistry, University of Ioannina, 45110 Ioannina (Greece); Vlahos, C [Department of Chemistry, University of Ioannina, 45110 Ioannina (Greece)
2007-11-21
The effects of chain size and architectural asymmetry on the miscibility of blends with chemically identical monomers, differing only in their molecular weight and architecture, are studied via Monte Carlo simulation by using the bond fluctuation model. Namely, we consider blends composed of linear/linear, star/linear and star/star chains. We found that linear/linear blends are more miscible than the corresponding star/star mixtures. In star/linear blends, the increase in the volume fraction of the star chains increases the miscibility. For both star/linear and star/star blends, the miscibility decreases with the increase in star functionality. When we increase the molecular weight of linear chains of star/linear mixtures the miscibility decreases. Our findings are compared with recent analytical and experimental results.
Monte Carlo simulation of star/linear and star/star blends with chemically identical monomers
Theodorakis, P. E.; Avgeropoulos, A.; Freire, J. J.; Kosmas, M.; Vlahos, C.
2007-11-01
The effects of chain size and architectural asymmetry on the miscibility of blends with chemically identical monomers, differing only in their molecular weight and architecture, are studied via Monte Carlo simulation by using the bond fluctuation model. Namely, we consider blends composed of linear/linear, star/linear and star/star chains. We found that linear/linear blends are more miscible than the corresponding star/star mixtures. In star/linear blends, the increase in the volume fraction of the star chains increases the miscibility. For both star/linear and star/star blends, the miscibility decreases with the increase in star functionality. When we increase the molecular weight of linear chains of star/linear mixtures the miscibility decreases. Our findings are compared with recent analytical and experimental results.
Monte Carlo simulation of star/linear and star/star blends with chemically identical monomers
International Nuclear Information System (INIS)
Theodorakis, P E; Avgeropoulos, A; Freire, J J; Kosmas, M; Vlahos, C
2007-01-01
The effects of chain size and architectural asymmetry on the miscibility of blends with chemically identical monomers, differing only in their molecular weight and architecture, are studied via Monte Carlo simulation by using the bond fluctuation model. Namely, we consider blends composed of linear/linear, star/linear and star/star chains. We found that linear/linear blends are more miscible than the corresponding star/star mixtures. In star/linear blends, the increase in the volume fraction of the star chains increases the miscibility. For both star/linear and star/star blends, the miscibility decreases with the increase in star functionality. When we increase the molecular weight of linear chains of star/linear mixtures the miscibility decreases. Our findings are compared with recent analytical and experimental results
Multiple stellar generations in the Large Magellanic Cloud Star Cluster NGC 1846
Milone, Antonino
2010-09-01
The recent discovery of multiple stellar populations in massive Galactic globular clusters poses a serious challenge for models of star cluster formation and evolution. The finding of multiple main sequences in the massive clusters NGC 2808 and omega Centauri, and multiple sub-giant-branch in NGC 1851 and many other globulars have demonstrated that star clusters are not as simple as we have imagined for decades. Surprisingly the only way to explain the main sequence splitting appears to be Helium enrichment, up to an astonishingly high Y 0.40.An unique angle on this problem can be provided by intermediate-age clusters in the Magellanic Clouds with peculiar main-sequence turn-off morphologies. Recent discoveries, based on ACS data of unparalleled photometric accuracy, have demonstrated that the CMDs of a large fraction of these clusters { 70 %} are not consistent with the simple, single stellar population hypothesis. Explanations for what conditions could give rise to multiple populations in Galactic Globular Clusters remain controversial; this is even more the case for LMC clustersTo properly constraint the multipopulation phenomenon in Magellanic Cloud star clusters, we propose deep UV/IR imaging of NGC 1846, a star cluster where multiple populations have already been identified. The proposed observation will allow us to accurately measure the age difference between the stellar populations providing fundamental clues on the formation mechanism. Our simulations of WFC3 performance suggest that we will be able to detect even the main sequence splitting caused by small He differences {Delta Y 0.02}.
International Nuclear Information System (INIS)
Palmerini, S.; Busso, M.; Maiorca, E.; Cristallo, S.; Abia, C.; Uttenthaler, S.; Gialanella, L.
2011-01-01
of measuring very low Li abundances in O-rich AGB stars due to the presence of TiO bands and (2) the fact that many, relatively massive (M > 3 M sun ) K- and M-type giants may remain Li-rich, not evolving to the C-rich stages. Efficient extra mixing on the AGB is instead typical of very low masses (M ∼ sun ). It also characterizes CJ stars, where it produces Li and reduces F and the carbon isotope ratio, as observed in these peculiar objects.
A computational and observational study of peculiar galaxies in the Coma cluster
International Nuclear Information System (INIS)
Fujimoto, Mitsuaki; Sofue, Yoshiaki; Jugaku, Jun.
1977-01-01
Expected numbers of elliptical galaxies distorted tidally in the Coma cluster are formulated in terms of the various parameters of the cluster, and of cross section of galaxy-galaxy encounters and duration of associated tidal distributions. For the latter two quantities, numerical computations are carried out by simulating elliptical galaxies with hundreds of test particles. Comparisons are made with the number of peculiar galaxies observed in the Coma cluster. The hypothesis that the ''missing mass'' of the Coma cluster is hidden in the form of invisible galaxies or huge black holes of ordinary galaxy masses is also tested. It is concluded that tidal interaction between the visible galaxies plays only a minor role in the origin of the peculiar galaxies in the Coma cluster. Most of them would be due to their individual non-tidal mechanisms. If invisible galaxies or massive black holes are assumed as cluster members, their encounters with the luminous members increase the frequency of observable tidal distortion, and approximately half of the number of the peculiar galaxies could be explained in terms of tidal interaction. This result is discussed in relation to some special types of the peculiar galaxies in the Coma cluster. (auth.)
4977-bp mitochondrial DNA deletion in infertile patients with varicocele.
Gashti, N G; Salehi, Z; Madani, A H; Dalivandan, S T
2014-04-01
Varicocele is the abnormal inflexion and distension of veins of the pampiniform plexus within spermatic cord and is one of the amendable causes of male infertility. It can increase reactive oxygen species (ROS) production in semen and cause oxidative stress. The purpose of this study was to analyse spermatozoa mtDNA 4977-bp deletion in infertile men with varicocele. To detect 4977-bp deletion in spermatozoa mtDNA, semen samples of 60 infertile patients with clinical varicocele and 90 normal men from northern Iran were prepared. After extraction of spermatozoa total DNA, Gap polymerase chain reaction (Gap PCR) was performed. 4977-bp deletion was observed in 81.66% of patients with varicocele, while approximately 15.55% of controls had this deletion. As spermatozoa from patients with varicocele had a high frequency of occurrence of 4977-bp deletion in mtDNA [OR = 24.18, 95% confidence interval (CI) = 10.15-57.57, P deletion in spermatozoa and cause infertility in north Iranian men. However, to determine the relation between sperm mtDNA 4977-bp deletion and varicocele-induced infertility, larger population-based studies are needed. It is concluded that there is an association between sperm mtDNA 4977-bp deletion and varicocele-induced infertility in the population studied. © 2013 Blackwell Verlag GmbH.
InterProScan Result: BP116799 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP116799 BP116799_1_ORF2 D3F3F8C61868AD4C PANTHER PTHR11792 ARRESTIN 3.5e-15 T IPR000698 Arrestin Biological... Process: signal transduction (GO:0007165)|Biological Process: sensory perception (GO:0007600) ...
InterProScan Result: BP116799 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP116799 BP116799_1_ORF2 D3F3F8C61868AD4C PRINTS PR00309 ARRESTIN 6e-17 T IPR000698 Arrestin Biological... Process: signal transduction (GO:0007165)|Biological Process: sensory perception (GO:0007600) ...
Movimientos peculiares de galaxias en el Universo cercano
Alonso, M. V.
Se presenta un resumen de los resultados más importantes obtenidos en los últimos años sobre movimientos peculiares en el Universo Cercano. En el escenario de inestabilidad gravitacional, el campo de velocidades peculiares es una herramienta muy útil para estimar las fluctuaciones en la distribución de masa que generan los movimientos observados. Esta aproximación puede, además, ser utilizada para poner restricciones al espectro de potencia de la masa, a la relación entre las distribuciones de galaxias y de materia y al valor del parámetro de densidad cosmológico, Ω, a grandes escalas. Son además presentados una reconstrucción preliminar de los campos de densidad de masa y velocidades peculiares en el universo cercano usando nuevas medidas de distancias obtenidas con la relación Dn - σ, para una muestra de galaxias elípticas y lenticulares. Dos subestructuras prominentes son encontradas en la región del Gran Atractor, que corresponden a los complejos de Centaurus y Pavo--Indus. Estos últimos, junto a los complejos de Perseus--Piscis y Cetus parecen ser importantes estructuras que determinan el flujo global. El patrón obtenido a través de una muestra de galaxias elípticas muestra variaciones con respecto al obtenido por galaxias espirales. Estos nuevos resultados muestran una coherencia menor en el flujo global, cuando son comparados con resultados obtenidos anteriormente.
Tong, Hao; Xu, Renxin
2013-03-01
The X-ray dim isolated neutron stars (XDINSs) are peculiar pulsar-like objects, characterized by their very well Planck-like spectrum. In studying their spectral energy distributions, the optical/UV excess is a long standing problem. Recently, Kaplan et al. (2011) have measured the optical/UV excess for all seven sources, which is understandable in the resonant cyclotron scattering (RCS) model previously addressed. The RCS model calculations show that the RCS process can account for the observed optical/UV excess for most sources. The flat spectrum of RX J2143.0+0654 may due to contribution from bremsstrahlung emission of the electron system in addition to the RCS process.
The optical/ultraviolet excess of isolated neutron stars in the resonant cyclotron scattering model
Tong, Hao; Xu, Ren-Xin; Song, Li-Ming
2011-12-01
X-ray dim isolated neutron stars are peculiar pulsar-like objects, characterized by their Planck-like spectrum. In studying their spectral energy distributions, optical/ultraviolet (UV) excess is a long standing problem. Recently Kaplan et al. measured the optical/UV excess for all seven sources, which is understandable in the resonant cyclotron scattering (RCS) model previously addressed. The RCS model calculations show that the RCS process can account for the observed optical/UV excess for most sources. The flat spectrum of RX J2143.0+0654 may be due to contributions from the bremsstrahlung emission of the electron system in addition to the RCS process.
International Nuclear Information System (INIS)
Irvine, J.M.
1978-01-01
The subject is covered in chapters entitled: introduction (resume of stellar evolution, gross characteristics of neutron stars); pulsars (pulsar characteristics, pulsars as neutron stars); neutron star temperatures (neutron star cooling, superfluidity and superconductivity in neutron stars); the exterior of neutron stars (the magnetosphere, the neutron star 'atmosphere', pulses); neutron star structure; neutron star equations of state. (U.K.)
The MCM-associated protein MCM-BP is important for human nuclear morphology.
Jagannathan, Madhav; Sakwe, Amos M; Nguyen, Tin; Frappier, Lori
2012-01-01
Mini-chromosome maintenance complex-binding protein (MCM-BP) was discovered as a protein that is strongly associated with human MCM proteins, known to be crucial for DNA replication in providing DNA helicase activity. The Xenopus MCM-BP homologue appears to play a role in unloading MCM complexes from chromatin after DNA synthesis; however, the importance of MCM-BP and its functional contribution to human cells has been unclear. Here we show that depletion of MCM-BP by sustained expression of short hairpin RNA (shRNA) results in highly abnormal nuclear morphology and centrosome amplification. The abnormal nuclear morphology was not seen with depletion of other MCM proteins and was rescued with shRNA-resistant MCM-BP. MCM-BP depletion was also found to result in transient activation of the G2 checkpoint, slowed progression through G2 and increased replication protein A foci, indicative of replication stress. In addition, MCM-BP depletion led to increased cellular levels of MCM proteins throughout the cell cycle including soluble MCM pools. The results suggest that MCM-BP makes multiple contributions to human cells that are not limited to unloading of the MCM complex.
76 FR 69713 - Application To Export Electric Energy; BP Energy Company
2011-11-09
... DEPARTMENT OF ENERGY [OE Docket No. EA-314-A] Application To Export Electric Energy; BP Energy.... SUMMARY: BP Energy Company (BP Energy) has applied to renew its authority to transmit electric energy from... electric energy from the United States to Mexico as a power marketer for a five-year term using existing...
Directory of Open Access Journals (Sweden)
Наталія Приміна
2014-07-01
Full Text Available In the given article the psychological peculiarities of teaching future navigators reading English professional authentic documentation have been analyzed. The psychological foundations of understanding printed information in general and foreign information particularly have been disclosed. The processes of textual information perception and visual material perception comprehension have been analysed. The language levels of foreign text comprehension have been examined. The peculiarities of perceptual transformation of foreign language information while reading English sailing directions have been found out.
Expression of the Transcription Factor E4BP4 in Human Basophils
DEFF Research Database (Denmark)
Jensen, Bettina Margrethe; Gohr, Maria; Poulsen, Lars Kærgaard
2014-01-01
Rationale The cytokine IL-3 plays an important role for human basophil development, function and survival. IL-3 is also reported to induce the expression of the transcription factor E4BP4, but it is not known whether E4BP4 is expressed in basophils and influences basophil responsiveness. The aim...... by Alcian blue. RNA was extracted (0.005-0.02 µg RNA from 0.5 - 1 x 106 cells), and the corresponding cDNA analyzed by real-time PCR where E4BP4 expression was calculated as 2-(CT(E4BP4) - CT(β-actin)). E4BP4 protein expression was visualized in basophil lysates (107 cells/ml) by Western blot followed...... the transcription factor E4BP4 which might have an impact on basophil histamine release....
Nuclear Enterprises portable dose rate meter type PDR4 and external probes types BP1/1, BP8 and GP9
International Nuclear Information System (INIS)
Burgess, P.H.; Iles, W.J.
1979-08-01
The performance characteristics of Nuclear Enterprises Portable Dose Rate Meter Type PDR4 are evaluated under the headings: general description, facilities and controls, radiation characteristics, electrical characteristics, environmental characteristics, mechanical characteristics, the manual, summary of performance, and conclusions. Results of an investigation of the radiation characteristics of the external probes Type BP1/1, Type BP8, and Type GP9 are also detailed. (U.K.)
International Nuclear Information System (INIS)
Pyper, D.M.; Adelman, S.J.
1985-01-01
Optical region spectrophotometry results are presented for seven Ap stars. Additional data for two silicon stars, HD 34452 and CU Vir, show that both have energy distributions that can be fit by a single global model atmosphere, except for the lambda 4200 and lambda 5200 broad absorption features. These features are strong in HD 34452 and show no evidence of variation, while they are weak in CU Vir but show clear evidence of variations. The energy distributions of the five cooler Ap stars cannot be fit by a single model atmosphere. CQ UMa, CS Vir and β CrB all show complicated variations with phase at different wavelengths. Their energy distributions show combined effects of flux redistribution and differential line blanketing. Except for epsilon UMa, none of these five stars show evidence of variations of the lambda 4200 or lambda 5200 broad absorption features
Energy Technology Data Exchange (ETDEWEB)
Van den Heuvel, E. P. J. [Astronomical Institute Anton Pannekoek, University of Amsterdam, P.O. Box 94249, 1090 GE Amsterdam (Netherlands); Portegies Zwart, S. F. [Leiden Observatory, Leiden University, P.O. Box 9513, 2300 RA Leiden (Netherlands)
2013-12-20
Superluminous supernovae (SLSNe) occur almost exclusively in small galaxies (Small/Large Magellanic Cloud (SMC/LMC)-like or smaller), and the few SLSNe observed in larger star-forming galaxies always occur close to the nuclei of their hosts. Another type of peculiar and highly energetic supernovae are the broad-line Type Ic SNe (SN Ic-BL) that are associated with long-duration gamma-ray bursts (LGRBs). Also these have a strong preference for occurring in small (SMC/LMC-like or smaller) star-forming galaxies, and in these galaxies LGRBs always occur in the brightest spots. Studies of nearby star-forming galaxies that are similar to the hosts of LGRBs show that these brightest spots are giant H II regions produced by massive dense young star clusters with many hundreds of O- and Wolf-Rayet-type stars. Such dense young clusters are also found in abundance within a few hundred parsecs from the nucleus of larger galaxies like our own. We argue that the SLSNe and the SNe Ic-BL/LGRBs are exclusive products of two types of dynamical interactions in dense young star clusters. In our model the high angular momentum of the collapsing stellar cores required for the engines of an SN Ic-BL results from the post-main-sequence mergers of dynamically produced cluster binaries with almost equal-mass components. The merger produces a critically rotating single helium star with sufficient angular momentum to produce an LGRB; the observed 'metal aversion' of LGRBs is a natural consequence of the model. We argue that, on the other hand, SLSNe could be the products of runaway multiple collisions in dense clusters, and we present (and quantize) plausible scenarios of how the different types of SLSNe can be produced.
Intensive Versus Standard Blood Pressure Control in SPRINT-Eligible Participants of ACCORD-BP.
Buckley, Leo F; Dixon, Dave L; Wohlford, George F; Wijesinghe, Dayanjan S; Baker, William L; Van Tassell, Benjamin W
2017-12-01
We sought to determine the effect of intensive blood pressure (BP) control on cardiovascular outcomes in participants with type 2 diabetes mellitus (T2DM) and additional risk factors for cardiovascular disease (CVD). This study was a post hoc, multivariate, subgroup analysis of ACCORD-BP (Action to Control Cardiovascular Risk in Diabetes Blood Pressure) participants. Participants were eligible for the analysis if they were in the standard glucose control arm of ACCORD-BP and also had the additional CVD risk factors required for SPRINT (Systolic Blood Pressure Intervention Trial) eligibility. We used a Cox proportional hazards regression model to compare the effect of intensive versus standard BP control on CVD outcomes. The "SPRINT-eligible" ACCORD-BP participants were pooled with SPRINT participants to determine whether the effects of intensive BP control interacted with T2DM. The mean baseline Framingham 10-year CVD risk scores were 14.5% and 14.8%, respectively, in the intensive and standard BP control groups. The mean achieved systolic BP values were 120 and 134 mmHg in the intensive and standard BP control groups ( P control reduced the composite of CVD death, nonfatal myocardial infarction (MI), nonfatal stroke, any revascularization, and heart failure (hazard ratio 0.79; 95% CI 0.65-0.96; P = 0.02). Intensive BP control also reduced CVD death, nonfatal MI, and nonfatal stroke (hazard ratio 0.69; 95% CI 0.51-0.93; P = 0.01). Treatment-related adverse events occurred more frequently in participants receiving intensive BP control (4.1% vs. 2.1%; P = 0.003). The effect of intensive BP control on CVD outcomes did not differ between patients with and without T2DM ( P > 0.62). Intensive BP control reduced CVD outcomes in a cohort of participants with T2DM and additional CVD risk factors. © 2017 by the American Diabetes Association.
SALT reveals the barium central star of the planetary nebula Hen 2-39
Miszalski, B.; Boffin, H. M. J.; Jones, D.; Karakas, A. I.; Köppen, J.; Tyndall, A. A.; Mohamed, S. S.; Rodríguez-Gil, P.; Santander-García, M.
2013-12-01
Classical barium stars are binary systems which consist of a late-type giant enriched in carbon and slow neutron capture (s-process) elements and an evolved white dwarf (WD) that is invisible at optical wavelengths. The youngest observed barium stars are surrounded by planetary nebulae (PNe), ejected soon after the wind accretion of polluted material when the WD was in its preceding asymptotic giant branch (AGB) phase. Such systems are rare but powerful laboratories for studying AGB nucleosynthesis as we can measure the chemical abundances of both the polluted star and the nebula ejected by the polluter. Here, we present evidence for a barium star in the PN Hen 2-39 (PN G283.8-04.2) as one of only a few known systems. The polluted giant is very similar to that found in WeBo 1 (PN G135.6+01.0). It is a cool (Teff = 4250 ± 150 K) giant enhanced in carbon ([C/H] = 0.42 ± 0.02 dex) and barium ([Ba/Fe] = 1.50 ± 0.25 dex). A spectral type of C-R3 C24 nominally places Hen 2-39 amongst the peculiar early R-type carbon stars; however, the barium enhancement and likely binary status mean that it is more likely to be a barium star with similar properties, rather than a true member of this class. An AGB star model of initial mass 1.8 M⊙ and a relatively large carbon pocket size can reproduce the observed abundances well, provided mass is transferred in a highly conservative way from the AGB star to the polluted star (e.g. wind Roche lobe overflow). It also shows signs of chromospheric activity and photometric variability with a possible rotation period of ˜5.5 d likely induced by wind accretion. The nebula exhibits an apparent ring morphology in keeping with the other PNe around barium stars (WeBo 1 and A 70) and shows a high degree of ionization implying the presence of an invisible hot pre-WD companion that will require confirmation with UV observations. In contrast to A 70, the nebular chemical abundance pattern is consistent with non-Type I PNe, in keeping with the
International Nuclear Information System (INIS)
Boee, Reidulv; Lepland, Aivo; Blikra, Lars Harald; Longva, Oddvar; Soenstegaard, Eivind
2002-01-01
The Ormen Lange Gas Field was discovered in the Norwegian Sea outside the Moere og Romsdal in 1997. The development of this field which is located in the area of the Storegga Slide, requires safety assessment. The project aims to collect and compile data on slides, avalanches and gravitational faults that may have resulted from large earthquakes or tsunamis in the north west of Western Norway. A major task in the present project has been to investigate the spatial extent and interpret the origin of a postulated mass movement event ca. 2000 years ago and to evaluate its causes, climate variations, a tsunami (possibly caused by an earthquake affecting the offshore area), and earthquake only affecting parts of Western Norway or a combination of an earthquake and a tsunami. Several other mass movements, including the Storegga Slide tsunami deposits and pre-Storegga Slide slide and debris flow deposits have been studied both in the fjord and the lake sediments. Five of the 16 investigated fjords (Dalsfjorden, Foerdefjorden, Syvdsfjorden, Voldafjorden, Oerstadfjorden) provide evidence for a 2000 - 2200 years BP (calendar years before present, i.e. 1950) event. Previous investigations show no indication of a large shelf edge slide in the Storegga area, that may have created a tsunami at that time, nor are any mass movement deposits found on land or in the investigated lakes. This suggests that the 2000 - 2200 BP debris flows and turbidites were most likely related to one or more earthquakes on land or close to the coast and not an offshore mega slide generated tsunami. The Storegga Slide (8200 BP) tsunami deposits are observed in cores over most of the investigated area, both in the deep fjords and in lakes. Striking similarity between major slide and debris flow deposits at the 2000 - 2200 BP and ca. 11000 - 11700 BP stratigraphic levels suggest a common triggering mechanism, probably earthquakes with epicentres in the Sunnfjord Sunnmoere region. A period of debris flows
Gear Fault Diagnosis Based on BP Neural Network
Huang, Yongsheng; Huang, Ruoshi
2018-03-01
Gear transmission is more complex, widely used in machinery fields, which form of fault has some nonlinear characteristics. This paper uses BP neural network to train the gear of four typical failure modes, and achieves satisfactory results. Tested by using test data, test results have an agreement with the actual results. The results show that the BP neural network can effectively solve the complex state of gear fault in the gear fault diagnosis.
The peculiarity of animal complexes of chernozem
Directory of Open Access Journals (Sweden)
O. V. Zhukov
2005-02-01
Full Text Available The genetic connection of animal complexes and soil cover is in the basis of diagnostic ability of animals to indicate and quantity assessment of soil processes. The ecoiGgical view and peculiarity of soil animal complexes has the most impotent value. The soil animal complexes of steppe and their trans-formation under artificial forest are discussed
GRB 110530A: Peculiar Broad Bump and Delayed Plateau in Early Optical Afterglows
Zhong, Shu-Qing; Xin, Li-Ping; Liang, En-Wei; Wei, Jian-Yan; Urata, Yuji; Huang, Kui-Yun; Qiu, Yu-Lei; Deng, Can-Min; Wang, Yuan-Zhu; Deng, Jin-Song
2016-11-01
We report our very early optical observations of GRB 110530A and investigate its jet properties together with its X-ray afterglow data. A peculiar broad onset bump followed by a plateau is observed in its early R band afterglow light curve. The optical data in the other bands and the X-ray data are well consistent with the temporal feature of the R band light curve. Our joint spectral fits of the optical and X-ray data show that they are in the same regime, with a photon index of ∼1.70. The optical and X-ray afterglow light curves are well fitted with the standard external shock model by considering a delayed energy injection component. Based on our modeling results, we find that the radiative efficiency of the gamma-ray burst jet is ∼ 1 % and the magnetization parameter of the afterglow jet is \\lt 0.04 with a derived extremely low {ε }B (the ratio of shock energy to the magnetic field) of (1.64+/- 0.25)× {10}-6. These results indicate that the jet may be matter dominated. A discussion on delayed energy injection from the accretion of the late fall-back material of its pre-supernova star is also presented.
[Clinical significance of NS1-BP expression in esophageal squamous cell carcinoma].
Ren, K; Qian, D; Wang, Y W; Pang, Q S; Zhang, W C; Yuan, Z Y; Wang, P
2018-01-23
Objective: To investigate the clinical significance of NS1-BP expression in patients with esophageal squamous cell carcinoma (ESCC), and to study the roles of NS1-BP in proliferation and apoptosis of ESCC cells. Methods: A total of 98 tumor tissues and 30 adjacent normal tissues from 98 ESCC patients were used as study group and control group, and these samples were collected in Sun Yat-Sen University Cancer Center between 2002 and 2008. In addition, 46 ESCC tissues which were collected in Cancer Institute and Hospital of Tianjin Medical University were used as validation group. Expression of mucosal NS1-BP was detected by immunohistochemistry. Kaplan-Meier curve and log-rank test were used to analyze the survival rate. Multivariate Cox proportional hazard model was used to analyze the prognostic factors. Furthermore, NS1-BP was over expressed or knocked down in ESCC cells by transient transfection. Protein levels of c-Myc were detected by western blot. Cell viability and apoptosis was analyzed by MTT assay and flow cytometry. Results: Among all of tested samples, NS1-BP were down-regulated in 9 out of 30 non-tumorous normal esophageal tissues (30.0%) and 85 out of 144 ESCC tissues (59.0%), respectively, showing a statistically significant difference ( P =0.012). In the study group, three-year disease-free survival rate of NS1-BP high expression group (53.2%) was significantly higher than that of NS1-BP low expression group (27.6%; P =0.009). In the validation group, the three-year disease-free survival rates were 57.8% and 25.5% in NS1-BP high and low levels groups, respectively, showing a similar results ( P =0.016). Importantly, multivariate analyses showed that low expression of NS1-BP was an independent predictor for chemoradiotherapy sensitivity and shorter disease-free survival time in ESCC patients( P <0.05 for all). Furthermore, overexpressed NS1-BP in TE-1 cells repressed c-Myc expression, inhibited cell proliferation and promoted apoptosis. In contrast
Neutron Star Science with the NuSTAR
Energy Technology Data Exchange (ETDEWEB)
Vogel, J. K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2015-10-16
The Nuclear Spectroscopic Telescope Array (NuSTAR), launched in June 2012, helped scientists obtain for the first time a sensitive high-energy X-ray map of the sky with extraordinary resolution. This pioneering telescope has aided in the understanding of how stars explode and neutron stars are born. LLNL is a founding member of the NuSTAR project, with key personnel on its optics and science team. We used NuSTAR to observe and analyze the observations of different neutron star classes identified in the last decade that are still poorly understood. These studies not only help to comprehend newly discovered astrophysical phenomena and emission processes for members of the neutron star family, but also expand the utility of such observations for addressing broader questions in astrophysics and other physics disciplines. For example, neutron stars provide an excellent laboratory to study exotic and extreme phenomena, such as the equation of state of the densest matter known, the behavior of matter in extreme magnetic fields, and the effects of general relativity. At the same time, knowing their accurate populations has profound implications for understanding the life cycle of massive stars, star collapse, and overall galactic evolution.
Homoniuk, Olena; Pokudina, Larysa
2016-01-01
The article touches on the peculiarities of future finance and economics specialists' training in educational establishments of Western Europe and Ukraine. The problem of higher economic education has been considered. The experience of higher economic education organization in developed European countries has been generalized. The peculiarities of…
Energy Technology Data Exchange (ETDEWEB)
Richards, Joseph W.; Starr, Dan L.; Miller, Adam A.; Bloom, Joshua S.; Butler, Nathaniel R.; Berian James, J. [Astronomy Department, University of California, Berkeley, CA 94720-7450 (United States); Brink, Henrik [Dark Cosmology Centre, Juliane Maries Vej 30, 2100 Copenhagen O (Denmark); Long, James P.; Rice, John, E-mail: jwrichar@stat.berkeley.edu [Statistics Department, University of California, Berkeley, CA 94720-7450 (United States)
2012-01-10
Despite the great promise of machine-learning algorithms to classify and predict astrophysical parameters for the vast numbers of astrophysical sources and transients observed in large-scale surveys, the peculiarities of the training data often manifest as strongly biased predictions on the data of interest. Typically, training sets are derived from historical surveys of brighter, more nearby objects than those from more extensive, deeper surveys (testing data). This sample selection bias can cause catastrophic errors in predictions on the testing data because (1) standard assumptions for machine-learned model selection procedures break down and (2) dense regions of testing space might be completely devoid of training data. We explore possible remedies to sample selection bias, including importance weighting, co-training, and active learning (AL). We argue that AL-where the data whose inclusion in the training set would most improve predictions on the testing set are queried for manual follow-up-is an effective approach and is appropriate for many astronomical applications. For a variable star classification problem on a well-studied set of stars from Hipparcos and Optical Gravitational Lensing Experiment, AL is the optimal method in terms of error rate on the testing data, beating the off-the-shelf classifier by 3.4% and the other proposed methods by at least 3.0%. To aid with manual labeling of variable stars, we developed a Web interface which allows for easy light curve visualization and querying of external databases. Finally, we apply AL to classify variable stars in the All Sky Automated Survey, finding dramatic improvement in our agreement with the ASAS Catalog of Variable Stars, from 65.5% to 79.5%, and a significant increase in the classifier's average confidence for the testing set, from 14.6% to 42.9%, after a few AL iterations.
International Nuclear Information System (INIS)
Richards, Joseph W.; Starr, Dan L.; Miller, Adam A.; Bloom, Joshua S.; Butler, Nathaniel R.; Berian James, J.; Brink, Henrik; Long, James P.; Rice, John
2012-01-01
Despite the great promise of machine-learning algorithms to classify and predict astrophysical parameters for the vast numbers of astrophysical sources and transients observed in large-scale surveys, the peculiarities of the training data often manifest as strongly biased predictions on the data of interest. Typically, training sets are derived from historical surveys of brighter, more nearby objects than those from more extensive, deeper surveys (testing data). This sample selection bias can cause catastrophic errors in predictions on the testing data because (1) standard assumptions for machine-learned model selection procedures break down and (2) dense regions of testing space might be completely devoid of training data. We explore possible remedies to sample selection bias, including importance weighting, co-training, and active learning (AL). We argue that AL—where the data whose inclusion in the training set would most improve predictions on the testing set are queried for manual follow-up—is an effective approach and is appropriate for many astronomical applications. For a variable star classification problem on a well-studied set of stars from Hipparcos and Optical Gravitational Lensing Experiment, AL is the optimal method in terms of error rate on the testing data, beating the off-the-shelf classifier by 3.4% and the other proposed methods by at least 3.0%. To aid with manual labeling of variable stars, we developed a Web interface which allows for easy light curve visualization and querying of external databases. Finally, we apply AL to classify variable stars in the All Sky Automated Survey, finding dramatic improvement in our agreement with the ASAS Catalog of Variable Stars, from 65.5% to 79.5%, and a significant increase in the classifier's average confidence for the testing set, from 14.6% to 42.9%, after a few AL iterations.
Richards, Joseph W.; Starr, Dan L.; Brink, Henrik; Miller, Adam A.; Bloom, Joshua S.; Butler, Nathaniel R.; James, J. Berian; Long, James P.; Rice, John
2012-01-01
Despite the great promise of machine-learning algorithms to classify and predict astrophysical parameters for the vast numbers of astrophysical sources and transients observed in large-scale surveys, the peculiarities of the training data often manifest as strongly biased predictions on the data of interest. Typically, training sets are derived from historical surveys of brighter, more nearby objects than those from more extensive, deeper surveys (testing data). This sample selection bias can cause catastrophic errors in predictions on the testing data because (1) standard assumptions for machine-learned model selection procedures break down and (2) dense regions of testing space might be completely devoid of training data. We explore possible remedies to sample selection bias, including importance weighting, co-training, and active learning (AL). We argue that AL—where the data whose inclusion in the training set would most improve predictions on the testing set are queried for manual follow-up—is an effective approach and is appropriate for many astronomical applications. For a variable star classification problem on a well-studied set of stars from Hipparcos and Optical Gravitational Lensing Experiment, AL is the optimal method in terms of error rate on the testing data, beating the off-the-shelf classifier by 3.4% and the other proposed methods by at least 3.0%. To aid with manual labeling of variable stars, we developed a Web interface which allows for easy light curve visualization and querying of external databases. Finally, we apply AL to classify variable stars in the All Sky Automated Survey, finding dramatic improvement in our agreement with the ASAS Catalog of Variable Stars, from 65.5% to 79.5%, and a significant increase in the classifier's average confidence for the testing set, from 14.6% to 42.9%, after a few AL iterations.
A new BP Fourier algorithm and its application in English teaching evaluation
Pei, Xuehui; Pei, Guixin
2017-08-01
BP neural network algorithm has wide adaptability and accuracy when used in complicated system evaluation, but its calculation defects such as slow convergence have limited its practical application. The paper tries to speed up the calculation convergence of BP neural network algorithm with Fourier basis functions and presents a new BP Fourier algorithm for complicated system evaluation. First, shortages and working principle of BP algorithm are analyzed for subsequent targeted improvement; Second, the presented BP Fourier algorithm adopts Fourier basis functions to simplify calculation structure, designs new calculation transfer function between input and output layers, and conducts theoretical analysis to prove the efficiency of the presented algorithm; Finally, the presented algorithm is used in evaluating university English teaching and the application results shows that the presented BP Fourier algorithm has better performance in calculation efficiency and evaluation accuracy and can be used in evaluating complicated system practically.
InterProScan Result: BP117067 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP117067 BP117067_1_ORF2 D483359C05197373 PFAM PF00067 p450 6e-05 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...
International Nuclear Information System (INIS)
Conti, P.S.; Underhill, A.B.; Jordan, S.; Thomas, R.
1988-01-01
Basic information is given about O and Wolf-Rayet stars indicating how these stars are defined and what their chief observable properties are. Part 2 of the volume discussed four related themes pertaining to the hottest and most luminous stars. Presented are: an observational overview of the spectroscopic classification and extrinsic properties of O and Wolf-Rayet stars; the intrinsic parameters of luminosity, effective temperature, mass, and composition of the stars, and a discussion of their viability; stellar wind properties; and the related issues concerning the efforts of stellar radiation and wind on the immediate interstellar environment are presented
Conti, Peter S.; Underhill, Anne B.; Jordan, Stuart (Editor); Thomas, Richard (Editor)
1988-01-01
Basic information is given about O and Wolf-Rayet stars indicating how these stars are defined and what their chief observable properties are. Part 2 of the volume discussed four related themes pertaining to the hottest and most luminous stars. Presented are: an observational overview of the spectroscopic classification and extrinsic properties of O and Wolf-Rayet stars; the intrinsic parameters of luminosity, effective temperature, mass, and composition of the stars, and a discussion of their viability; stellar wind properties; and the related issues concerning the efforts of stellar radiation and wind on the immediate interstellar environment are presented.
InterProScan Result: BP124291 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP124291 BP124291_5_ORF1 92B626ADD33C8436 PFAM PF00067 p450 1.8e-09 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...
InterProScan Result: BP123442 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP123442 BP123442_1_ORF1 331440C6CA592A17 PRINTS PR00385 P450 6.3e-05 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...
TopBP1 associates with NBS1 and is involved in homologous recombination repair
International Nuclear Information System (INIS)
Morishima, Ken-ichi; Sakamoto, Shuichi; Kobayashi, Junya; Izumi, Hideki; Suda, Tetsuji; Matsumoto, Yoshiyuki; Tauchi, Hiroshi; Ide, Hiroshi; Komatsu, Kenshi; Matsuura, Shinya
2007-01-01
TopBP1 is involved in DNA replication and DNA damage checkpoint. Recent studies have demonstrated that TopBP1 is a direct positive effecter of ATR. However, it is not known how TopBP1 recognizes damaged DNA. Here, we show that TopBP1 formed nuclear foci after exposure to ionizing radiation, but such TopBP1 foci were abolished in Nijmegen breakage syndrome cells. We also show that TopBP1 physically associated with NBS1 in vivo. These results suggested that NBS1 might regulate TopBP1 recruitment to the sites of DNA damage. TopBP1-depleted cells showed hypersensitivity to Mitomycin C and ionizing radiation, an increased frequency of sister-chromatid exchange level, and a reduced frequency of DNA double-strand break induced homologous recombination repair. Together, these results suggested that TopBP1 might be a mediator of DNA damage signaling from NBS1 to ATR and promote homologous recombination repair
The human element of right-sizing. BP experiences
International Nuclear Information System (INIS)
Hollis, J.W.
1994-01-01
BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning
The human element of right-sizing. BP experiences
Energy Technology Data Exchange (ETDEWEB)
Hollis, J W [BP Norge (Norway)
1994-12-31
BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning
Rotational Evolution and Magnetic Field of AP Stars
Xiaojun, C.; Matsuura, O. T.
1990-11-01
RESUMO. Prop6e- se qLie 0 campo de estrelas Ap pode ser 9cr ado pelo mecanismo de na base clo envelope c 0 fl V C C t V 0, C t r a ri S p 0 r t a d C) p a r a a S LI p e r f C 1 e p e I a Instabllidade de boiament 0 na ase de Haya hi. Campos cibservados permit em est imar uma perda de momento durante a ase pr -Seque%nC:ia P r ri C: p a I a ci ni p a t V C I C: C) m a s C) b s e r V a nT C 5. E S t r C I a S A normals, que ro t a ao , ria0 most ram camp Os :os superficia; importantes e isto pode ac:oriteaer C LIma protoestrela evolue para Sequencia Principal em passar pela fase de Hayashi. ABSTRACT: It 5 proposed that the ma9netic field o Ap stars may be enerated by the dynamo at the base of the convective envelope, arid transported to the surface b y t h C i ri s t a b iii t y C) f b LI 0 y a n c y i n t h C H a y a s hi p h a s e. Observed surface ma9netic fields allow to estimate a 1055 of an9ular momentum during the pre-Main Sequence phase compatible with the observations. apidIy rotating normal A stars do not shciw important surface magnetic fields and this may occur if a protostar evcilves to Main Sequence skipping the Hayashi phase. Key words: HYDROMAGNETICS - STARS-PECULIAR A
A robust star identification algorithm with star shortlisting
Mehta, Deval Samirbhai; Chen, Shoushun; Low, Kay Soon
2018-05-01
A star tracker provides the most accurate attitude solution in terms of arc seconds compared to the other existing attitude sensors. When no prior attitude information is available, it operates in "Lost-In-Space (LIS)" mode. Star pattern recognition, also known as star identification algorithm, forms the most crucial part of a star tracker in the LIS mode. Recognition reliability and speed are the two most important parameters of a star pattern recognition technique. In this paper, a novel star identification algorithm with star ID shortlisting is proposed. Firstly, the star IDs are shortlisted based on worst-case patch mismatch, and later stars are identified in the image by an initial match confirmed with a running sequential angular match technique. The proposed idea is tested on 16,200 simulated star images having magnitude uncertainty, noise stars, positional deviation, and varying size of the field of view. The proposed idea is also benchmarked with the state-of-the-art star pattern recognition techniques. Finally, the real-time performance of the proposed technique is tested on the 3104 real star images captured by a star tracker SST-20S currently mounted on a satellite. The proposed technique can achieve an identification accuracy of 98% and takes only 8.2 ms for identification on real images. Simulation and real-time results depict that the proposed technique is highly robust and achieves a high speed of identification suitable for actual space applications.
A peculiar low-luminosity short gamma-ray burst from a double neutron star merger progenitor.
Zhang, B-B; Zhang, B; Sun, H; Lei, W-H; Gao, H; Li, Y; Shao, L; Zhao, Y; Hu, Y-D; Lü, H-J; Wu, X-F; Fan, X-L; Wang, G; Castro-Tirado, A J; Zhang, S; Yu, B-Y; Cao, Y-Y; Liang, E-W
2018-01-31
Double neutron star (DNS) merger events are promising candidates of short gamma-ray burst (sGRB) progenitors as well as high-frequency gravitational wave (GW) emitters. On August 17, 2017, such a coinciding event was detected by both the LIGO-Virgo gravitational wave detector network as GW170817 and Gamma-Ray Monitor on board NASA's Fermi Space Telescope as GRB 170817A. Here, we show that the fluence and spectral peak energy of this sGRB fall into the lower portion of the distributions of known sGRBs. Its peak isotropic luminosity is abnormally low. The estimated event rate density above this luminosity is at least [Formula: see text] Gpc -3 yr -1 , which is close to but still below the DNS merger event rate density. This event likely originates from a structured jet viewed from a large viewing angle. There are similar faint soft GRBs in the Fermi archival data, a small fraction of which might belong to this new population of nearby, low-luminosity sGRBs.
Star-Branched Polymers (Star Polymers)
Hirao, Akira
2015-09-01
The synthesis of well-defined regular and asymmetric mixed arm (hereinafter miktoarm) star-branched polymers by the living anionic polymerization is reviewed in this chapter. In particular, much attention is being devoted to the synthetic development of miktoarm star polymers since 2000. At the present time, the almost all types of multiarmed and multicomponent miktoarm star polymers have become feasible by using recently developed iterative strategy. For example, the following well-defined stars have been successfully synthesized: 3-arm ABC, 4-arm ABCD, 5-arm ABCDE, 6-arm ABCDEF, 7-arm ABCDEFG, 6-arm ABC, 9-arm ABC, 12-arm ABC, 13-arm ABCD, 9-arm AB, 17-arm AB, 33-arm AB, 7-arm ABC, 15-arm ABCD, and 31-arm ABCDE miktoarm star polymers, most of which are quite new and difficult to synthesize by the end of the 1990s. Several new specialty functional star polymers composed of vinyl polymer segments and rigid rodlike poly(acetylene) arms, helical polypeptide, or helical poly(hexyl isocyanate) arms are introduced.
International Nuclear Information System (INIS)
Switsur, Roy
1986-01-01
A history of the development of the technique of radiocarbon dating highlights the two problems with this method. The first is calibration; the radiocarbon calendar is not linear. However two independent experiments to provide high precision measurements in tree rings have resulted in a high precision calibration curve. The second is how to denote radiocarbon ages and calibrated dates, as this depends on how the dendrochronology time scale used in the calibration is transferred to the actual calendar. If the zero of the dendroscale is transferred from the origin of the Christian calendar to AD 1950, radiocarbon ages are designated CAL BP (BP = before present). There is an alternative method which results in CAL AD and CAL BC. A suggestion for a standard notation is made to avoid the confusion of two systems. (U.K.)
Massive Star Burps, Then Explodes
2007-04-01
evolved stars that have shed their outer envelopes. Swift XRT Image Swift XRT Image (Credit: NASA / GSFC / CXC /S.Immler) Most astronomers did not expect that a massive star would explode so soon after a major outburst, or that a Wolf-Rayet star would produce such a luminous eruption, so SN 2006jc represents a puzzle for theorists. "It challenges some aspects of our current model of stellar evolution," says Foley. "We really don't know what caused this star to have such a large eruption so soon before it went supernova." "SN 2006jc provides us with an important clue that LBV-style eruptions may be related to the deaths of massive stars, perhaps more closely than we used to think," adds coauthor and UC Berkeley astronomer Nathan Smith. "The fact that we have no well-established theory for what actually causes these outbursts is the elephant in the living room that nobody is talking about." SN 2006jc occurred in galaxy UGC 4904, located 77 million light years from Earth in the constellation Lynx. The supernova explosion, a peculiar variant of a Type Ib, was first sighted by Itagaki, American amateur astronomer Tim Puckett and Italian amateur astronomer Roberto Gorelli. See also NASA Goddard press release at: http://www.nasa.gov/centers/goddard/news/topstory/ 2007/supernova_imposter.html
BP teatas harvast edusammust / Hendrik Vosman
Vosman, Hendrik
2010-01-01
Naftakompanii BP teatas, et suudab Mehhiko lahest päevas kinni püüda sinna lekkinud 10 000 barrelit naftat. Tegu on ajutise lahendusega, lõplikult peaks naftavoo peatama merepõhja puuritavad nn. asenduskaevud
International Nuclear Information System (INIS)
Iwabuchi, Kuniyoshi; Matsui, Tadashi; Hashimoto, Mitsumasa; Matsumoto, Yoshihisa; Kurihara, Takayuki; Date, Takayasu
2008-01-01
53BP1 plays important roles in checkpoint signaling and repair for DNA double-strand breaks. We found that a colon cancer cell line, SW48, expressed a splicing variant form of 53BP1, which lacks the residues corresponding to exons 10 and 11. Activation of ATM and phosphorylation of ATM and ATR targets occurred in SW48 cells in response to X-irradiation, and these X-ray-induced responses were not enhanced by expression of full-length 53BP1 in SW48 cells, indicating that this splicing variant fully activates the major checkpoint signaling in SW48 cells. In contrast, the expression of full-length 53BP1 in SW48 cells promoted the repair of X-ray-induced DNA damage, evidenced by faster disappearance of X-ray-induced γ-H2AX foci, a marker for DNA damage, and less residual chromosomal aberrations after X-irradiation. We conclude that the two major roles of 53BP1, the checkpoint signaling and repair for DNA damage, can be functionally separated
IGF2BP3 Modulates the Interaction of Invasion-Associated Transcripts with RISC
Directory of Open Access Journals (Sweden)
Hanane Ennajdaoui
2016-05-01
Full Text Available Insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3 expression correlates with malignancy, but its role(s in pathogenesis remains enigmatic. We interrogated the IGF2BP3-RNA interaction network in pancreatic ductal adenocarcinoma (PDAC cells. Using a combination of genome-wide approaches, we have identified 164 direct mRNA targets of IGF2BP3. These transcripts encode proteins enriched for functions such as cell migration, proliferation, and adhesion. Loss of IGF2BP3 reduced PDAC cell invasiveness and remodeled focal adhesion junctions. Individual nucleotide resolution crosslinking immunoprecipitation (iCLIP revealed significant overlap of IGF2BP3 and microRNA (miRNA binding sites. IGF2BP3 promotes association of the RNA-induced silencing complex (RISC with specific transcripts. Our results show that IGF2BP3 influences a malignancy-associated RNA regulon by modulating miRNA-mRNA interactions.
IGF2BP3 Modulates the Interaction of Invasion-Associated Transcripts with RISC.
Ennajdaoui, Hanane; Howard, Jonathan M; Sterne-Weiler, Timothy; Jahanbani, Fereshteh; Coyne, Doyle J; Uren, Philip J; Dargyte, Marija; Katzman, Sol; Draper, Jolene M; Wallace, Andrew; Cazarez, Oscar; Burns, Suzanne C; Qiao, Mei; Hinck, Lindsay; Smith, Andrew D; Toloue, Masoud M; Blencowe, Benjamin J; Penalva, Luiz O F; Sanford, Jeremy R
2016-05-31
Insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3) expression correlates with malignancy, but its role(s) in pathogenesis remains enigmatic. We interrogated the IGF2BP3-RNA interaction network in pancreatic ductal adenocarcinoma (PDAC) cells. Using a combination of genome-wide approaches, we have identified 164 direct mRNA targets of IGF2BP3. These transcripts encode proteins enriched for functions such as cell migration, proliferation, and adhesion. Loss of IGF2BP3 reduced PDAC cell invasiveness and remodeled focal adhesion junctions. Individual nucleotide resolution crosslinking immunoprecipitation (iCLIP) revealed significant overlap of IGF2BP3 and microRNA (miRNA) binding sites. IGF2BP3 promotes association of the RNA-induced silencing complex (RISC) with specific transcripts. Our results show that IGF2BP3 influences a malignancy-associated RNA regulon by modulating miRNA-mRNA interactions. Copyright © 2016 The Author(s). Published by Elsevier Inc. All rights reserved.
BP Canada Energy Company : climate change action plan update 1999-2000
International Nuclear Information System (INIS)
2001-10-01
An aggressive, world-wide target for a 10 per cent reduction of greenhouse gas emissions was set by BP p.l.c. and BP Canada Energy Company has supported this endeavour. Six major areas have been identified as offering potential solutions to the problem of climate change: the control of greenhouse gases, the conservation of energy, the introduction of new technologies, the promotion of flexible market instruments, the participation in the policy process, and an investment in research. This document reviewed the efforts expanded to date in those areas. It was noted that a deliberate shift was made by BP leadership from oil to natural gas production, releasing much less carbon dioxide in the atmosphere when burned. A brief overview of the operations of BP Canada Energy Company was provided in chapter 1, followed by the philosophy concerning greenhouse gases in chapter 2. In chapter 3, the topic of BP's global emissions trading system was discussed. The current and projected greenhouse gas emissions were looked at in chapter 4, while chapter 5 dealt with setting global targets, with specific emphasis on Canadian targets. In chapter 6 , the emphasis was placed on BP's emission reduction initiatives. In chapter 7, the question of raising awareness was examined. 7 tabs., 7 figs
Statistical investigation of flare stars. III. Flare stars in the general galactic star field
International Nuclear Information System (INIS)
Mirzoyan, L.V.; Ambaryan, V.V.; Garibdzhanyan, A.T.; Mirzoyan, A.L.
1989-01-01
Some questions relating to the existence of a large number of flare stars in the general star field of the Galaxy are discussed. It is shown that only a small proportion of them can be found by photographic observations, and the fraction of field flare stars among such stars found in the regions of star clusters and associations does not exceed 10%. The ratio of the numbers of flare stars of the foreground and the background for a particular system depends on its distance, reaching zero at a distance of about 500 pc. The spatial density of flare stars in the Pleiades is at least two orders of magnitude greater than in the general galactic field. A lower limit for the number of flare stars in the Galaxy is estimated at 4.2 ·10 9 , and the number of nonflare red dwarfs at 2.1·10 10 . There are grounds for believing that they were all formed in star clusters and associations
Planck intermediate results: XIII. Constraints on peculiar velocities
DEFF Research Database (Denmark)
Cardoso, J.-F.; Delabrouille, J.; Ganga, K.
2014-01-01
Using Planck data combined with the Meta Catalogue of X-ray detected Clusters of galaxies (MCXC), we address the study of peculiar motions by searching for evidence of the kinetic Sunyaev-Zeldovich effect (kSZ). By implementing various filters designed to extract the kSZ generated at the position...
Neutron star/red giant encounters in globular clusters
International Nuclear Information System (INIS)
Bailyn, C.D.
1988-01-01
The author presents a simple expression for the amount by which xsub(crit) is diminished as a star evolves xsub(crit) Rsub(crit)/R*, where Rsub(crit) is the maximum distance of closest approach between two stars for which the tidal energy is sufficient to bind the system, and R* is the radius of the star on which tides are being raised. Also it is concluded that tidal capture of giants by neutron stars resulting in binary systems is unlikely in globular clusters. However, collisions between neutron stars and red giants, or an alternative process involving tidal capture of a main-sequence star into an initially detached binary system, may result either in rapidly rotating neutron stars or in white dwarf/neutron star binaries. (author)
Preliminary Geological Findings on the BP-1 Simulant
Stoeser, D. B.; Rickman, D. L.; Wilson, S.
2010-01-01
A waste material from an aggregate producing quarry has been used to make an inexpensive lunar simulant called BP-1. The feedstock is the Black Point lava flow in northern Arizona. Although this is part of the San Francisco volcanic field, which is also the source of the JSC-1 series feedstock, BP-1 and JSC-1 are distinct. Chemically, the Black Point flow is an amygdaloidal nepheline-bearing basalt. The amygdules are filled with secondary minerals containing opaline silica, calcium carbonate, and ferric iron minerals. X-ray diffraction (XRD) detected approximately 3% quartz, which is in line with tests done by the Kennedy Space Center Industrial Hygiene Office. Users of this material should use appropriate protective equipment. XRD also showed the presence of significant halite and some bassanite. Both are interpreted to be evaporative residues due to recycling of wash water at the quarry. The size distribution of BP-1 may be superior to some other simulants for some applications.
International Nuclear Information System (INIS)
Boyarchuk, A.A.
1975-01-01
There are some arguments that the symbiotic stars are binary, where one component is a red giant and the other component is a small hot star which is exciting a nebula. The symbiotic stars belong to the old disc population. Probably, symbiotic stars are just such an evolutionary stage for double stars as planetary nebulae for single stars. (Auth.)
Quark core stars, quark stars and strange stars
International Nuclear Information System (INIS)
Grassi, F.
1988-01-01
A recent one flavor quark matter equation of state is generalized to several flavors. It is shown that quarks undergo a first order phase transition. In addition, this equation of state depends on just one parameter in the two flavor case, two parameters in the three flavor case, and these parameters are constrained by phenomenology. This equation of state is then applied to the hadron-quark transition in neutron stars and the determination of quark star stability, the investigation of strange matter stability and possible strange star existence. 43 refs., 6 figs
"Movie Star" Acting Strangely, Radio Astronomers Find
1999-01-01
Astronomers have used the National Science Foundation's Very Long Baseline Array (VLBA) radio telescope to make the first-ever time-lapse "movie" showing details of gas motions around a star other than our Sun. The study, the largest observational project yet undertaken using Very Long Baseline Interferometry, has produced surprising results that indicate scientists do not fully understand stellar atmospheres. The "movie" shows that the atmosphere of a pulsating star more than 1,000 light-years away continues to expand during a part of the star's pulsation period in which astronomers expected it to start contracting. Philip Diamond and Athol Kemball, of the National Radio Astronomy Observatory (NRAO) in Socorro, New Mexico, announced their findings at the American Astronomical Society's meeting in Austin, TX, today. "The continued expansion we're seeing contradicts current theoretical models for how these stars work," Diamond said. "The models have assumed spherical symmetry in the star's atmosphere, and our movie shows that this is not the case. Such models suggest that a shock wave passes outward from the star. Once it's passed, then the atmosphere should begin to contract because of the star's gravity. We've long passed that point and the contraction has not begun." The time-lapse images show that the gas motions are not uniform around the star. Most of the motion is that of gas moving directly outward from the star's surface. However, in about one-fourth of the ring, there are peculiar motions that do not fit this pattern. The scientists speculate that the rate of mass loss may not be the same from all parts of the star's surface. "A similar star behaved as predicted when studied a few years ago, so we're left to wonder what's different about this one," Diamond said. "Right now, we think that different rates of mass loss in the two stars may be the cause of the difference. This star is losing mass at 100 times the rate of the star in the earlier study." "This
Conformational Dynamics of apo-GlnBP Revealed by Experimental and Computational Analysis
Feng, Yitao
2016-10-13
The glutamine binding protein (GlnBP) binds l-glutamine and cooperates with its cognate transporters during glutamine uptake. Crystal structure analysis has revealed an open and a closed conformation for apo- and holo-GlnBP, respectively. However, the detailed conformational dynamics have remained unclear. Herein, we combined NMR spectroscopy, MD simulations, and single-molecule FRET techniques to decipher the conformational dynamics of apo-GlnBP. The NMR residual dipolar couplings of apo-GlnBP were in good agreement with a MD-derived structure ensemble consisting of four metastable states. The open and closed conformations are the two major states. This four-state model was further validated by smFRET experiments and suggests the conformational selection mechanism in ligand recognition of GlnBP. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim
Fault Diagnosis of Power System Based on Improved Genetic Optimized BP-NN
Directory of Open Access Journals (Sweden)
Yuan Pu
2015-01-01
Full Text Available BP neural network (Back-Propagation Neural Network, BP-NN is one of the most widely neural network models and is applied to fault diagnosis of power system currently. BP neural network has good self-learning and adaptive ability and generalization ability, but the operation process is easy to fall into local minima. Genetic algorithm has global optimization features, and crossover is the most important operation of the Genetic Algorithm. In this paper, we can modify the crossover of traditional Genetic Algorithm, using improved genetic algorithm optimized BP neural network training initial weights and thresholds, to avoid the problem of BP neural network fall into local minima. The results of analysis by an example, the method can efficiently diagnose network fault location, and improve fault-tolerance and grid fault diagnosis effect.
Conformational Dynamics of apo-GlnBP Revealed by Experimental and Computational Analysis
Feng, Yitao; Zhang, Lu; Wu, Shaowen; Liu, Zhijun; Gao, Xin; Zhang, Xu; Liu, Maili; Liu, Jianwei; Huang, Xuhui; Wang, Wenning
2016-01-01
The glutamine binding protein (GlnBP) binds l-glutamine and cooperates with its cognate transporters during glutamine uptake. Crystal structure analysis has revealed an open and a closed conformation for apo- and holo-GlnBP, respectively. However, the detailed conformational dynamics have remained unclear. Herein, we combined NMR spectroscopy, MD simulations, and single-molecule FRET techniques to decipher the conformational dynamics of apo-GlnBP. The NMR residual dipolar couplings of apo-GlnBP were in good agreement with a MD-derived structure ensemble consisting of four metastable states. The open and closed conformations are the two major states. This four-state model was further validated by smFRET experiments and suggests the conformational selection mechanism in ligand recognition of GlnBP. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim
Estrelas magnéticas quimicamente peculiares
Fraga, Luciano
2006-01-01
Tese (doutorado) - Universidade Federal de Santa Catarina, Centro de Ciências Físicas e Matemáticas - Programa de Pós-Graduação em Física. Apresentamos nesta tese os resultados de três estudos observacionais relacionados com as estrelas Ap, assim como a sub-classe das estrelas rapidamente oscilantes (roAp). No primeiro estudo, investigamos o estado evolutivo das estrelas Ap visando responder a seguinte pergunta: as estrelas nascem peculiares, ou desenvolvem suas peculiaridades ao longo de...
Peculiarities of Modern Foreign Policy of Iran
Directory of Open Access Journals (Sweden)
V I Yourtaev
2012-06-01
Full Text Available The article is focuses on the analysis of the main peculiarities of modern foreign policy of iranian President M. Ahmadinejad, his constructive interaction concept in foreign policy. The formation of the nuclear gate for entering into world policy and basic problems of Iranian development as a new regional leader in the context of globalization and international relations transformation process are considered.
TopBP1-mediated DNA processing during mitosis.
Gallina, Irene; Christiansen, Signe Korbo; Pedersen, Rune Troelsgaard; Lisby, Michael; Oestergaard, Vibe H
2016-01-01
Maintenance of genome integrity is crucial to avoid cancer and other genetic diseases. Thus faced with DNA damage, cells mount a DNA damage response to avoid genome instability. The DNA damage response is partially inhibited during mitosis presumably to avoid erroneous processing of the segregating chromosomes. Yet our recent study shows that TopBP1-mediated DNA processing during mitosis is highly important to reduce transmission of DNA damage to daughter cells. (1) Here we provide an overview of the DNA damage response and DNA repair during mitosis. One role of TopBP1 during mitosis is to stimulate unscheduled DNA synthesis at underreplicated regions. We speculated that such genomic regions are likely to hold stalled replication forks or post-replicative gaps, which become the substrate for DNA synthesis upon entry into mitosis. Thus, we addressed whether the translesion pathways for fork restart or post-replicative gap filling are required for unscheduled DNA synthesis in mitosis. Using genetics in the avian DT40 cell line, we provide evidence that unscheduled DNA synthesis in mitosis does not require the translesion synthesis scaffold factor Rev1 or PCNA ubiquitylation at K164, which serve to recruit translesion polymerases to stalled forks. In line with this finding, translesion polymerase η foci do not colocalize with TopBP1 or FANCD2 in mitosis. Taken together, we conclude that TopBP1 promotes unscheduled DNA synthesis in mitosis independently of the examined translesion polymerases.
BP pääseb lekkest kuiva nahaga / Heiki Suurkask
Suurkask, Heiki, 1972-
2010-01-01
BP saab peagi valmis tagavara-naftapuuraugu, lekkinud puuraugule õnnestus peale valada betoonkiht. Autor märgib, et tegelikult ei saa USA võimud ühtegi edusammu naftalekke peatamisel selgelt oma nimele kirjutada ning ainsaks kaotajaks selles lekkes peale looduse ja kalurite paistab olevat ameti kaotav BP juht Tony Hatward
200-BP-5 operable unit Technical Baseline report
International Nuclear Information System (INIS)
Jacques, I.D.; Kent, S.K.
1991-10-01
This report supports development of a remedial investigation/feasibility study work plan for the 200-BP-5 operable unit. The report summarizes baseline information for waste sites and unplanned release sites located in the 200-BP-5 operable unit. The sites were investigated by the Technical Baseline Section of the Environmental Engineering Group, Westinghouse Hanford Company (Westinghouse Hanford). The investigation consisted of review and evaluation of current and historical Hanford Site reports, drawings, and photographs, and was supplemented with recent inspections of the Hanford Site and employee interviews. No field investigations or sampling were conducted
Advertising as Insurance or Commitment? Evidence from the BP Oil Spill
Lint Barrage; Eric Chyn; Justine Hastings
2014-01-01
This paper explores how advertising impacts the consumer response to news about unobserved product quality. Specifically, we estimate how British Petroleum’s (BP) 2000-2008 “Beyond Petroleum” advertising campaign affected the impact of the 2010 BP oil spill. We find that BP station margins declined by 4.2 cents per gallon, and volumes declined by 3.6 percent after the spill. However, pre-spill advertising significantly dampened the price response in the short-run, and reduced the fraction of ...
Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication
International Nuclear Information System (INIS)
Kanginakudru, Sriramana; DeSmet, Marsha; Thomas, Yanique; Morgan, Iain M.; Androphy, Elliot J.
2015-01-01
The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication
Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication
Energy Technology Data Exchange (ETDEWEB)
Kanginakudru, Sriramana, E-mail: skangina@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); DeSmet, Marsha, E-mail: mdesmet@iupui.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Thomas, Yanique, E-mail: ysthomas@umail.iu.edu [Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States); Morgan, Iain M., E-mail: immorgan@vcu.edu [VCU Philips Institute for Oral Health Research, Virginia Commonwealth University, Richmond, Virginia (United States); Androphy, Elliot J., E-mail: eandro@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States)
2015-04-15
The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication.
Solubility and peculiarities of the yttrium-aluminium borate crystal growth
International Nuclear Information System (INIS)
Azizov, A.V.; Leonyuk, N.I.; Rezvyj, V.R.; Timchenko, T.I.; Belov, N.V.
1982-01-01
The nature of crystallization media and crystallization peculiarities of IAl 3 [BO 3 ] 4 yttrium-alluminium borate (YAB) were investigated. The investigation of YAB solubility was conducted in the melts of two different compositions: 88.1K 2 Mo 2 O 10 -3.5V 2 O 3 -8.4B 2 O 3 (1) and 89.5K 2 Mo 3 O 10 - - 10.5B 2 O 3 (2) at 1060-900 deg C. The YAB crystals obtained from different crystallization media had different habit and morphology. The revealed peculiarities are significant for the choice of the YAB crystal growing conditions on orientated seedings: more rapid growth can be exercised along the [0001] face from the solution in the melt (2)
Barium and iron abundances in red giants
International Nuclear Information System (INIS)
Fernandez-Villacanas, J.L.; Rego, M.; Cornide, M.
1990-01-01
An intermediate-dispersion abundance analysis has been carried out on a sample of 21 barium and 14 comparison stars. The excess of barium over iron has been used as the most representative indicator of peculiarity. These excesses are higher in the peculiar stars than in the nonpeculiar stars. Particularly interesting is the case of HD 67447, included in the comparison stars, with an excess Ba/Fe abundance = 1.61, probably a new barium star. A trend indicating a possible anticorrelation between barium overabundance and metallicity favors the suggestion that the barium strong group is older than the barium weak one. 36 refs
Interactions of the human MCM-BP protein with MCM complex components and Dbf4.
Directory of Open Access Journals (Sweden)
Tin Nguyen
Full Text Available MCM-BP was discovered as a protein that co-purified from human cells with MCM proteins 3 through 7; results which were recapitulated in frogs, yeast and plants. Evidence in all of these organisms supports an important role for MCM-BP in DNA replication, including contributions to MCM complex unloading. However the mechanisms by which MCM-BP functions and associates with MCM complexes are not well understood. Here we show that human MCM-BP is capable of interacting with individual MCM proteins 2 through 7 when co-expressed in insect cells and can greatly increase the recovery of some recombinant MCM proteins. Glycerol gradient sedimentation analysis indicated that MCM-BP interacts most strongly with MCM4 and MCM7. Similar gradient analyses of human cell lysates showed that only a small amount of MCM-BP overlapped with the migration of MCM complexes and that MCM complexes were disrupted by exogenous MCM-BP. In addition, large complexes containing MCM-BP and MCM proteins were detected at mid to late S phase, suggesting that the formation of specific MCM-BP complexes is cell cycle regulated. We also identified an interaction between MCM-BP and the Dbf4 regulatory component of the DDK kinase in both yeast 2-hybrid and insect cell co-expression assays, and this interaction was verified by co-immunoprecipitation of endogenous proteins from human cells. In vitro kinase assays showed that MCM-BP was not a substrate for DDK but could inhibit DDK phosphorylation of MCM4,6,7 within MCM4,6,7 or MCM2-7 complexes, with little effect on DDK phosphorylation of MCM2. Since DDK is known to activate DNA replication through phosphorylation of these MCM proteins, our results suggest that MCM-BP may affect DNA replication in part by regulating MCM phosphorylation by DDK.
Interactions of the human MCM-BP protein with MCM complex components and Dbf4.
Nguyen, Tin; Jagannathan, Madhav; Shire, Kathy; Frappier, Lori
2012-01-01
MCM-BP was discovered as a protein that co-purified from human cells with MCM proteins 3 through 7; results which were recapitulated in frogs, yeast and plants. Evidence in all of these organisms supports an important role for MCM-BP in DNA replication, including contributions to MCM complex unloading. However the mechanisms by which MCM-BP functions and associates with MCM complexes are not well understood. Here we show that human MCM-BP is capable of interacting with individual MCM proteins 2 through 7 when co-expressed in insect cells and can greatly increase the recovery of some recombinant MCM proteins. Glycerol gradient sedimentation analysis indicated that MCM-BP interacts most strongly with MCM4 and MCM7. Similar gradient analyses of human cell lysates showed that only a small amount of MCM-BP overlapped with the migration of MCM complexes and that MCM complexes were disrupted by exogenous MCM-BP. In addition, large complexes containing MCM-BP and MCM proteins were detected at mid to late S phase, suggesting that the formation of specific MCM-BP complexes is cell cycle regulated. We also identified an interaction between MCM-BP and the Dbf4 regulatory component of the DDK kinase in both yeast 2-hybrid and insect cell co-expression assays, and this interaction was verified by co-immunoprecipitation of endogenous proteins from human cells. In vitro kinase assays showed that MCM-BP was not a substrate for DDK but could inhibit DDK phosphorylation of MCM4,6,7 within MCM4,6,7 or MCM2-7 complexes, with little effect on DDK phosphorylation of MCM2. Since DDK is known to activate DNA replication through phosphorylation of these MCM proteins, our results suggest that MCM-BP may affect DNA replication in part by regulating MCM phosphorylation by DDK.
Crystallization peculiarities in metallic glasses
International Nuclear Information System (INIS)
Serebryakov, A.V.; Abrosimova, G.E.; Aronin, A.S.
1985-01-01
Methods of X-ray electron microscopy and X-ray diffraction analysis were used to investigate the peculiarities of crystallization of amorphous metallic Fe-B and Fe-Si-B alloys related to sufficient change of volume when passing from amorphous to crystalline state and the effect of sample prehistory on its thermal stability and crystallization kinetics. The dependence of morphology of crystalline phases formed during crystallization of amorphous Fe-B alloys on sample thickness was revealed and investigated. The model explaining this dependence was suggested. The observed differences are related, according to the model, with different diffusion ways of ''poles'' - elementary carriers of empty volume to their sinks
Tamburini, Fabrizio; Licata, Ignazio
2017-09-01
The search for dark matter (DM) is one of the most active and challenging areas of current research. Possible DM candidates are ultralight fields such as axions and weak interacting massive particles (WIMPs). Axions piled up in the center of stars are supposed to generate matter/DM configurations with oscillating geometries at a very rapid frequency, which is a multiple of the axion mass m B (Brito et al (2015); Brito et al (2016)). Borra and Trottier (2016) recently found peculiar ultrafast periodic spectral modulations in 236 main sequence stars in the sample of 2.5 million spectra of galactic halo stars of the Sloan Digital Sky Survey (˜1% of main sequence stars in the F-K spectral range) that were interpreted as optical signals from extraterrestrial civilizations, suggesting them as possible candidates for the search for extraterrestrial intelligence (SETI) program. We argue, instead, that this could be the first indirect evidence of bosonic axion-like DM fields inside main sequence stars, with a stable radiative nucleus, where a stable DM core can be hosted. These oscillations were not observed in earlier stellar spectral classes probably because of the impossibility of starting a stable oscillatory regime due to the presence of chaotic motions in their convective nuclei. The axion mass values, (50< {m}B< 2.4× {10}3) μ {eV}, obtained from the frequency range observed by Borra and Trottier, (0.6070< f< 0.6077) THz, agree with the recent theoretical results from high-temperature lattice quantum chromodynamics (Borsanyi et al (2016); Borsanyi et al (2016b)).
The effect of peculiar velocities on supernova cosmology
DEFF Research Database (Denmark)
Davis, Tamara Maree; Hui, Lam; Frieman, Joshua A.
2011-01-01
We analyze the effect that peculiar velocities have on the cosmological inferences we make using luminosity distance indicators, such as Type Ia supernovae. In particular we study the corrections required to account for (1) our own motion, (2) correlations in galaxy motions, and (3) a possible lo...... when future surveys aim for percent-level accuracy and we recommend our statistical approach to down-weighting peculiar velocities as a more robust option than a sharp low-redshift cut....... local under- or overdensity. For all of these effects we present a case study showing the impact on the cosmology derived by the Sloan Digital Sky Survey-II Supernova Survey (SDSS-II SN Survey). Correcting supernova (SN) redshifts for the cosmic microwave background (CMB) dipole slightly overcorrects...... nearby SNe that share some of our local motion. We show that while neglecting the CMB dipole would cause a shift in the derived equation of state of ¿w ~ 0.04 (at fixed O m ), the additional local-motion correction is currently negligible (¿w
Bp'S Baku-Tbilisi-Ceyhan pipeline: the new corporate colonialism.
Marriott, James; Muttitt, Greg
2006-01-01
An international campaign was waged questioning the benefits of BP's Baku-Tbilisi-Ceyhan pipeline in an effort to avoid a "zone of sacrifice" there. This article is an offshoot of that effort and explains the contemporary struggle over the pipeline project. The authors describe the project's background and evaluate the actual and potential impacts of the project in which they consider eight areas. They also assess BP's capacity to confront resistance to the pipeline.
Energy Technology Data Exchange (ETDEWEB)
Jiang, Long; Li, Xiang-Dong [Department of Astronomy, Nanjing University, Nanjing 210046 (China); Dey, Jishnu; Dey, Mira, E-mail: lixd@nju.edu.cn [Department of Physics, Presidency University, 86/1, College Street, Kolkata 700 073 (India)
2015-07-01
According to the recycling scenario, millisecond pulsars (MSPs) have evolved from low-mass X-ray binaries (LMXBs). Their orbits are expected to be circular due to tidal interactions during binary evolution, as observed in most binary MSPs. There are some peculiar systems that do not fit this picture. Three recent examples are the PSRs J2234+06, J1946+3417, and J1950+2414, all of which are MSPs in eccentric orbits but with mass functions compatible with expected He white dwarf (WD) companions. It has been suggested these MSPs may have formed from delayed accretion-induced collapse of massive WDs, or the eccentricity may be induced by dynamical interaction between the binary and a circumbinary disk. Assuming that the core density of accreting neutron stars (NSs) in LMXBs may reach the density of quark deconfinement, which can lead to phase transition from NSs to strange quark stars, we show that the resultant MSPs are likely to have an eccentric orbit, due to the sudden loss of the gravitational mass of the NS during the transition. The eccentricities can be reproduced with a reasonable estimate of the mass loss. This scenario might also account for the formation of the youngest known X-ray binary Cir X–1, which also possesses a low-field compact star in an eccentric orbit.
A Brightness-Referenced Star Identification Algorithm for APS Star Trackers
Zhang, Peng; Zhao, Qile; Liu, Jingnan; Liu, Ning
2014-01-01
Star trackers are currently the most accurate spacecraft attitude sensors. As a result, they are widely used in remote sensing satellites. Since traditional charge-coupled device (CCD)-based star trackers have a limited sensitivity range and dynamic range, the matching process for a star tracker is typically not very sensitive to star brightness. For active pixel sensor (APS) star trackers, the intensity of an imaged star is valuable information that can be used in star identification process. In this paper an improved brightness referenced star identification algorithm is presented. This algorithm utilizes the k-vector search theory and adds imaged stars' intensities to narrow the search scope and therefore increase the efficiency of the matching process. Based on different imaging conditions (slew, bright bodies, etc.) the developed matching algorithm operates in one of two identification modes: a three-star mode, and a four-star mode. If the reference bright stars (the stars brighter than three magnitude) show up, the algorithm runs the three-star mode and efficiency is further improved. The proposed method was compared with other two distinctive methods the pyramid and geometric voting methods. All three methods were tested with simulation data and actual in orbit data from the APS star tracker of ZY-3. Using a catalog composed of 1500 stars, the results show that without false stars the efficiency of this new method is 4∼5 times that of the pyramid method and 35∼37 times that of the geometric method. PMID:25299950
Correlation of expression of BP1, a homeobox gene, with estrogen receptor status in breast cancer
International Nuclear Information System (INIS)
Fu, Sidney W; Poola, Indira; Stephan, Dietrich A; Berg, Patricia E; Schwartz, Arnold; Stevenson, Holly; Pinzone, Joseph J; Davenport, Gregory J; Orenstein, Jan M; Gutierrez, Peter; Simmens, Samuel J; Abraham, Jessy
2003-01-01
BP1 is a novel homeobox gene cloned in our laboratory. Our previous studies in leukemia demonstrated that BP1 has oncogenic properties, including as a modulator of cell survival. Here BP1 expression was examined in breast cancer, and the relationship between BP1 expression and clinicopathological data was determined. Total RNA was isolated from cell lines, tumors, and matched normal adjacent tissue or tissue from autopsy. Reverse transcription polymerase chain reaction was performed to evaluate BP1 expression. Statistical analysis was accomplished with SAS. Analysis of 46 invasive ductal breast tumors demonstrated BP1 expression in 80% of them, compared with a lack of expression in six normal breast tissues and low-level expression in one normal breast tissue. Remarkably, 100% of tumors that were negative for the estrogen receptor (ER) were BP1-positive, whereas 73% of ER-positive tumors expressed BP1 (P = 0.03). BP1 expression was also associated with race: 89% of the tumors of African American women were BP1-positive, whereas 57% of those from Caucasian women expressed BP1 (P = 0.04). However, there was no significant difference in BP1 expression between grades I, II, and III tumors. Interestingly, BP1 mRNA expression was correlated with the ability of malignant cell lines to cause breast cancer in mice. Because BP1 is expressed abnormally in breast tumors, it could provide a useful target for therapy, particularly in patients with ER-negative tumors. The frequent expression of BP1 in all tumor grades suggests that activation of BP1 is an early event
Lee, Myungsun; Han, Gunsoo
2016-04-01
[Purpose] This study aimed to investigate the effect of peculiar complex core balance training on the isokinetic muscle function of the knee joint and lumbus to provide fundamental data for establishing a training program that focuses on improving the performance and prevention of injury by developing the core and low extremity muscles. [Subjects and Methods] The participants in this study included a total of ten high school athletes involved in a throwing event for over five years. The subjects were randomly divided into two groups: The experimental group (N=5) and the control group (N=5). The experimental group underwent peculiar complex core balance training. [Results] According to the analysis of covariance, there was a significant effect of peculiar complex core balance training. Therefore, the isokinetic muscle function of the knee joint and lumbus in the experimental group participating in peculiar complex core balance training was significantly increased compared to the control group. [Conclusion] It is concluded that peculiar complex core balance training had a positive effect on the isokinetic muscle function of the knee and lumbus in throwing event athletes.
200-BP-5 operable unit treatability test report
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-04-01
The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites.
200-BP-5 operable unit treatability test report
International Nuclear Information System (INIS)
1996-04-01
The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites
Energy Technology Data Exchange (ETDEWEB)
Sales Silva, J. V.; Peña Suárez, V. J.; Katime Santrich, O. J.; Pereira, C. B.; Drake, N. A.; Roig, F., E-mail: joaovictor@on.br, E-mail: jearim@on.br, E-mail: osantrich@on.br, E-mail: claudio@on.br, E-mail: drake@on.br, E-mail: froig@on.br [Observatório Nacional/MCT, Rua Gen. José Cristino, 77, 20921-400 Rio de Janeiro (Brazil)
2014-11-01
Binary stars in open clusters are very useful targets in constraining the nucleosynthesis process. The luminosities of the stars are known because the distances of the clusters are also known, so chemical peculiarities can be linked directly to the evolutionary status of a star. In addition, binary stars offer the opportunity to verify a relationship between them and the straggler population in both globular and open clusters. We carried out a detailed spectroscopic analysis to derive the atmospheric parameters for 16 red giants in binary systems and the chemical composition of 11 of them in the open clusters NGC 2360, NGC 3680, and NGC 5822. We obtained abundances of C, N, O, Na, Mg, Al, Ca, Si, Ti, Ni, Cr, Y, Zr, La, Ce, and Nd. The atmospheric parameters of the studied stars and their chemical abundances were determined using high-resolution optical spectroscopy. We employ the local thermodynamic equilibrium model atmospheres of Kurucz and the spectral analysis code MOOG. The abundances of the light elements were derived using the spectral synthesis technique. We found that the stars NGC 2360-92 and 96, NGC 3680-34, and NGC 5822-4 and 312 are yellow straggler stars. We show that the spectra of NGC 5822-4 and 312 present evidence of contamination by an A-type star as a secondary star. For the other yellow stragglers, evidence of contamination is given by the broad wings of the Hα. Detection of yellow straggler stars is important because the observed number can be compared with the number predicted by simulations of binary stellar evolution in open clusters. We also found that the other binary stars are not s-process enriched, which may suggest that in these binaries the secondary star is probably a faint main-sequence object. The lack of any s-process enrichment is very useful in setting constraints for the number of white dwarfs in the open cluster, a subject that is related to the birthrate of these kinds of stars in open clusters and also to the age of a
Peculiarities Of Financial Management In Family Firms
Martin R. W. Hiebl
2012-01-01
The majority of firms in market-oriented countries are family-owned. Despite their significant economic importance for these countries, research focusing on family firms is a rather young field within business research, having intensified starting only in the late 1980s. Research regarding the peculiarities of financial management in family firms is especially scarce. Hence, this paper seeks to synthesize existing research and to theoretically analyze the finance and accounting practices and ...
Study on MPGA-BP of Gravity Dam Deformation Prediction
Directory of Open Access Journals (Sweden)
Xiaoyu Wang
2017-01-01
Full Text Available Displacement is an important physical quantity of hydraulic structures deformation monitoring, and its prediction accuracy is the premise of ensuring the safe operation. Most existing metaheuristic methods have three problems: (1 falling into local minimum easily, (2 slowing convergence, and (3 the initial value’s sensitivity. Resolving these three problems and improving the prediction accuracy necessitate the application of genetic algorithm-based backpropagation (GA-BP neural network and multiple population genetic algorithm (MPGA. A hybrid multiple population genetic algorithm backpropagation (MPGA-BP neural network algorithm is put forward to optimize deformation prediction from periodic monitoring surveys of hydraulic structures. This hybrid model is employed for analyzing the displacement of a gravity dam in China. The results show the proposed model is superior to an ordinary BP neural network and statistical regression model in the aspect of global search, convergence speed, and prediction accuracy.
RanBP3 influences interactions between CRM1 and its nuclear protein export substrates
Englmeier, Ludwig; Fornerod, Maarten; Bischoff, F. Ralf; Petosa, Carlo; Mattaj, Iain W.; Kutay, Ulrike
2001-01-01
We investigated the role of RanBP3, a nuclear member of the Ran-binding protein 1 family, in CRM1-mediated protein export in higher eukaryotes. RanBP3 interacts directly with CRM1 and also forms a trimeric complex with CRM1 and RanGTP. However, RanBP3 does not bind to CRM1 like an export substrate. Instead, it can stabilize CRM1–export substrate interaction. Nuclear RanBP3 stimulates CRM1-dependent protein export in permeabilized cells. These data indicate that RanBP3 functions by a novel mec...
HD 179821 (V1427 Aql, IRAS 19114+0002) - a massive post-red supergiant star?
Şahin, T.; Lambert, David L.; Klochkova, Valentina G.; Panchuk, Vladimir E.
2016-10-01
We have derived elemental abundances of a remarkable star, HD 179821, with unusual composition (e.g. [Na/Fe] = 1.0 ± 0.2 dex) and extra-ordinary spectral characteristics. Its metallicity at [Fe/H] = 0.4 dex places it among the most metal-rich stars yet analysed. The abundance analysis of this luminous star is based on high-resolution and high-quality (S/N ≈ 120-420) optical echelle spectra from McDonald Observatory and Special Astronomy Observatory. The data includes five years of observations over 21 epochs. Standard 1D local thermodynamic equilibrium analysis provides a fresh determination of the atmospheric parameters over all epochs: Teff = 7350 ± 200 K, log g= +0.6 ± 0.3, and a microturbulent velocity ξ = 6.6 ± 1.6 km s-1 and [Fe/H] = 0.4 ± 0.2, and a carbon abundance [C/Fe] = -0.19 ± 0.30. We find oxygen abundance [O/Fe] = -0.25 ± 0.28 and an enhancement of 0.9 dex in N. A supersonic macroturbulent velocity of 22.0 ± 2.0 km s-1 is determined from both strong and weak Fe I and Fe II lines. Elemental abundances are obtained for 22 elements. HD 179821 is not enriched in s-process products. Eu is overabundant relative to the anticipated [X/Fe] ≈ 0.0. Some peculiarities of its optical spectrum (e.g. variability in the spectral line shapes) is noticed. This includes the line profile variations for H α line. Based on its estimated luminosity, effective temperature and surface gravity, HD 179821 is a massive star evolving to become a red supergiant and finally a Type II supernova.
BP Investment Exceeds $4 Bln in china
Institute of Scientific and Technical Information of China (English)
Wang Ping
2008-01-01
@@ British Petroleum (BP) recently signed a series of agreements with China including those in clean energy and wind power generation, during British Prime Minister Gordon Brown's visit to China in mid-January.
Design and application of star map simulation system for star sensors
Wu, Feng; Shen, Weimin; Zhu, Xifang; Chen, Yuheng; Xu, Qinquan
2013-12-01
Modern star sensors are powerful to measure attitude automatically which assure a perfect performance of spacecrafts. They achieve very accurate attitudes by applying algorithms to process star maps obtained by the star camera mounted on them. Therefore, star maps play an important role in designing star cameras and developing procession algorithms. Furthermore, star maps supply significant supports to exam the performance of star sensors completely before their launch. However, it is not always convenient to supply abundant star maps by taking pictures of the sky. Thus, star map simulation with the aid of computer attracts a lot of interests by virtue of its low price and good convenience. A method to simulate star maps by programming and extending the function of the optical design program ZEMAX is proposed. The star map simulation system is established. Firstly, based on analyzing the working procedures of star sensors to measure attitudes and the basic method to design optical system by ZEMAX, the principle of simulating star sensor imaging is given out in detail. The theory about adding false stars and noises, and outputting maps is discussed and the corresponding approaches are proposed. Then, by external programming, the star map simulation program is designed and produced. Its user interference and operation are introduced. Applications of star map simulation method in evaluating optical system, star image extraction algorithm and star identification algorithm, and calibrating system errors are presented completely. It was proved that the proposed simulation method provides magnificent supports to the study on star sensors, and improves the performance of star sensors efficiently.
Peculiar transient events in the Schumann resonance band and their possible explanation
Ondrásková, Adriena; Bór, József; S[Breve]Evcík, Sebastián; Kostecký, Pavel; Rosenberg, Ladislav
2008-04-01
Superimposed on the continuous Schumann resonance (SR) background in the extremely low frequency (ELF) band, transient signals (e.g. bursts) can be observed, which originate from intense lightning discharges occurring at different locations on the globe. From the many transients that were observed at the Astronomical and Geophysical Observatory (AGO) of Comenius University near Modra, western Slovakia, in the vertical electric field component mainly during May and June of 2006, a peculiar group of events could be recognized. According to the waveform analysis, these peculiar events in most cases consist of two overlapping transients with a characteristic time difference of 0.13-0.15 s between the onsets. On the other hand, the spectrum of these peculiar transients showed discernible SR peaks for higher modes as well (n>7). The same events could be found in the records of the Széchenyi István Geophysical Observatory of the Geodetic and Geophysical Research Institute of the Hungarian Academy of Sciences near Nagycenk, Hungary (NCK). The natural origin of the peculiar events was verified from the NCK data and the source location was determined from the second transient. The results suggest that the two consecutive transients originated in the same thunderstorm. Furthermore, the phase spectrum analysis indicates that the sources have coherently excited the Earth-ionosphere cavity. These findings seem to support the idea that electromagnetic waves orbiting the Earth might trigger lightning discharges. The possibility that electromagnetic waves may trigger discharges was first considered by Nikola Tesla.
Psychological Peculiarities of Judge Professional Activity and Decision-Making
Uspanov, Zholdybai T.; Turabayeva, Dana S.
2016-01-01
The article considers the psychological peculiarities of judge professional activity and decision-making, judge's mental set and requirements to ethical and moral requirements and quality. Moreover, this work offers original job analysis and competency model of judge professional activity. The authors have studied the problems concerning the…
Kiefer, F.; Lecavelier des Étangs, A.; Vidal-Madjar, A.; Hébrard, G.; Bourrier, V.; Wilson, P. A.
2017-12-01
As revealed by its peculiar Kepler light curve, the enigmatic star KIC 8462852 undergoes short and deep flux dimmings at a priori unrelated epochs. This star presents nonetheless all other characteristics of a quiet 1 Gyr old F3V star. These dimmings resemble the absorption features expected for the transit of dust cometary tails. The exocomet scenario is therefore most commonly advocated. We reanalysed the Kepler data and extracted a new high-quality light curve to allow for the search of shallow signatures of single or a few exocomets. We discovered that among the 22 flux dimming events that we identified, two events present a striking similarity. These events occurred 928.25 days apart and lasted for 4.4 days with a drop in the star brightness by 1000 ppm. We show that the light curve of these events is well explained by the occultation of the star by a giant ring system or by the transit of a string of half a dozen exocomets with a typical dust production rate of 105-106 kg s-1. Assuming that these two similar events are related to the transit of the same object, we derive a period of 928.25 days. The following transit was expected in March 2017 but bad weather prohibited us from detecting it from ground-based spectroscopy. We predict that the next event will occur between 3-8 October 2019.
Regular Generalized Star Star closed sets in Bitopological Spaces
K. Kannan; D. Narasimhan; K. Chandrasekhara Rao; R. Ravikumar
2011-01-01
The aim of this paper is to introduce the concepts of τ1τ2-regular generalized star star closed sets , τ1τ2-regular generalized star star open sets and study their basic properties in bitopological spaces.
The problems of peculiarity regeneration of architectural-spatial environment of demolished cities
Directory of Open Access Journals (Sweden)
Babakhanyans Dalar
2017-01-01
Full Text Available Boundaries of national and international, typical and peculiar, individual and mass are ignored in the present conditions of battles (globalization, leakage of information, loss of technology, fast programs and the observation and regeneration of architectural-spatial environments has become very important. The article observes the revelation of this problem with regeneration of architectural-spatial environment of Gyumri city. The goal is to determine modern approaches of observance of the peculiarity of cities. The problem is to study development demands of architectural-spatial environment in modern and historical cities, to study its perception mechanisms , the main factors and patterns.
Directory of Open Access Journals (Sweden)
Aikaterini Patsatsi
2012-01-01
Full Text Available 39 bullous pemphigoid (BP patients were studied to assess the clinical significance of anti-BP180 and anti-BP230 circulating autoantibodies of BP and correlate their titers with the clinical scores of the BP Disease Area Index (BPDAI and the Autoimmune Bullous Skin Disorder Intensity Score (ABSIS as well as with the intensity of pruritus measured by the BPDAI pruritus component. All parameters were evaluated by the time of diagnosis (baseline, month 3, and month 6. Titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with BPDAI component for the intensity of pruritus (, at baseline. At month 3, titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with the BPDAI component for the intensity of pruritus (, . At month 6, titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with the BPDAI component for the intensity of pruritus (, . There was no statistically significant correlation between titers of anti-BP230 autoantibodies and the BPDAI, ABSIS, and BPDAI component for the intensity of pruritus at the same time points.
Sleep-time BP: prognostic marker of type 2 diabetes and therapeutic target for prevention.
Hermida, Ramón C; Ayala, Diana E; Mojón, Artemio; Fernández, José R
2016-02-01
We investigated the prognostic value of clinic and ambulatory BP (ABP) to predict new-onset diabetes and whether risk reduction is related to the progressive decrease of clinic BP or awake or asleep ABP. We prospectively evaluated 2,656 individuals without diabetes, 1,292 men and 1,364 women, 50.6 ± 14.3 years of age, with baseline BP ranging from normotension to hypertension according to ABP criteria. At baseline and annually (more frequently if hypertension treatment was adjusted based on ABP) thereafter, ABP and physical activity (wrist actigraphy) were simultaneously monitored for 48 h to accurately derive the awake and asleep BP means. During a 5.9-year median follow-up, 190 participants developed type 2 diabetes. The asleep systolic ABP mean was the most significant predictor of new-onset diabetes in a Cox proportional-hazard model adjusted for age, waist circumference, glucose, chronic kidney disease (CKD) and hypertension treatment. Daytime clinic BP and awake or 48 h ABP mean had no predictive value when corrected by the asleep ABP mean. Analyses of BP changes during follow-up revealed a 30% reduction in the risk of new-onset diabetes per 1-SD decrease in asleep systolic ABP mean, independent of changes in clinic BP or awake or 48 h ABP means. Sleep-time BP is a highly significant independent prognostic marker for new-onset diabetes. Alteration in sleep-time BP regulation seems to precede, rather than follow, the development of new-onset diabetes. Most important, lowering asleep BP, a novel therapeutic target requiring ABP evaluation, could be a significant method for reducing new-onset diabetes risk.
Overexpressed CacyBP/SIP leads to the suppression of growth in renal cell carcinoma
International Nuclear Information System (INIS)
Sun, Shiren; Ning, Xiaoxuan; Liu, Jie; Liu, Lili; Chen, Yu; Han, Shuang; Zhang, Yanqi; Liang, Jie; Wu, Kaichun; Fan, Daiming
2007-01-01
Calcyclin-binding protein/Siah-1-interacting protein (CacyBP/SIP), a target protein of S100, has been identified as a component of a novel ubiquitinylation complex leading to β-catenin degradation, which was found to be related to the malignant phenotypes of gastric cancer. However, the roles of CacyBP/SIP in renal cell carcinoma still remain unclear. In the present study, we had analyzed the expression of the CacyBP/SIP protein in human renal cancer cells and clinical tissue samples. The possible roles of CacyBP/SIP in regulating the malignant phenotype of renal cancer cells were also investigated. The results demonstrated that the expression of CacyBP/SIP was markedly down-regulated in renal cell carcinoma tissues and cell lines. Ectopic overexpression of CacyBP/SIP in A498 cells inhibited the proliferation of this cell and delayed cell cycle progression significantly, which might be related to the down-regulation of Cyclin D1 through reducing β-catenin protein. CacyBP/SIP also suppressed colony formation in soft agar and its tumorigenicity in nude mice. Taken together, our work showed that CacyBP/SIP, as a novel down-regulated gene in renal cell carcinoma, suppressed proliferation and tumorigenesis of renal cancer cells
Bidet, Katell; Dadlani, Dhivya; Garcia-Blanco, Mariano A
2014-07-01
Viral RNA-host protein interactions are critical for replication of flaviviruses, a genus of positive-strand RNA viruses comprising major vector-borne human pathogens including dengue viruses (DENV). We examined three conserved host RNA-binding proteins (RBPs) G3BP1, G3BP2 and CAPRIN1 in dengue virus (DENV-2) infection and found them to be novel regulators of the interferon (IFN) response against DENV-2. The three RBPs were required for the accumulation of the protein products of several interferon stimulated genes (ISGs), and for efficient translation of PKR and IFITM2 mRNAs. This identifies G3BP1, G3BP2 and CAPRIN1 as novel regulators of the antiviral state. Their antiviral activity was antagonized by the abundant DENV-2 non-coding subgenomic flaviviral RNA (sfRNA), which bound to G3BP1, G3BP2 and CAPRIN1, inhibited their activity and lead to profound inhibition of ISG mRNA translation. This work describes a new and unexpected level of regulation for interferon stimulated gene expression and presents the first mechanism of action for an sfRNA as a molecular sponge of anti-viral effectors in human cells.
BP Oil Company's approach to risk management
International Nuclear Information System (INIS)
Fryman, C.E.
1996-01-01
The oil and chemical industries face major challenges in deciding how to handle the numerous recommendations coming from various audits, reviews and studies conducted in the functional areas of personnel health and safety, loss prevention, and environmental protection. And, the number of recommendations continues to grow with time, as regulations and normal business requirements are met. BP Oil has developed a methodology for risk ranking the events leading to specific recommendations and then determining the cost-effectiveness of the recommendations in reducing the risk. The author completed successful pilot tests of this methodology at two of BP Oil's petroleum refineries, examining the recommendations from process hazards analyses and studies completed over the past few years. The methodology has since been implemented throughout their petroleum refining, distribution, transportation, and retail business streams
Theoretical models of highly magnetic white dwarf stars that violate the Chandrasekhar Limit
Shah, Hridaya
2017-08-01
Until recently, white dwarf (WD) stars were believed to be no more massive than 1.44 solar masses (M ⊙ ). This belief has been changed now with the observations of over-luminous or 'peculiar' Type la supernovae that have lead researchers to hypothesize the existence of WDs in the mass range 2.4 - 2.8 M ⊙ . This discovery also raises some doubt over the reliability of the Type Ia supernova as a standard candle. It is thought that these super-massive WDs are their most likely progenitors and that they probably have a very strong magnetic field inside them. A degenerate electron gas in a magnetic field, such as that present inside this star, will be Landau quantized. Magnetic field changes the momentum space of electrons which in turn changes their density of states (DOS) and that in turn changes the equation of state (EoS) of matter inside the star, as opposed to that without a field. When this change in the DOS is taken into account and a link between the DOS and the EoS is established, as is done in this work, I find a physical reason behind the theoretical mass-radius (M-R) relations of a super-massive WD. I start with different equations of state with at most three Landau levels occupied and then construct stellar models of magnetic WDs (MWDs) using the same. I also show the M-R relations of these stars for a particular chosen value of maximum electron Fermi energy. Once a multiple Landau level system of electrons is considered, I find that it leads to such an EoS that gives multiple branches in the MR relations. Super-massive MWDs are obtained only when the Landau level occupancy is limited to just one level and some of the mass values fall within the mass range given above.
1I/‘Oumuamua as a Tidal Disruption Fragment from a Binary Star System
Ćuk, Matija
2018-01-01
1I/‘Oumuamua is the first known interstellar small body, probably being only about 100 m in size. Against expectations based on comets, ‘Oumuamua does not show any activity and has a very elongated figure, and it also exhibits undamped rotational tumbling. In contrast, ‘Oumuamua’s trajectory indicates that it was moving with the local stars, as expected from a low-velocity ejection from a relatively nearby system. Here, I assume that ‘Oumuamua is typical of 100 m interstellar objects and speculate on its origins. I find that giant planets are relatively inefficient at ejecting small bodies from inner solar systems of main-sequence stars, and that binary systems offer a much better opportunity for ejections of non-volatile bodies. I also conclude that ‘Oumuamua is not a member of a collisional population, which could explain its dramatic difference from small asteroids. I observe that 100 m small bodies are expected to carry little mass in realistic collisional populations and that occasional events, when whole planets are disrupted in catastrophic encounters, may dominate the interstellar population of 100 m fragments. Unlike the Sun or Jupiter, red dwarf stars are very dense and are capable of thoroughly tidally disrupting terrestrial planets. I conclude that ‘Oumuamua may have originated as a fragment from a planet that was tidally disrupted and then ejected by a dense member of a binary system, which could explain its peculiarities.
Prediction of BP Reactivity to Talking Using Hybrid Soft Computing Approaches
Directory of Open Access Journals (Sweden)
Gurmanik Kaur
2014-01-01
Full Text Available High blood pressure (BP is associated with an increased risk of cardiovascular diseases. Therefore, optimal precision in measurement of BP is appropriate in clinical and research studies. In this work, anthropometric characteristics including age, height, weight, body mass index (BMI, and arm circumference (AC were used as independent predictor variables for the prediction of BP reactivity to talking. Principal component analysis (PCA was fused with artificial neural network (ANN, adaptive neurofuzzy inference system (ANFIS, and least square-support vector machine (LS-SVM model to remove the multicollinearity effect among anthropometric predictor variables. The statistical tests in terms of coefficient of determination (R2, root mean square error (RMSE, and mean absolute percentage error (MAPE revealed that PCA based LS-SVM (PCA-LS-SVM model produced a more efficient prediction of BP reactivity as compared to other models. This assessment presents the importance and advantages posed by PCA fused prediction models for prediction of biological variables.
Prediction of BP reactivity to talking using hybrid soft computing approaches.
Kaur, Gurmanik; Arora, Ajat Shatru; Jain, Vijender Kumar
2014-01-01
High blood pressure (BP) is associated with an increased risk of cardiovascular diseases. Therefore, optimal precision in measurement of BP is appropriate in clinical and research studies. In this work, anthropometric characteristics including age, height, weight, body mass index (BMI), and arm circumference (AC) were used as independent predictor variables for the prediction of BP reactivity to talking. Principal component analysis (PCA) was fused with artificial neural network (ANN), adaptive neurofuzzy inference system (ANFIS), and least square-support vector machine (LS-SVM) model to remove the multicollinearity effect among anthropometric predictor variables. The statistical tests in terms of coefficient of determination (R (2)), root mean square error (RMSE), and mean absolute percentage error (MAPE) revealed that PCA based LS-SVM (PCA-LS-SVM) model produced a more efficient prediction of BP reactivity as compared to other models. This assessment presents the importance and advantages posed by PCA fused prediction models for prediction of biological variables.
Individually-Personal Peculiarities of Younger Preschoolers’ Speech
Directory of Open Access Journals (Sweden)
M E Novikova
2013-12-01
Full Text Available Studying the speech of the younger preschoolers is a major factor in designing educational methods and preparing children for school. There exist individual and gender differences in the way children acquire speech skills. Word comprehension and idea interpretation depend on the child’s upbringing, his or her environment, the interaction within the family. This article submits the research data obtained from the study of the individual peculiarities of the younger preschool children’s speech.
Some Peculiarities of Newton-Hooke Space-Times
Tian, Yu
2011-01-01
Newton-Hooke space-times are the non-relativistic limit of (anti-)de Sitter space-times. We investigate some peculiar facts about the Newton-Hooke space-times, among which the "extraordinary Newton-Hooke quantum mechanics" and the "anomalous Newton-Hooke space-times" are discussed in detail. Analysis on the Lagrangian/action formalism is performed in the discussion of the Newton-Hooke quantum mechanics, where the path integral point of view plays an important role, and the physically measurab...
Peculiarities of product placement in Lithuanian movies
Pilelienė, Lina; Jurgilaitė, Sigita
2013-01-01
The scientific problem analysed in the article is formulates as follows: how product placement is used in Lithuanian movies. The object of the article is product placement in Lithuanian movies, and the aim is to analyse the peculiarities of product placement in Lithuanian movies. Following methods were used to reveal the problem and reach the aim. Theoretical analysis of scientific literature was provided to construct the framework for the research. The analysis of current usage of product pl...
Peculiarities of the Woody Plants Re-Bloom
Opalko Olga Anatolievna; Opalko Anatoly Ivanovich
2015-01-01
The data of literary sources concerning the bloom of angiosperm plants and deviation in the development of a flower and inflorescence, in particular untimely flowering, was generalized; our observation results of some peculiarities of re-bloom of woody plants in the National Dendrological Park “Sofiyivka” of NAS of Ukraine (NDP “Sofiyivka”) were discussed. The flowering process was formed during a long-term evolution of a propagation system of angiosperm plants as a basis of fertilization and...
Divergent homologs of the predicted small RNA BpCand697 in Burkholderia spp.
Damiri, Nadzirah; Mohd-Padil, Hirzahida; Firdaus-Raih, Mohd
2015-09-01
The small RNA (sRNA) gene candidate, BpCand697 was previously reported to be unique to Burkholderia spp. and is encoded at 3' non-coding region of a putative AraC family transcription regulator gene. This study demonstrates the conservation of BpCand697 sequence across 32 Burkholderia spp. including B. pseudomallei, B. mallei, B. thailandensis and Burkholderia sp. by integrating both sequence homology and secondary structural analyses of BpCand697 within the dataset. The divergent sequence of BpCand697 was also used as a discriminatory power in clustering the dataset according to the potential virulence of Burkholderia spp., showing that B. thailandensis was clearly secluded from the virulent cluster of B. pseudomallei and B. mallei. Finally, the differential co-transcript expression of BpCand697 and its flanking gene, bpsl2391 was detected in Burkholderia pseudomallei D286 after grown under two different culture conditions using nutrient-rich and minimal media. It is hypothesized that the differential expression of BpCand697-bpsl2391 co-transcript between the two standard prepared media might correlate with nutrient availability in the culture media, suggesting that the physical co-localization of BpCand697 in B. pseudomallei D286 might be directly or indirectly involved with the transcript regulation of bpsl2391 under the selected in vitro culture conditions.
I-Love relations for incompressible stars and realistic stars
Chan, T. K.; Chan, AtMa P. O.; Leung, P. T.
2015-02-01
In spite of the diversity in the equations of state of nuclear matter, the recently discovered I-Love-Q relations [Yagi and Yunes, Science 341, 365 (2013), 10.1126/science.1236462], which relate the moment of inertia, tidal Love number (deformability), and the spin-induced quadrupole moment of compact stars, hold for various kinds of realistic neutron stars and quark stars. While the physical origin of such universality is still a current issue, the observation that the I-Love-Q relations of incompressible stars can well approximate those of realistic compact stars hints at a new direction to approach the problem. In this paper, by establishing recursive post-Minkowskian expansion for the moment of inertia and the tidal deformability of incompressible stars, we analytically derive the I-Love relation for incompressible stars and show that the so-obtained formula can be used to accurately predict the behavior of realistic compact stars from the Newtonian limit to the maximum mass limit.
PM : Cabinet likely to choose TNK-BP
2005-01-01
Tõenäoliselt saab Mazeikiu Nafta aktsiate ostjaks Suurbritannia-Vene ettevõte TNK-BP. Endiselt soovib ka Leedu Jukose osa naftakompaniist osta, kuid selleks raha laenamine võib mõjutada riigi majandust ja üleminekut eurole
Lamin A/C-dependent interaction with 53BP1 promotes cellular responses to DNA damage
DEFF Research Database (Denmark)
Gibbs-Seymour, Ian; Markiewicz, Ewa; Bekker-Jensen, Simon
2015-01-01
Lamins A/C have been implicated in DNA damage response pathways. We show that the DNA repair protein 53BP1 is a lamin A/C binding protein. In undamaged human dermal fibroblasts (HDF), 53BP1 is a nucleoskeleton protein. 53BP1 binds to lamins A/C via its Tudor domain, and this is abrogated by DNA...... damage. Lamins A/C regulate 53BP1 levels and consequently lamin A/C-null HDF display a 53BP1 null-like phenotype. Our data favour a model in which lamins A/C maintain a nucleoplasmic pool of 53BP1 in order to facilitate its rapid recruitment to sites of DNA damage and could explain why an absence...
Mallamaci, Francesca; Tripepi, Rocco; Leonardis, Daniela; Mafrica, Angela; Versace, Maria Carmela; Provenzano, Fabio; Tripepi, Giovanni; Zoccali, Carmine
2016-10-01
The clinical relevance of ambulatory blood pressure monitoring (ABPM) for risk stratification in renal transplant patients still remains poorly defined. We investigated the association between clinic and ABPM with an established biomarker of atherosclerosis (intima-media thickness [IMT] by echo-color Doppler) in a large, inclusive survey (n = 172) in renal transplant patients at a single institution. Forty-two patients (24%) were classified as hypertensive by ABPM criteria and 29 (17%) by clinic blood pressure (BP) criteria. Average daytime and nighttime BP was 126 ± 12/78 ± 9 mm Hg and 123 ± 13/74 ± 10 mm Hg, respectively. Forty-five patients (26%) were classified as hypertensive by the daytime criterion (>135/85 mm Hg) and a much higher proportion (n = 119, 69%) by the nighttime criterion (>120/70 mm Hg). Sixty-two patients (36%) had a night-day ratio of 1 or greater, indicating clear-cut nondipping. The average nighttime systolic BP (r = 0.24, P = 0.001) and the night-day systolic BP ratio (r = 0.23, P = 0.002) were directly related to IMT, and these associations were much more robust than the 24-hour systolic BP-IMT relationship (r = 0.16, P = 0.04). Average daytime BP and clinic B were unrelated to IMT. In a multiple regression analysis adjusting for confounders, the night-day systolic BP ratio maintained an independent association with IMT (β = 0.14, P = 0.04). In renal transplant patients, the prevalence of nocturnal hypertension by far exceeds the prevalence of hypertension as assessed by clinic, daytime, and 24-hour ABPM. Nighttime systolic BP and the night-day ratio but no other BP metrics are independently associated with IMT. Blood pressure during nighttime may provide unique information for the assessment of cardiovascular risk attributable to BP burden in renal transplant patients.
Peculiarities of the Digital Divide in Sub-Saharan Africa
Mutula, Stephen M.
2005-01-01
Purpose: Seeks to argue that the peculiarities of sub-Saharan Africa, in terms of its socio-cultural diversity, low economic development, linguistic factors, HIV/AIDS pandemic, gender discrimination, low ICT awareness and so on, demand a new model of addressing the digital divide. Design/methodology/approach: Paper largely based on literature…
Search for OB stars running away from young star clusters. II. The NGC 6357 star-forming region
Gvaramadze, V. V.; Kniazev, A. Y.; Kroupa, P.; Oh, S.
2011-11-01
Dynamical few-body encounters in the dense cores of young massive star clusters are responsible for the loss of a significant fraction of their massive stellar content. Some of the escaping (runaway) stars move through the ambient medium supersonically and can be revealed via detection of their bow shocks (visible in the infrared, optical or radio). In this paper, which is the second of a series of papers devoted to the search for OB stars running away from young ( ≲ several Myr) Galactic clusters and OB associations, we present the results of the search for bow shocks around the star-forming region NGC 6357. Using the archival data of the Midcourse Space Experiment (MSX) satellite and the Spitzer Space Telescope, and the preliminary data release of the Wide-Field Infrared Survey Explorer (WISE), we discovered seven bow shocks, whose geometry is consistent with the possibility that they are generated by stars expelled from the young (~1-2 Myr) star clusters, Pismis 24 and AH03 J1725-34.4, associated with NGC 6357. Two of the seven bow shocks are driven by the already known OB stars, HD 319881 and [N78] 34. Follow-up spectroscopy of three other bow-shock-producing stars showed that they are massive (O-type) stars as well, while the 2MASS photometry of the remaining two stars suggests that they could be B0 V stars, provided that both are located at the same distance as NGC 6357. Detection of numerous massive stars ejected from the very young clusters is consistent with the theoretical expectation that star clusters can effectively lose massive stars at the very beginning of their dynamical evolution (long before the second mechanism for production of runaway stars, based on a supernova explosion in a massive tight binary system, begins to operate) and lends strong support to the idea that probably all field OB stars have been dynamically ejected from their birth clusters. A by-product of our search for bow shocks around NGC 6357 is the detection of three circular
Do All O Stars Form in Star Clusters?
Weidner, C.; Gvaramadze, V. V.; Kroupa, P.; Pflamm-Altenburg, J.
The question whether or not massive stars can form in isolation or only in star clusters is of great importance for the theory of (massive) star formation as well as for the stellar initial mass function of whole galaxies (IGIMF-theory). While a seemingly easy question it is rather difficult to answer. Several physical processes (e.g. star-loss due to stellar dynamics or gas expulsion) and observational limitations (e.g. dust obscuration of young clusters, resolution) pose severe challenges to answer this question. In this contribution we will present the current arguments in favour and against the idea that all O stars form in clusters.
Peculiarities of the early Universe (Universes) birth and positron annihilation
International Nuclear Information System (INIS)
Svetlov-Prokop'ev, E.P.
2003-01-01
Works on the problem of quantum birth of the Universe are reviewed. Possible peculiarities of electron-positron annihilation at the early stages of the Universe (s) birth in connection with black holes are considered. Possible concept of Eternity is discussed. (author)
Directory of Open Access Journals (Sweden)
Katell Bidet
2014-07-01
Full Text Available Viral RNA-host protein interactions are critical for replication of flaviviruses, a genus of positive-strand RNA viruses comprising major vector-borne human pathogens including dengue viruses (DENV. We examined three conserved host RNA-binding proteins (RBPs G3BP1, G3BP2 and CAPRIN1 in dengue virus (DENV-2 infection and found them to be novel regulators of the interferon (IFN response against DENV-2. The three RBPs were required for the accumulation of the protein products of several interferon stimulated genes (ISGs, and for efficient translation of PKR and IFITM2 mRNAs. This identifies G3BP1, G3BP2 and CAPRIN1 as novel regulators of the antiviral state. Their antiviral activity was antagonized by the abundant DENV-2 non-coding subgenomic flaviviral RNA (sfRNA, which bound to G3BP1, G3BP2 and CAPRIN1, inhibited their activity and lead to profound inhibition of ISG mRNA translation. This work describes a new and unexpected level of regulation for interferon stimulated gene expression and presents the first mechanism of action for an sfRNA as a molecular sponge of anti-viral effectors in human cells.
Bursting star formation and the overabundance of Wolf-Rayet stars
International Nuclear Information System (INIS)
Bodigfee, G.; Deloore, C.
1985-01-01
The ratio of the number of WR-stars to their OB progenitors appears to be significantly higher in some extragalactic systems than in our Galaxy. This overabundance of Wolf-Rayet-stars can be explained as a consequence of a recent burst of star formation. It is suggested that this burst is the manifestation of a long period nonlinear oscillation in the star formation process, produced by positive feedback effects between young stars and the interstellar medium. Star burst galaxies with large numbers of WR-stars must generate gamma fluxes but due to the distance, all of them are beyond the reach of present-day detectors, except probably 30 Dor
TRIGGERED STAR FORMATION SURROUNDING WOLF-RAYET STAR HD 211853
Energy Technology Data Exchange (ETDEWEB)
Liu Tie; Wu Yuefang; Zhang Huawei [Department of Astronomy, Peking University, 100871 Beijing (China); Qin Shengli, E-mail: liutiepku@gmail.com [I. Physikalisches Institut, Universitaet zu Koeln, Zuelpicher Str. 77, 50937 Koeln (Germany)
2012-05-20
The environment surrounding Wolf-Rayet (W-R) star HD 211853 is studied in molecular, infrared, as well as radio, and H I emission. The molecular ring consists of well-separated cores, which have a volume density of 10{sup 3} cm{sup -3} and kinematic temperature {approx}20 K. Most of the cores are under gravitational collapse due to external pressure from the surrounding ionized gas. From the spectral energy distribution modeling toward the young stellar objects, the sequential star formation is revealed on a large scale in space spreading from the W-R star to the molecular ring. A small-scale sequential star formation is revealed toward core 'A', which harbors a very young star cluster. Triggered star formations are thus suggested. The presence of the photodissociation region, the fragmentation of the molecular ring, the collapse of the cores, and the large-scale sequential star formation indicate that the 'collect and collapse' process functions in this region. The star-forming activities in core 'A' seem to be affected by the 'radiation-driven implosion' process.
TRIGGERED STAR FORMATION SURROUNDING WOLF-RAYET STAR HD 211853
International Nuclear Information System (INIS)
Liu Tie; Wu Yuefang; Zhang Huawei; Qin Shengli
2012-01-01
The environment surrounding Wolf-Rayet (W-R) star HD 211853 is studied in molecular, infrared, as well as radio, and H I emission. The molecular ring consists of well-separated cores, which have a volume density of 10 3 cm –3 and kinematic temperature ∼20 K. Most of the cores are under gravitational collapse due to external pressure from the surrounding ionized gas. From the spectral energy distribution modeling toward the young stellar objects, the sequential star formation is revealed on a large scale in space spreading from the W-R star to the molecular ring. A small-scale sequential star formation is revealed toward core 'A', which harbors a very young star cluster. Triggered star formations are thus suggested. The presence of the photodissociation region, the fragmentation of the molecular ring, the collapse of the cores, and the large-scale sequential star formation indicate that the 'collect and collapse' process functions in this region. The star-forming activities in core 'A' seem to be affected by the 'radiation-driven implosion' process.
Marine04 marine radiocarbon age calibration, 0-26 cal kyr BP
Hughen, Konrad A.; Baillie, Mike G.L.; Bard, Edouard; Beck, J. Warren; Bertrand, Chanda J.H.; Blackwell, Paul G.; Buck, Caitlin E.; Burr, George S.; Cutler, Kirsten B.; Damon, Paul E.; Edwards, Richard L.; Fairbanks, Richard G.; Friedrich, Michael; Guilderson, Thomas P.; Kromer, Bernd; McCormac, Gerry; Manning, Sturt; Bronk Ramsey, Christopher; Reimer, Paula J.; Reimer, Ron W.; Remmele, Sabine; Southon, John R.; Stuiver, Minze; Talamo, Sahra; Taylor, F.W.; Plicht, Johannes van der; Weyhenmeyer, Constanze E.
2004-01-01
New radiocarbon calibration curves, IntCal04 and Marine04, have been constructed and internationally ratified to replace the terrestrial and marine components of IntCal98. The new calibration data sets extend an additional 2000 yr, from 0–26 cal kyr BP (Before Present, 0 cal BP = AD 1950), and
Induction Magnetometers – Design Peculiarities
Directory of Open Access Journals (Sweden)
Valeriy KOREPANOV
2010-09-01
Full Text Available Induction or search-coil magnetometers (IM are widely used in many branches of science and industry. The frequency range and dynamic range of IMs are probably the widest of all existing magnetometers: they are used for the measurement of magnetic field variations in the frequency band from ~10-4 till ~106 Hz with the intensities from fractions of femtotesla till tens of tesla. This explains the permanent interest to IM design and the attempts to construct the IMs with best possible parameters. The present paper deals with the peculiarities of IM design. An attempt to re-establish the correctness of priorities in the field is made and the approaches to the IM optimization and their quality estimation are described.
Ren, Jing M; McKenzie, Thomas G; Fu, Qiang; Wong, Edgar H H; Xu, Jiangtao; An, Zesheng; Shanmugam, Sivaprakash; Davis, Thomas P; Boyer, Cyrille; Qiao, Greg G
2016-06-22
Recent advances in controlled/living polymerization techniques and highly efficient coupling chemistries have enabled the facile synthesis of complex polymer architectures with controlled dimensions and functionality. As an example, star polymers consist of many linear polymers fused at a central point with a large number of chain end functionalities. Owing to this exclusive structure, star polymers exhibit some remarkable characteristics and properties unattainable by simple linear polymers. Hence, they constitute a unique class of technologically important nanomaterials that have been utilized or are currently under audition for many applications in life sciences and nanotechnologies. This article first provides a comprehensive summary of synthetic strategies towards star polymers, then reviews the latest developments in the synthesis and characterization methods of star macromolecules, and lastly outlines emerging applications and current commercial use of star-shaped polymers. The aim of this work is to promote star polymer research, generate new avenues of scientific investigation, and provide contemporary perspectives on chemical innovation that may expedite the commercialization of new star nanomaterials. We envision in the not-too-distant future star polymers will play an increasingly important role in materials science and nanotechnology in both academic and industrial settings.
An Inventory Controlled Supply Chain Model Based on Improved BP Neural Network
Directory of Open Access Journals (Sweden)
Wei He
2013-01-01
Full Text Available Inventory control is a key factor for reducing supply chain cost and increasing customer satisfaction. However, prediction of inventory level is a challenging task for managers. As one of the widely used techniques for inventory control, standard BP neural network has such problems as low convergence rate and poor prediction accuracy. Aiming at these problems, a new fast convergent BP neural network model for predicting inventory level is developed in this paper. By adding an error offset, this paper deduces the new chain propagation rule and the new weight formula. This paper also applies the improved BP neural network model to predict the inventory level of an automotive parts company. The results show that the improved algorithm not only significantly exceeds the standard algorithm but also outperforms some other improved BP algorithms both on convergence rate and prediction accuracy.
The prenyl-binding protein PrBP/δ: a chaperone participating in intracellular trafficking.
Zhang, Houbin; Constantine, Ryan; Frederick, Jeanne M; Baehr, Wolfgang
2012-12-15
Expressed ubiquitously, PrBP/δ functions as chaperone/co-factor in the transport of a subset of prenylated proteins. PrBP/δ features an immunoglobulin-like β-sandwich fold for lipid binding, and interacts with diverse partners. PrBP/δ binds both C-terminal C15 and C20 prenyl side chains of phototransduction polypeptides and small GTP-binding (G) proteins of the Ras superfamily. PrBP/δ also interacts with the small GTPases, ARL2 and ARL3, which act as release factors (GDFs) for prenylated cargo. Targeted deletion of the mouse Pde6d gene encoding PrBP/δ resulted in impeded trafficking to the outer segments of GRK1 and cone PDE6 which are predicted to be farnesylated and geranylgeranylated, respectively. Rod and cone transducin trafficking was largely unaffected. These trafficking defects produce progressive cone-rod dystrophy in the Pde6d(-/-) mouse. Copyright © 2012 Elsevier Ltd. All rights reserved.
The Case of the Neutron Star With a Wayward Wake
2006-06-01
A long observation with NASA's Chandra X-ray Observatory has revealed important new details of a neutron star that is spewing out a wake of high-energy particles as it races through space. The deduced location of the neutron star on the edge of a supernova remnant, and the peculiar orientation of the neutron star wake, pose mysteries that remain unresolved. "Like a kite flying in the wind, the behavior of this neutron star and its wake tell us what sort of gas it must be plowing through," said Bryan Gaensler of the Harvard-Smithsonian Center for Astrophysics (CfA) in Cambridge, Mass., and lead author of a paper accepted to The Astrophysical Journal. "Yet we're still not sure how the neutron star got to its present location." Animation: Sequence of images of J0617 in IC 443 Animation: Sequence of images of J0617 in IC 443 The neutron star, known as CXOU J061705.3+222127, or J0617 for short, appears to lie near the outer edge of an expanding bubble of hot gas associated with the supernova remnant IC 443. Presumably, J0617 was created at the time of the supernova -- approximately 30,000 years ago -- and propelled away from the site of the explosion at about 500,000 miles per hour. However, the neutron star's wake is oriented almost perpendicularly to the direction expected if the neutron star were moving away from the center of the supernova remnant. This apparent misalignment had previously raised doubts about the association of the speeding neutron star with the supernova remnant. Gaensler and his colleagues provide strong evidence that J0617 was indeed born in the same explosion that created the supernova remnant. First, the shape of the neutron star's wake indicates it is moving a little faster than the speed of sound in Composite Images of SNR IC 443 Composite Images of SNR IC 443 the remnant's multimillion-degree gas. The velocity that one can then calculate from this conclusion closely matches the predicted pace of the neutron star. In contrast, if the neutron
[Segmentation of whole body bone SPECT image based on BP neural network].
Zhu, Chunmei; Tian, Lianfang; Chen, Ping; He, Yuanlie; Wang, Lifei; Ye, Guangchun; Mao, Zongyuan
2007-10-01
In this paper, BP neural network is used to segment whole body bone SPECT image so that the lesion area can be recognized automatically. For the uncertain characteristics of SPECT images, it is hard to achieve good segmentation result if only the BP neural network is employed. Therefore, the segmentation process is divided into three steps: first, the optimal gray threshold segmentation method is employed for preprocessing, then BP neural network is used to roughly identify the lesions, and finally template match method and symmetry-removing program are adopted to delete the wrongly recognized areas.
Energy Technology Data Exchange (ETDEWEB)
Sahade, J
1981-12-01
Aspects of the problems of the Wolf-Rayet stars related to their chemical composition, their evolutionary status, and their apparent dichotomy in two spectral sequences are discussed. Dogmas concerning WR stars are critically discussed, including the belief that WR stars lack hydrogen, that they are helium stars evolved from massive close binaries, and the existence of a second WR stage in which the star is a short-period single-lined binary. The relationship of WR stars with planetary nebulae is addressed, as is the membership of these stars in clusters and associations. The division of WR stars into WN and WC sequences is considered, questioning the reasonability of accounting for WR line formation in terms of abundance differences.
Spearing, M K; Post, R M; Leverich, G S; Brandt, D; Nolen, W
1997-12-05
The Clinical Global Impressions Scale (CGI) was modified specifically for use in assessing global illness severity and change in patients with bipolar disorder. Criticisms of the original CGI were addressed by correcting inconsistencies in scaling, identifying time frames for comparison, clarifying definitions of illness severity and change, and separating out assessment of treatment side effects from illness improvement during treatment. A Detailed User's Guide was developed to train clinicians in the use of the new CGI-Bipolar Version (CGI-BP) for rating severity of manic and depressive episodes and the degree of change from the immediately preceding phase and from the worst phase of illness. The revised scale and manual provide a focused set of instructions to facilitate the reliability of these ratings of mania, depression, and overall bipolar illness during treatment of an acute episode or in longer-term illness prophylaxis. Interrater reliability of the scale was demonstrated in preliminary analyses. Thus, the modified CGI-BP is anticipated to be more useful than the original CGI in studies of bipolar disorder.
StarDOM: From STAR format to XML
International Nuclear Information System (INIS)
Linge, Jens P.; Nilges, Michael; Ehrlich, Lutz
1999-01-01
StarDOM is a software package for the representation of STAR files as document object models and the conversion of STAR files into XML. This allows interactive navigation by using the Document Object Model representation of the data as well as easy access by XML query languages. As an example application, the entire BioMagResBank has been transformed into XML format. Using an XML query language, statistical queries on the collected NMR data sets can be constructed with very little effort. The BioMagResBank/XML data and the software can be obtained at http://www.nmr.embl-heidelberg.de/nmr/StarDOM/
International Nuclear Information System (INIS)
Jones, M.
1993-01-01
The island of Kuai, home to the Pacific Missile Range Facility, is preparing for the first of a series of Star Wars rocket launches expected to begin early this year. The Strategic Defense Initiative plans 40 launches of the Stategic Target System (STARS) over a 10-year period. The focus of the tests appears to be weapons and sensors designed to combat multiple-warhead ICBMs, which will be banned under the START II Treaty that was signed in January. The focus of this article is to express the dubious value of testing the STARS at a time when their application will not be an anticipated problem
Directory of Open Access Journals (Sweden)
Tao Qin
Full Text Available Dendritic cells (DCs play a vital role in the regulation of immune-mediated inflammatory diseases. Thus, DCs have been regarded as a major target for the development of immunomodulators. However, oxidative stress could disturb inflammatory regulation in DCs. Here, we examined the effect of bursopentine (BP5, a novel pentapeptide isolated from chicken bursa of fabricius, on the protection of DCs against oxidative stress for immunosuppression. BP5 showed potent protective effects against the lipopolysaccharide (LPS-induced oxidative stress in DCs, including nitric oxide, reactive oxygen species and lipid peroxidation. Furthermore, BP5 elevated the level of cellular reductive status through increasing the reduced glutathione (GSH and the GSH/GSSG ratio. Concomitant with these, the activities of several antioxidative redox enzymes, including glutathione peroxidase (GPx, catalase (CAT and superoxide dismutase (SOD, were obviously enhanced. BP5 also suppressed submucosal DC maturation in the LPS-stimulated intestinal epithelial cells (ECs/DCs coculture system. Finally, we found that heme oxygenase 1 (HO-1 was remarkably upregulated by BP5 in the LPS-induced DCs, and played an important role in the suppression of oxidative stress and DC maturation. These results suggested that BP5 could protect the LPS-activated DCs against oxidative stress and have potential applications in DC-related inflammatory responses.
A MODERN SEARCH FOR WOLF–RAYET STARS IN THE MAGELLANIC CLOUDS. II. A SECOND YEAR OF DISCOVERIES
Energy Technology Data Exchange (ETDEWEB)
Massey, Philip; Neugent, Kathryn F. [Lowell Observatory, 1400 W Mars Hill Road, Flagstaff, AZ 86001 (United States); Morrell, Nidia, E-mail: phil.massey@lowell.edu, E-mail: kneugent@lowell.edu, E-mail: nmorrell@lco.cl [Las Campanas Observatory, Carnegie Observatories, Casilla 601, La Serena (Chile)
2015-07-01
The numbers and types of evolved massive stars found in nearby galaxies provide an exacting test of stellar evolution models. Because of their proximity and rich massive star populations, the Magellanic Clouds have long served as the linchpins for such studies. Yet the continued accidental discoveries of Wolf–Rayet (WR) stars in these systems demonstrate that our knowledge is not as complete as usually assumed. Therefore, we undertook a multi-year survey for WRs in the Magellanic Clouds. Our results from our first year (reported previously) confirmed nine new LMC WRs. Of these, six were of a type never before recognized, with WN3-type emission combined with O3-type absorption features. Yet these stars are 2–3 mag too faint to be WN3+O3 V binaries. Here we report on the second year of our survey, including the discovery of four more WRs, two of which are also WN3/O3s, plus two “slash” WRs. This brings the total of known LMC WRs to 152, 13 (8.2%) of which were found by our survey, which is now ∼60% complete. We find that the spatial distribution of the WN3/O3s is similar to that of other WRs in the LMC, suggesting that they are descended from the same progenitors. We call attention to the fact that 5 of the 12 known SMC WRs may in fact be similar WN3/O3s rather than the binaries they have often assumed to be. We also discuss our other discoveries: a newly discovered Onfp-type star, and a peculiar emission-line object. Finally, we consider the completeness limits of our survey.
International Nuclear Information System (INIS)
Appleton, P. N.; Bitsakis, T.; Alatalo, K.; Mundell, C.; Lacy, M.; Armus, L.; Charmandaris, V.; Duc, P.-A.; Lisenfeld, U.; Ogle, P.
2014-01-01
We present archival Spitzer photometry and spectroscopy and Herschel photometry of the peculiar ''Green Valley'' elliptical galaxy NGC 3226. The galaxy, which contains a low-luminosity active galactic nucleus (AGN), forms a pair with NGC 3227 and is shown to lie in a complex web of stellar and H I filaments. Imaging at 8 and 16 μm reveals a curved plume structure 3 kpc in extent, embedded within the core of the galaxy and coincident with the termination of a 30 kpc long H I tail. In situ star formation associated with the infrared (IR) plume is identified from narrowband Hubble Space Telescope (HST) imaging. The end of the IR plume coincides with a warm molecular hydrogen disk and dusty ring containing 0.7-1.1 × 10 7 M ☉ detected within the central kiloparsec. Sensitive upper limits to the detection of cold molecular gas may indicate that a large fraction of the H 2 is in a warm state. Photometry derived from the ultraviolet (UV) to the far-IR shows evidence for a low star-formation rate of ∼0.04 M ☉ yr –1 averaged over the last 100 Myr. A mid-IR component to the spectral energy distribution (SED) contributes ∼20% of the IR luminosity of the galaxy, and is consistent with emission associated with the AGN. The current measured star formation rate is insufficient to explain NGC 3226's global UV-optical ''green'' colors via the resurgence of star formation in a ''red and dead'' galaxy. This form of ''cold accretion'' from a tidal stream would appear to be an inefficient way to rejuvenate early-type galaxies and may actually inhibit star formation
Sales Silva, J. V.; Peña Suárez, V. J.; Katime Santrich, O. J.; Pereira, C. B.; Drake, N. A.; Roig, F.
2014-11-01
Binary stars in open clusters are very useful targets in constraining the nucleosynthesis process. The luminosities of the stars are known because the distances of the clusters are also known, so chemical peculiarities can be linked directly to the evolutionary status of a star. In addition, binary stars offer the opportunity to verify a relationship between them and the straggler population in both globular and open clusters. We carried out a detailed spectroscopic analysis to derive the atmospheric parameters for 16 red giants in binary systems and the chemical composition of 11 of them in the open clusters NGC 2360, NGC 3680, and NGC 5822. We obtained abundances of C, N, O, Na, Mg, Al, Ca, Si, Ti, Ni, Cr, Y, Zr, La, Ce, and Nd. The atmospheric parameters of the studied stars and their chemical abundances were determined using high-resolution optical spectroscopy. We employ the local thermodynamic equilibrium model atmospheres of Kurucz and the spectral analysis code MOOG. The abundances of the light elements were derived using the spectral synthesis technique. We found that the stars NGC 2360-92 and 96, NGC 3680-34, and NGC 5822-4 and 312 are yellow straggler stars. We show that the spectra of NGC 5822-4 and 312 present evidence of contamination by an A-type star as a secondary star. For the other yellow stragglers, evidence of contamination is given by the broad wings of the Hα. Detection of yellow straggler stars is important because the observed number can be compared with the number predicted by simulations of binary stellar evolution in open clusters. We also found that the other binary stars are not s-process enriched, which may suggest that in these binaries the secondary star is probably a faint main-sequence object. The lack of any s-process enrichment is very useful in setting constraints for the number of white dwarfs in the open cluster, a subject that is related to the birthrate of these kinds of stars in open clusters and also to the age of a
Photometric peculiarities of the RY Taurus
International Nuclear Information System (INIS)
Zajtseva, G.V.
1982-01-01
The results are presented of photoelectric UBV-observations of RY Taurus carried out in 1965-80 at the Crimean Station of the State Sternberg Astronomical Institute. Two components of brightness variations are observed: fast (days) and slow (years). During fast variations the colour indices U-B and B-V change independently of brightness, however, in particular time inter-- vals the rather strong correlation with the star brightness is observed, positive or negative. During the slow variations only the reverse dependence is observed; the brightness increase is followed by the increase of colour indices (reddening of the star). The comparison of the RY TAURUS intrinsic polarization variations has shown that the dependence of polarization degree on brightness is nonmonotonic. At minimum and maximum brightness the RY TAURUS intrinsic polarization is maximum and reaches 5-6 %. At the general amplitude of RY TAURUS brightness variations in V rays from 10.sup(m)1 to 11.sup(m)7 the V=11.sup(m)0 value is singled out. First a certain ''avoidance'' of this brightness value by the star is observed. Second, the fracture in the course of polarization dependence on brightness occurs as well in the V=11sup(m) region
Star-forming galaxy models: Blending star formation into TREESPH
Mihos, J. Christopher; Hernquist, Lars
1994-01-01
We have incorporated star-formation algorithms into a hybrid N-body/smoothed particle hydrodynamics code (TREESPH) in order to describe the star forming properties of disk galaxies over timescales of a few billion years. The models employ a Schmidt law of index n approximately 1.5 to calculate star-formation rates, and explicitly include the energy and metallicity feedback into the Interstellar Medium (ISM). Modeling the newly formed stellar population is achieved through the use of hybrid SPH/young star particles which gradually convert from gaseous to collisionless particles, avoiding the computational difficulties involved in creating new particles. The models are shown to reproduce well the star-forming properties of disk galaxies, such as the morphology, rate of star formation, and evolution of the global star-formation rate and disk gas content. As an example of the technique, we model an encounter between a disk galaxy and a small companion which gives rise to a ring galaxy reminiscent of the Cartwheel (AM 0035-35). The primary galaxy in this encounter experiences two phases of star forming activity: an initial period during the expansion of the ring, and a delayed phase as shocked material in the ring falls back into the central regions.
EMACSS: Evolve Me A Cluster of StarS
Alexander, Poul E. R.; Gieles, Mark
2012-03-01
The star cluster evolution code Evolve Me A Cluster of StarS (EMACSS) is a simple yet physically motivated computational model that describes the evolution of some fundamental properties of star clusters in static tidal fields. The prescription is based upon the flow of energy within the cluster, which is a constant fraction of the total energy per half-mass relaxation time. According to Henon's predictions, this flow is independent of the precise mechanisms for energy production within the core, and therefore does not require a complete description of the many-body interactions therein. Dynamical theory and analytic descriptions of escape mechanisms is used to construct a series of coupled differential equations expressing the time evolution of cluster mass and radius for a cluster of equal-mass stars. These equations are numerically solved using a fourth-order Runge-Kutta integration kernel; the results were benchmarked against a data base of direct N-body simulations. EMACSS is publicly available and reproduces the N-body results to within 10 per cent accuracy for the entire post-collapse evolution of star clusters.
BP erioperatsioon naftalekke peatamiseks nurjus / Jürgen Tamme
Tamme, Jürgen
2010-01-01
Naftakompanii BP katse peatada Mehhiko lahe naftaleke ebaõnnestus, nüüd püütakse reostust peatada uue toru paigaldamise abil. USA president Barack Obama avaldas taas rahulolematust naftakompaniiga. Kaart
EST Table: BP117517 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP117517 ce--0464 10/09/28 63 %/173 aa ref|XP_002092422.1| GE14184 [Drosophila yakuba] gb|EDW92134.1| GE14...184 [Drosophila yakuba] 10/08/28 63 %/173 aa FBpp0259194|DyakGE14184-PA 10/08/28 35 %
International Nuclear Information System (INIS)
Brand, J.; Wouterloot, J.G.A.
1988-01-01
We have used the Walraven photometric system (V BLUW) to derive distances to stars of spectral type earlier than A7 (T eff > 8000 K). We discuss the method and its accuracy, using it on member stars of (open) clusters with spectral types between 06 and A7. To obtain the weighted average distance modulus of a cluster, a weighting scheme is derived, based on the propagation of measurement errors in the distance modulus of a star as a function of its magnitude, T eff , and colour. The average uncertainty in a cluster distance modulus is 0. m 13 (6% in distance). For a single, normal star (i.e. one without spectral peculiarities), the average deviation from the mean-cluster distance modulus is about 0. m 5 (25% in distance). A comparison with the literature shows that previous distance determinations, using different techniques, of the clusters studied here agree within 0. m 36 (18% in distance) with ours. For three clusters, Upper-Scorpius, NGC 3293, and IC 2944, a star-by-star comparison is made with published data. Although the average cluster distance moduli are equal within the uncertainties, the moduli of the individual stars can differ up to about 2 m . These differences are the consequence of the adopted absolute magnitude calibrations, and/or a slightly different spectral classification for the cluster stars between the VBLUW results and the literature. The latter are comparable to the variations in classification found in the literature, and are therefore within the resolution of the methods used to derive distances. A semi-empirical ZAMS relation for the Walraven system for spectral types from 0 to K is given
Directory of Open Access Journals (Sweden)
Hua Bai
Full Text Available Mutations of the insulin/IGF signaling (IIS pathway extend Drosophila lifespan. Based on genetic epistasis analyses, this longevity assurance is attributed to downstream effects of the FOXO transcription factor. However, as reported FOXO accounts for only a portion of the observed longevity benefit, suggesting there are additional outputs of IIS to mediate aging. One candidate is target of rapamycin complex 1 (TORC1. Reduced TORC1 activity is reported to slow aging, whereas reduced IIS is reported to repress TORC1 activity. The eukaryotic translation initiation factor 4E binding protein (4E-BP is repressed by TORC1, and activated 4E-BP is reported to increase Drosophila lifespan. Here we use genetic epistasis analyses to test whether longevity assurance mutants of chico, the Drosophila insulin receptor substrate homolog, require Drosophila d4eBP to slow aging. In chico heterozygotes, which are robustly long-lived, d4eBP is required but not sufficient to slow aging. Remarkably, d4eBP is not required or sufficient for chico homozygotes to extend longevity. Likewise, chico heterozygote females partially require d4eBP to preserve age-dependent locomotion, and both chico genotypes require d4eBP to improve stress-resistance. Reproduction and most measures of growth affected by either chico genotype are always independent of d4eBP. In females, chico heterozygotes paradoxically produce more rather than less phosphorylated 4E-BP (p4E-BP. Altered IRS function within the IIS pathway of Drosophila appears to have partial, conditional capacity to regulate aging through an unconventional interaction with 4E-BP.
MCM-BP regulates unloading of the MCM2–7 helicase in late S phase
Nishiyama, Atsuya; Frappier, Lori; Méchali, Marcel
2011-01-01
Origins of DNA replication are licensed by recruiting MCM2–7 to assemble the prereplicative complex (pre-RC). How MCM2–7 is inactivated or removed from chromatin at the end of S phase is still unclear. Here, we show that MCM-BP can disassemble the MCM2–7 complex and might function as an unloader of MCM2–7 from chromatin. In Xenopus egg extracts, MCM-BP exists in a stable complex with MCM7, but is not associated with the MCM2–7 hexameric complex. MCM-BP accumulates in nuclei in late S phase, well after the loading of MCM2–7 onto chromatin. MCM-BP immunodepletion in Xenopus egg extracts inhibits replication-dependent MCM dissociation without affecting pre-RC formation and DNA replication. When excess MCM-BP is incubated with Xenopus egg extracts or immunopurified MCM2–7, it binds to MCM proteins and promotes disassembly of the MCM2–7 complex. Recombinant MCM-BP also releases MCM2–7 from isolated late-S-phase chromatin, but this activity is abolished when DNA replication is blocked. MCM-BP silencing in human cells also delays MCM dissociation in late S phase. We propose that MCM-BP plays a key role in the mechanism by which pre-RC is cleared from replicated DNA in vertebrate cells. PMID:21196493
Oxygen-dependent acetylation and dimerization of the corepressor CtBP2 in neural stem cells
International Nuclear Information System (INIS)
Karaca, Esra; Lewicki, Jakub; Hermanson, Ola
2015-01-01
The transcriptional corepressor CtBP2 is essential for proper development of the nervous system. The factor exerts its repression by interacting in complexes with chromatin-modifying factors such as histone deacetylases (HDAC) 1/2 and the histone demethylase LSD1/KDM1. Notably, the histone acetyl transferase p300 acetylates CtBP2 and this is an important regulatory event of the activity and subcellular localization of the protein. We recently demonstrated an essential role for CtBPs as sensors of microenvironmental oxygen levels influencing the differentiation potential of neural stem cells (NSCs), but it is not known whether oxygen levels influence the acetylation levels of CtBP factors. Here we show by using proximity ligation assay (PLA) that CtBP2 acetylation levels increased significantly in undifferentiated, proliferating NSCs under hypoxic conditions. CtBP2 interacted with the class III HDAC Sirt1 but this interaction was unaltered in hypoxic conditions, and treatment with the Sirt1 inhibitor Ex527 did not result in any significant change in total CtBP2 acetylation levels. Instead, we revealed a significant decrease in PLA signal representing CtBP2 dimerization in NSCs under hypoxic conditions, negatively correlating with the acetylation levels. Our results suggest that microenvironmental oxygen levels influence the dimerization and acetylation levels, and thereby the activity, of CtBP2 in proliferating NSCs
Oxygen-dependent acetylation and dimerization of the corepressor CtBP2 in neural stem cells
Energy Technology Data Exchange (ETDEWEB)
Karaca, Esra; Lewicki, Jakub; Hermanson, Ola, E-mail: Ola.Hermanson@ki.se
2015-03-01
The transcriptional corepressor CtBP2 is essential for proper development of the nervous system. The factor exerts its repression by interacting in complexes with chromatin-modifying factors such as histone deacetylases (HDAC) 1/2 and the histone demethylase LSD1/KDM1. Notably, the histone acetyl transferase p300 acetylates CtBP2 and this is an important regulatory event of the activity and subcellular localization of the protein. We recently demonstrated an essential role for CtBPs as sensors of microenvironmental oxygen levels influencing the differentiation potential of neural stem cells (NSCs), but it is not known whether oxygen levels influence the acetylation levels of CtBP factors. Here we show by using proximity ligation assay (PLA) that CtBP2 acetylation levels increased significantly in undifferentiated, proliferating NSCs under hypoxic conditions. CtBP2 interacted with the class III HDAC Sirt1 but this interaction was unaltered in hypoxic conditions, and treatment with the Sirt1 inhibitor Ex527 did not result in any significant change in total CtBP2 acetylation levels. Instead, we revealed a significant decrease in PLA signal representing CtBP2 dimerization in NSCs under hypoxic conditions, negatively correlating with the acetylation levels. Our results suggest that microenvironmental oxygen levels influence the dimerization and acetylation levels, and thereby the activity, of CtBP2 in proliferating NSCs.
A central role for R7bp in the regulation of itch sensation.
Pandey, Mritunjay; Zhang, Jian-Hua; Mishra, Santosh K; Adikaram, Poorni R; Harris, Benjamin; Kahler, John F; Loshakov, Anna; Sholevar, Roxanne; Genis, Allison; Kittock, Claire; Kabat, Juraj; Ganesan, Sundar; Neubig, Richard R; Hoon, Mark A; Simonds, William F
2017-05-01
Itch is a protective sensation producing a desire to scratch. Pathologic itch can be a chronic symptom of illnesses such as uremia, cholestatic liver disease, neuropathies and dermatitis, however current therapeutic options are limited. Many types of cell surface receptors, including those present on cells in the skin, on sensory neurons and on neurons in the spinal cord, have been implicated in itch signaling. The role of G protein signaling in the regulation of pruriception is poorly understood. We identify here 2 G protein signaling components whose mutation impairs itch sensation. R7bp (a.k.a. Rgs7bp) is a palmitoylated membrane anchoring protein expressed in neurons that facilitates Gαi/o -directed GTPase activating protein activity mediated by the Gβ5/R7-RGS complex. Knockout of R7bp diminishes scratching responses to multiple cutaneously applied and intrathecally-administered pruritogens in mice. Knock-in to mice of a GTPase activating protein-insensitive mutant of Gαo (Gnao1 G184S/+) produces a similar pruriceptive phenotype. The pruriceptive defect in R7bp knockout mice was rescued in double knockout mice also lacking Oprk1, encoding the G protein-coupled kappa-opioid receptor whose activation is known to inhibit itch sensation. In a model of atopic dermatitis (eczema), R7bp knockout mice showed diminished scratching behavior and enhanced sensitivity to kappa opioid agonists. Taken together, our results indicate that R7bp is a key regulator of itch sensation and suggest the potential targeting of R7bp-dependent GTPase activating protein activity as a novel therapeutic strategy for pathological itch.
Barium and Tc-poor S stars: Binary masqueraders among carbon stars
Jorissen, A.; Van Eck, S.
1997-01-01
The current understanding of the origin of barium and S stars is reviewed, based on new orbital elements and binary frequencies. The following questions are addressed: (i) Is binarity a necessary condition to produce a barium star? (ii) What is the mass transfer mode (wind accretion or RLOF?) responsible for their formation? (iii) Do barium stars form as dwarfs or as giants? (iv) Do barium stars evolve into Tc-poor S stars? (v) What is the relative frequency of Tc-rich and Tc-poor S stars?
Peculiarities of phase transformation in Ni3Fe powder alloy
International Nuclear Information System (INIS)
Nuzhdin, A.A.
1990-01-01
Ordering process in sintered powder alloy Ni 3 Fe by normal and high temperatures was studied. Thermal stresses connected with porosity level of material effect on transformation peculiarities. The changes of electric conductivity, thermal expansion coefficient, bulk modulus during transformation were studied. The analysis of this changes was made
INDIVIDUAL AND PSYCHOLOGICAL PECULIARITIES OF TRANSLATING AS A LANGUAGE ABILITIES COMPONENT
Directory of Open Access Journals (Sweden)
Natalia Ya Bolshunova
2017-12-01
Full Text Available The article addresses the differential-psychological aspect of translating abilities as a component of language abilities. The peculiarity of translation is described including both linguistic and paralinguistic aspects of translating a content and a sense from one language into another accompanied by linguistic and cognitive actions. A variety of individual and psychological peculiarities of translation based on the translation dominant were revealed. It was demonstrated that these peculiarities are relevant to communicative and linguistic types of language abilities discovered byM.K. Kabardov. Valid assessment methods such as M.N. Borisova’s test for investigation “artistic” and “thinking” types of Higher Nervous Activity (HNA, D. Wechsler’ test of verbal and nonverbal intelligence, and a test developed by the authors of the article for individual specificity of interpreter’s activity as communicative and linguistic types of translating abilities assessment were used. The results suggest that all the typological differences are based on special human types of HNA. Subjects displaying the “thinking” type use linguistic methods when translating, whereas subjects displaying the “artistic” type try to use their own subjective life experience and extralinguistic methods when translating foreign language constructions. Extreme subjects of both types try to use the most developed components of their special abilities in order to compensate the components of the other type which are not well developed to accomplish some language tasks. In this case subjects of both types can fulfill these tasks rather successfully.
Tan, L H
2004-07-01
This review revisits Waldeyer's ring lymphomas as classified by the World Health Organisation. Sources of data include international studies on Waldeyer's ring lymphomas as well as from personal observations gleaned from lymphoma statistics of Singapore General Hospital, Changi General Hospital, Tan Tock Seng Hospital and National University Hospital within the last decade or so. Waldeyer's ring shares many of the histopathological trends of the rest of mucosa-associated lymphoid tissue (MALT), such as the high frequency of diffuse large B-cell lymphomas, and the relative rarity of follicular lymphomas in spite of its rich endowment with reactive lymphoid follicles. However, extranodal marginal zone lymphoma or "MALToma" may not be as frequently encountered as in other mucosal sites. Furthermore, the placement of Waldeyer's ring is unique in that stark comparisons with the lymphopathology of the immediately anterior oronasal cavities can be made, with intriguing peculiarities such as the abrupt reversal of the ratio of B-cell to T/NK-cell lymphoma frequency upon crossing the imaginary line that separates the 2 regions. The differential diagnosis with regionally common lymphoma mimics, in particular reactive parafollicular hyperplasia and nasopharyngeal undifferentiated (lymphoepithelial) carcinoma of Schmincke pattern, both often aetiologically related to Epstein-Barr viral infection, is also discussed. Recognition of the peculiarities and patterns of Waldeyer's ring lymphomas is important for accurate pathologic assessment. Postulates that attempt to account for the patterns and peculiarities of Waldeyer's ring lymphopathology can be used to direct further research.
Civil Cases Proof Peculiarities of Road Traffic Accidents Damages
Directory of Open Access Journals (Sweden)
Polyakov D. N.
2012-11-01
Full Text Available The author reveals proof peculiarities in civil cases of reparation of damages harmed by road traffic accident, in relation to the determination of a respondent (debtor. In the article are analyzed the appropriate norms of the RF Civil code regulating the rules and conditions of civil liability for damage caused by using a transport facility as a source of danger
International Nuclear Information System (INIS)
Hjellming, R.M.
1976-01-01
Any discussion of the radio emission from stars should begin by emphasizing certain unique problems. First of all, one must clarify a semantic confusion introduced into radio astronomy in the late 1950's when most new radio sources were described as radio stars. All of these early 'radio stars' were eventually identified with other galactic and extra-galactic objects. The study of true radio stars, where the radio emission is produced in the atmosphere of a star, began only in the 1960's. Most of the work on the subject has, in fact, been carried out in only the last few years. Because the real information about radio stars is quite new, it is not surprising that major aspects of the subject are not at all understood. For this reason this paper is organized mainly around three questions: what is the available observational information; what physical processes seem to be involved; and what working hypotheses look potentially fruitful. (Auth.)
TURBOVELOCITY STARS: KICKS RESULTING FROM THE TIDAL DISRUPTION OF SOLITARY STARS
International Nuclear Information System (INIS)
Manukian, Haik; Guillochon, James; Ramirez-Ruiz, Enrico; O'Leary, Ryan M.
2013-01-01
The centers of most known galaxies host supermassive black holes (SMBHs). In orbit around these black holes are a centrally concentrated distribution of stars, both in single and in binary systems. Occasionally, these stars are perturbed onto orbits that bring them close to the SMBH. If the star is in a binary system, the three-body interaction with the SMBH can lead to large changes in orbital energy, depositing one of the two stars on a tightly-bound orbit, and its companion into a hyperbolic orbit that may escape the galaxy. In this Letter, we show that the disruption of solitary stars can also lead to large positive increases in orbital energy. The kick velocity depends on the amount of mass the star loses at pericenter, but not on the ratio of black hole to stellar mass, and are at most the star's own escape velocity. We find that these kicks are usually too small to result in the ejection of stars from the Milky Way, but can eject the stars from the black hole's sphere of influence, reducing their probability of being disrupted again. We estimate that ∼ 10 5 stars, ∼ 1% of all stars within 10 pc of the galactic center, are likely to have had mass removed by the central black hole through tidal interaction, and speculate that these 'turbovelocity' stars will at first be redder, but eventually bluer, and always brighter than their unharassed peers.
CacyBP/SIP binds ERK1/2 and affects transcriptional activity of Elk-1
International Nuclear Information System (INIS)
Kilanczyk, Ewa; Filipek, Slawomir; Jastrzebska, Beata; Filipek, Anna
2009-01-01
In this work we showed for the first time that mouse CacyBP/SIP interacts with extracellular signal regulated kinases 1 and 2 (ERK1/2). We also established that a calcium binding protein, S100A6, competes for this interaction. Moreover, the E217K mutant of CacyBP/SIP does not bind significantly to ERK1/2 although it retains the ability to interact with S100A6. Molecular modeling shows that the E217K mutation in the 189-219 CacyBP/SIP fragment markedly changes its electrostatic potential, suggesting that the binding with ERK1/2 might have an electrostatic character. We also demonstrate that CacyBP/SIP-ERK1/2 interaction inhibits phosphorylation of the Elk-1 transcription factor in vitro and in the nuclear fraction of NB2a cells. Altogether, our data suggest that the binding of CacyBP/SIP with ERK1/2 might regulate Elk-1 phosphorylation/transcriptional activity and that S100A6 might further modulate this effect via Ca 2+ -dependent interaction with CacyBP/SIP and competition with ERK1/2.
BP and sustainable development and biodiversity in Azerbaijan
International Nuclear Information System (INIS)
Grant, Vidrine; Askerov, Faig
2002-01-01
Full text: BP takes its commitment to the environmental extremely seriously. BP believes it is essential to ensure that our operations and activities comply with the environmental standards in our PSAs and with the laws of Azerbaijan. To achieve this we have developed Environmental Operating Procedures. These procedures are currently being audited and we expect to receive ISO 14001 certification for all of our operations. Together with our Emergency Response and Oil Spill Response Plans we are able to manage our operations to ensure minimum impact and regulatory compliance. Additional, AIOC contributed to opening the Caspian Environmental Laboratory in 1999 to provide on a commercial basis, environmental services in Azerbaijan of an internationally recognized standard. We have conducted many other activities to promote biodiversity. In absence of the appropriate infrastructure we have built a waste management site at Serenja where we are currently disposing of synthetic based muds from our offshore drilling operations. We have also developed and implemented a Research and Monitoring Program in co-operation with representatives from SOCAR, Academy of Sciences, Azgipromorneftegaz and State Committee of Ecology. We have conducted Seals mortality investigation, Birds monitoring, Fish monitoring, Offshore surveys studying macrobenthos, water chemistry, sediments, groundwater monitoring, re-vegetation, etc. In developing our overall strategy BP has set some long term environmental aspirations or expectations: stop the use of halocarbons; to reduce Green House Gases by 10% by 20 lOin comparison with baseline data for 1990; stop venting and flaring; stop discharges to water of synthetic and oil based muds. BP recognizes that this is a goal. It is something we commit to and aspire to achieve and something we are wise enough to realize cannot be achieved overnight. None-the-less, it is something we constantly work towards. We also realize that this goal cannot be achieved in
TopBP1 is required at mitosis to reduce transmission of DNA damage to G1 daughter cells
DEFF Research Database (Denmark)
Pedersen, Rune Troelsgaard; Kruse, Thomas; Nilsson, Jakob
2015-01-01
mitotic entry. In early mitosis, TopBP1 marks sites of and promotes unscheduled DNA synthesis. Moreover, TopBP1 is required for focus formation of the structure-selective nuclease and scaffold protein SLX4 in mitosis. Persistent TopBP1 foci transition into 53BP1 nuclear bodies (NBs) in G1 and precise...... temporal depletion of TopBP1 just before mitotic entry induced formation of 53BP1 NBs in the next cell cycle, showing that TopBP1 acts to reduce transmission of DNA damage to G1 daughter cells. Based on these results, we propose that TopBP1 maintains genome integrity in mitosis by controlling chromatin...
BP reactivity to public speaking in stage 1 hypertension: influence of different task scenarios.
Palatini, Paolo; Bratti, Paolo; Palomba, Daniela; Bonso, Elisa; Saladini, Francesca; Benetti, Elisabetta; Casiglia, Edoardo
2011-10-01
To investigate the blood pressure (BP) reaction to public speaking performed according to different emotionally distressing scenarios in stage 1 hypertension. METHODS. We assessed 64 hypertensive and 30 normotensive subjects. They performed three speech tasks with neutral, anger and anxiety scenarios. BP was assessed with the Finometer beat-to-beat non-invasive recording system throughout the test procedure. For all types of speech, the systolic BP response was greater in the hypertensive than the normotensive subjects (all p public speaking is increased in stage 1 hypertension. A speech with anxiety or anger scenario elicits a greater diastolic BP reaction than tasks with neutral content.
EST Table: BP124521 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP124521 epV32477 10/09/28 59 %/164 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 55 %/163 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1
EST Table: BP123885 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP123885 epV31590 10/09/28 57 %/174 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 55 %/163 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1
EST Table: BP125106 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP125106 fbpv0387 10/09/28 58 %/165 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 56 %/165 aa FBpp0212871|DsimGD14469-PA 10/08/28 n.h 10/09/1
EST Table: BP125521 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP125521 fbpv0944 10/09/28 59 %/165 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 56 %/164 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1
EST Table: BP125005 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP125005 fbpv0197 10/09/28 58 %/185 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 58 %/173 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1
EST Table: BP121749 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP121749 ceN-5256 10/09/28 100 %/172 aa ref|NP_001036831.1| saposin-related [Bombyx...|GB16561-PA 10/09/10 44 %/178 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS791050 ceN- ...
EST Table: BP121763 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP121763 ceN-5273 10/09/28 99 %/184 aa ref|NP_001036831.1| saposin-related [Bombyx ...GB16561-PA 10/09/10 43 %/192 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS791050 ceN- ...
International Nuclear Information System (INIS)
Hjellming, R.M.; Gibson, D.M.
1985-01-01
Studies of stellar radio emission became an important field of research in the 1970's and have now expanded to become a major area of radio astronomy with the advent of new instruments such as the Very Large Array in New Mexico and transcontinental telescope arrays. This volume contains papers from the workshop on stellar continuum radio astronomy held in Boulder, Colorado, and is the first book on the rapidly expanding field of radio emission from stars and stellar systems. Subjects covered include the observational and theoretical aspects of stellar winds from both hot and cool stars, radio flares from active double star systems and red dwarf stars, bipolar flows from star-forming regions, and the radio emission from X-ray binaries. (orig.)
Magnetoresistance Effect in NiFe/BP/NiFe Vertical Spin Valve Devices
Directory of Open Access Journals (Sweden)
Leilei Xu
2017-01-01
Full Text Available Two-dimensional (2D layered materials such as graphene and transition metal dichalcogenides are emerging candidates for spintronic applications. Here, we report magnetoresistance (MR properties of a black phosphorus (BP spin valve devices consisting of thin BP flakes contacted by NiFe ferromagnetic (FM electrodes. The spin valve effect has been observed from room temperature to 4 K, with MR magnitudes of 0.57% at 4 K and 0.23% at 300 K. In addition, the spin valve resistance is found to decrease monotonically as temperature is decreased, indicating that the BP thin film works as a conductive interlayer between the NiFe electrodes.
IntCal04 terrestrial radiocarbon age calibration, 0-26 cal kyr BP
Reimer, Paula J.; Baillie, Mike G.L.; Bard, Edouard; Bayliss, Alex; Beck, J. Warren; Bertrand, Chanda J.H.; Blackwell, Paul G.; Buck, Caitlin E.; Burr, George S.; Cutler, Kirsten B.; Damon, Paul E.; Edwards, R. Lawrence; Fairbanks, Richard G.; Friedrich, Michael; Guilderson, Thomas P.; Hogg, Alan G.; Hughen, Konrad A.; Kromer, Bernd; McCormac, Gerry; Manning, Sturt; Bronk Ramsey, Christopher; Reimer, Ron W.; Remmele, Sabine; Southon, John R.; Stuiver, Minze; Talamo, Sahra; Taylor, F.W.; Plicht, Johannes van der; Weyhenmeyer, Constanze E.
2004-01-01
A new calibration curve for the conversion of radiocarbon ages to calibrated (cal) ages has been constructed and internationally ratified to replace IntCal98, which extended from 0–24 cal kyr BP (Before Present, 0 cal BP = AD 1950). The new calibration data set for terrestrial samples extends from
BP1, an Isoform of DLX4 Homeoprotein, Negatively Regulates BRCA1 in Sporadic Breast Cancer
Kluk, Brian J.; Fu, Yebo; Formolo, Trina A.; Zhang, Lei; Hindle, Anne K.; Man, Yan-gao; Siegel, Robert S.; Berg, Patricia E.; Deng, Chuxia; McCaffrey, Timothy A.; Fu, Sidney W.
2010-01-01
Introduction: Several lines of evidence point to an important role for BP1, an isoform of DLX4 homeobox gene, in breast carcinogenesis and progression. BRCA1 is a well-known player in the etiology of breast cancer. While familial breast cancer is often marked by BRCA1 mutation and subsequent loss of heterozygosity, sporadic breast cancers exhibit reduced expression of wild type BRCA1, and loss of BRCA1 expression may result in tumor development and progression. Methods: The Cister algorithm and Genomatix program were used to identify potential BP1 binding sites in BRCA1 gene. Real-time PCR, Western blot and immunohistochemistry analysis were performed to verify the expression of BRCA1 and BP1 in cell lines and breast cancer tissues. Double-stranded siRNA transfection was carried out for silencing BP1 expression. ChIP and EMSA were used to confirm that BP1 specifically binds to BRCA1. Results: A putative BP1 binding site was identified in the first intron of BRCA1, which was confirmed by chromatin immunoprecipiation and electrophoresis mobility shift assay. BP1 and BRCA1 expression were inversely correlated in breast cancer cell lines and tissues, suggesting that BP1 may suppress BRCA1 transcription through consensus sequence binding. Conclusions: BP1 homeoprotein represses BRCA1 expression through direct binding to its first intron, which is consistent with a previous study which identified a novel transcriptional repressor element located more than 500 base pairs into the first intron of BRCA1, suggesting that the first intron plays an important role in the negative regulation of BRCA1. Although further functional studies are necessary to confirm its repressor activity towards BRCA1, the elucidation of the role of BP1 in breast tumorigenesis holds great promise in establishing BP1 as a novel target for drug therapy. PMID:20877436
The large-scale peculiar velocity field in flat models of the universe
International Nuclear Information System (INIS)
Vittorio, N.; Turner, M.S.
1986-10-01
The inflationary Universe scenario predicts a flat Universe and both adiabatic and isocurvature primordial density perturbations with the Zel'dovich spectrum. The two simplest realizations, models dominated by hot or cold dark matter, seem to be in conflict with observations. Flat models are examined with two components of mass density, where one of the components of mass density is smoothly distributed and the large-scale (≥10h -1 MpC) peculiar velocity field for these models is considered. For the smooth component relativistic particles, a relic cosmological term, and light strings are considered. At present the observational situation is unsettled; but, in principle, the large-scale peculiar velocity field is very powerful discriminator between these different models. 61 refs
A hybrid method for accurate star tracking using star sensor and gyros.
Lu, Jiazhen; Yang, Lie; Zhang, Hao
2017-10-01
Star tracking is the primary operating mode of star sensors. To improve tracking accuracy and efficiency, a hybrid method using a star sensor and gyroscopes is proposed in this study. In this method, the dynamic conditions of an aircraft are determined first by the estimated angular acceleration. Under low dynamic conditions, the star sensor is used to measure the star vector and the vector difference method is adopted to estimate the current angular velocity. Under high dynamic conditions, the angular velocity is obtained by the calibrated gyros. The star position is predicted based on the estimated angular velocity and calibrated gyros using the star vector measurements. The results of the semi-physical experiment show that this hybrid method is accurate and feasible. In contrast with the star vector difference and gyro-assisted methods, the star position prediction result of the hybrid method is verified to be more accurate in two different cases under the given random noise of the star centroid.
Star Products and Applications
Iida, Mari; Yoshioka, Akira
2010-01-01
Star products parametrized by complex matrices are defined. Especially commutative associative star products are treated, and star exponentials with respect to these star products are considered. Jacobi's theta functions are given as infinite sums of star exponentials. As application, several concrete identities are obtained by properties of the star exponentials.
Effective star tracking method based on optical flow analysis for star trackers.
Sun, Ting; Xing, Fei; Wang, Xiaochu; Li, Jin; Wei, Minsong; You, Zheng
2016-12-20
Benefiting from rapid development of imaging sensor technology, modern optical technology, and a high-speed computing chip, the star tracker's accuracy, dynamic performance, and update rate have been greatly improved with low power consumption and miniature size. The star tracker is currently one of the most competitive attitude measurement sensors. However, due to restrictions of the optical imaging system, difficulties still exist in moving star spot detection and star tracking when in special motion conditions. An effective star tracking method based on optical flow analysis for star trackers is proposed in this paper. Spot-based optical flow, based on a gray gradient between two adjacent star images, is analyzed to distinguish the star spot region and obtain an accurate star spot position so that the star tracking can keep continuous under high dynamic conditions. The obtained star vectors and extended Kalman filter (EKF) are then combined to conduct an angular velocity estimation to ensure region prediction of the star spot; this can be combined with the optical flow analysis result. Experiment results show that the method proposed in this paper has advantages in conditions of large angular velocity and large angular acceleration, despite the presence of noise. Higher functional density and better performance can be achieved; thus, the star tracker can be more widely applied in small satellites, remote sensing, and other complex space missions.
The Peculiarities of the Outbound Tourist Market of China
Directory of Open Access Journals (Sweden)
Romanova Anna A.
2017-12-01
Full Text Available The outbound tourist market of China was analyzed as the priority target audience of consumers of the Ukrainian tourism product. A wording of the diplomatic preconditions for development of tourism relations with the People’s Republic of China and the partner countries of the economic and humanitarian project «One Belt, One Way» has been provided. The main characteristics of the outbound Chinese tourist market have been allocated and researched: hyper size; significant purchasing power; sustained growth pace; priority of Asian destinations, at the same time emergence of interest in the EU and Russia; organization, group character; seasonality; short-term traveling; cluster (combined travels; predominance of women tourists; priority of on-line booking of tours; peculiarities of travel behavior; predominance of certain types of tourism; preference of national Chinese cuisine, etc. These peculiarities of the Chinese outbound tourist market must be considered when developing tourism product for the Chinese and creating a strategy to increase the tourist flows from China to any destination and tourism facility. Recommendations for the entities of tourism activity which plan to work with the Chinese consumer of the national tourism product have been formulated.
The regulation of peculiarities of electronic contracting: comparative analysis
Directory of Open Access Journals (Sweden)
Наталія Юліївна Філатова
2017-12-01
Full Text Available Contract formation by electronic means nowadays is a widespread phenomenon. Nevertheless electronic contracting has been thoroughly explored by scholars all over the world and regulated both internationally and domestically, there still remain some issues which need to be carefully analyzed. In our view, the most essential question raised by electronic contracting is whether there is a need to amend substantial contract law provisions with regard to peculiarities of contracts concluded by electronic means. Seeking the answer to this question several approaches have been formulated, but none of them seems to be completely appropriate. In this paper the answer is also attempted to be found. For this purpose a comparative analysis of doctrine, legislation and judicial practice of certain states is performed. Particularly, offer, acceptance and moment of electronic contract formation are explored. On the basis of this research the following conclusion is done: amendments to substantial contract law provisions are not always necessary to improve the regulation of electronic contracting. Nevertheless the provisions of law should be applied correctly to the disputes arising from electronic contract formation taking into account the peculiarities of such contracts.
EST Table: BP182610 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP182610 NRPG0829 10/09/28 35 %/122 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...nl|Amel|GB19565-PA 10/09/10 35 %/122 aa gi|91093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 NRPG ...
Infrared spectra of peculiar emission-line stars
International Nuclear Information System (INIS)
Andrillat, Yvette; Houziaux, Leo
1975-01-01
230A/mm spectra of HD51585, V1016Cyg, HBV475 and XXOph between 8,000 and 11,000A are described. Important spectral variations have been noted between 1974 and 1975. Satisfactory identifications cannot be proposed for lines at 9,180 and 9,204A [fr