WorldWideScience

Sample records for peculiar bp stars

  1. On the co-existence of chemically peculiar Bp stars, slowly pulsating B stars and constant B stars in the same part of the HR diagram

    NARCIS (Netherlands)

    Briquet, M.; Hubrig, S.; Cat, P. de; Aerts, C.C.; North, P.; Schöller, M.

    2007-01-01

    Aims. In order to better model massive B-type stars, we need to understand the physical processes taking place in slowly pulsating B (SPB) stars, chemically peculiar Bp stars, and non-pulsating normal B stars co-existing in the same part of the H-R diagram. Methods: We carry out a comparative study

  2. Flares on a Bp Star

    Science.gov (United States)

    Mullan, D. J.

    2009-09-01

    Two large X-ray flares have been reported from the direction of a magnetic B2p star (σ Ori E). Sanz-Forcada et al. have suggested that the flares did not occur on the B2p star but on a companion of late spectral type. A star which is a candidate for a late-type flare star near σ Ori E has recently been identified by Bouy et al. However, based on the properties of the flares, and based on a recent model of rotating magnetospheres, we argue that, rather than attributing the two flares to a late-type dwarf, it is a viable hypothesis that the flares were magnetic phenomena associated with the rotating magnetosphere of the B2p star itself.

  3. FLARES ON A Bp STAR

    International Nuclear Information System (INIS)

    Mullan, D. J.

    2009-01-01

    Two large X-ray flares have been reported from the direction of a magnetic B2p star (σ Ori E). Sanz-Forcada et al. have suggested that the flares did not occur on the B2p star but on a companion of late spectral type. A star which is a candidate for a late-type flare star near σ Ori E has recently been identified by Bouy et al. However, based on the properties of the flares, and based on a recent model of rotating magnetospheres, we argue that, rather than attributing the two flares to a late-type dwarf, it is a viable hypothesis that the flares were magnetic phenomena associated with the rotating magnetosphere of the B2p star itself.

  4. HD 101065, the Most Peculiar Star

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... In this paper we discuss the prospects for asteroseismology with spatial resolution and motivate studies of the most chemically peculiar roAp star HD 101065. We present the first results from a high-precision radial velocity (RV) study of HD 101065 based on data spanning four nights that were acquired ...

  5. Spectrophotometry of peculiar B and A stars

    International Nuclear Information System (INIS)

    Adelman, S.J.

    1980-01-01

    Spectrophotometry of the optical region lambda lambda 3300-7100 is presented for seven magnetic Ap stars: HD 32650, 84 Ursa Majoris, HD 149822, 19 Lyrae, 4 Cygni, HD 196178, and 108 Aquarii. The energy distributions of all seven stars show definite lambda 4200 and lambda 5200 broad, continuum features as well as other more subtle deviations from the predictions of normal stellar atmospheres. The observations of HD 32650 violate the general rule for the Ap stars that the temperature found by comparing the Balmer jump regions with the predictions of normal stalle atmospheres with log g = 4.0 are systematically greater than those found from fitting the slopes of the Paschen continua. (orig.)

  6. What stars become peculiar type I supernovae?

    International Nuclear Information System (INIS)

    Uomoto, A.

    1986-01-01

    Hot hydrogen-deficient binaries such as Upsilon Sgr and KS Per are suggested as the stars most likely to become Type Ib supernovae. These systems satisfy the preexplosion constraints imposed by Type Ib observations by not having any hydrogen in their atmospheres (explaining their spectra), being truncated at the Roche lobe (explaining their light curves), and having large main-sequence masses (explaining their presence in extreme Population I locations). Although none of those known seems to be in danger of exploding, a system with a current primary mass of about solar masses may do so by core collapse. 36 references

  7. The occurrence of peculiar stars in open clusters

    International Nuclear Information System (INIS)

    Abt, H.A.; Levato, H.

    1978-01-01

    The authors have classified on the MK system a total of 455 stars in 12 open clusters and associations. The classification is based on wide (1.2 mm) spectra of two reciprocal dispersions (39, 128 A mm -1 ) obtained with the Kitt Peak 2.1 m and 90 cm reflectors respectively. The higher dispersion is necessary to show the subtle peculiarities found in some stars. The clusters are the Orion Nebula cluster, Orion OB1 association, Lacerta OB1 association, IC 2602, IC 4665, Pleiades, M39, M34, NGC 2516, NGC 6633, NGC 6475, and Coma. (Auth.)

  8. SPECTROPOLARIMETRY OF THE CLASSICAL T TAURI STAR BP TAU

    International Nuclear Information System (INIS)

    Chen, Wei; Johns-Krull, Christopher M.

    2013-01-01

    We implement a least-squares deconvolution (LSD) code to study magnetic fields on cool stars. We first apply our code to high-resolution optical echelle spectra of 53 Cam (a magnetic Ap star) and three well-studied cool stars (Arcturus, 61 Cyg A, and ξ Boo A) as well as the Sun (by observing the asteroid Vesta) as tests of the code and the instrumentation. Our analysis is based on several hundred photospheric lines spanning the wavelength range 5000 Å to 9000 Å. We then apply our LSD code to six nights of data on the Classical T Tauri Star BP Tau. A maximum longitudinal field of 370 ± 80 G is detected from the photospheric lines on BP Tau. A 1.8 kG dipole tilted at 129° with respect to the rotation axis and a 1.4 kG octupole tilted at 104° with respect to the rotation axis, both with a filling factor of 0.25, best fit our LSD Stokes V profiles. Measurements of several emission lines (He I 5876 Å, Ca II 8498 Å, and 8542 Å) show the presence of strong magnetic fields in the line formation regions of these lines, which are believed to be the base of the accretion footpoints. The field strength measured from these lines shows night-to-night variability consistent with rotation of the star

  9. SPECTROPOLARIMETRY OF THE CLASSICAL T TAURI STAR BP TAU

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Wei; Johns-Krull, Christopher M., E-mail: wc2@rice.edu, E-mail: cmj@rice.edu [Department of Physics and Astronomy, Rice University, Houston, TX 77005 (United States)

    2013-10-20

    We implement a least-squares deconvolution (LSD) code to study magnetic fields on cool stars. We first apply our code to high-resolution optical echelle spectra of 53 Cam (a magnetic Ap star) and three well-studied cool stars (Arcturus, 61 Cyg A, and ξ Boo A) as well as the Sun (by observing the asteroid Vesta) as tests of the code and the instrumentation. Our analysis is based on several hundred photospheric lines spanning the wavelength range 5000 Å to 9000 Å. We then apply our LSD code to six nights of data on the Classical T Tauri Star BP Tau. A maximum longitudinal field of 370 ± 80 G is detected from the photospheric lines on BP Tau. A 1.8 kG dipole tilted at 129° with respect to the rotation axis and a 1.4 kG octupole tilted at 104° with respect to the rotation axis, both with a filling factor of 0.25, best fit our LSD Stokes V profiles. Measurements of several emission lines (He I 5876 Å, Ca II 8498 Å, and 8542 Å) show the presence of strong magnetic fields in the line formation regions of these lines, which are believed to be the base of the accretion footpoints. The field strength measured from these lines shows night-to-night variability consistent with rotation of the star.

  10. Peculiar early-type galaxies with central star formation

    International Nuclear Information System (INIS)

    Ge Chong; Gu Qiusheng

    2012-01-01

    Early-type galaxies (ETGs) are very important for understanding the formation and evolution of galaxies. Recent observations suggest that ETGs are not simply old stellar spheroids as we previously thought. Widespread recent star formation, cool gas and dust have been detected in a substantial fraction of ETGs. We make use of the radial profiles of g — r color and the concentration index from the Sloan Digital Sky Survey database to pick out 31 peculiar ETGs with central blue cores. By analyzing the photometric and spectroscopic data, we suggest that the blue cores are caused by star formation activities rather than the central weak active galactic nucleus. From the results of stellar population synthesis, we find that the stellar population of the blue cores is relatively young, spreading from several Myr to less than one Gyr. In 14 galaxies with H I observations, we find that the average gas fraction of these galaxies is about 0.55. The bluer galaxies show a higher gas fraction, and the total star formation rate (SFR) correlates very well with the H I gas mass. The star formation history of these ETGs is affected by the environment, e.g. in the denser environment the H I gas is less and the total SFR is lower. We also discuss the origin of the central star formation of these early-type galaxies.

  11. Magnetic field of massive chemically peculiar stars in the Orion OB1 association

    Science.gov (United States)

    Romanyuk, I. I.; Semenko, E. A.; Kudryavtsev, D. O.; Yakunin, I. A.

    2018-01-01

    Spectropolarimetric observations of 55 chemically peculiar stars in the Orion OB1 association were obtained at the 6 m telescope of the Russian Academy of Sciences with the aim of searching for the presence of stellar magnetic fields. We found 8 new magnetic stars in addition to 20 previously known objects. The frequency of chemically peculiar A and B-type stars among normal A and B-type stars and the frequency of magnetic stars among all chemically peculiar stars decreases with age in the Orion OB1 association.

  12. The incidence of chemically peculiar stars in open clusters

    Energy Technology Data Exchange (ETDEWEB)

    Netopil, M.

    2013-07-01

    The formation and evolution of chemically peculiar (CP) stars is still a matter of debate, although the first representatives were detected already more than 110 years ago. From the astrophysical point of view, these objects are of particular interest, since they combine a wide variety of specific properties. This work deals with a subgroup of CP stars, showing beside overabundances of some iron-peak (e.g. Chromium) and rare earth elements like Europium, also strong ordered magnetic fields as well as a slow rotation. Based on a selection of well investigated close field stars, the possible connections of these properties were examined. However, the main research focus was the analysis of a relationship between the number of CP stars and their age. For this purpose, the results of the extensive Delta-a survey in open clusters were used. This photometric filter system allows an efficient and economic detection of magnetic CP stars due to a characteristic flux depression at 520 nm. Compared to field stars, open clusters offer the big advantage that for example the age and the distance can be determined more accurately on a statistical basis, since all member stars of an open cluster originate more or less at the same time from a single molecular cloud. After the membership analysis of all in Delta a investigated objects and the determination of the cluster parameters, it was shown that the occurrence of CP stars depend on age, but can be explained by the general evolution of stars. This entails amongst others that CP stars show their typical characteristics already as soon as they have arrived the main-sequence, or even before. Furthermore, we were able to detect at least one representative, probably still in its pre-main-sequence phase. (author) [German] Die Entstehung und Entwicklung von chemisch pekuliaren (CP) Sternen ist nach wie vor nicht restlos geklärt, und das obwohl die ersten Vertreter dieser Sterngruppe bereits vor mehr als 110 Jahren entdeckt wurden. Aus

  13. Mixed poloidal-toroidal magnetic configuration and surface abundance distributions of the Bp star 36 Lyn

    Science.gov (United States)

    Oksala, M. E.; Silvester, J.; Kochukhov, O.; Neiner, C.; Wade, G. A.; the MiMeS Collaboration

    2018-01-01

    Previous studies of the chemically peculiar Bp star 36 Lyn revealed a moderately strong magnetic field, circumstellar material and inhomogeneous surface abundance distributions of certain elements. We present in this paper an analysis of 33 high signal-to-noise ratio, high-resolution Stokes IV observations of 36 Lyn obtained with the Narval spectropolarimeter at the Bernard Lyot Telescope at Pic du Midi Observatory. From these data, we compute new measurements of the mean longitudinal magnetic field, Bℓ, using the multiline least-squares deconvolution (LSD) technique. A rotationally phased Bℓ curve reveals a strong magnetic field, with indications for deviation from a pure dipole field. We derive magnetic maps and chemical abundance distributions from the LSD profiles, produced using the Zeeman-Doppler imaging code INVERSLSD. Using a spherical harmonic expansion to characterize the magnetic field, we find that the harmonic energy is concentrated predominantly in the dipole mode (ℓ = 1), with significant contribution from both the poloidal and toroidal components. This toroidal field component is predicted theoretically, but not typically observed for Ap/Bp stars. Chemical abundance maps reveal a helium enhancement in a distinct region where the radial magnetic field is strong. Silicon enhancements are located in two regions, also where the radial field is stronger. Titanium and iron enhancements are slightly offset from the helium enhancements, and are located in areas where the radial field is weak, close to the magnetic equator.

  14. Spectrophotometry of peculiar B and A stars. I. On the detection of the lambda4200 and lambda5200 broad, continuum features of peculiar A stars

    International Nuclear Information System (INIS)

    Adelman, S.J.

    1979-01-01

    Photometric indices are used to study the broad, continuum features that are present in the energy distributions of many peculiar A stars and that may be indicators of the atmospheric structure. Values of Maitzen's Δa index, which is a measure of the lambda5200 feature, are synthesized from spectrophotometric data to examine the properties of this photometric system as well as to establish a preliminary criterion of presence for the feature. Many Ap stars definitely exhibit this feature, which normal main sequence stars lack. Two indices Δiota and Δiota* are calculated from spectrophotometry to measure the strength of the lambda4200 feature. About 90% of the Ap stars are found to have definite positive results based on the preliminary criterion of presence of the latter index. For the Ap stars there is a general tendency for Δa to increase with Δiota and Δiota*. This most likely reflects the tendency for most abundances to increase together in the Ap stars. The HgMn stars have systematically larger Δiota* and Δa values than the normal stars. This does not necessarily mean that they have the lambda4200 and lambda5200 features of the peculiar A stars. To study this question requires careful comparison of the energy distributions of the HgMn stars with those of other stars and with the predictions of model atmospheres

  15. Search for white dwarf companions of cool stars with peculiar element abundances

    Energy Technology Data Exchange (ETDEWEB)

    Boehm-Vitense, E.

    1984-01-01

    A search for a white dwarf companions of cool stars with peculiar element abundances was undertaken. One additional star the xi Cet, was found with a white dwarf companion. It was found that HR 1016, 56Uma, 16 Ser, have high excitation emission lines which indicate a high temperature object in the system. It is suggested that since these indications for high temperature companions were seen for all nearby Ba stars, it is highly probable that all Ba stars have white dwarf companions, and that the peculiar element abundances seen in the Ba stars are due to mass transfer. Observations, arguments and conclusions are presented. White dwarf companions were not found. Together with the Li and Be abundances and the chromospheric emission line spectra in these stars were studied. No white dwarf companions were seen for subgiant CH stars.

  16. Search for white dwarf companions of cool stars with peculiar element abundances

    International Nuclear Information System (INIS)

    Boehm-Vitense, E.

    1984-01-01

    A search for a white dwarf companions of cool stars with peculiar element abundances was undertaken. One additional star the xi Cet, was found with a white dwarf companion. It was found that HR 1016, 56Uma, 16 Ser, have high excitation emission lines which indicate a high temperature object in the system. It is suggested that since these indications for high temperature companions were seen for all nearby Ba stars, it is highly probable that all Ba stars have white dwarf companions, and that the peculiar element abundances seen in the Ba stars are due to mass transfer. Observations, arguments and conclusions are presented. White dwarf companions were not found. Together with the Li and Be abundances and the chromospheric emission line spectra in these stars were studied. No white dwarf companions were seen for subgiant CH stars

  17. Search for molecular outflows associated with peculiar nebulosities and regions of star formation

    Energy Technology Data Exchange (ETDEWEB)

    Torrelles, J M; Rodriguez, L F; Canto, J; Marcaide, J; Gyulbudaghian, A L

    1983-01-01

    We surveyed an extensive list of peculiar nebulosities and regions of star formation searching for conspicuous cases of high-velocity carbon monoxide emission. We detected an apparently isotropic outflow associated with the star-forming region GL 2591. Among the other sources surveyed, the cometary nebula GM 24 is of interest since it is located in a very hot molecular spot where formation of massive stars took place recently.

  18. The Nainital Cape Survey Project : A Search for Pulsation in Chemically Peculiar Stars

    Science.gov (United States)

    Chakradhari, Nand Kumar; Joshi, Santosh

    2018-04-01

    The Nainital-Cape Survey is a dedicated search programme initiated in 1999 in the coordination of astronomers from SAAO South Africa, ARIES Nainital and ISRO Bangalore. Over the last 17 years a total of 345 chemically peculiar stars were monitored for photometric variability, making it one of the longest ground-based survey to search for pulsation in chemically peculiar stars in terms of both time span and sample size. Under this survey, we discovered rapid pulsation in the Ap star HD12098 while δ Scuti-type pulsations were detected in seven Am stars. Those stars in which pulsations were not detected have also been tabulated along with their detailed astrophysical parameters for further investigation.

  19. CHANDRA X-RAY DETECTION OF THE ENIGMATIC FIELD STAR BP Psc

    International Nuclear Information System (INIS)

    Kastner, Joel H.; Montez, Rodolfo; Rodriguez, David; Zuckerman, B.; Perrin, Marshall D.; Grosso, Nicolas; Forveille, Thierry; Graham, James R.

    2010-01-01

    BP Psc is a remarkable emission-line field star that is orbited by a dusty disk and drives a parsec-scale system of jets. We report the detection by the Chandra X-ray Observatory of a weak X-ray point source coincident with the centroids of optical/IR and submillimeter continuum emission at BP Psc. As the star's photosphere is obscured throughout the visible and near-infrared, the Chandra X-ray source likely represents the first detection of BP Psc itself. The X-rays most likely originate with magnetic activity at BP Psc and hence can be attributed either to a stellar corona or to star-disk interactions. The log of the ratio of X-ray to bolometric luminosity, log(L X /L bol ), lies in the range -5.8 to -4.2. This is smaller than log(L X /L bol ) ratios typical of low-mass, pre-main sequence stars, but is well within the log(L X /L bol ) range observed for rapidly rotating (FK Com-type) G giant stars. Hence, the Chandra results favor an exotic model wherein the disk/jet system of BP Psc is the result of its very recently engulfing a companion star or a giant planet, as the primary star ascended the giant branch.

  20. The peculiar A star HD 110066: a photographic region line identification study

    International Nuclear Information System (INIS)

    Adelman, S.J.

    1988-01-01

    A line identification study of the very sharp-lined peculiar A star HD 110066 has been performed using four high dispersion photographic region spectrograms. New species found include Al I, Si I, S II, Ti I, Co II, Zr II, Cd I, La II, Ce III, Gd III, Dy II, Er II and Tm II. The presence of these species is in accord with the continuity of the magnetic Ap star sequence. (author)

  1. HD 185330 — chemically peculiar 3He star in the Kepler field

    Science.gov (United States)

    Niemczura, E.; Vennes, S.; Różański, T.; Pigulski, A.; Hełminiak, K.; Lehmann, H.

    2018-01-01

    We analyzed high-resolution spectra of the chemically peculiar 3He star HD 185330. We determined its atmospheric parameters (Teff, log g, ξ) and constrained its rotation velocity and abundance pattern. In particular, we found a large (×100) phosphorus abundance excess and evidence of 3He and 4He abundance stratification in the atmosphere.

  2. HD 101065, the Most Peculiar Star: First Results from Precise Radial ...

    Indian Academy of Sciences (India)

    Abstract. In this paper we discuss the prospects for asteroseismology with spatial resolution and motivate studies of the most chemically peculiar. roAp star HD 101065. We present the first results from a high-precision radial velocity (RV) study of HD 101065 based on data spanning four nights that were acquired using the ...

  3. Peculiar variable star R Aquarii and its jet

    Energy Technology Data Exchange (ETDEWEB)

    Kafatos, M; Michalitsianos, A G [National Aeronautics and Space Administration, Greenbelt, MD (USA). Goddard Space Flight Center

    1982-08-05

    The formation of a jet from the central star in the symbiotic variable R Aquarii is discussed and it is suggested that it is the result of supercritical accretion of mass transferred from the cool 387-day period Mira to the hot companion in a highly elliptical orbit. Ancient Japanese astronomical records suggest a nova outburst in AD930 may be associated with R Aquarii which formed the outer extended nebulosity. It is considered that the jet may help explain the outbursts of this object as well as the excitation of the R Aquarii nebula.

  4. Spectroscopic Peculiarity of the Herbig Be Star HD 259431

    Science.gov (United States)

    Pogodin, M. A.; Pavlovskij, S. E.; Drake, N. A.; Beskrovnaya, N. G.; Kozlova, O. V.; Alekseev, I. Yu.; Borges Fernandes, M.; Pereira, C. B.; Valyavin, G.

    2017-06-01

    High-resolution spectra of the Herbig Be star HD 259431 obtained in 2010-2016 at three observatories (Crimean AO, ESO in Chile, and OAN SPN in Mexico) are analysed. The object demonstrates a very rich emission line profile spectrum. The bulk of the lines exhibit double-peaked emission profiles and originate in the gaseous disk. The atmospheric lines are unusually shallow, and majority of them are distorted by the circumstellar (CS) contribution. Moreover, we have revealed that they are overlapped with an additional continuum emission. Using the observed ratio of the equivalent widths of two He I λ 4009 and 4026 lines, we estimated the spectral type of the object as B5 V. We also constructed the spectral energy distribution of the additional continuum using wide wings of the atmospheric Hβ-Hɛ lines free of the CS contribution. The continuum corresponds to the blue part of the black body spectrum. The Hβ - Hɛ Balmer emission lines show very variable profiles looking as either of P Cyg-type or a double-peaked emission line with a depression of the red wing. We found the period of this variability P = 2.630d and interpreted it as a sign of a rotating magnetosphere of the star with the magnetic axis inclined to the rotation axis. At different phases of rotation, the observer can see either an accretion flow at high magnetic latitudes or a wind zone at lower latitudes. We also estimated the inclination of the rotation axis i = 52°±1°.

  5. A search for peculiar stars in the open cluster Hogg 16

    Science.gov (United States)

    Cariddi, Stefano; Azatyan, Naira M.; Kurfürst, Petr; Štofanová, Lýdia; Netopil, Martin; Paunzen, Ernst; Pintado, Olga I.; Aidelman, Yael J.

    2018-01-01

    The study of chemically peculiar (CP) stars in open clusters provides valuable information about their evolutionary status. Their detection can be performed using the Δa photometric system, which maps a characteristic flux depression at λ ∼ 5200 Å. This paper aims at studying the occurrence of CP stars in the earliest stages of evolution of a stellar population by applying this technique to Hogg 16, a very young Galactic open cluster ( ∼ 25 Myr). We identified several peculiar candidates: two B-type stars with a negative Δa index (CD - 60 4701, CPD - 60 4706) are likely emission-line (Be) stars, even though spectral measurements are necessary for a proper classification of the second one; a third object (CD - 60 4703), identified as a Be candidate in literature, appears to be a background B-type supergiant with no significant Δa index, which does not rule out the possibility that it is indeed peculiar as the normality line of Δa for supergiants has not been studied in detail yet. A fourth object (CD - 60 4699) appears to be a magnetic CP star of 8 M⊙, but obtained spectral data seem to rule out this hypothesis. Three more magnetic CP star candidates are found in the domain of early F-type stars. One is a probable nonmember and close to the border of significance, but the other two are probably pre-main sequence cluster objects. This is very promising, as it can lead to very strong constraints to the diffusion theory. Finally, we derived the fundamental parameters of Hogg 16 and provide for the first time an estimate of its metal content.

  6. The composite nature of the peculiar star HR 6560 (HD 159870)

    Science.gov (United States)

    Wegner, Gary; Cowley, Charles R.

    1992-01-01

    Ground-based high-dispersion photographic spectra and ultraviolet spectra obtained with the IUE satellite are described and employed to determine the nature of the peculiar star HR 6560 (HD 159870). Previously this object had been described as both a composite system and as a strong Fm star. The UBVRI, Stromgren, and ultraviolet colors of HR 6560 are compared with objects classified composite from the Bright Star Catalogue and normal dwarfs and giants. The colors of HR 6560 are not unusual for a composite and are consistent with a late-A dwarf, combined with a late-G or early-K giant. The ultraviolet satellite clearly shows the presence of an A component, but its precise spectral type is difficult to assign. The IUE and TD-1 data suggest that the ultraviolet is dominated by light from an A5 V secondary and the visual from a GO III primary. This does not agree well with the most plausible model that fits the visual photometry. The peculiar nature of HR 6560's spectrum is most likely due to its composite nature.

  7. Spectrophotometry of peculiar B and A stars. II. Eleven mercury-manganese stars

    International Nuclear Information System (INIS)

    Adelman, S.J.; Pyper, D.M.

    1979-01-01

    Spectrophotometry of eleven HgMn stars is presented for the optical region. As found in Paper I, the HgMn stars have systematically larger Δiota* and Δa values than the normal main sequence stars due to differences with respect to the mean continuum particularly of the lambda4464 values and the lambda5200 region, respectively. The HgMn stars exhibit a continuous range in the behavior of both the lambda4200 and lambda5200 regions between those stars that have index values larger than the appropriate criterion of presence and present definite evidence for the features to those stars with only a slight possibility of such features. The strengths of the lambda4200 and lambda5200 features appear not to be correlated. In the HgMn stars, both features may be due to differential line blocking. In the energy distribution of all eleven stars, the Balmer jump regions best fit the predictions of slightly hotter solar composition, log g=4.0, fully line blanketed model atmospheres than do the corresponding Paschen continua

  8. HD 66051, an eclipsing binary hosting a highly peculiar, HgMn-related star.

    Science.gov (United States)

    Niemczura, Ewa; Hümmerich, Stefan; Castelli, Fiorella; Paunzen, Ernst; Bernhard, Klaus; Hambsch, Franz-Josef; Hełminiak, Krzysztof

    2017-07-19

    HD 66051 is an eclipsing system with an orbital period of about 4.75 d that exhibits out-of-eclipse variability with the same period. New multicolour photometric observations confirm the longevity of the secondary variations, which we interpret as a signature of surface inhomogeneities on one of the components. Using archival and newly acquired high-resolution spectra, we have performed a detailed abundance analysis. The primary component is a slowly rotating late B-type star (T eff  = 12500 ± 200 K; log g = 4.0, v sin i = 27 ± 2 km s -1 ) with a highly peculiar composition reminiscent of the singular HgMn-related star HD 65949, which seems to be its closest analogue. Some light elements as He, C, Mg, Al are depleted, while Si and P are enhanced. Except for Ni, all the iron-group elements, as well as most of the heavy elements, and in particular the REE elements, are overabundant. The secondary component was estimated to be a slowly rotating A-type star (T eff  ~ 8000 K; log g = 4.0, v sin i ~ 18 km s -1 ). The unique configuration of HD 66051 opens up intriguing possibilities for future research, which might eventually and significantly contribute to the understanding of such diverse phenomena as atmospheric structure, mass transfer, magnetic fields, photometric variability and the origin of chemical anomalies observed in HgMn stars and related objects.

  9. Peculiarities and Variations in the Optical Spectrum of the RV Tauri-type Star R Sct

    Directory of Open Access Journals (Sweden)

    Kipper Tõnu

    2013-06-01

    Full Text Available We analyzed some new high resolution optical spectra of the semiregular RV Tauri-type star R Sct. Fundamental parameters were found to be Teff = 4500 K, log g = 0.0 and ξt = 4.0 km s−1. The results of chemical analysis show that R Sct is a metal-poor star with [Fe/H]≈ −0.5. The carbon content with respect to iron is significantly larger than in the Sun, [C/Fe]=0.84, but there is an evident deficiency of heavy elements. We found no tight correlation of the chemical abundances on the condensation temperatures of elements. This means that in R Sct the depletion by condensation into dust does not work, with possible exception of Ca and Sc. The luminosity derived from the Hipparcos parallax corresponds to a tip of the red-giant branch or slightly above it. Thus it is possible that R Sct evolved off the early-AGB when it has not yet experienced the third dredge-up in thermal pulses, or it is still located on AGB. The peculiarities of spectral features (emissions, line-splitting and the complicated time-variable radial velocities were also studied.

  10. The peculiar galactic center neutron star X-ray binary XMM J174457-2850.3

    Energy Technology Data Exchange (ETDEWEB)

    Degenaar, N.; Reynolds, M. T.; Miller, J. M. [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48109 (United States); Wijnands, R. [Anton Pannekoek Institute of Astronomy, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Altamirano, D. [School of Physics and Astronomy, University of Southampton, Highfield, Southampton SO17 1BJ (United Kingdom); Kennea, J. [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); Gehrels, N. [Astrophysics Science Division, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Haggard, D. [CIERA, Physics and Astronomy Department, Northwestern University, 2145 Sheridan Road, Evanston, IL 60208 (United States); Ponti, G., E-mail: degenaar@umich.edu [Max Planck Institute fur Extraterrestriche Physik, D-85748 Garching (Germany)

    2014-09-10

    The recent discovery of a millisecond radio pulsar experiencing an accretion outburst similar to those seen in low mass X-ray binaries, has opened up a new opportunity to investigate the evolutionary link between these two different neutron star manifestations. The remarkable X-ray variability and hard X-ray spectrum of this object can potentially serve as a template to search for other X-ray binary/radio pulsar transitional objects. Here we demonstrate that the transient X-ray source XMM J174457-2850.3 near the Galactic center displays similar X-ray properties. We report on the detection of an energetic thermonuclear burst with an estimated duration of ≅2 hr and a radiated energy output of ≅ 5 × 10{sup 40} erg, which unambiguously demonstrates that the source harbors an accreting neutron star. It has a quiescent X-ray luminosity of L {sub X} ≅ 5 × 10{sup 32}(D/6.5 kpc){sup 2} erg s{sup –1} and exhibits occasional accretion outbursts during which it brightens to L {sub X} ≅ 10{sup 35}-10{sup 36}(D/6.5 kpc){sup 2} erg s{sup –1} for a few weeks (2-10 keV). However, the source often lingers in between outburst and quiescence at L {sub X} ≅ 10{sup 33}-10{sup 34}(D/6.5 kpc){sup 2} erg s{sup –1}. This peculiar X-ray flux behavior and its relatively hard X-ray spectrum, a power law with an index of Γ ≅ 1.4, could possibly be explained in terms of the interaction between the accretion flow and the magnetic field of the neutron star.

  11. A HIGH-RESOLUTION, MULTI-EPOCH SPECTRAL ATLAS OF PECULIAR STARS INCLUDING RAVE, GAIA , AND HERMES WAVELENGTH RANGES

    International Nuclear Information System (INIS)

    Tomasella, Lina; Munari, Ulisse; Zwitter, Tomaz

    2010-01-01

    We present an Echelle+CCD, high signal-to-noise ratio, high-resolution (R = 20,000) spectroscopic atlas of 108 well-known objects representative of the most common types of peculiar and variable stars. The wavelength interval extends from 4600 to 9400 A and includes the RAVE, Gaia, and HERMES wavelength ranges. Multi-epoch spectra are provided for the majority of the observed stars. A total of 425 spectra of peculiar stars, which were collected during 56 observing nights between 1998 November and 2002 August, are presented. The spectra are given in FITS format and heliocentric wavelengths, with accurate subtraction of both the sky background and the scattered light. Auxiliary material useful for custom applications (telluric dividers, spectrophotometric stars, flat-field tracings) is also provided. The atlas aims to provide a homogeneous database of the spectral appearance of stellar peculiarities, a tool useful both for classification purposes and inter-comparison studies. It could also serve in the planning and development of automated classification algorithms designed for RAVE, Gaia, HERMES, and other large-scale spectral surveys. The spectrum of XX Oph is discussed in some detail as an example of the content of the present atlas.

  12. Peculiarities in the distribution of galactic Wolf-Rayet stars: constraints on evolutionary scenarios

    International Nuclear Information System (INIS)

    Gomez, A.; Lortet, M.-C.; Pitault, A.

    1981-01-01

    The re-examination of the spatial distribution of 158 Wolf-Rayet stars in the Galaxy may help to define different breeds of Wolf-Rayet stars and put constraints on possible evolutionary scenarios. (Auth.)

  13. Using the Seismology of Non-magnetic Chemically Peculiar Stars as ...

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Chemical composition is a good tracer of the hydrodynamical processes that occur in stars as they often lead to mixing and particle transport. By comparing abundances predicted by models and those observed in stars we can infer some constraints on those mixing processes. As pulsations in the stars are ...

  14. A white dwarf companion to the main-sequence star 4 Omicron(1) Orionis and the binary hypothesis for the origin of peculiar red giants

    Science.gov (United States)

    Ake, Thomas B.; Johnson, Hollis R.

    1988-01-01

    Ultraviolet spectra of the peculiar red giants (PRGs) called MS stars are investigated, and the discovery of a white dwarf (WD) companion to the MS star 4 Omicron(1) Orionis is reported. The observations and data analysis are discussed and compared with those for field WDs in order to derive parameters for the WD and the luminosity of the primary. Detection limits for the other MS stars investigated are derived, and the binary hypothesis for PRGs is reviewed.

  15. Peculiar A star HD 43819 - A photographic region line-identification study

    International Nuclear Information System (INIS)

    Adelman, S.J.; The Citadel, Charleston, SC)

    1985-01-01

    A line identification study of the sharp-lined silicon star HD 43819 has been performed for the photographic region 3759-4924 A. Comparison of this star's spectrum with those of other silicon stars shows that it shares many of their apparent abundance anomalies. The TiII, CrII, FeI, and FeII spectra are well represented while the singly ionized rare earths are represented by at best a few lines per species. 21 references

  16. Ultraviolet energy distributions and the temperatures of peculiar B and A stars

    International Nuclear Information System (INIS)

    Adelman, S.J.; NASA, Goddard Space Flight Center, Greenbelt, MD)

    1985-01-01

    Color temperatures have been estimated by comparing ultraviolet observations of HgMn and magnetic Ap stars with those of normal stars. Ultraviolet data from the OAO-2, ANS, TD-1, and IUE satellites generally give similar results. The values for the normal stars were derived from comparison of fluxes predicted by solar-composition fully line-blanketed model atmospheres with optical region spectrophotometry. The ultraviolet temperatures of the HgMn stars cover a narrower temperature range than do their optical region values. Magnetic Ap stars with similar optical region temperatures can show substantial differences in their ultraviolet color temperatures. This may result from magnetic field configuration and abundance differences. 27 references

  17. Using the Seismology of Non-magnetic Chemically Peculiar Stars as ...

    Indian Academy of Sciences (India)

    stars we can infer some constraints on those mixing processes. As pulsa- tions in the ... Finally, microscopic diffusion due to gravity and radiation pressure ... complications posed by the largely unknown strength and geometry of the magnetic.

  18. Behavior of Abundances in Chemically Peculiar Dwarf and Subgiant A-Type Stars: HD 23193 and HD 170920

    Science.gov (United States)

    Kılıçoğlu, Tolgahan; Çalışkan, Şeyma; Ünal, Kübraözge

    2018-01-01

    To understand the origin of the abundance peculiarities of non-magnetic A-type stars, we present the first detailed chemical abundance analysis of a metallic line star HD 23193 (A2m) and an A-type subgiant HD 170920 (A5), which could have been a HgMn star on the main sequence. Our analysis is based on medium (R ∼ 14,000) and high (R ∼ 40,000) resolution spectroscopic data of the stars. The abundances of 18 elements are derived: C, O, Na, Mg, Al, Si, S, Ca, Sc, Ti, Cr, Mn, Fe, Ni, Zn, Sr, Y, and Ba. The masses of HD 23193 and HD 170920 are estimated from evolutionary tracks as 2.3 ± 0.1 M ⊙ and 2.9 ± 0.1 M ⊙. The ages are found to be 635 ± 33 Myr for HD 23193 and 480 ± 50 Myr for HD 170920 using isochrones. The abundance pattern of HD 23193 shows deviations from solar values in the iron-peak elements and indicates remarkable overabundances of Sr (1.16), Y (1.03), and Ba (1.24) with respect to the solar abundances. We compare the derived abundances of this moderately rotating (v\\sin i =37.5 km s‑1) Am star to the theoretical chemical evolution models including rotational mixing. The theoretically predicted abundances resemble our derived abundance pattern, except for a few elements (Si and Cr). For HD 170920, we find nearly solar abundances, except for C (‑0.43), S (0.16), Ti (0.15), Ni (0.16), Zn (0.41), Y (0.57), and Ba (0.97). Its low rotational velocity (v\\sin i=14.5 km s‑1), reduced carbon abundance, and enhanced heavy element abundances suggest that the star is most likely an evolved HgMn star. Based on observations made at the TÜBITAK National Observatory (Program ID 14BRTT150–671), and the Ankara University Observatory, Turkey.

  19. Abundances in normal and chemically peculiar B, A and F stars: hortatory remarks and prospectus

    International Nuclear Information System (INIS)

    Cowley, C.R.

    1983-01-01

    A variety of new techniques are discussed which make it possible to determine considerably more accurate abundances than are now available for stars near spectral type A. Specific suggestions are made for implementing them. Adoption of the critically evaluated oscillator strengths by the NBS is recommended as a standard. Many references are given to data sources, both physical and astronomical. Suggestions are made for avoiding the most common sources of error in abundance work. (author)

  20. Magnetic field topology and chemical abundance distributions of the young, rapidly rotating, chemically peculiar star HR 5624

    Science.gov (United States)

    Kochukhov, O.; Silvester, J.; Bailey, J. D.; Landstreet, J. D.; Wade, G. A.

    2017-09-01

    Context. The young, rapidly rotating Bp star HR 5624 (HD 133880) shows an unusually strong non-sinusoidal variability of its longitudinal magnetic field. This behaviour was previously interpreted as the signature of an exceptionally strong, quadrupole-dominated surface magnetic field geometry. Aims: We studied the magnetic field structure and chemical abundance distributions of HR 5624 with the aim to verify the unusual quadrupolar nature of its magnetic field and to investigate correlations between the field topology and chemical spots. Methods: We analysed high-resolution, time series Stokes parameter spectra of HR 5624 with the help of a magnetic Doppler imaging inversion code based on detailed polarised radiative transfer modelling of the line profiles. Results: We refined the stellar parameters, revised the rotational period, and obtained new longitudinal magnetic field measurements. Our magnetic Doppler inversions reveal that the field structure of HR 5624 is considerably simpler and the field strength is much lower than proposed by previous studies. We find a maximum local field strength of 12 kG and a mean field strength of 4 kG, which is about a factor of three weaker than predicted by quadrupolar field models. Our model implies that overall large-scale field topology of HR 5624 is better described as a distorted, asymmetric dipole rather than an axisymmetric quadrupole. The chemical abundance maps of Mg, Si, Ti, Cr, Fe, and Nd obtained in our study are characterised by large-scale, high-contrast abundance patterns. These structures correlate weakly with the magnetic field geometry and, in particular, show no distinct element concentrations in the horizontal field regions predicted by theoretical atomic diffusion calculations. Conclusions: We conclude that the surface magnetic field topology of HR 5624 is not as unusual as previously proposed. Considering these results together with other recent magnetic mapping analyses of early-type stars suggests that

  1. Peculiar Supernovae

    Science.gov (United States)

    Milisavljevic, Dan; Margutti, Raffaella

    2018-06-01

    What makes a supernova truly "peculiar?" In this review we attempt to address this question by tracing the history of the use of "peculiar" as a descriptor of non-standard supernovae back to the original binary spectroscopic classification of Type I vs. Type II proposed by Minkowski (Publ. Astron. Soc. Pac., 53:224, 1941). A handful of noteworthy examples are highlighted to illustrate a general theme: classes of supernovae that were once thought to be peculiar are later seen as logical branches of standard events. This is not always the case, however, and we discuss ASASSN-15lh as an example of a transient with an origin that remains contentious. We remark on how late-time observations at all wavelengths (radio-through-X-ray) that probe 1) the kinematic and chemical properties of the supernova ejecta and 2) the progenitor star system's mass loss in the terminal phases preceding the explosion, have often been critical in understanding the nature of seemingly unusual events.

  2. Using the seismology of non-magnetic chemically peculiar stars as a probe of dynamical processes in stellar interiors

    OpenAIRE

    Turcotte, S.

    2005-01-01

    Chemical composition is a good tracer of hydrodynamical processes that occur in stars as they often lead to mixing and particle transport. By comparing abundances predicted by models and those observed in stars we can infer some constraints on those mixing processes. As pulsations in stars are often very sensitive to chemical composition, we can use asteroseismology to probe the internal chemical composition of stars where no direct observations are possible. In this paper I focus on main seq...

  3. EVOLUTION OF INTERMEDIATE-MASS X-RAY BINARIES DRIVEN BY THE MAGNETIC BRAKING OF AP/BP STARS. I. ULTRACOMPACT X-RAY BINARIES

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Wen-Cong [School of Physics and Electrical Information, Shangqiu Normal University, Shangqiu 476000 (China); Podsiadlowski, Philipp, E-mail: chenwc@pku.edu.cn [Department of Physics, University of Oxford, Oxford OX1 3RH (United Kingdom)

    2016-10-20

    It is generally believed that ultracompact X-ray binaries (UCXBs) evolved from binaries consisting of a neutron star accreting from a low-mass white dwarf (WD) or helium star where mass transfer is driven by gravitational radiation. However, the standard WD evolutionary channel cannot produce the relatively long-period (40–60 minutes) UCXBs with a high time-averaged mass-transfer rate. In this work, we explore an alternative evolutionary route toward UCXBs, where the companions evolve from intermediate-mass Ap/Bp stars with an anomalously strong magnetic field (100–10,000 G). Including the magnetic braking caused by the coupling between the magnetic field and an irradiation-driven wind induced by the X-ray flux from the accreting component, we show that intermediate-mass X-ray binaries (IMXBs) can evolve into UCXBs. Using the MESA code, we have calculated evolutionary sequences for a large number of IMXBs. The simulated results indicate that, for a small wind-driving efficiency f = 10{sup −5}, the anomalous magnetic braking can drive IMXBs to an ultra-short period of 11 minutes. Comparing our simulated results with the observed parameters of 15 identified UCXBs, the anomalous magnetic braking evolutionary channel can account for the formation of seven and eight sources with f = 10{sup −3}, and 10{sup −5}, respectively. In particular, a relatively large value of f can fit three of the long-period, persistent sources with a high mass-transfer rate. Though the proportion of Ap/Bp stars in intermediate-mass stars is only 5%, the lifetime of the UCXB phase is ≳2 Gyr, producing a relatively high number of observable systems, making this an alternative evolutionary channel for the formation of UCXBs.

  4. A VLT/FLAMES STUDY OF THE PECULIAR INTERMEDIATE-AGE LARGE MAGELLANIC CLOUD STAR CLUSTER NGC 1846. I. KINEMATICS

    International Nuclear Information System (INIS)

    Mackey, A. D.; Da Costa, G. S.; Yong, D.; Ferguson, A. M. N.

    2013-01-01

    In this paper we present high-resolution VLT/FLAMES observations of red giant stars in the massive intermediate-age Large Magellanic Cloud star cluster NGC 1846, which, on the basis of its extended main-sequence turnoff (EMSTO), possesses an internal age spread of ≈300 Myr. We describe in detail our target selection and data reduction procedures, and construct a sample of 21 stars possessing radial velocities indicating their membership of NGC 1846 at high confidence. We consider high-resolution spectra of the planetary nebula Mo-17, and conclude that this object is also a member of the cluster. Our measured radial velocities allow us to conduct a detailed investigation of the internal kinematics of NGC 1846, the first time this has been done for an EMSTO system. The key result of this work is that the cluster exhibits a significant degree of systemic rotation, of a magnitude comparable to the mean velocity dispersion. Using an extensive suite of Monte Carlo models we demonstrate that, despite our relatively small sample size and the substantial fraction of unresolved binary stars in the cluster, the rotation signal we detect is very likely to be genuine. Our observations are in qualitative agreement with the predictions of simulations modeling the formation of multiple populations of stars in globular clusters, where a dynamically cold, rapidly rotating second generation is a common feature. NGC 1846 is less than one relaxation time old, so any dynamical signatures encoded during its formation ought to remain present.

  5. G 2.4 + 1.4: a supernova remnant or ring nebula around a peculiar star

    International Nuclear Information System (INIS)

    Johnson, H.M.

    1975-01-01

    G2.4+1.4 is a probable nonthermal radio source and an optical nebula which appears to be a supernova remnant (SNR). It also contains an O vi sequence star of great excitation. We present new radiofrequency continuum and (nil) H 92α observations, optical spectroscopy, and Fabry-Perot scanner observations of the nebula. The object distance (5 kpc), origin of gas kinematics (SNR expansion), and mode of excitation of the gas (photoexcitation and/or shock wave) remain uncertain. We discuss the possible roles of the O vi star as ''runaway'' in a SNR, as a source of photoexcitation, and as an ejector of a ''counterfeit'' SNR

  6. Spectrophotometry of peculiar B and A stars. XVIII - The helium rich variable stars HR 1890, Sigma Orionis E, and HD 37776

    Science.gov (United States)

    Adelman, S. J.; Pyper, D. M.

    1985-01-01

    Optical region spectrophotometry at 3300-7850 A has been obtained for three helium rich stars, HR 1890, Sigma Ori E, and HD 37776, of the Orion OB1 Association. New uvby-beta photometry of HR 1890 and HD 37776 as well as published data are also used to investigate the variability of these stars. A new period of 1.53862 days was determined for HD 37776. For all three stars H-beta varies in antiphase with strong He I lines. The spectrophotometric bandpass containing the strong He I line at 4471 A varies in phase with the R index of Pedersen and Thomsen (1977). Evidence is found for weak absorption features which appear to be an extension of the 5200 A feature seen in cooler CP stars.

  7. THE TRANSVERSE PECULIAR VELOCITY OF THE Q2237+0305 LENS GALAXY AND THE MEAN MASS OF ITS STARS

    International Nuclear Information System (INIS)

    Poindexter, Shawn; Kochanek, Christopher S.

    2010-01-01

    Using 11 years of OGLE V-band photometry of Q2237+0305, we measure the transverse velocity of the lens galaxy and the mean mass of its stars. We can do so because, for the first time, we fully include the random motions of the stars in the lens galaxy in the analysis of the light curves. In doing so, we are also able to correctly account for Earth's parallax motion and the rotation of the lens galaxy, further reducing systematic errors. We measure a lower limit on the transverse speed of the lens galaxy, v t > 338 km s -1 (68% confidence) and find a preferred direction to the east. The mean stellar mass estimate, including a well-defined velocity prior, is 0.12 ≤ (M/M sun ) ≤ 1.94 at 68% confidence, with a median of 0.52 M sun . We also show for the first time that analyzing subsets of a microlensing light curve, in this case the first and second halves of the OGLE V-band light curve, gives mutually consistent physical results.

  8. A peculiar low-luminosity short gamma-ray burst from a double neutron star merger progenitor.

    Science.gov (United States)

    Zhang, B-B; Zhang, B; Sun, H; Lei, W-H; Gao, H; Li, Y; Shao, L; Zhao, Y; Hu, Y-D; Lü, H-J; Wu, X-F; Fan, X-L; Wang, G; Castro-Tirado, A J; Zhang, S; Yu, B-Y; Cao, Y-Y; Liang, E-W

    2018-01-31

    Double neutron star (DNS) merger events are promising candidates of short gamma-ray burst (sGRB) progenitors as well as high-frequency gravitational wave (GW) emitters. On August 17, 2017, such a coinciding event was detected by both the LIGO-Virgo gravitational wave detector network as GW170817 and Gamma-Ray Monitor on board NASA's Fermi Space Telescope as GRB 170817A. Here, we show that the fluence and spectral peak energy of this sGRB fall into the lower portion of the distributions of known sGRBs. Its peak isotropic luminosity is abnormally low. The estimated event rate density above this luminosity is at least [Formula: see text] Gpc -3  yr -1 , which is close to but still below the DNS merger event rate density. This event likely originates from a structured jet viewed from a large viewing angle. There are similar faint soft GRBs in the Fermi archival data, a small fraction of which might belong to this new population of nearby, low-luminosity sGRBs.

  9. The peculiar isolated neutron star in the Carina Nebula. Deep XMM-Newton and ESO-VLT observations of 2XMM J104608.7-594306

    Science.gov (United States)

    Pires, A. M.; Motch, C.; Turolla, R.; Schwope, A.; Pilia, M.; Treves, A.; Popov, S. B.; Janot-Pacheco, E.

    2012-08-01

    While fewer in number than the dominant rotation-powered radio pulsar population, peculiar classes of isolated neutron stars (INSs) - which include magnetars, the ROSAT-discovered "Magnificent Seven" (M7), rotating radio transients (RRATs), and central compact objects in supernova remnants (CCOs) - represent a key element in understanding the neutron star phenomenology. We report the results of an observational campaign to study the properties of the source 2XMM J104608.7-594306, a newly discovered thermally emitting INS. The evolutionary state of the neutron star is investigated by means of deep dedicated observations obtained with the XMM-Newton Observatory, the ESO Very Large Telescope, as well as publicly available γ-ray data from the Fermi Space Telescope and the AGILE Mission. The observations confirm previous expectations and reveal a unique type of object. The source, which is likely within the Carina Nebula (NH = 2.6 × 1021 cm-2), has a spectrum that is both thermal and soft, with kT∞ = 135 eV. Non-thermal (magnetospheric) emission is not detected down to 1% (3σ, 0.1-12 keV) of the source luminosity. Significant deviations (absorption features) from a simple blackbody model are identified in the spectrum of the source around energies 0.6 keV and 1.35 keV. While the former deviation is likely related to a local oxygen overabundance in the Carina Nebula, the latter can only be accounted for by an additional spectral component, which is modelled as a Gaussian line in absorption with EW = 91 eV and σ = 0.14 keV (1σ). Furthermore, the optical counterpart is fainter than mV = 27 (2σ) and no γ-ray emission is significantly detected by either the Fermi or AGILE missions. Very interestingly, while these characteristics are remarkably similar to those of the M7 or the only RRAT so far detected in X-rays, which all have spin periods of a few seconds, we found intriguing evidence of very rapid rotation, P = 18.6 ms, at the 4σ confidence level. We interpret

  10. Putting atomic diffusion theory of magnetic ApBp stars to the test: evaluation of the predictions of time-dependent diffusion models

    Science.gov (United States)

    Kochukhov, O.; Ryabchikova, T. A.

    2018-02-01

    A series of recent theoretical atomic diffusion studies has address the challenging problem of predicting inhomogeneous vertical and horizontal chemical element distributions in the atmospheres of magnetic ApBp stars. Here we critically assess the most sophisticated of such diffusion models - based on a time-dependent treatment of the atomic diffusion in a magnetized stellar atmosphere - by direct comparison with observations as well by testing the widely used surface mapping tools with the spectral line profiles predicted by this theory. We show that the mean abundances of Fe and Cr are grossly underestimated by the time-dependent theoretical diffusion model, with discrepancies reaching a factor of 1000 for Cr. We also demonstrate that Doppler imaging inversion codes, based either on modelling of individual metal lines or line-averaged profiles simulated according to theoretical three-dimensional abundance distribution, are able to reconstruct correct horizontal chemical spot maps despite ignoring the vertical abundance variation. These numerical experiments justify a direct comparison of the empirical two-dimensional Doppler maps with theoretical diffusion calculations. This comparison is generally unfavourable for the current diffusion theory, as very few chemical elements are observed to form overabundance rings in the horizontal field regions as predicted by the theory and there are numerous examples of element accumulations in the vicinity of radial field zones, which cannot be explained by diffusion calculations.

  11. Peculiar Euphrosyne

    International Nuclear Information System (INIS)

    Carruba, V.; Aljbaae, S.; Souami, D.

    2014-01-01

    The asteroid (31) Euphrosyne is the largest body of its namesake family, and it contains more than 99% of the family mass. Among large asteroid families, the Euphrosyne group is peculiar because of its quite steep size-frequency distribution (SFD), significantly depleted in large- and medium-sized asteroids (8 < D < 12 km). The current steep SFD of the Euphrosyne family has been suggested to be the result of a grazing impact in which only the farthest, smallest members failed to accrete. The Euphrosyne family is, however, also very peculiar because of its dynamics: near its center it is crossed by the ν 6 = g – g 6 linear secular resonance, and it hosts the largest population (140 bodies) of asteroids in ν 6 antialigned librating states (or Tina-like asteroids) in the main belt. In this work we investigated the orbital evolution of newly obtained members of the dynamical family, with an emphasis on its interaction with the ν 6 resonance. Because of its unique resonant configuration, large- and medium-sized asteroids tend to migrate away from the family orbital region faster than small-sized objects, which were ejected farther away from the family center. As a consequence, the SFD of the Euphrosyne family becomes steeper in time with a growing depletion in the number of the largest family members. We estimate that the current SFD could be attained from a typical, initial SFD on timescales of 500 Myr, consistent with estimates of the family age obtained with other independent methods.

  12. Peculiar Euphrosyne

    Science.gov (United States)

    Carruba, V.; Aljbaae, S.; Souami, D.

    2014-09-01

    The asteroid (31) Euphrosyne is the largest body of its namesake family, and it contains more than 99% of the family mass. Among large asteroid families, the Euphrosyne group is peculiar because of its quite steep size-frequency distribution (SFD), significantly depleted in large- and medium-sized asteroids (8 < D < 12 km). The current steep SFD of the Euphrosyne family has been suggested to be the result of a grazing impact in which only the farthest, smallest members failed to accrete. The Euphrosyne family is, however, also very peculiar because of its dynamics: near its center it is crossed by the ν6 = g - g 6 linear secular resonance, and it hosts the largest population (140 bodies) of asteroids in ν6 antialigned librating states (or Tina-like asteroids) in the main belt. In this work we investigated the orbital evolution of newly obtained members of the dynamical family, with an emphasis on its interaction with the ν6 resonance. Because of its unique resonant configuration, large- and medium-sized asteroids tend to migrate away from the family orbital region faster than small-sized objects, which were ejected farther away from the family center. As a consequence, the SFD of the Euphrosyne family becomes steeper in time with a growing depletion in the number of the largest family members. We estimate that the current SFD could be attained from a typical, initial SFD on timescales of 500 Myr, consistent with estimates of the family age obtained with other independent methods.

  13. Peculiar Euphrosyne

    Energy Technology Data Exchange (ETDEWEB)

    Carruba, V.; Aljbaae, S. [UNESP, Univ. Estadual Paulista, Grupo de dinâmica Orbital e Planetologia, Guaratinguetá, SP, 12516-410 (Brazil); Souami, D., E-mail: vcarruba@feg.unesp.br [NAXYS, Namur Center for Complex Systems, Department of Mathematics, University of Namur, B-5000 Namur (Belgium)

    2014-09-01

    The asteroid (31) Euphrosyne is the largest body of its namesake family, and it contains more than 99% of the family mass. Among large asteroid families, the Euphrosyne group is peculiar because of its quite steep size-frequency distribution (SFD), significantly depleted in large- and medium-sized asteroids (8 < D < 12 km). The current steep SFD of the Euphrosyne family has been suggested to be the result of a grazing impact in which only the farthest, smallest members failed to accrete. The Euphrosyne family is, however, also very peculiar because of its dynamics: near its center it is crossed by the ν{sub 6} = g – g {sub 6} linear secular resonance, and it hosts the largest population (140 bodies) of asteroids in ν{sub 6} antialigned librating states (or Tina-like asteroids) in the main belt. In this work we investigated the orbital evolution of newly obtained members of the dynamical family, with an emphasis on its interaction with the ν{sub 6} resonance. Because of its unique resonant configuration, large- and medium-sized asteroids tend to migrate away from the family orbital region faster than small-sized objects, which were ejected farther away from the family center. As a consequence, the SFD of the Euphrosyne family becomes steeper in time with a growing depletion in the number of the largest family members. We estimate that the current SFD could be attained from a typical, initial SFD on timescales of 500 Myr, consistent with estimates of the family age obtained with other independent methods.

  14. Spectrophotometry of peculiar B and A stars. XVII. 63 Andromedae, HD 34452, epsilon Ursae Majoris, CQ Ursae Majoris, CU Virginis, CS Virginis and Beta Coronae Borealis

    International Nuclear Information System (INIS)

    Pyper, D.M.; Adelman, S.J.

    1985-01-01

    Optical region spectrophotometry results are presented for seven Ap stars. Additional data for two silicon stars, HD 34452 and CU Vir, show that both have energy distributions that can be fit by a single global model atmosphere, except for the lambda 4200 and lambda 5200 broad absorption features. These features are strong in HD 34452 and show no evidence of variation, while they are weak in CU Vir but show clear evidence of variations. The energy distributions of the five cooler Ap stars cannot be fit by a single model atmosphere. CQ UMa, CS Vir and β CrB all show complicated variations with phase at different wavelengths. Their energy distributions show combined effects of flux redistribution and differential line blanketing. Except for epsilon UMa, none of these five stars show evidence of variations of the lambda 4200 or lambda 5200 broad absorption features

  15. Observations of central stars

    International Nuclear Information System (INIS)

    Lutz, J.H.

    1978-01-01

    Difficulties occurring in the observation of central stars of planetary nebulae are reviewed with emphasis on spectral classifications and population types, and temperature determination. Binary and peculiar central stars are discussed. (U.M.G.)

  16. MAGNETIC FIELDS OF STARS

    OpenAIRE

    Bychkov, V. D.; Bychkova, L. V.; Madej, J.

    2008-01-01

    Now it is known about 1212 stars of the main sequence and giants (from them 610 stars - it is chemically peculiarity (CP) stars) for which direct measurements of magnetic fields were spent (Bychkov et al.,2008). Let's consider, what representations were generated about magnetic fields (MT) of stars on the basis of available observations data.

  17. BP volume reduction equipment

    International Nuclear Information System (INIS)

    Kitamura, Yoshinori; Muroo, Yoji; Hamanaka, Isao

    2003-01-01

    A new type of burnable poison (BP) volume reduction system is currently being developed. Many BP rods, a subcomponent of spent fuel assemblies are discharged from nuclear power reactors. This new system reduces the overall volume of BP rods. The main system consists of BP rod cutting equipment, equipment for the recovery of BP cut pieces, and special transport equipment for the cut rods. The equipment is all operated by hydraulic press cylinders in water to reduce operator exposure to radioactivity. (author)

  18. BP's emissions trading system

    International Nuclear Information System (INIS)

    Victor, David G.; House, Joshua C.

    2006-01-01

    Between 1998 and 2001, BP reduced its emissions of greenhouse gases by more than 10%. BP's success in cutting emissions is often equated with its use of an apparently market-based emissions trading program. However no independent study has ever examined the rules and operation of BP's system and the incentives acting on managers to reduce emissions. We use interviews with key managers and with traders in several critical business units to explore the bound of BP's success with emissions trading. No money actually changed hands when permits were traded, and the main effect of the program was to create awareness of money-saving emission controls rather than strong price incentives. We show that the trading system did not operate like a 'textbook' cap and trade scheme. Rather, the BP system operated much like a 'safety valve' trading system, where managers let the market function until the cost of doing so surpassed what the company was willing to tolerate

  19. Peculiarities of Gender

    OpenAIRE

    Garduno, Sylvia Aide Figueroa; Kovacova, Nikola; Arjona, Ruben Campos

    2017-01-01

    This project challenges the essentialist notions of gender in fantasy genre. The trilogy of Miss Peregrine’s Peculiar Children will shed light on the shifting patterns of gender performativity in fantasy. To drive our analysis, we will resort to Judith Butler’s theory of gender performativity, Joseph Campbell’s monomyth and William Indick’s study of fantasy and myth.

  20. FDG goes BP

    International Nuclear Information System (INIS)

    Chan, J.G.

    2000-01-01

    Full text: A monograph for Fluorodeoxyglucose F-18 Injection (FDG) was first released in Supplement 1 of the United States Pharmacopoeia 1990 (USP 90) on 1 November 1989 to become effective on 1 January 1990. As this was the only monograph available until recently it served as the applicable standard to be followed. The Therapeutic Goods Act states that the British Pharmacopoeia (BP) is the precedent to be followed in Australia and implies that if a monograph exists for a finished product then this needs to be applied to achieve a certain standard of quality. If the monograph does not exist in the BP then other pharmacopoeia monographs can be sourced starting with the European Pharmacopoeia (Ph Eur) then the USP. A monograph for FDG first appeared in the Ph Eur in a 1999 Supplement (effective 1 January 1999 and now included in the Ph Eur 2000) and then in the BP 1999 (effective 1 December 1999). The Commonwealth Government Gazette (Notice 48, 1/12/99) published that the BP 99 was adopted on the 1st December 1999. Since then manufacturers have been required to comply with the monograph for FDG in the BP 99. This presentation looks at the content of the BP 99 monograph and compares it with that in the USP. Copyright (2000) The Australian and New Zealand Society of Nuclear Medicine Inc

  1. The Kuwano peculiar object (PU Vulpeculae)

    International Nuclear Information System (INIS)

    Belyakina, T.S.; Gershberg, R.E.; Efimov, Yu.S.; Krasnobabtsev, V.I.; Pavlenko, E.P.; Petrov, P.P.; Chuvaev, K.K.; Shenavrin, V.I.

    1982-01-01

    U, B, V, J, H, K photometry, polarimetry and spectroscopy of this peculiar object was made from August 1979 to December 1980 and the observations are briefly discussed. The authors consider PU Vul to be binary with a late M giant and a component of probably low luminosity. The latter flared in 1979, and the former also changed a little. From the photometric, spectroscopic and polarimetric data they estimate E(B-V) <= 0.4 and locate the star at 5-7 kpc from the sun and 0.7-1.0 kpc from the galactic plane. The photometric behaviour, duplicity, and nature of the components are similar to those of novae and symbiotic stars, but no evidence for an ejected envelope is seen. (Auth.)

  2. Giant CP stars

    International Nuclear Information System (INIS)

    Loden, L.O.; Sundman, A.

    1989-01-01

    This study is part of an investigation of the possibility of using chemically peculiar (CP) stars to map local galactic structure. Correct luminosities of these stars are therefore crucial. CP stars are generally regarded as main-sequence or near-main-sequence objects. However, some CP stars have been classified as giants. A selection of stars, classified in literature as CP giants, are compared to normal stars in the same effective temperature interval and to ordinary 'non giant' CP stars. There is no clear confirmation of a higher luminosity for 'CP giants', than for CP stars in general. In addition, CP characteristics seem to be individual properties not repeated in a component star or other cluster members. (author). 50 refs., 5 tabs., 3 figs

  3. Symbiotic stars

    International Nuclear Information System (INIS)

    Kafatos, M.; Michalitsianos, A.G.

    1984-01-01

    Among the several hundred million binary systems estimated to lie within 3000 light years of the solar system, a tiny fraction, no more than a few hundred, belong to a curious subclass whose radiation has a wavelength distribution so peculiar that it long defied explanation. Such systems radiate strongly in the visible region of the spectrum, but some of them do so even more strongly at both shorter and longer wavelengths: in the ultraviolet region and in the infrared and radio regions. This odd distribution of radiation is best explained by the pairing of a cool red giant star and an intensely hot small star that is virtually in contact with its larger companion. Such objects have become known as symbiotic stars. On photographic plate only the giant star can be discerned, but evidence for the existence of the hot companion has been supplied by satellite-born instruments capable of detecting ultraviolet radiation. The spectra of symbiotic stars indicate that the cool red giant is surrounded by a very hot ionized gas. Symbiotic stars also flared up in outbursts indicating the ejection of material in the form of a shell or a ring. Symbiotic stars may therefore represent a transitory phase in the evolution of certain types of binary systems in which there is substantial transfer of matter from the larger partner to the smaller

  4. The magnetic early B-type stars I: magnetometry and rotation

    Science.gov (United States)

    Shultz, M. E.; Wade, G. A.; Rivinius, Th; Neiner, C.; Alecian, E.; Bohlender, D.; Monin, D.; Sikora, J.; MiMeS Collaboration; BinaMIcS Collaboration

    2018-04-01

    The rotational and magnetic properties of many magnetic hot stars are poorly characterized, therefore the Magnetism in Massive Stars and Binarity and Magnetic Interactions in various classes of Stars collaborations have collected extensive high-dispersion spectropolarimetric data sets of these targets. We present longitudinal magnetic field measurements for 52 early B-type stars (B5-B0), with which we attempt to determine their rotational periods Prot. Supplemented with high-resolution spectroscopy, low-resolution Dominion Astrophysical Observatory circular spectropolarimetry, and archival Hipparcos photometry, we determined Prot for 10 stars, leaving only five stars for which Prot could not be determined. Rotational ephemerides for 14 stars were refined via comparison of new to historical magnetic measurements. The distribution of Prot is very similar to that observed for the cooler Ap/Bp stars. We also measured v sin i and vmac for all stars. Comparison to non-magnetic stars shows that v sin i is much lower for magnetic stars, an expected consequence of magnetic braking. We also find evidence that vmac is lower for magnetic stars. Least-squares deconvolution profiles extracted using single-element masks revealed widespread, systematic discrepancies in between different elements: this effect is apparent only for chemically peculiar stars, suggesting it is a consequence of chemical spots. Sinusoidal fits to H line measurements (which should be minimally affected by chemical spots), yielded evidence of surface magnetic fields more complex than simple dipoles in six stars for which this has not previously been reported; however, in all six cases, the second- and third-order amplitudes are small relative to the first-order (dipolar) amplitudes.

  5. Kinematic and spatial distributions of barium stars - are the barium stars and Am stars related?

    International Nuclear Information System (INIS)

    Hakkila, J.

    1989-01-01

    The possibility of an evolutionary link between Am stars and barium stars is considered, and an examination of previous data suggests that barium star precursors are main-sequence stars of intermediate mass, are most likely A and/or F dwarfs, and are intermediate-mass binaries with close to intermediate orbital separations. The possible role of mass transfer in the later development of Am systems is explored. Mass transfer and loss from systems with a range of masses and orbital separations may explain such statistical peculiarities of barium stars as the large dispersion in absolute magnitude, the large range of elemental abundances from star to star, and the small number of stars with large peculiar velocities. 93 refs

  6. The distribution of silicon on BP Boo

    International Nuclear Information System (INIS)

    Hatzes, A.P.

    1990-01-01

    A version of the Doppler imaging technique which incorporates the principles of maximum entropy reconstruction is used to derive the silicon distribution on the Ap star BP Boo (HR 5857). The method used made it possible to detect an error in the published photometric period and a new value of 1.29557 d was determined. The silicon distribution consists of two depleted spots of unequal area separated by about 180deg in longitude. These spots may coincide with the location of the magnetic poles of the star as in the case of γ 2 Ari. Near the larger of the depleted silicon spots is a spot of enhanced abundance. The unequal area of the depleted spots as well as the close proximity of the enhanced spot to one of the depleted regions suggests the presence of non-axisymmetric magnetic field lines. (author)

  7. Magnetic fields in beta Cep, SPB, and Be stars

    OpenAIRE

    Schoeller, M.; Hubrig, S.; Briquet, M.; Ilyin, I.

    2013-01-01

    Recent observational and theoretical results emphasize the potential significance of magnetic fields for structure, evolution, and environment of massive stars. Depending on their spectral and photometric behavior, the upper main-sequence B-type stars are assigned to different groups, such as beta Cep stars and slowly pulsating B (SPB) stars, He-rich and He-deficient Bp stars, Be stars, BpSi stars, HgMn stars, or normal B-type stars. All these groups are characterized by different magnetic fi...

  8. Inter-Division IV/V WG on Active OB Stars

    NARCIS (Netherlands)

    Owocki, S.; Aerts, C.; Fabregat, J.; Gies, D.; Henrichs, H.F.; McDavid, D.; Porter, J.; Rivinius, T.; Peters, G.; Stefl, S.

    2007-01-01

    Our group studies active early-type (OB) stars, with historical focus on classical Be stars, but extending in recent years to include Slowly Pulsating B-stars (SPB), Beta-Cephei stars, the strongly magnetic Bp stars, Luminous Blue Vairiable (LBV) stars, and B[e] stars. An overall goal is to

  9. Wolf-Rayet stars and O-star runaways with HIPPARCOS - I. Kinematics

    NARCIS (Netherlands)

    Moffat, AFJ; Marchenko, SV; Seggewiss, W; van der Hucht, KA; Schrijver, H; Stenholm, B; Lundstrom, [No Value; Gunawan, DYAS; Sutantyo, W; van den Heuvel, EPJ; De Cuyper, JP; Gomez, AE

    Reliable systemic radial velocities are almost impossible to secure for Wolf-Rayet stars, difficult for O stars. Therefore, to study the motions - both systematic in the Galaxy and peculiar - of these two related types of hot, luminous star, we have examined the Hipparcos proper motions of some 70

  10. Cosmic string induced peculiar velocities

    International Nuclear Information System (INIS)

    van Dalen, A.; Schramm, D.N.

    1987-02-01

    We calculate analytically the probability distribution for peculiar velocities on scales from 10h -1 to 60h -1 Mpc with cosmic string loops as the dominant source of primordial gravitational perturbations. We consider a range of parameters βGμ appropriate for both hot (HDM) and cold (CDM) dark matter scenarios. An Ω = 1 CDM Universe is assumed with the loops randomly placed on a smooth background. It is shown how the effects can be estimated of loops breaking up and being born with a spectrum of sizes. It is found that to obtain large scale streaming velocities of at least 400 km/s it is necessary that either a large value for βGμ or the effect of loop fissioning and production details be considerable. Specifically, for optimal CDM string parameters Gμ = 10 -6 , β = 9, h = .5, and scales of 60h -1 Mpc, the parent size spectrum must be 36 times larger than the evolved daughter spectrum to achieve peculiar velocities of at least 400 km/s with a probability of 63%. With this scenario the microwave background dipole will be less than 800 km/s with only a 10% probability. The string induced velocity spectrum is relatively flat out to scales of about 2t/sub eq//a/sub eq/ and then drops off rather quickly. The flatness is a signature of string models of galaxy formation. With HDM a larger value of βGμ is necessary for galaxy formation since accretion on small scales starts later. Hence, with HDM, the peculiar velocity spectrum will be larger on large scales and the flat region will extend to larger scales. If large scale peculiar velocities greater than 400 km/s are real then it is concluded that strings plus CDM have difficulties. The advantages of strings plus HDM in this regard will be explored in greater detail in a later paper. 27 refs., 4 figs., 1 tab

  11. Radio emission in peculiar galaxies

    Science.gov (United States)

    Demellorabaca, Dulia F.; Abraham, Zulema

    1990-01-01

    During the last decades a number of surveys of peculiar galaxies have been carried out and accurate positions become available. Since peculiarities are a possible evidence of radio emission (Wright, 1974; Sulentic, 1976; Stocke et al., 1978), the authors selected a sample of 24 peculiar galaxies with optical jet-like features or extensions in different optical catalogues, mainly the Catalogue of Southern Peculiar Galaxies and Associations (Arp and Madore, 1987) and the ESO/Uppsala Survey of the ESO(B) Atlas (Lauberts, 1982) for observation at the radio continuum frequency of 22 GHz. The sample is listed in a table. Sol (1987) studied this sample and concluded that the majority of the jet-like features seem to admit an explanation in terms of interactive galaxies with bridges and/or tails due to tidal effects. Only in a few cases do the jets seem to be possibly linked to some nuclear activity of the host galaxy. The observations were made with the 13.7m-radome enclosed Itapetinga Radiotelescope (HPBW of 4.3 arcmin), in Brazil. The receiver was a 1 GHz d.s.b. super-heterodine mixer operated in total-power mode, with a system temperature of approximately 800 K. The observational technique consisted in scans in right ascention, centralized in the optical position of the galaxy. The amplitude of one scan was 43 arcmin, and its duration time was 20 seconds. The integration time was at least 2 hours (12 ten-minute observations) and the sensibility limit adopted was an antenna temperature greater than 3 times the r.m.s. error of the baseline determination. Virgo A was used as the calibrator source. Three galaxies were detected for the first time as radio sources and four other known galaxies at low frequencies had their flux densities measured at 22 GHz. The results for these sources are presented.

  12. Neutron stars

    International Nuclear Information System (INIS)

    Irvine, J.M.

    1978-01-01

    The subject is covered in chapters entitled: introduction (resume of stellar evolution, gross characteristics of neutron stars); pulsars (pulsar characteristics, pulsars as neutron stars); neutron star temperatures (neutron star cooling, superfluidity and superconductivity in neutron stars); the exterior of neutron stars (the magnetosphere, the neutron star 'atmosphere', pulses); neutron star structure; neutron star equations of state. (U.K.)

  13. Crystallization peculiarities in metallic glasses

    International Nuclear Information System (INIS)

    Serebryakov, A.V.; Abrosimova, G.E.; Aronin, A.S.

    1985-01-01

    Methods of X-ray electron microscopy and X-ray diffraction analysis were used to investigate the peculiarities of crystallization of amorphous metallic Fe-B and Fe-Si-B alloys related to sufficient change of volume when passing from amorphous to crystalline state and the effect of sample prehistory on its thermal stability and crystallization kinetics. The dependence of morphology of crystalline phases formed during crystallization of amorphous Fe-B alloys on sample thickness was revealed and investigated. The model explaining this dependence was suggested. The observed differences are related, according to the model, with different diffusion ways of ''poles'' - elementary carriers of empty volume to their sinks

  14. On the origin of hyperfast neutron stars

    NARCIS (Netherlands)

    Gvaramadze, V.V.; Gualandris, A.; Portegies Zwart, S.

    2007-01-01

    We propose an explanation for the origin of hyperfast neutron stars (e.g. PSR B1508+55, PSR B2224+65, RX J0822-4300) based on the hypothesis that they could be the remnants of a symmetric supernova explosion of a high-velocity massive star (or its helium core) which attained its peculiar velocity

  15. Infrared spectra of peculiar emission-line stars

    International Nuclear Information System (INIS)

    Andrillat, Yvette; Houziaux, Leo

    1975-01-01

    230A/mm spectra of HD51585, V1016Cyg, HBV475 and XXOph between 8,000 and 11,000A are described. Important spectral variations have been noted between 1974 and 1975. Satisfactory identifications cannot be proposed for lines at 9,180 and 9,204A [fr

  16. Optical region elemental abundance analyses of B and A stars

    International Nuclear Information System (INIS)

    Adelman, S.J.; Young, J.M.; Baldwin, H.E.

    1984-01-01

    Abundance analyses using optical region data and fully line blanketed model atmospheres have been performed for two sharp-lined hot Am stars o Pegasi and σ Aquarii and for the sharp-lined marginally peculiar A star v Cancri. The derived abundances exhibit definite anomalies compared with those of normal B-type stars and the Sun. (author)

  17. On the origin of high-velocity runaway stars

    NARCIS (Netherlands)

    Gvaramadze, V.V.; Gualandris, A.; Portegies Zwart, S.

    2009-01-01

    We explore the hypothesis that some high-velocity runaway stars attain their peculiar velocities in the course of exchange encounters between hard massive binaries and a very massive star (either an ordinary 50-100 M-circle dot star or a more massive one, formed through runaway mergers of ordinary

  18. Induction Magnetometers – Design Peculiarities

    Directory of Open Access Journals (Sweden)

    Valeriy KOREPANOV

    2010-09-01

    Full Text Available Induction or search-coil magnetometers (IM are widely used in many branches of science and industry. The frequency range and dynamic range of IMs are probably the widest of all existing magnetometers: they are used for the measurement of magnetic field variations in the frequency band from ~10-4 till ~106 Hz with the intensities from fractions of femtotesla till tens of tesla. This explains the permanent interest to IM design and the attempts to construct the IMs with best possible parameters. The present paper deals with the peculiarities of IM design. An attempt to re-establish the correctness of priorities in the field is made and the approaches to the IM optimization and their quality estimation are described.

  19. Peculiar velocity measurement in a clumpy universe

    Science.gov (United States)

    Habibi, Farhang; Baghram, Shant; Tavasoli, Saeed

    Aims: In this work, we address the issue of peculiar velocity measurement in a perturbed Friedmann universe using the deviations from measured luminosity distances of standard candles from background FRW universe. We want to show and quantify the statement that in intermediate redshifts (0.5 deviations from the background FRW model are not uniquely governed by peculiar velocities. Luminosity distances are modified by gravitational lensing. We also want to indicate the importance of relativistic calculations for peculiar velocity measurement at all redshifts. Methods: For this task, we discuss the relativistic correction on luminosity distance and redshift measurement and show the contribution of each of the corrections as lensing term, peculiar velocity of the source and Sachs-Wolfe effect. Then, we use the SNe Ia sample of Union 2, to investigate the relativistic effects, we consider. Results: We show that, using the conventional peculiar velocity method, that ignores the lensing effect, will result in an overestimate of the measured peculiar velocities at intermediate redshifts. Here, we quantify this effect. We show that at low redshifts the lensing effect is negligible compare to the effect of peculiar velocity. From the observational point of view, we show that the uncertainties on luminosity of the present SNe Ia data prevent us from precise measuring the peculiar velocities even at low redshifts (z < 0.2).

  20. Symbiotic stars

    International Nuclear Information System (INIS)

    Boyarchuk, A.A.

    1975-01-01

    There are some arguments that the symbiotic stars are binary, where one component is a red giant and the other component is a small hot star which is exciting a nebula. The symbiotic stars belong to the old disc population. Probably, symbiotic stars are just such an evolutionary stage for double stars as planetary nebulae for single stars. (Auth.)

  1. THE PECULIAR CHEMICAL INVENTORY OF NGC 2419: AN EXTREME OUTER HALO 'GLOBULAR CLUSTER'

    International Nuclear Information System (INIS)

    Cohen, Judith G.; Kirby, Evan N.; Huang Wenjin

    2011-01-01

    NGC 2419 is a massive outer halo Galactic globular cluster (GC) whose stars have previously been shown to have somewhat peculiar abundance patterns. We have observed seven luminous giants that are members of NGC 2419 with Keck/HIRES at reasonable signal-to-noise ratio. One of these giants is very peculiar, with an extremely low [Mg/Fe] and high [K/Fe] but normal abundances of most other elements. The abundance pattern does not match the nucleosynthetic yields of any supernova model. The other six stars show abundance ratios typical of inner halo Galactic GCs, represented here by a sample of giants in the nearby GC M30. Although our measurements show that NGC 2419 is unusual in some respects, its bulk properties do not provide compelling evidence for a difference between inner and outer halo GCs.

  2. BP report of the business year 1979

    Energy Technology Data Exchange (ETDEWEB)

    1980-01-01

    The paper presents a survey about the development of the energy- and petroleum market during the year 1979. A commentary of the German BP A.G. and its activities is given here: personnel- and management policy, exploration, supply, refining and distribution, investigation, and development. After a survey about the business situation of the German BP A.G. the detailed annual balance sheets of 1979 of the German BP and of the whole enterprise are given.

  3. Peculiarities of Pattern Information Transmission

    Directory of Open Access Journals (Sweden)

    Evgeniy V. Yurkevich

    2017-01-01

    Full Text Available The rates of modern technologies development is such that educational programs are constantly required to be enlarged with new material. However, the introduced supplements often do not take into account the limited possibilities of perceiving amounts of information offered in class. As a result, a significant number of graduates get diplomas of educational institutions with a number of pathologies. Despite heavy load during training, the knowledge of a graduate is often not enough to recognize him ready to participate in modern production. The problem of providing quality education by creating a technology making it possible to maximize students’ knowledge while reducing the number of messages transmitted in the classroom. Consideration of the educational process in the form of an information system with messages transmitted in the form of images is proposed as one of the ways of solving it. The work assumed that each message is reflected in the consciousness of the source and receiver of information in the form of mental images. Mental images of the teacher and student are considered as a convolution of information. The analysis of peculiarities of mental images formation and development is given, a model of the mechanism of pattern information transmission is proposed. The model of transmitting sign, pattern, and symbol information is described. The communication bandwidth between the participants  of the educational process is considered as depending on their goal setting, training, physiological and emotional features, as well as a number of other non-formalized factors. Graduates of educational institutions are considered as means of producing intellectual products, and the purpose of obtaining knowledge is proposed to be formed based on the definition of the attractor of developing the “teacher-student” system. A principle of organizing educational processes is proposed: the education technology should not violate the consistency

  4. On the Origin of Hyperfast Neutron Stars

    Science.gov (United States)

    Gvaramadze, V. V.; Gualandris, A.; Portegies Zwart, S.

    2008-05-01

    We propose an explanation for the origin of hyperfast neutron stars (e.g. PSR B1508+55, PSR B2224+65, RX J0822 4300) based on the hypothesis that they could be the remnants of a symmetric supernova explosion of a high-velocity massive star (or its helium core) which attained its peculiar velocity (similar to that of the neutron star) in the course of a strong three- or four-body dynamical encounter in the core of a young massive star cluster. This hypothesis implies that the dense cores of star clusters (located either in the Galactic disk or near the Galactic centre) could also produce the so-called hypervelocity stars ordinary stars moving with a speed of ~ 1 000 km s-1.

  5. BP - bisnis põhjas? / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2010-01-01

    Seoses Mehhiko lahe naftareostusega ootab BP-d kuni 21 mld. dollari suurune trahv, kahjude hüvitamiseks peab BP müüma osa oma varast. Ekspertide hinnangul tähendavad Mehhiko lahe sündmused suuri muutusi kogu naftaäris

  6. Structural peculiarities in magnetic small particles

    International Nuclear Information System (INIS)

    Haneda, K.; Morrish, A.H.

    1993-01-01

    Nanostructured magnetic materials, consisting of nanometer-sized crystallites, are currently a developing subject. Evidence has been accumulating that they possess properties that can differ substantially from those of bulk materials. This paper illustrates how Moessbauer spectroscopy can yield useful information on the structural peculiarities associated with these small particles. As illustrations, metallic iron and iron-oxide systems are considered in detail. The subjects discussed include: (1) Phase stabilities in small particles, (2) deformed or nonsymmetric atomic arrangements in small particles, and (3) peculiar magnetic structures or non-collinear spin arrangements in small magnetic oxide particles that are correlated with lower specific magnetizations as compared to the bulk values. (orig.)

  7. The peculiarity of animal complexes of chernozem

    Directory of Open Access Journals (Sweden)

    O. V. Zhukov

    2005-02-01

    Full Text Available The genetic connection of animal complexes and soil cover is in the basis of diagnostic ability of animals to indicate and quantity assessment of soil processes. The ecoiGgical view and peculiarity of soil animal complexes has the most impotent value. The soil animal complexes of steppe and their trans-formation under artificial forest are discussed

  8. Peculiarities of Modern Foreign Policy of Iran

    Directory of Open Access Journals (Sweden)

    V I Yourtaev

    2012-06-01

    Full Text Available The article is focuses on the analysis of the main peculiarities of modern foreign policy of iranian President M. Ahmadinejad, his constructive interaction concept in foreign policy. The formation of the nuclear gate for entering into world policy and basic problems of Iranian development as a new regional leader in the context of globalization and international relations transformation process are considered.

  9. Fractographic peculiarities of cermet tungsten fracture

    International Nuclear Information System (INIS)

    Stepanenko, V.A.; Babak, A.V.; Uskov, E.I.

    1982-01-01

    Effect of test temperature on fracture peculiarities of cermets tungsten with initial cellular structure of deformation is shown. Tungsten crack resistance increases at temperatures to Tsub(x) (ductile-brittle transition temperature) and decreases at temperatures above Tsub(x). The degree of ceramics tungsten plasticity realization depends on its crack resistance

  10. Studying coherent scattering in the CP stars atmospheres

    Science.gov (United States)

    Fišák, J.; Kubát, J.; Krtička, J.

    2018-01-01

    Chemically peculiar stars form a very interesting class of stars which frequently show variability. The variability is probably caused by the uneven surface distribution of chemical elements. Some elements are overabundant and some elements are underabundant compared to the solar chemical composition. In the case of chemically overabundant composition some of the rare photon-atom processes can be more important than in the atmospheres of stars with solar chemical composition. We study the importance of Rayleigh scattering by helium.

  11. BP Investment Exceeds $4 Bln in china

    Institute of Scientific and Technical Information of China (English)

    Wang Ping

    2008-01-01

    @@ British Petroleum (BP) recently signed a series of agreements with China including those in clean energy and wind power generation, during British Prime Minister Gordon Brown's visit to China in mid-January.

  12. BP teatas harvast edusammust / Hendrik Vosman

    Index Scriptorium Estoniae

    Vosman, Hendrik

    2010-01-01

    Naftakompanii BP teatas, et suudab Mehhiko lahest päevas kinni püüda sinna lekkinud 10 000 barrelit naftat. Tegu on ajutise lahendusega, lõplikult peaks naftavoo peatama merepõhja puuritavad nn. asenduskaevud

  13. Stars and Star Myths.

    Science.gov (United States)

    Eason, Oliver

    Myths and tales from around the world about constellations and facts about stars in the constellations are presented. Most of the stories are from Greek and Roman mythology; however, a few Chinese, Japanese, Polynesian, Arabian, Jewish, and American Indian tales are also included. Following an introduction, myths are presented for the following 32…

  14. Conflicting evidence on the composition of Am stars

    International Nuclear Information System (INIS)

    't Veer, C. van

    1976-01-01

    The programme involves the study of Am stars of differing temperatures and luminosities as well as of the Am stars deviating from the positions of the classical ones in the photometric diagrams. For certain stars a significant disagreement between the so-called 'abundance indices' and the abundances determined at high dispersion is found. Often giants or spectroscopic binaries, or stars with a detectable rotation, are involved. However, there are no consistent relationships between these different peculiarities and the observed disagreements. Examples are given of stars studied. Are these 'abundance indices' really what they are supposed to be in all cases. In which cases are they not and why. (Auth.)

  15. Defining photometric peculiar type Ia supernovae

    Energy Technology Data Exchange (ETDEWEB)

    González-Gaitán, S.; Pignata, G.; Förster, F.; Gutiérrez, C. P.; Bufano, F.; Galbany, L.; Hamuy, M.; De Jaeger, T. [Millennium Institute of Astrophysics, Casilla 36-D, Santiago (Chile); Hsiao, E. Y.; Phillips, M. M. [Carnegie Observatories, Las Campanas Observatory, Casilla 601, La Serena (Chile); Folatelli, G. [Kavli Institute for the Physics and Mathematics of the Universe, the University of Tokyo, Kashiwa 277-8583 (Kavli IPMU, WPI) (Japan); Anderson, J. P., E-mail: sgonzale@das.uchile.cl [European Southern Observatory, Alonso de Córdova 3107, Casilla 19, Santiago (Chile)

    2014-11-10

    We present a new photometric identification technique for SN 1991bg-like type Ia supernovae (SNe Ia), i.e., objects with light curve characteristics such as later primary maxima and the absence of a secondary peak in redder filters. This method is capable of selecting this sub-group from the normal type Ia population. Furthermore, we find that recently identified peculiar sub-types such as SNe Iax and super-Chandrasekhar SNe Ia have photometric characteristics similar to 91bg-like SNe Ia, namely, the absence of secondary maxima and shoulders at longer wavelengths, and can also be classified with our technique. The similarity of these different SN Ia sub-groups perhaps suggests common physical conditions. This typing methodology permits the photometric identification of peculiar SNe Ia in large upcoming wide-field surveys either to study them further or to obtain a pure sample of normal SNe Ia for cosmological studies.

  16. Peculiarities Of Financial Management In Family Firms

    OpenAIRE

    Martin R. W. Hiebl

    2012-01-01

    The majority of firms in market-oriented countries are family-owned. Despite their significant economic importance for these countries, research focusing on family firms is a rather young field within business research, having intensified starting only in the late 1980s. Research regarding the peculiarities of financial management in family firms is especially scarce. Hence, this paper seeks to synthesize existing research and to theoretically analyze the finance and accounting practices and ...

  17. Peculiarities of product placement in Lithuanian movies

    OpenAIRE

    Pilelienė, Lina; Jurgilaitė, Sigita

    2013-01-01

    The scientific problem analysed in the article is formulates as follows: how product placement is used in Lithuanian movies. The object of the article is product placement in Lithuanian movies, and the aim is to analyse the peculiarities of product placement in Lithuanian movies. Following methods were used to reveal the problem and reach the aim. Theoretical analysis of scientific literature was provided to construct the framework for the research. The analysis of current usage of product pl...

  18. The Peculiar Filamentary H i Structure of NGC 6145

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Enci; Kong, Xu; Mou, Guobin [CAS Key Laboratory for Research in Galaxies and Cosmology, Department of Astronomy, University of Science and Technology of China, Hefei, Anhui 230026 (China); Wang, Jing [Australia Telescope National Facility, CSIRO Astronomy and Space Science, P.O. Box 76, Epping, NSW 1710 (Australia); Guo, Fulai; Lin, Lin; Li, Cheng; Xiao, Ting, E-mail: ecwang16@ustc.edu.cn, E-mail: xkong@ustc.edu.cn [Key Laboratory for Research in Galaxies and Cosmology, Shanghai Astronomical Observatory, Chinese Astronomical Society, 80 Nandan Road, Shanghai 200030 (China)

    2017-08-01

    In this paper, we report the peculiar H i morphology of the cluster spiral galaxy NGC 6145, which has a 150 kpc H i filament on one side that is nearly parallel to its major axis. This filament is made up of several H i clouds and the diffuse H i gas between them, with no optical counterparts. We compare its H i distribution with other one-sided H i distributions in the literature and find that the overall H i distribution is very different from the typical tidal and ram-pressure stripped H i shape, and that its morphology is inconsistent with that of a pure accretion event. Only ∼30% of the total H i gas is anchored on the stellar disk, while most of the H i gas forms the filament in the west. At a projected distance of 122 kpc, we find a massive elliptical companion (NGC 6146) with extended radio emission whose axis points to an H i gap in NGC 6145. The velocity of the H i filament shows an overall line-of-sight motion of 80–180 km s{sup −1} with respect to NGC 6145. Using the long-slit spectra of NGC 6145 along its major stellar axis, we find that some outer regions show enhanced star formation, while in contrast, almost no star formation activities are found in its center (<2 kpc). Pure accretion, tidal, or ram-pressure stripping are not likely to produce the observed H i filament. An alternative explanation is the jet stripping from NGC 6146, although direct evidence for a jet-cold gas interaction has not been found.

  19. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Brorsen, Michael; Frigaard, Peter

    Denne rapport beskriver numeriske beregninger af forskellige flydergeometrier for bølgeenergianlæget Wave Star.......Denne rapport beskriver numeriske beregninger af forskellige flydergeometrier for bølgeenergianlæget Wave Star....

  20. Hyperfast pulsars as the remnants of massive stars ejected from young star clusters

    Science.gov (United States)

    Gvaramadze, Vasilii V.; Gualandris, Alessia; Portegies Zwart, Simon

    2008-04-01

    Recent proper motion and parallax measurements for the pulsar PSR B1508+55 indicate a transverse velocity of ~1100kms-1, which exceeds earlier measurements for any neutron star. The spin-down characteristics of PSR B1508+55 are typical for a non-recycled pulsar, which implies that the velocity of the pulsar cannot have originated from the second supernova disruption of a massive binary system. The high velocity of PSR B1508+55 can be accounted for by assuming that it received a kick at birth or that the neutron star was accelerated after its formation in the supernova explosion. We propose an explanation for the origin of hyperfast neutron stars based on the hypothesis that they could be the remnants of a symmetric supernova explosion of a high-velocity massive star which attained its peculiar velocity (similar to that of the pulsar) in the course of a strong dynamical three- or four-body encounter in the core of dense young star cluster. To check this hypothesis, we investigated three dynamical processes involving close encounters between: (i) two hard massive binaries, (ii) a hard binary and an intermediate-mass black hole (IMBH) and (iii) a single stars and a hard binary IMBH. We find that main-sequence O-type stars cannot be ejected from young massive star clusters with peculiar velocities high enough to explain the origin of hyperfast neutron stars, but lower mass main-sequence stars or the stripped helium cores of massive stars could be accelerated to hypervelocities. Our explanation for the origin of hyperfast pulsars requires a very dense stellar environment of the order of 106- 107starspc-3. Although such high densities may exist during the core collapse of young massive star clusters, we caution that they have never been observed.

  1. Based on BP Neural Network Stock Prediction

    Science.gov (United States)

    Liu, Xiangwei; Ma, Xin

    2012-01-01

    The stock market has a high profit and high risk features, on the stock market analysis and prediction research has been paid attention to by people. Stock price trend is a complex nonlinear function, so the price has certain predictability. This article mainly with improved BP neural network (BPNN) to set up the stock market prediction model, and…

  2. A peculiar Herbig-Haro object located far outside Lynds 1641

    International Nuclear Information System (INIS)

    Ogura, Katsuo

    1991-01-01

    A peculiar Herbig-Haro object, named HH 131, has been discovered by low-dispersion slit spectroscopy and narrowband CCD imaging. It lies well outside the dark cloud Lynds (L) 1641 toward the southwest. Accordingly, it has no associated molecular cloud, but it may be related to a cloud of atomic hydrogen. Its morphology is also unique, showing a fairly high degree of axisymmetric structure as well as a sort of double helix. No likely candidates for its energy source have been found in the IRAS Point Source Catalog, or by slit spectroscopy and an objective-prism Schmidt survey of nearby stars. 24 refs

  3. Estrelas magnéticas quimicamente peculiares

    OpenAIRE

    Fraga, Luciano

    2006-01-01

    Tese (doutorado) - Universidade Federal de Santa Catarina, Centro de Ciências Físicas e Matemáticas - Programa de Pós-Graduação em Física. Apresentamos nesta tese os resultados de três estudos observacionais relacionados com as estrelas Ap, assim como a sub-classe das estrelas rapidamente oscilantes (roAp). No primeiro estudo, investigamos o estado evolutivo das estrelas Ap visando responder a seguinte pergunta: as estrelas nascem peculiares, ou desenvolvem suas peculiaridades ao longo de...

  4. The Peculiar Radial Distribution of Multiple Populations in the Massive Globular Cluster M80

    Science.gov (United States)

    Dalessandro, E.; Cadelano, M.; Vesperini, E.; Salaris, M.; Ferraro, F. R.; Lanzoni, B.; Raso, S.; Hong, J.; Webb, J. J.; Zocchi, A.

    2018-05-01

    We present a detailed analysis of the radial distribution of light-element multiple populations (LE-MPs) in the massive and dense globular cluster M80, based on a combination of UV and optical Hubble Space Telescope data. Surprisingly, we find that first-generation (FG) stars (FG) are significantly more centrally concentrated than extreme second-generation (SG) stars out to ∼2.5r h from the cluster center. To understand the origin of such peculiar behavior, we used a set of N-body simulations following the long-term dynamical evolution of LE-MPs. We find that, given the advanced dynamical state of the cluster, the observed difference does not depend on the primordial relative distributions of FG and SG stars. On the contrary, a difference of ∼0.05–0.10 M ⊙ between the average masses of the two subpopulations is needed to account for the observed radial distributions. We argue that such a mass difference might be the result of the higher He abundance of SG stars (of the order of ΔY ∼ 0.05–0.06) with respect to FG stars. Interestingly, we find that a similar He variation is necessary to reproduce the horizontal branch morphology of M80. These results demonstrate that differences in mass among LE-MPs, due to different He content, should be properly taken into account for a correct interpretation of their radial distribution, at least in dynamically evolved systems.

  5. What stars become supernovae

    International Nuclear Information System (INIS)

    Tinsley, B.M.

    1975-01-01

    A variety of empirical lines of evidence is assembled on the masses and stellar population types of stars that trigger supernova (SN) explosions. The main theoretical motivations are to determine whether type I supernovae (SN I) can have massive precursors, and whether there is an interval of stellar mass, between the masses of precursors of pulsars and white dwarfs, that is disrupted by carbon detonation. Statistical and other uncertainties in the empirical arguments are given particular attention, and are found to be more important than generally realized. Relatively secure conclusions include the following. Statistics of stellar birthrates, SN, pulsars, and SN remnants in the Galaxy show that SN II (or all SN) could arise from stars with masses greater than M/sub s/ where M/sub s/ approximately 49 to 12 M solar mass; the precursor mass range cannot be more closely defined from present data; nor can it be said whether all SN leave pulsars and/or extended radio remnants. Several methods of estimating the masses of stars that become white dwarfs are consistent with a lower limit, M/sub s/ greater than or equal to 5 M solar mass, so carbon detonation may indeed be avoided, although this conclusion is not secure. Studies of the properties of galaxies in which SN occur, and their distributions within galaxies, support the usual views that SN I have low-mass precursors (less than or equal to 5 M solar mass and typically less than or equal to 1 M solar mass) and SN II have massive precursors (greater than or equal to 5 M solar mass); the restriction of known SN II to Sc and Sb galaxies, to date, is shown to be consistent, statistically, with massive stars in other galaxies also dying as SN II. Possible implications of the peculiarities of some SN-producing galaxies are discussed. Suggestions are made for observational and theoretical studies that would help answer important remaining questions on the nature of SN precursors

  6. On the origin of the hypervelocity runaway star HD 271791

    Science.gov (United States)

    Gvaramadze, V. V.

    2010-01-01

    We discuss the origin of the early-B-type runaway star HD 271791 and show that its extremely high velocity (≃530 - 920km s-1) cannot be explained within the framework of the binary-supernova ejection scenario. Instead, we suggest that HD 271791 attained its peculiar velocity in the course of a strong dynamical encounter between two hard, massive binaries or through an exchange encounter between a hard, massive binary and a very massive star, formed through runaway mergers of ordinary massive stars in the dense core of a young massive star cluster.

  7. AcEST: BP918406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B06 468 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B06. BP918406 - Show BP918406...is mRNA. clone: YMU001_000113_B06. Accession BP918406 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-vene...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-veneris m

  8. AcEST: BP918011 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_E11 519 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E11. BP918011 - Show BP91801...is mRNA. clone: YMU001_000108_E11. Accession BP918011 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiant...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiantum cap

  9. 884 Cal.BP and all that

    International Nuclear Information System (INIS)

    Switsur, Roy

    1986-01-01

    A history of the development of the technique of radiocarbon dating highlights the two problems with this method. The first is calibration; the radiocarbon calendar is not linear. However two independent experiments to provide high precision measurements in tree rings have resulted in a high precision calibration curve. The second is how to denote radiocarbon ages and calibrated dates, as this depends on how the dendrochronology time scale used in the calibration is transferred to the actual calendar. If the zero of the dendroscale is transferred from the origin of the Christian calendar to AD 1950, radiocarbon ages are designated CAL BP (BP = before present). There is an alternative method which results in CAL AD and CAL BC. A suggestion for a standard notation is made to avoid the confusion of two systems. (U.K.)

  10. BP Oil Company's approach to risk management

    International Nuclear Information System (INIS)

    Fryman, C.E.

    1996-01-01

    The oil and chemical industries face major challenges in deciding how to handle the numerous recommendations coming from various audits, reviews and studies conducted in the functional areas of personnel health and safety, loss prevention, and environmental protection. And, the number of recommendations continues to grow with time, as regulations and normal business requirements are met. BP Oil has developed a methodology for risk ranking the events leading to specific recommendations and then determining the cost-effectiveness of the recommendations in reducing the risk. The author completed successful pilot tests of this methodology at two of BP Oil's petroleum refineries, examining the recommendations from process hazards analyses and studies completed over the past few years. The methodology has since been implemented throughout their petroleum refining, distribution, transportation, and retail business streams

  11. Radio stars

    International Nuclear Information System (INIS)

    Hjellming, R.M.

    1976-01-01

    Any discussion of the radio emission from stars should begin by emphasizing certain unique problems. First of all, one must clarify a semantic confusion introduced into radio astronomy in the late 1950's when most new radio sources were described as radio stars. All of these early 'radio stars' were eventually identified with other galactic and extra-galactic objects. The study of true radio stars, where the radio emission is produced in the atmosphere of a star, began only in the 1960's. Most of the work on the subject has, in fact, been carried out in only the last few years. Because the real information about radio stars is quite new, it is not surprising that major aspects of the subject are not at all understood. For this reason this paper is organized mainly around three questions: what is the available observational information; what physical processes seem to be involved; and what working hypotheses look potentially fruitful. (Auth.)

  12. BP's driving safety strategy

    Energy Technology Data Exchange (ETDEWEB)

    Herman, B. [BP Canada Energy Company, Calgary, AB (Canada)

    2006-07-01

    This presentation focused on why it is important to drive safely. It addressed driver fatigue as well as BP's global driving standard. The Standard applies to all BP employees and contractors that drive any vehicle on BP business and consists of 10 mandatory elements focusing on safety of the driver, the safety of the journey, and the safety of the vehicle. The driving standards focus on several themes, including skill and competency of the driver, safety of the journey, and safety of the vehicle. Fatigue causes more than 20 per cent of motorway accidents and is the most frequent cause of accidental death of truck drivers. The presentation also discussed vehicle data recorders, driving immersion, and Driving Safety Program results. Journey management, driver training, vehicle inspections and policies, and statistics on vehicle incidents were also provided. The presentation revealed that a lack of pre-trip journey management, inadequate training or recall of training, and not following safe driving practices were major contributors to incident occurrences. It also revealed that traveling on gravel or ice and avoiding wildlife were factors in many vehicle incidents. 1 tab., 1 fig.

  13. Shooting stars

    International Nuclear Information System (INIS)

    Maurette, M.; Hammer, C.

    1985-01-01

    A shooting star passage -even a star shower- can be sometimes easily seen during moonless black night. They represent the partial volatilization in earth atmosphere of meteorites or micrometeorites reduced in cosmic dusts. Everywhere on earth, these star dusts are searched to be gathered. This research made one year ago on the Greenland ice-cap is this article object; orbit gathering projects are also presented [fr

  14. Research of braking peculiarities of used cars

    Directory of Open Access Journals (Sweden)

    V. Mitunevičius

    2002-06-01

    Full Text Available This paper briefly describes some analysis of a car braking process - the peculiarities of car wheel-to-road adhesion, the influence of distribution of braking forces on car stability between front and rear axles. The requirements of EU Directive 71/320/EEC to braking force coefficients of car front and rear axles are exposed. Structural designs of braking systems are analyzed with respect to their meeting the EU standards. Experimental measurements of braking force coefficients for some models of cars which are used in Lithuania, are presented with the analysis how these coefficients meet the EU standards. The analysis of test results, suggestions for the ratio of braking forces of car front and rear axles are presented.

  15. Peculiar chondroblastoma involving multiple tarsal bones

    International Nuclear Information System (INIS)

    Fukunaga, Masaharu; Asanuma, Kazuo; Irie, Takeo

    2010-01-01

    A case of peculiar chondroblastoma involving multiple tarsal bones in a 49-year-old woman is described. The patient presented with pain and swelling of the right foot. Radiographs revealed a lytic expansile lesion of medial, intermediate, and lateral cuneiform bones, navicular, cuboid, and tarsal bones of the right foot, indicating a malignant tumor. Biopsies demonstrated a diffuse proliferation of round cells with eccentric and indented nuclei with longitudinal grooves and eosinophilic cytoplasm. Atypia was prominent, but mitotic figures were rare. The stroma was chondroid with focal chicken-wire calcification. On electron microscopy, the tumor exhibited chondroblastic features. The patient is alive with the tumor 7 years after radiotherapy. The tumor is considered a chondroblastoma with low malignant potential. (orig.)

  16. Peculiarities of marketing communications in cultural marketing

    Directory of Open Access Journals (Sweden)

    Daniel Gardan

    2016-09-01

    Full Text Available Extending the application of marketing science specific concepts and principles in various sectors would not have been possible without their gradual evolution, in terms of customization and differentiation tailored for a specific field. This phenomenon regarding marketing evolution in terms of both extensively and intensively way, led to the emergence and consolidation of a set of concepts adapted also for cultural products and services market, or in other words for culture “consumption”. This article highlights a number of marketing communications specific elements, derived from the peculiarities of modern culture consumer and the latest technologies interference in the creation and delivery of cultural products and services. Given the high degree of consumer involvement in relation to the needs that underlie consumption of cultural products and services, as well as the dimension specific for an artistic act in some cases, marketing communications has to respond to particular challenges in the process of building customer-provider relationship.

  17. Peculiar chondroblastoma involving multiple tarsal bones

    Energy Technology Data Exchange (ETDEWEB)

    Fukunaga, Masaharu [Jikei University School of Medicine, Department of Pathology, Tokyo (Japan); the Jikei University Daisan Hospital, Department of Pathology, Tokyo (Japan); Asanuma, Kazuo [Jikei University School of Medicine, Department of Orthopedic Surgery, Tokyo (Japan); Irie, Takeo [Jikei University School of Medicine, Department of Radiology, Tokyo (Japan)

    2010-07-15

    A case of peculiar chondroblastoma involving multiple tarsal bones in a 49-year-old woman is described. The patient presented with pain and swelling of the right foot. Radiographs revealed a lytic expansile lesion of medial, intermediate, and lateral cuneiform bones, navicular, cuboid, and tarsal bones of the right foot, indicating a malignant tumor. Biopsies demonstrated a diffuse proliferation of round cells with eccentric and indented nuclei with longitudinal grooves and eosinophilic cytoplasm. Atypia was prominent, but mitotic figures were rare. The stroma was chondroid with focal chicken-wire calcification. On electron microscopy, the tumor exhibited chondroblastic features. The patient is alive with the tumor 7 years after radiotherapy. The tumor is considered a chondroblastoma with low malignant potential. (orig.)

  18. The Peculiar Chemical Inventory of NGC 2419: An Extreme Outer Halo "Globular Cluster"

    Science.gov (United States)

    Cohen, Judith G.; Huang, Wenjin; Kirby, Evan N.

    2011-10-01

    NGC 2419 is a massive outer halo Galactic globular cluster (GC) whose stars have previously been shown to have somewhat peculiar abundance patterns. We have observed seven luminous giants that are members of NGC 2419 with Keck/HIRES at reasonable signal-to-noise ratio. One of these giants is very peculiar, with an extremely low [Mg/Fe] and high [K/Fe] but normal abundances of most other elements. The abundance pattern does not match the nucleosynthetic yields of any supernova model. The other six stars show abundance ratios typical of inner halo Galactic GCs, represented here by a sample of giants in the nearby GC M30. Although our measurements show that NGC 2419 is unusual in some respects, its bulk properties do not provide compelling evidence for a difference between inner and outer halo GCs. Based in part on observations obtained at the W. M. Keck Observatory, which is operated jointly by the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration.

  19. All-star sports medicine film panel

    International Nuclear Information System (INIS)

    Rogers, L.F.; Braunstein, E.M.; DeSmet, A.A.; Helms, C.A.; Pavlov, H.; Sukaer, J.R.; Torg, J.S.

    1987-01-01

    All Star Sports Panel cases are selected to test the mettle of the panelists and familiarize the audience with injuries peculiar to participation in a variety of sports. Match wits with the experts on the field. Gear up for the big game by previewing the clinical histories and initial radiographic examinations. Diagnosis requires familiarity with stresses incurred in the performance of various athletic pursuits, knowledge of specific radiographic findings, and awareness of imaging techniques that best demonstrate underlying injury

  20. Magnetic fields of HgMn stars

    DEFF Research Database (Denmark)

    Hubrig, S.; González, J. F.; Ilyin, I.

    2012-01-01

    Context. The frequent presence of weak magnetic fields on the surface of spotted late-B stars with HgMn peculiarity in binary systems has been controversial during the two last decades. Recent studies of magnetic fields in these stars using the least-squares deconvolution (LSD) technique have...... failed to detect magnetic fields, indicating an upper limit on the longitudinal field between 8 and 15G. In these LSD studies, assumptions were made that all spectral lines are identical in shape and can be described by a scaled mean profile. Aims. We re-analyse the available spectropolarimetric material...

  1. Pulsations of the R Coronae Borealis stars

    International Nuclear Information System (INIS)

    Cox, J.P.; King, D.S.; Cox, A.N.; Wheeler, J.C.; Hansen, C.J.; Hodson, S.W.

    1980-01-01

    The radial pulsations of very luminous, low-mass models (L/M approx. 10 4 , solar units), which are possible representatives of the R CrB stars, have been examined. These pulsations are extremely nonadiabatic. There are in some cases at least one extra (strange) mode which makes interpretation difficult. The blue instability edges are also peculiar, in that there is an abrupt excursion of the blue edge to the blue for L/M sufficiently large. The range of periods of the model encompasses observed periods of the Cepheid-like pulsations of actual R CrB stars

  2. Star Polymers.

    Science.gov (United States)

    Ren, Jing M; McKenzie, Thomas G; Fu, Qiang; Wong, Edgar H H; Xu, Jiangtao; An, Zesheng; Shanmugam, Sivaprakash; Davis, Thomas P; Boyer, Cyrille; Qiao, Greg G

    2016-06-22

    Recent advances in controlled/living polymerization techniques and highly efficient coupling chemistries have enabled the facile synthesis of complex polymer architectures with controlled dimensions and functionality. As an example, star polymers consist of many linear polymers fused at a central point with a large number of chain end functionalities. Owing to this exclusive structure, star polymers exhibit some remarkable characteristics and properties unattainable by simple linear polymers. Hence, they constitute a unique class of technologically important nanomaterials that have been utilized or are currently under audition for many applications in life sciences and nanotechnologies. This article first provides a comprehensive summary of synthetic strategies towards star polymers, then reviews the latest developments in the synthesis and characterization methods of star macromolecules, and lastly outlines emerging applications and current commercial use of star-shaped polymers. The aim of this work is to promote star polymer research, generate new avenues of scientific investigation, and provide contemporary perspectives on chemical innovation that may expedite the commercialization of new star nanomaterials. We envision in the not-too-distant future star polymers will play an increasingly important role in materials science and nanotechnology in both academic and industrial settings.

  3. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Brorsen, Michael; Frigaard, Peter

    Nærværende rapport beskriver numeriske beregninger af den hydrodynamiske interaktion mellem 5 flydere i bølgeenergianlægget Wave Star.......Nærværende rapport beskriver numeriske beregninger af den hydrodynamiske interaktion mellem 5 flydere i bølgeenergianlægget Wave Star....

  4. Star Imager

    DEFF Research Database (Denmark)

    Madsen, Peter Buch; Jørgensen, John Leif; Thuesen, Gøsta

    1997-01-01

    The version of the star imager developed for Astrid II is described. All functions and features are described as well as the operations and the software protocol.......The version of the star imager developed for Astrid II is described. All functions and features are described as well as the operations and the software protocol....

  5. The peculiar object He 2--467

    International Nuclear Information System (INIS)

    Lutz, J.H.; Lutz, T.E.; Kaler, J.B.; Osterbrock, D.E.; Gregory, S.A.

    1976-01-01

    He 2--467 has been classified as a planetary nebula. However, the spectrum of this object shows emission lines superposed on the absorption spectrum of a G-type star. Image tube spectrograph and scanner observations of the emission and absorption features are presented. The emission spectrum is unusual in that no forbidden lines are seen, and the He i singlet to triplet ratios do not agree with recombination theory

  6. Photometric peculiarities of the RY Taurus

    International Nuclear Information System (INIS)

    Zajtseva, G.V.

    1982-01-01

    The results are presented of photoelectric UBV-observations of RY Taurus carried out in 1965-80 at the Crimean Station of the State Sternberg Astronomical Institute. Two components of brightness variations are observed: fast (days) and slow (years). During fast variations the colour indices U-B and B-V change independently of brightness, however, in particular time inter-- vals the rather strong correlation with the star brightness is observed, positive or negative. During the slow variations only the reverse dependence is observed; the brightness increase is followed by the increase of colour indices (reddening of the star). The comparison of the RY TAURUS intrinsic polarization variations has shown that the dependence of polarization degree on brightness is nonmonotonic. At minimum and maximum brightness the RY TAURUS intrinsic polarization is maximum and reaches 5-6 %. At the general amplitude of RY TAURUS brightness variations in V rays from 10.sup(m)1 to 11.sup(m)7 the V=11.sup(m)0 value is singled out. First a certain ''avoidance'' of this brightness value by the star is observed. Second, the fracture in the course of polarization dependence on brightness occurs as well in the V=11sup(m) region

  7. Radio stars

    International Nuclear Information System (INIS)

    Hjellming, R.M.; Gibson, D.M.

    1985-01-01

    Studies of stellar radio emission became an important field of research in the 1970's and have now expanded to become a major area of radio astronomy with the advent of new instruments such as the Very Large Array in New Mexico and transcontinental telescope arrays. This volume contains papers from the workshop on stellar continuum radio astronomy held in Boulder, Colorado, and is the first book on the rapidly expanding field of radio emission from stars and stellar systems. Subjects covered include the observational and theoretical aspects of stellar winds from both hot and cool stars, radio flares from active double star systems and red dwarf stars, bipolar flows from star-forming regions, and the radio emission from X-ray binaries. (orig.)

  8. SHOCKS AND A GIANT PLANET IN THE DISK ORBITING BP PISCIUM?

    International Nuclear Information System (INIS)

    Melis, C.; Zuckerman, B.; Gielen, C.; Chen, C. H.; Rhee, Joseph H.; Song, Inseok

    2010-01-01

    Spitzer Infrared Spectrograph data support the interpretation that BP Piscium, a gas and dust enshrouded star residing at high Galactic latitude, is a first-ascent giant rather than a classical T Tauri star. Our analysis suggests that BP Piscium's spectral energy distribution can be modeled as a disk with a gap that is opened by a giant planet. Modeling the rich mid-infrared emission line spectrum indicates that the solid-state emitting grains orbiting BP Piscium are primarily composed of ∼75 K crystalline, magnesium-rich olivine; ∼75 K crystalline, magnesium-rich pyroxene; ∼200 K amorphous, magnesium-rich pyroxene; and ∼200 K annealed silica (cristobalite). These dust grains are all sub-micron sized. The giant planet and gap model also naturally explains the location and mineralogy of the small dust grains in the disk. Disk shocks that result from disk-planet interaction generate the highly crystalline dust which is subsequently blown out of the disk mid-plane and into the disk atmosphere.

  9. ATM signaling and 53BP1

    International Nuclear Information System (INIS)

    Zgheib, Omar; Huyen, Yentram; DiTullio, Richard A.; Snyder, Andrew; Venere, Monica; Stavridi, Elena S.; Halazonetis, Thanos D.

    2005-01-01

    The ATM (mutated in Ataxia-Telangiectasia) protein kinase is an important player in signaling the presence of DNA double strand breaks (DSBs) in higher eukaryotes. Recent studies suggest that ATM monitors the presence of DNA DSBs indirectly, through DNA DSB-induced changes in chromatin structure. One of the proteins that sense these chromatin structure changes is 53BP1, a DNA damage checkpoint protein conserved in all eukaryotes and the putative ortholog of the S. cerevisiae RAD9 protein. We review here the mechanisms by which ATM is activated in response to DNA DSBs, as well as key ATM substrates that control cell cycle progression, apoptosis and DNA repair

  10. Peculiarities of clinical course of children skin cancer

    International Nuclear Information System (INIS)

    Zikiryakhodjaev, D.Z.; Sanginov, D.R.

    2001-01-01

    In this chapter of book authors investigated the peculiarities of clinical course of children skin cancer. They noted that comprehensive studying of peculiarities of clinical course of children skin cancer proved that they depend not only from age, but from morphologic structure, previous skin illness which was cause of skin cancer

  11. Photographic infrared spectroscopy and near infrared photometry of Be stars

    International Nuclear Information System (INIS)

    Swings, J.P.

    1976-01-01

    Two topics are tackled in this presentation: spectroscopy and photometry. The following definitions are chosen: photographic infrared spectroscopy (wavelengths Hα<=lambda<1.2 μ); near infrared photometry (wavebands: 1.6 μ<=lambda<=20 μ). Near infrared spectroscopy and photometry of classical and peculiar Be stars are discussed and some future developments in the field are outlined. (Auth.)

  12. Sediment Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  13. Air Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  14. Waste Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  15. Air Monitoring Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  16. Surface Water Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  17. Water Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  18. A Binary Nature of the Marginal CP Star Sigma Sculptoris

    Science.gov (United States)

    Janík, Jan; Krtička, Jiří; Mikulášek, Zdeněk; Zverko, Juraj; Pintado, Olga; Paunzen, Ernst; Prvák, Milan; Skalický, Jan; Zejda, Miloslav; Adam, Christian

    2018-05-01

    The A2 V star σ Scl was suspected of being a low-amplitude rotating variable of the Ap-type star by several authors. Aiming to decide whether the star is a variable chemically peculiar (CP) star, we searched for the photometric and spectroscopic variability, and determined chemical abundances of σ Scl. The possible variability was tested using several types of periodograms applied to the photometry from Long-Term Photometry of Variables project (LTPV) and Hipparcos. Sixty spectrograms of high signal-to-noise (S/N) were obtained and used for chemical analysis of the stellar atmosphere and for looking for spectral variability that is symptomatic for the CP stars. We did not find any signs of the light variability or prominent chemical peculiarity, that is specific for the CP stars. The only exception is the abundance of scandium, which is significantly lower than the solar one and yttrium and barium, which are strongly overabundant. As a by-product of the analysis, and with the addition of 29 further spectra, we found that σ Scl is a single-lined spectroscopic binary with orbital period of 46.877(8) d. We argue that σ Scl is not an Ap star, but rather a marginal Am star in SB1 system. The spectral energy distribution of the binary reveals infrared excess due to circumstellar material.

  19. Peculiarities of Hemiplegic Migraine in Children

    Directory of Open Access Journals (Sweden)

    S. L. Moiseeva

    2015-01-01

    Full Text Available The article describes the individual peculiarities of a rare disease — hemiplegic migraine — in 3 patients (two girls aged 2 and 14 years old and a boy of 16 years. In common clinical aspect there was a correlation between the migraine-attack and the slight head trauma in all patients. Attack symptoms were almost identical: hemiparesis, aphasia, ataxia. The family history for migraine was burdened in both girls. A genetic testing in the boy and in the smallest girl demonstrated CACNA1A gene mutation, in the teen girl — ATP1A2 gene mutation. The electroencephalograms in all patients during the acute phase presented signs of hemipcortical brain dysfunction. The magnetic resonance imaging revealed prominent but reversible hemicortical oedema. The repeated MRI studies diagnosed nonrelevant for this disease hemicortical atrophy (girl 2 years and atrophy of the cerebellum (the boy. Due to the rarity of the disease so far there are no clear guidelines for its treatment and prevention. In view of the pathogenesis for the prevention patients were prescribed medications changing the activity of cytoplasmic calcium and sodium canals.

  20. AcEST: BP918019 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F08 47 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F08. BP918019 - Show BP91801... mRNA. clone: YMU001_000108_F08. Accession BP918019 Tissue type prothallium Developmental stage - Contig ID

  1. Stars of type MS with evidence of white dwarf companions. [IUE, Main Sequence (MS)

    Science.gov (United States)

    Peery, Benjamin F., Jr.

    1986-01-01

    A search for white dwarf companions of MS-type stars was conducted, using IUE. The overendowments of these stars in typical S-process nuclides suggest that they, like the Ba II stars, may owe their peculiar compositions to earlier mass transfer. Short-wavelength IUE spectra show striking emission line variability in HD35155, HD61913, and 4 Ori; HD35155 and 4 Ori show evidence of white dwarf companions.

  2. Star formation

    International Nuclear Information System (INIS)

    Woodward, P.R.

    1978-01-01

    Theoretical models of star formation are discussed beginning with the earliest stages and ending in the formation of rotating, self-gravitating disks or rings. First a model of the implosion of very diffuse gas clouds is presented which relies upon a shock at the edge of a galactic spiral arm to drive the implosion. Second, models are presented for the formation of a second generation of massive stars in such a cloud once a first generation has formed. These models rely on the ionizing radiation from massive stars or on the supernova shocks produced when these stars explode. Finally, calculations of the gravitational collapse of rotating clouds are discussed with special focus on the question of whether rotating disks or rings are the result of such a collapse. 65 references

  3. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Frigaard, Peter

    Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Byggeri og Anlæg med bølgeenergianlæget Wave Star.......Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Byggeri og Anlæg med bølgeenergianlæget Wave Star....

  4. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Andersen, Thomas Lykke

    Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star.......Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star....

  5. STARS no star on Kauai

    International Nuclear Information System (INIS)

    Jones, M.

    1993-01-01

    The island of Kuai, home to the Pacific Missile Range Facility, is preparing for the first of a series of Star Wars rocket launches expected to begin early this year. The Strategic Defense Initiative plans 40 launches of the Stategic Target System (STARS) over a 10-year period. The focus of the tests appears to be weapons and sensors designed to combat multiple-warhead ICBMs, which will be banned under the START II Treaty that was signed in January. The focus of this article is to express the dubious value of testing the STARS at a time when their application will not be an anticipated problem

  6. Flare stars

    International Nuclear Information System (INIS)

    Nicastro, A.J.

    1981-01-01

    The least massive, but possibly most numerous, stars in a galaxy are the dwarf M stars. It has been observed that some of these dwarfs are characterized by a short increase in brightness. These stars are called flare stars. These flare stars release a lot of energy in a short amount of time. The process producing the eruption must be energetic. The increase in light intensity can be explained by a small area rising to a much higher temperature. Solar flares are looked at to help understand the phenomenon of stellar flares. Dwarfs that flare are observed to have strong magnetic fields. Those dwarf without the strong magnetic field do not seem to flare. It is believed that these regions of strong magnetic fields are associated with star spots. Theories on the energy that power the flares are given. Astrophysicists theorize that the driving force of a stellar flare is the detachment and collapse of a loop of magnetic flux. The mass loss due to stellar flares is discussed. It is believed that stellar flares are a significant contributor to the mass of interstellar medium in the Milky Way

  7. AcEST: BP919406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_G04 562 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G04. BP919406 - Show BP919406...is mRNA. clone: YMU001_000124_G04. Accession BP919406 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-...ucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-veneris mRNA, c

  8. AcEST: BP914061 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D09 599 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D09. BP91406...1 CL1730Contig1 Show BP914061 Clone id YMU001_000039_D09 Library YMU01 Length 599 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D09. Accession BP914061 Tissue type prothallium Developmental stag... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adia...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adiantum capillus-veneris mRNA, c

  9. AcEST: BP914068 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E04 420 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E04. BP914068 - Show BP91406...is mRNA. clone: YMU001_000039_E04. Accession BP914068 Tissue type prothallium Developmental stage - Contig I...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914068|Adiantum capillus-veneris mRNA, clone:

  10. AcEST: BP913406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_H06 570 Adiantum capillus-veneris mRNA. clone: YMU001_000029_H06. BP913406 - Show BP913406...is mRNA. clone: YMU001_000029_H06. Accession BP913406 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capillus-veneris mRNA, clone: YMU00...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capil...LDVTRGLVNGARGVVVAFES--GKHG---------------LPH 406 Query: 387 VRFACNRAEIVIGPDRQTVESGGMQVARRIQVPLILAWALSVHKCQGM

  11. AcEST: BP915406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_B11 433 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B11. BP915406 - Show BP915406...is mRNA. clone: YMU001_000071_B11. Accession BP915406 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: Y...leic Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B11. (433

  12. AcEST: BP914064 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D12 560 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D12. BP91406...4 CL532Contig1 Show BP914064 Clone id YMU001_000039_D12 Library YMU01 Length 560 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_D12. Accession BP914064 Tissue type prothallium Developmental stage...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adiantum capillus-vener...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adi

  13. AcEST: BP912406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_F09 348 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F09. BP912406... CL1894Contig1 Show BP912406 Clone id YMU001_000018_F09 Library YMU01 Length 348 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_F09. Accession BP912406 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406|Adiantum capillus-veneris mRNA...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406

  14. AcEST: BP916406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000087_D01 556 Adiantum capillus-veneris mRNA. clone: YMU001_000087_D01. BP916406... CL1913Contig1 Show BP916406 Clone id YMU001_000087_D01 Library YMU01 Length 556 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000087_D01. Accession BP916406 Tissue type prothallium Developmental stag...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capill...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capillus-veneris mRNA, c

  15. AcEST: BP917406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_D10 492 Adiantum capillus-veneris mRNA. clone: YMU001_000100_D10. BP917406... CL2033Contig1 Show BP917406 Clone id YMU001_000100_D10 Library YMU01 Length 492 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_D10. Accession BP917406 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917406...Nucleic Acids Res. 25:3389-3402. Query= BP917406|Adiantum capillus-veneris mRNA,

  16. AcEST: BP914406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_E09 562 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E09. BP914406... CL513Contig1 Show BP914406 Clone id YMU001_000058_E09 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000058_E09. Accession BP914406 Tissue type prothallium Developmental stage...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406|Adiantum capillus...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406

  17. AcEST: BP921000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D05 407 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D05. BP921000 - Show BP921000...is mRNA. clone: YMU001_000144_D05. Accession BP921000 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum cap...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum capillus-veneris mRN

  18. AcEST: BP920140 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E03 489 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E03. BP92014...0 CL2574Contig1 Show BP920140 Clone id YMU001_000133_E03 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E03. Accession BP920140 Tissue type prothallium Developmental stag... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920140|Adian... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  19. AcEST: BP920147 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F01 365 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F01. BP920147 - Show BP92014...is mRNA. clone: YMU001_000133_F01. Accession BP920147 Tissue type prothallium Developmental stage - Contig I...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920147|Adiantum capillus-veneris mRNA, clone: YMU001_...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201

  20. AcEST: BP920143 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E07 533 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E07. BP92014...3 CL2377Contig1 Show BP920143 Clone id YMU001_000133_E07 Library YMU01 Length 533 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E07. Accession BP920143 Tissue type prothallium Developmental stag...ms, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E0...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum

  1. AcEST: BP920144 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E09 265 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E09. BP920144 - Show BP92014...is mRNA. clone: YMU001_000133_E09. Accession BP920144 Tissue type prothallium Developmental stage - Contig I...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920144|Adiantum capillus-veneris mRNA, clone: YMU001...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  2. AcEST: BP920141 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E04 528 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E04. BP920141 - Show BP92014...is mRNA. clone: YMU001_000133_E04. Accession BP920141 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (528 lette...cleic Acids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (52

  3. AcEST: BP920148 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F02 429 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F02. BP92014...8 CL3819Contig1 Show BP920148 Clone id YMU001_000133_F02 Library YMU01 Length 429 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F02. Accession BP920148 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920148|Adiantum capillus-vener...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  4. AcEST: BP920145 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E11 274 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E11. BP920145 - Show BP92014...is mRNA. clone: YMU001_000133_E11. Accession BP920145 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E11.... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adian

  5. AcEST: BP920142 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E05 486 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E05. BP920142 - Show BP92014...is mRNA. clone: YMU001_000133_E05. Accession BP920142 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris ...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris mRNA, clone: YMU001_0001

  6. AcEST: BP920998 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D03 529 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D03. BP92099...8 CL1935Contig1 Show BP920998 Clone id YMU001_000144_D03 Library YMU01 Length 529 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_D03. Accession BP920998 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-veneris mRNA, clon... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-ven

  7. AcEST: BP920996 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D01 496 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D01. BP92099...6 CL262Contig1 Show BP920996 Clone id YMU001_000144_D01 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D01. Accession BP920996 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920996|Adiantum capillus-ve

  8. AcEST: BP920995 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_C12 350 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C12. BP920995 - Show BP92099...is mRNA. clone: YMU001_000144_C12. Accession BP920995 Tissue type prothallium Developmental stage - Contig I...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

  9. AcEST: BP912099 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_B05 315 Adiantum capillus-veneris mRNA. clone: YMU001_000015_B05. BP912099 - Show BP912099...is mRNA. clone: YMU001_000015_B05. Accession BP912099 Tissue type prothallium Developmental stage - Contig I...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099|Adiantum capillus-vene

  10. AcEST: BP918801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000117_F03 542 Adiantum capillus-veneris mRNA. clone: YMU001_000117_F03. BP918801 - Show BP918801...is mRNA. clone: YMU001_000117_F03. Accession BP918801 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum capillus-veneris mRNA, clone: YMU0...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum ca

  11. AcEST: BP916801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000091_G06 127 Adiantum capillus-veneris mRNA. clone: YMU001_000091_G06. BP916801... CL2168Contig1 Show BP916801 Clone id YMU001_000091_G06 Library YMU01 Length 127 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000091_G06. Accession BP916801 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP916801|Adiantum capillus-veneris mRNA, clone: YMU0...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916801

  12. AcEST: BP918015 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F03 437 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F03. BP918015 - Show BP91801...is mRNA. clone: YMU001_000108_F03. Accession BP918015 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP918015|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F03. (437 letters) Data...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

  13. AcEST: BP918013 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F01 490 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F01. BP918013 - Show BP91801...is mRNA. clone: YMU001_000108_F01. Accession BP918013 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...idylinositol-4-phosphate 5-kinase 1 OS=Oryza sativa subsp. japonica GN=PIPK1 PE=2 SV=2 Length = 801 Score = ..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

  14. AcEST: BP918018 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F06 436 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F06. BP918018 - Show BP91801...is mRNA. clone: YMU001_000108_F06. Accession BP918018 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP918018|Adiantum capillus-veneris mRNA, clone: YM...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

  15. AcEST: BP913801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000035_D11 562 Adiantum capillus-veneris mRNA. clone: YMU001_000035_D11. BP913801... CL482Contig1 Show BP913801 Clone id YMU001_000035_D11 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000035_D11. Accession BP913801 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum capillus-veneris mRNA, clone: YMU0

  16. AcEST: BP917801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_F04 280 Adiantum capillus-veneris mRNA. clone: YMU001_000105_F04. BP917801 - Show BP917801...is mRNA. clone: YMU001_000105_F04. Accession BP917801 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-ve... Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-veneris mRNA, clone: YMU001_000105_F04.

  17. AcEST: BP918017 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F05 267 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F05. BP918017 - Show BP91801...is mRNA. clone: YMU001_000108_F05. Accession BP918017 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris m...cleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F05. (26

  18. AcEST: BP911801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_C12 487 Adiantum capillus-veneris mRNA. clone: YMU001_000009_C12. BP911801 - Show BP911801...is mRNA. clone: YMU001_000009_C12. Accession BP911801 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911801.... 25:3389-3402. Query= BP911801|Adiantum capillus-veneris mRNA, clone: YMU001_000

  19. AcEST: BP915801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000077_B02 555 Adiantum capillus-veneris mRNA. clone: YMU001_000077_B02. BP915801 - Show BP915801...is mRNA. clone: YMU001_000077_B02. Accession BP915801 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP915801|Adiantum capillus-veneris mRNA, clone: YMU001_000077_B02. ...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915801|A

  20. AcEST: BP920801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000141_G10 454 Adiantum capillus-veneris mRNA. clone: YMU001_000141_G10. BP920801... CL819Contig1 Show BP920801 Clone id YMU001_000141_G10 Library YMU01 Length 454 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000141_G10. Accession BP920801 Tissue type prothallium Developmental stage... Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-veneris mRNA, clone: ...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-

  1. AcEST: BP912801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000023_A07 527 Adiantum capillus-veneris mRNA. clone: YMU001_000023_A07. BP912801 - Show BP912801...is mRNA. clone: YMU001_000023_A07. Accession BP912801 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912801...es. 25:3389-3402. Query= BP912801|Adiantum capillus-veneris mRNA, clone: YMU001_0

  2. AcEST: BP918012 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_E12 547 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E12. BP918012 - Show BP91801...is mRNA. clone: YMU001_000108_E12. Accession BP918012 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108_E1

  3. On the origin of the hypervelocity runaway star HD271791

    OpenAIRE

    Gvaramadze, V. V.

    2009-01-01

    We discuss the origin of the runaway early B-type star HD271791 and show that its extremely high velocity (\\simeq 530-920 km/s) cannot be explained within the framework of the binary-supernova ejection scenario. Instead, we suggest that HD271791 attained its peculiar velocity in the course of a strong dynamical encounter between two hard massive binaries or via an exchange encounter between a hard massive binary and a very massive star, formed through runaway mergers of ordinary massive stars...

  4. Nonlinear peculiar-velocity analysis and PCA

    Energy Technology Data Exchange (ETDEWEB)

    Dekel, A. [and others

    2001-02-20

    We allow for nonlinear effects in the likelihood analysis of peculiar velocities, and obtain {approximately}35%-lower values for the cosmological density parameter and for the amplitude of mass-density fluctuations. The power spectrum in the linear regime is assumed to be of the flat {Lambda}CDM model (h = 0:65, n = 1) with only {Omega}{sub m} free. Since the likelihood is driven by the nonlinear regime, we break the power spectrum at k{sub b} {approximately} 0.2 (h{sup {minus}1} Mpc){sup {minus}1} and fit a two-parameter power-law at k > k{sub b} . This allows for an unbiased fit in the linear regime. Tests using improved mock catalogs demonstrate a reduced bias and a better fit. We find for the Mark III and SFI data {Omega}{sub m} = 0.35 {+-} 0.09 with {sigma}{sub 8}{Omega}P{sub m}{sup 0.6} = 0.55 {+-} 0.10 (90% errors). When allowing deviations from {Lambda}CDM, we find an indication for a wiggle in the power spectrum in the form of an excess near k {approximately} 0.05 and a deficiency at k {approximately} 0.1 (h{sup {minus}1} Mpc){sup {minus}1}--a cold flow which may be related to a feature indicated from redshift surveys and the second peak in the CMB anisotropy. A {chi}{sup 2} test applied to principal modes demonstrates that the nonlinear procedure improves the goodness of fit. The Principal Component Analysis (PCA) helps identifying spatial features of the data and fine-tuning the theoretical and error models. We address the potential for optimal data compression using PCA.

  5. THE EXTENDED He IIλ4686-EMITTING REGION IN IZw 18 UNVEILED: CLUES FOR PECULIAR IONIZING SOURCES

    Energy Technology Data Exchange (ETDEWEB)

    Kehrig, C.; Vílchez, J. M.; Pérez-Montero, E.; Iglesias-Páramo, J.; Bayo, F. M. [Instituto de Astrofísica de Andalucía (CSIC), Glorieta de la Astronomía s/n, E-18008 Granada (Spain); Brinchmann, J. [Leiden Observatory, Leiden University, P.O. Box 9513, NL-2300 RA Leiden (Netherlands); Kunth, D.; Durret, F. [Institut d’Astrophysique de Paris, UMR 7095, CNRS and UPMC, 98 bis Bd Arago, F-75014 Paris (France)

    2015-03-10

    New integral field spectroscopy has been obtained for IZw 18, the nearby lowest-metallicity galaxy considered to be our best local analog of systems forming at high redshift (z). Here we report the spatially resolved spectral map of the nebular He ii λ4686 emission in IZw 18, from which we derived for the first time its total He ii-ionizing flux. Nebular He ii emission implies the existence of a hard radiation field. He ii-emitters are observed to be more frequent among high-z galaxies than for local objects. Therefore, investigating the He ii-ionizing source(s) in IZw 18 may reveal the ionization processes at high z. He ii emission in star-forming galaxies has been suggested to be mainly associated with Wolf–Rayet stars (WRs), but WRs cannot satisfactorily explain the He ii-ionization at all times, particularly at the lowest metallicities. Shocks from supernova remnants, or X-ray binaries, have been proposed as additional potential sources of He ii-ionizing photons. Our data indicate that conventional He ii-ionizing sources (WRs, shocks, X-ray binaries) are not sufficient to explain the observed nebular He iiλ4686 emission in IZw 18. We find that the He ii-ionizing radiation expected from models for either low-metallicity super-massive O stars or rotating metal-free stars could account for the He ii-ionization budget measured, while only the latter models could explain the highest values of He iiλ4686/Hβ observed. The presence of such peculiar stars in IZw 18 is suggestive and further investigation in this regard is needed. This letter highlights that some of the clues of the early universe can be found here in our cosmic backyard.

  6. THE PECULIAR DISTRIBUTION OF CH{sub 3}CN IN IRC +10216 SEEN BY ALMA

    Energy Technology Data Exchange (ETDEWEB)

    Agúndez, M.; Cernicharo, J.; Quintana-Lacaci, G.; Prieto, L. Velilla [Instituto de Ciencia de Materiales de Madrid, CSIC, C/Sor Juana Inés de la Cruz 3, E-28049 Cantoblanco (Spain); Castro-Carrizo, A.; Guélin, M. [Institut de Radioastronomie Millimétrique, 300 rue de la Piscine, F-38406 St. Martin d’Héres (France); Marcelino, N. [INAF, Istituto di Radioastronomia, via Gobetti 101, I-40129 Bologna (Italy)

    2015-12-01

    IRC +10216 is a circumstellar envelope around a carbon-rich evolved star which contains a large variety of molecules. According to interferometric observations, molecules are distributed either concentrated around the central star or as a hollow shell with a radius of ∼15″. We present ALMA Cycle 0 band 6 observations of the J = 14 – 13 rotational transition of CH{sub 3}CN in IRC +10216, obtained with an angular resolution of 0.″76 × 0.″61. The bulk of the emission is distributed as a hollow shell located at just ∼2″ from the star, with a void of emission in the central region up to a radius of ∼1″. This spatial distribution is markedly different from those found to date in this source for other molecules. Our analysis indicates that methyl cyanide is not formed in either the stellar photosphere or far in the outer envelope, but at radial distances as short as 1″–2″, reaching a maximum abundance of ∼0.02 molecules cm{sup −3} at 2″ from the star. Standard chemical models of IRC +10216 predict that the bulk of CH{sub 3}CN molecules should be present at a radius of ∼15″ where other species such as polyyne radicals and cyanopolyynes are observed, with an additional inner component within 1″ from the star. The non-uniform structure of the circumstellar envelope and grain surface processes are discussed as possible causes of the peculiar distribution of methyl cyanide in IRC +10216.

  7. Gaia's view of the λ Boo star puzzle

    Science.gov (United States)

    Murphy, Simon J.; Paunzen, Ernst

    2017-04-01

    The evolutionary status of the chemically peculiar class of λ Boo stars has been intensely debated. It is now agreed that the λ Boo phenomenon affects A stars of all ages, from star formation to the terminal age main sequence, but the cause of the chemical peculiarity is still a puzzle. We revisit the debate of their ages and temperatures in order to shed light on the phenomenon, using the new parallaxes in Gaia Data Release 1 with existing Hipparcos parallaxes and multicolour photometry. We find that no single formation mechanism is able to explain all the observations, and suggest that there are multiple channels producing λ Boo spectra. The relative importance of these channels varies with age, temperature and environment.

  8. A search for magnetic fields in Lambda Bootis stars

    International Nuclear Information System (INIS)

    Bohlender, D.A.; Landstreet, J.D.

    1990-01-01

    We have searched a sample of λ Boo stars for magnetic fields similar to those observed in the magnetic Ap and Bp stars, using a Balmer-line Zeeman analyser. Apart from one dubious measurement, no fields are detected in our sample. It appears that magnetic fields of the λ Boo stars, if they exist, are significantly smaller than those found in magnetic upper main-sequence stars of similar spectral type; this conclusion is supported at about the 90 or 95 per cent confidence level by the present data. (author)

  9. On the origin of high-velocity runaway stars

    Science.gov (United States)

    Gvaramadze, Vasilii V.; Gualandris, Alessia; Portegies Zwart, Simon

    2009-06-01

    We explore the hypothesis that some high-velocity runaway stars attain their peculiar velocities in the course of exchange encounters between hard massive binaries and a very massive star (either an ordinary 50-100Msolar star or a more massive one, formed through runaway mergers of ordinary stars in the core of a young massive star cluster). In this process, one of the binary components becomes gravitationally bound to the very massive star, while the second one is ejected, sometimes with a high speed. We performed three-body scattering experiments and found that early B-type stars (the progenitors of the majority of neutron stars) can be ejected with velocities of >~200-400kms-1 (typical of pulsars), while 3-4Msolar stars can attain velocities of >~300-400kms-1 (typical of the bound population of halo late B-type stars). We also found that the ejected stars can occasionally attain velocities exceeding the Milky Ways's escape velocity.

  10. Symbiotic stars

    Science.gov (United States)

    Kafatos, M.; Michalitsianos, A. G.

    1984-01-01

    The physical characteristics of symbiotic star systems are discussed, based on a review of recent observational data. A model of a symbiotic star system is presented which illustrates how a cool red-giant star is embedded in a nebula whose atoms are ionized by the energetic radiation from its hot compact companion. UV outbursts from symbiotic systems are explained by two principal models: an accretion-disk-outburst model which describes how material expelled from the tenuous envelope of the red giant forms an inwardly-spiralling disk around the hot companion, and a thermonuclear-outburst model in which the companion is specifically a white dwarf which superheats the material expelled from the red giant to the point where thermonuclear reactions occur and radiation is emitted. It is suspected that the evolutionary course of binary systems is predetermined by the initial mass and angular momentum of the gas cloud within which binary stars are born. Since red giants and Mira variables are thought to be stars with a mass of one or two solar mass, it is believed that the original cloud from which a symbiotic system is formed can consist of no more than a few solar masses of gas.

  11. A Runaway Yellow Supergiant Star in the Small Magellanic Cloud

    Science.gov (United States)

    Neugent, Kathryn F.; Massey, Philip; Morrell, Nidia I.; Skiff, Brian; Georgy, Cyril

    2018-05-01

    We recently discovered a yellow supergiant (YSG) in the Small Magellanic Cloud (SMC) with a heliocentric radial velocity of ∼300 km s‑1, which is much larger than expected for a star at its location in the SMC. This is the first runaway YSG ever discovered and only the second evolved runaway star discovered in a galaxy other than the Milky Way. We classify the star as G5-8 I and use de-reddened broad-band colors with model atmospheres to determine an effective temperature of 4700 ± 250 K, consistent with what is expected from its spectral type. The star’s luminosity is then log L/L ⊙ ∼ 4.2 ± 0.1, consistent with it being a ∼30 Myr 9 M ⊙ star according to the Geneva evolution models. The star is currently located in the outer portion of the SMC’s body, but if the star’s transverse peculiar velocity is similar to its peculiar radial velocity, in 10 Myr the star would have moved 1.°6 across the disk of the SMC and could easily have been born in one of the SMC’s star-forming regions. Based on its large radial velocity, we suggest it originated in a binary system where the primary exploded as a supernovae, thus flinging the runaway star out into space. Such stars may provide an important mechanism for the dispersal of heavier elements in galaxies given the large percentage of massive stars that are runaways. In the future, we hope to look into additional evolved runaway stars that were discovered as part of our other past surveys. This paper includes data gathered with the 6.5 m Magellan Telescopes located at Las Campanas Observatory, Chile.

  12. Peculiarities of Flexibility Development in Middle Schoolers

    Directory of Open Access Journals (Sweden)

    М. В. Солодовникова

    2015-09-01

    Full Text Available The paper objective is to define the peculiarities of flexibility development in middle schoolers. To solve the tasks set, the study used the following research methods: theoretical analysis and collation of scientific and methodological literature; pedagogical testing, methods of mathematical statistics. Research results. The testing analysis showed statistically unreliable deviations in the results displayed by the fifth-, sixth- and seventh-grade girls in the following tests: “Rotation in the shoulder joint with a staff”, “Backbend from the lying position”, “Forward bend from the sitting position” (p > 0.05. The fifth-, sixth- and seventh-grade girls show improvement in their statistically significant results (p < 0.05 in the following tests: “Raise up from the lying position to the sitting position in 30 seconds”, “Bending and unbending of arms in the lying position”. The testing analysis showed a statistically significant deterioration in the results displayed by the fifth-, sixth- and seventh-grade boys in the following tests: “Rotation in the shoulder joint with a staff”, “Backbend from the lying position” (p < 0.05. The fifth-, sixth- and seventh-grade boys show improvement in their statistically significant results (p < 0.05 in the test " Raise up from the lying position to the sitting position in 30 seconds”, and an improving tendency in the results in the test “Bending and unbending of arms in the lying position”. Conclusions. The informative indicators of flexibility and strength readiness of the 5th-7th-grade boys are “Rotation in the shoulder joint with a staff”, “Backbend from the lying position” and “Raise up from the lying position to the sitting position in 30 seconds”. The informative indicators of strength readiness of the 5th-7th-grade girls are “Raise up from the lying position to the sitting position in 30 seconds”, “Bending and unbending of arms in the lying

  13. BP180 dysfunction triggers spontaneous skin inflammation in mice.

    Science.gov (United States)

    Zhang, Yang; Hwang, Bin-Jin; Liu, Zhen; Li, Ning; Lough, Kendall; Williams, Scott E; Chen, Jinbo; Burette, Susan W; Diaz, Luis A; Su, Maureen A; Xiao, Shengxiang; Liu, Zhi

    2018-06-04

    BP180, also known as collagen XVII, is a hemidesmosomal component and plays a key role in maintaining skin dermal/epidermal adhesion. Dysfunction of BP180, either through genetic mutations in junctional epidermolysis bullosa (JEB) or autoantibody insult in bullous pemphigoid (BP), leads to subepidermal blistering accompanied by skin inflammation. However, whether BP180 is involved in skin inflammation remains unknown. To address this question, we generated a BP180-dysfunctional mouse strain and found that mice lacking functional BP180 (termed Δ NC16A ) developed spontaneous skin inflammatory disease, characterized by severe itch, defective skin barrier, infiltrating immune cells, elevated serum IgE levels, and increased expression of thymic stromal lymphopoietin (TSLP). Severe itch is independent of adaptive immunity and histamine, but dependent on increased expression of TSLP by keratinocytes. In addition, a high TSLP expression is detected in BP patients. Our data provide direct evidence showing that BP180 regulates skin inflammation independently of adaptive immunity, and BP180 dysfunction leads to a TSLP-mediated itch. The newly developed mouse strain could be a model for elucidation of disease mechanisms and development of novel therapeutic strategies for skin inflammation and BP180-related skin conditions.

  14. CHLOE: A tool for automatic detection of peculiar galaxies

    Science.gov (United States)

    Shamir, Lior; Manning, Saundra; Wallin, John

    2014-09-01

    CHLOE is an image analysis unsupervised learning algorithm that detects peculiar galaxies in datasets of galaxy images. The algorithm first computes a large set of numerical descriptors reflecting different aspects of the visual content, and then weighs them based on the standard deviation of the values computed from the galaxy images. The weighted Euclidean distance of each galaxy image from the median is measured, and the peculiarity of each galaxy is determined based on that distance.

  15. Dark stars

    DEFF Research Database (Denmark)

    Maselli, Andrea; Pnigouras, Pantelis; Nielsen, Niklas Grønlund

    2017-01-01

    to the formation of compact objects predominantly made of dark matter. Considering both fermionic and bosonic (scalar φ4) equations of state, we construct the equilibrium structure of rotating dark stars, focusing on their bulk properties and comparing them with baryonic neutron stars. We also show that these dark......Theoretical models of self-interacting dark matter represent a promising answer to a series of open problems within the so-called collisionless cold dark matter paradigm. In case of asymmetric dark matter, self-interactions might facilitate gravitational collapse and potentially lead...... objects admit the I-Love-Q universal relations, which link their moments of inertia, tidal deformabilities, and quadrupole moments. Finally, we prove that stars built with a dark matter equation of state are not compact enough to mimic black holes in general relativity, thus making them distinguishable...

  16. Multivalent display of the antimicrobial peptides BP100 and BP143

    Directory of Open Access Journals (Sweden)

    Imma Güell

    2012-12-01

    Full Text Available Carbohydrates are considered as promising templates for the display of multiple copies of antimicrobial peptides. Herein, we describe the design and synthesis of chimeric structures containing two or four copies of the antimicrobial peptides KKLFKKILKYL-NH2 (BP100 and KKLfKKILKYL-NH2 (BP143 attached to the carbohydrate template cyclodithioerythritol (cDTE or α-D-galactopyranoside (Galp. The synthesis involved the preparation of the corresponding peptide aldehyde followed by coupling to an aminooxy-functionalized carbohydrate template. After purification, the multivalent display systems were obtained in high purities (90–98% and in good yields (42–64%. These compounds were tested against plant and human pathogenic bacteria and screened for their cytotoxicity on eukaryotic cells. They showed lower MIC values than the parent peptides against the bacteria analyzed. In particular, the carbopeptides derived from cDTE and Galp, which contained two or four copies of BP100, respectively, were 2- to 8-fold more active than the monomeric peptide against the phytopathogenic bacteria. These results suggest that preassembling antimicrobial peptides to multimeric structures is not always associated with a significant improvement of the activity. In contrast, the carbopeptides synthesized were active against human red blood cells pointing out that peptide preassembly is critical for the hemolytic activity. Notably, peptide preassembly resulted in an enhanced bactericidal effect.

  17. Unveiling the molecular bipolar outflow of the peculiar red supergiant VY Canis Majoris

    Science.gov (United States)

    Shinnaga, Hiroko; Claussen, Mark J.; Lim, Jeremy; Dinh-van-Trung; Tsuboi, Masato

    2003-04-01

    We carried out polarimetric spectral-line imaging of the molecular outflow of the peculiar red supergiant VY Canis Majoris in SiO J=1-0 line in the ground vibrational state, which contains highly linearly-polarized velocity components, using the Very Large Array. We succeeded in unveiling the highly linearly polarized bipolar outflow for the first time at subarcsecond spatial resolution. The results clearly show that the direction of linear polarization of the brightest maser components is parallel to the outflow axis. The results strongly suggest that the linear polarization of the SiO maser is closely related to the outflow phenomena of the star. Furthermore, the results indicate that the linear polarization observed in the optical and infrared also occur due to the outflow phenomena.

  18. Strong late-time circumstellar interaction in the peculiar supernova iPTF14hls

    Science.gov (United States)

    Andrews, Jennifer E.; Smith, Nathan

    2018-06-01

    We present a moderate-resolution spectrum of the peculiar Type II supernova (SN) iPTF14hls taken on day 1153 after discovery. This spectrum reveals the clear signature of shock interaction with dense circumstellar material (CSM). We suggest that this CSM interaction may be an important clue for understanding the extremely unusual photometric and spectroscopic evolution seen over the first 600 d of iPTF14hls. The late-time spectrum shows a double-peaked intermediate-width H α line indicative of expansion speeds around 1000 km s-1, with the double-peaked shape hinting at a disc-like geometry in the CSM. If the CSM were highly asymmetric, perhaps in a disc or torus that was ejected from the star 3-6 yr prior to explosion, the CSM interaction could have been overrun and hidden below the SN ejecta photosphere from a wide range of viewing angles. In that case, CSM interaction luminosity would have been thermalized well below the photosphere, potentially sustaining the high luminosity without exhibiting the traditional observational signatures of strong CSM interaction (narrow H α emission and X-rays). Variations in density structure of the CSM could account for the multiple rebrightenings of the light curve. We propose that a canonical 1 × 1051 erg explosion energy with enveloped CSM interaction as seen in some recent SNe, rather than an entirely new explosion mechanism, may be adequate to explain the peculiar evolution of iPTF14hls.

  19. Face recognition based on improved BP neural network

    Directory of Open Access Journals (Sweden)

    Yue Gaili

    2017-01-01

    Full Text Available In order to improve the recognition rate of face recognition, face recognition algorithm based on histogram equalization, PCA and BP neural network is proposed. First, the face image is preprocessed by histogram equalization. Then, the classical PCA algorithm is used to extract the features of the histogram equalization image, and extract the principal component of the image. And then train the BP neural network using the trained training samples. This improved BP neural network weight adjustment method is used to train the network because the conventional BP algorithm has the disadvantages of slow convergence, easy to fall into local minima and training process. Finally, the BP neural network with the test sample input is trained to classify and identify the face images, and the recognition rate is obtained. Through the use of ORL database face image simulation experiment, the analysis results show that the improved BP neural network face recognition method can effectively improve the recognition rate of face recognition.

  20. Congenital Arthrogryposis: An Extension of the 15q11.2 BP1-BP2 Microdeletion Syndrome?

    Directory of Open Access Journals (Sweden)

    K. M. Usrey

    2014-01-01

    Full Text Available The proximal 15q11–q13 region contains 5 breakpoints (BP1–BP5. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes. The genes in this region are known to play a role in central nervous system development and/or function. Microdeletions within the 15q11.2 BP1-BP2 region have been reported in patients with neurological dysfunction, developmental delays, behavioral problems, and dysmorphic features. We report two unrelated subjects with the 15q11.2 BP1-BP2 microdeletion and presenting with congenital arthrogryposis, a feature which has not been previously reported as part of this newly recognized microdeletion syndrome. While arthrogryposis seen in these two subjects may be coincidental, we propose that congenital arthrogryposis may result from neurological dysfunction and involvement of the microdeletion of the 15q11.2 BP1-BP2 region, further expanding the phenotype of this microdeletion syndrome. We encourage others to report patients with this chromosome microdeletion and neurological findings to further characterize the clinical phenotype.

  1. On the kinematics of visual binary and multiple stars of the FK4 cataloque

    International Nuclear Information System (INIS)

    Starikova, G.A.

    1981-01-01

    Kinematic features of single, binary and multiple stars are considered. To compare kinematics of such stars with the kinematics of single stars the data on positions and proper motions of those stars which are given in the basic catalogue FK4. Single as well as visual binary and multiple stars united because of their limited content in FK4 have been subdivided by spectra and classes of luminosity into groups with account for known kinematic peculiarities of various spectral groups. Kinematic features for the studied spectral groups are given. By the stars of the FK4 catalogue for various spectral classes the difference of kinematic features of single, visual binary and multiple stars is obtained. However the values of these differences need to be specified due to small number of stars included in five of six groups considered

  2. Cyanogen strengths of globular cluster post-main-sequence stars

    International Nuclear Information System (INIS)

    Hesser, J.E.; Hartwick, F.D.A.; McClure, R.D.

    1976-01-01

    CN strengths in the peculiar clusters ω Cen and M22 and the metal-rich clusters 47 Tuc, M71, and NGC 6352 are found to vary markedly from star to star. The strong variations in CN strength found earlier for ω Cen by Norris and Bessell and by Dickens and Bell are shown to extend to fainter stars, although expected correlations of CN strength with position in the color-magnitude (C-M) diagram are less evident in our sample. Several CN and metal-strong stars were also observed in M22. We conclude that CN, once it appears in globular clusters, can vary much more than it does in equivalent Population I samples, a result we briefly examine in light of current understanding regarding physical processes in the stars themselves and of models of galactic chemical evolution

  3. Hybrid stars

    Indian Academy of Sciences (India)

    Hybrid stars. AsHOK GOYAL. Department of Physics and Astrophysics, University of Delhi, Delhi 110 007, India. Abstract. Recently there have been important developments in the determination of neutron ... number and the electric charge. ... available to the system to rearrange concentration of charges for a given fraction of.

  4. Pulsating stars

    CERN Document Server

    Catelan, M?rcio

    2014-01-01

    The most recent and comprehensive book on pulsating stars which ties the observations to our present understanding of stellar pulsation and evolution theory.  Written by experienced researchers and authors in the field, this book includes the latest observational results and is valuable reading for astronomers, graduate students, nuclear physicists and high energy physicists.

  5. Variable stars

    International Nuclear Information System (INIS)

    Feast, M.W.; Wenzel, W.; Fernie, J.D.; Percy, J.R.; Smak, J.; Gascoigne, S.C.B.; Grindley, J.E.; Lovell, B.; Sawyer Hogg, H.B.; Baker, N.; Fitch, W.S.; Rosino, L.; Gursky, H.

    1976-01-01

    A critical review of variable stars is presented. A fairly complete summary of major developments and discoveries during the period 1973-1975 is given. The broad developments and new trends are outlined. Essential problems for future research are identified. (B.R.H. )

  6. AcEST: BP912612 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_H07 512 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H07. BP912612 - Show BP912612... Clone id YMU001_000020_H07 Library YMU01 Length 512 Definition Adiantum capillus-vener...is mRNA. clone: YMU001_000020_H07. Accession BP912612 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912612|Adiantum cap...illus-veneris mRNA, clone: YMU001_000020_H07. (512 letters) Database: uniprot_sprot.fasta 412,525 sequences;

  7. AcEST: BP912712 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000022_A07 476 Adiantum capillus-veneris mRNA. clone: YMU001_000022_A07. BP912712 - Show BP912712...is mRNA. clone: YMU001_000022_A07. Accession BP912712 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP912712|Adiantum capillus-veneris mRNA, cl...one: YMU001_000022_A07. (476 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...8%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Frame = +3 Query: 123 TSRRKSNHDQY--LPNYKVGTVHLLLGVKDQHLVSKIDI

  8. AcEST: BP912126 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D08 484 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D08. BP912126 CL412...4Contig1 Show BP912126 Clone id YMU001_000015_D08 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D08. Accession BP912126 Tissue type prothallium Developmental stage - Contig ID CL412...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...25:3389-3402. Query= BP912126|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D08. (484 letters) Databa

  9. AcEST: BP912212 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D11 457 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D11. BP912212... CL1085Contig1 Show BP912212 Clone id YMU001_000016_D11 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_D11. Accession BP912212 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912212...|Adiantum capillus-veneris mRNA, clone: YMU001_000016_D11. (457 letters) Database: uniprot_sprot.fasta 412

  10. AcEST: BP912312 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000017_F01 489 Adiantum capillus-veneris mRNA. clone: YMU001_000017_F01. BP912312... CL1779Contig1 Show BP912312 Clone id YMU001_000017_F01 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000017_F01. Accession BP912312 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912312...|Adiantum capillus-veneris mRNA, clone: YMU001_000017_F01. (489 letters) Database: uniprot_sprot.fasta 412

  11. AcEST: BP912128 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D10 477 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D10. BP91212...8 CL2328Contig1 Show BP912128 Clone id YMU001_000015_D10 Library YMU01 Length 477 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D10. Accession BP912128 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...8|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D10. (461 letters) Database: uniprot_sprot.fasta 412

  12. AcEST: BP912012 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A06. BP912012... CL2421Contig1 Show BP912012 Clone id YMU001_000012_A06 Library YMU01 Length 542 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A06. Accession BP912012 Tissue type prothallium Developmental stag...rams, Nucleic Acids Res. 25:3389-3402. Query= BP912012|Adiantum capillus-veneris ...mRNA, clone: YMU001_000012_A06. (542 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 t

  13. AcEST: BP912123 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D05 496 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D05. BP91212...3 CL498Contig1 Show BP912123 Clone id YMU001_000015_D05 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D05. Accession BP912123 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...3|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D05. (478 letters) Database: uniprot_sprot.fasta 412

  14. AcEST: BP912912 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000024_C05 413 Adiantum capillus-veneris mRNA. clone: YMU001_000024_C05. BP912912... CL1433Contig1 Show BP912912 Clone id YMU001_000024_C05 Library YMU01 Length 413 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000024_C05. Accession BP912912 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912912|Adiantum capillus-ven...eris mRNA, clone: YMU001_000024_C05. (413 letters) Database: uniprot_sprot.fasta 412

  15. AcEST: BP919999 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_G09 554 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G09. BP919999... CL2968Contig1 Show BP919999 Clone id YMU001_000131_G09 Library YMU01 Length 554 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_G09. Accession BP919999 Tissue type prothallium Developmental stag...b Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generatio...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919999|Adiantum capillus-ve

  16. AcEST: BP913636 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000032_E04 520 Adiantum capillus-veneris mRNA. clone: YMU001_000032_E04. BP913636... CL2643Contig1 Show BP913636 Clone id YMU001_000032_E04 Library YMU01 Length 520 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000032_E04. Accession BP913636 Tissue type prothallium Developmental stag...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP913636|Adiantum capillus-veneris mRNA, clone: YMU001_00003...tative phospholipid-transporting ATPase ... 149 8e-36 sp|Q9LNQ4|ALA4_ARATH Putati

  17. AcEST: BP920997 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D02. BP92099...7 CL10Contig1 Show BP920997 Clone id YMU001_000144_D02 Library YMU01 Length 534 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000144_D02. Accession BP920997 Tissue type prothallium Developmental stage ...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920997|Adian...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2

  18. AcEST: BP917373 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_A08 270 Adiantum capillus-veneris mRNA. clone: YMU001_000100_A08. BP917373 CL2373...Contig1 Show BP917373 Clone id YMU001_000100_A08 Library YMU01 Length 270 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_A08. Accession BP917373 Tissue type prothallium Developmental stage - Contig ID CL2373...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917373|Adiantum capillus-veneris mRNA, clone: YMU...EGAVKHVGVLSS 206 K+ GC+S G SRHGES V KE H SS Sbjct: 473 KKEKGCSSPGSSRHGESHKGVSHTPI

  19. How to unveil a T Tauri star

    International Nuclear Information System (INIS)

    Hartigan, P.; Hartmann, L.; Kenyon, S.; Hewett, R.; Stauffer, J.

    1989-01-01

    A method for separating the 'veiling' continuum often present in T Tauri stars from the underlying photospheric spectrum is described. Echelle observations from 5100 to 6800 A of the partially veiled T Tauri star BP Tau were analyzed to determine the shape of the veiling spectrum. The residuals of the fit indicate the deviation of the veiling spectrum from a simple continuum and identify the location and strength of any emission-line components. It is shown, by means of goodness-of-fit tests, that the spectrum of BP Tau can be decomposed into a normal stellar spectrum plus a smooth veiling continuum with only a few emission lines superposed. The continuum dominates the veiling spectrum in this spectral region; the veiling does not arise from numerous deep photospheric absorption lines that are filled in by weak emission. 36 refs

  20. Star Products and Applications

    OpenAIRE

    Iida, Mari; Yoshioka, Akira

    2010-01-01

    Star products parametrized by complex matrices are defined. Especially commutative associative star products are treated, and star exponentials with respect to these star products are considered. Jacobi's theta functions are given as infinite sums of star exponentials. As application, several concrete identities are obtained by properties of the star exponentials.

  1. Evaluation of fungal- and photo-degradation as potential treatments for the removal of sunscreens BP3 and BP1

    Energy Technology Data Exchange (ETDEWEB)

    Gago-Ferrero, Pablo, E-mail: pablo.gago@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Badia-Fabregat, Marina, E-mail: marina.badia@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Olivares, Alba, E-mail: esalba.olivares@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Pina, Benjamin, E-mail: benjami.pina@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Blanquez, Paqui, E-mail: paqui.blanquez@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Vicent, Teresa, E-mail: teresa.vicent@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Caminal, Gloria, E-mail: gloria.caminal@uab.cat [Unitat de Biocatalisi Aplicada associada al IQAC (CSIC-UAB). Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Diaz-Cruz, M. Silvia, E-mail: silvia.diaz@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); and others

    2012-06-15

    Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: Black-Right-Pointing-Pointer Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. Black-Right-Pointing-Pointer BP3 is not degraded under simulated sunlight. Black-Right-Pointing-Pointer Glycoconjugates have been identified as the main intermediate metabolites. Black-Right-Pointing-Pointer Decrease in endocrine activity

  2. Evaluation of fungal- and photo-degradation as potential treatments for the removal of sunscreens BP3 and BP1

    International Nuclear Information System (INIS)

    Gago-Ferrero, Pablo; Badia-Fabregat, Marina; Olivares, Alba; Piña, Benjamin; Blánquez, Paqui; Vicent, Teresa; Caminal, Gloria; Díaz-Cruz, M. Silvia

    2012-01-01

    Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: ► Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. ► BP3 is not degraded under simulated sunlight. ► Glycoconjugates have been identified as the main intermediate metabolites. ► Decrease in endocrine activity was found in both photodegradation and biodegradation.

  3. Searching for dust around hyper metal poor stars

    International Nuclear Information System (INIS)

    Venn, Kim A.; Divell, Mike; Starkenburg, Else; Puzia, Thomas H.; Côté, Stephanie; Lambert, David L.

    2014-01-01

    We examine the mid-infrared fluxes and spectral energy distributions for stars with iron abundances [Fe/H] <–5, and other metal-poor stars, to eliminate the possibility that their low metallicities are related to the depletion of elements onto dust grains in the formation of a debris disk. Six out of seven stars examined here show no mid-IR excesses. These non-detections rule out many types of circumstellar disks, e.g., a warm debris disk (T ≤ 290 K), or debris disks with inner radii ≤1 AU, such as those associated with the chemically peculiar post-asymptotic giant branch spectroscopic binaries and RV Tau variables. However, we cannot rule out cooler debris disks, nor those with lower flux ratios to their host stars due to, e.g., a smaller disk mass, a larger inner disk radius, an absence of small grains, or even a multicomponent structure, as often found with the chemically peculiar Lambda Bootis stars. The only exception is HE0107-5240, for which a small mid-IR excess near 10 μm is detected at the 2σ level; if the excess is real and associated with this star, it may indicate the presence of (recent) dust-gas winnowing or a binary system.

  4. Searching for dust around hyper metal poor stars

    Energy Technology Data Exchange (ETDEWEB)

    Venn, Kim A.; Divell, Mike; Starkenburg, Else [Department of Physics and Astronomy, University of Victoria, 3800 Finnerty Road, Victoria, BC, V8P 5C2 (Canada); Puzia, Thomas H. [Institute of Astrophysics, Pontificia Universidad Catolica de Chile, Av. Vicuna Mackenna 4860, 7820436 Macul, Santiago (Chile); Côté, Stephanie [NRC Herzberg Institute of Astrophysics, 5071 West Saanich Road, Victoria, BC, V9E 2E7 (Canada); Lambert, David L., E-mail: kvenn@uvic.ca [McDonald Observatory and the Department of Astronomy, University of Texas at Austin, RLM 15.308, Austin, TX 78712 (United States)

    2014-08-20

    We examine the mid-infrared fluxes and spectral energy distributions for stars with iron abundances [Fe/H] <–5, and other metal-poor stars, to eliminate the possibility that their low metallicities are related to the depletion of elements onto dust grains in the formation of a debris disk. Six out of seven stars examined here show no mid-IR excesses. These non-detections rule out many types of circumstellar disks, e.g., a warm debris disk (T ≤ 290 K), or debris disks with inner radii ≤1 AU, such as those associated with the chemically peculiar post-asymptotic giant branch spectroscopic binaries and RV Tau variables. However, we cannot rule out cooler debris disks, nor those with lower flux ratios to their host stars due to, e.g., a smaller disk mass, a larger inner disk radius, an absence of small grains, or even a multicomponent structure, as often found with the chemically peculiar Lambda Bootis stars. The only exception is HE0107-5240, for which a small mid-IR excess near 10 μm is detected at the 2σ level; if the excess is real and associated with this star, it may indicate the presence of (recent) dust-gas winnowing or a binary system.

  5. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Frigaard, Peter; Brorsen, Michael

    Nærværende rapport beskriver foreløbige hovedkonklusioner på modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star i perioden 13/9 2004 til 12/11 2004.......Nærværende rapport beskriver foreløbige hovedkonklusioner på modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star i perioden 13/9 2004 til 12/11 2004....

  6. HUBBLE CAPTURES THE HEART OF STAR BIRTH

    Science.gov (United States)

    2002-01-01

    NASA Hubble Space Telescope's Wide Field and Planetary Camera 2 (WFPC2) has captured a flurry of star birth near the heart of the barred spiral galaxy NGC 1808. On the left are two images, one superimposed over the other. The black-and-white picture is a ground-based view of the entire galaxy. The color inset image, taken with the Hubble telescope's Wide Field and Planetary Camera 2 (WFPC2), provides a close-up view of the galaxy's center, the hotbed of vigorous star formation. The ground-based image shows that the galaxy has an unusual, warped shape. Most spiral galaxies are flat disks, but this one has curls of dust and gas at its outer spiral arms (upper right-hand corner and lower left-hand corner). This peculiar shape is evidence that NGC 1808 may have had a close interaction with another nearby galaxy, NGC 1792, which is not in the picture Such an interaction could have hurled gas towards the nucleus of NGC 1808, triggering the exceptionally high rate of star birth seen in the WFPC2 inset image. The WFPC2 inset picture is a composite of images using colored filters that isolate red and infrared light as well as light from glowing hydrogen. The red and infrared light (seen as yellow) highlight older stars, while hydrogen (seen as blue) reveals areas of star birth. Colors were assigned to this false-color image to emphasize the vigorous star formation taking place around the galaxy's center. NGC 1808 is called a barred spiral galaxy because of the straight lines of star formation on both sides of the bright nucleus. This star formation may have been triggered by the rotation of the bar, or by matter which is streaming along the bar towards the central region (and feeding the star burst). Filaments of dust are being ejected from the core into a faint halo of stars surrounding the galaxy's disk (towards the upper left corner) by massive stars that have exploded as supernovae in the star burst region. The portion of the galaxy seen in this 'wide-field' image is

  7. AcEST: BP914065 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E01 548 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E01. BP91406...5 CL604Contig1 Show BP914065 Clone id YMU001_000039_E01 Library YMU01 Length 548 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_E01. Accession BP914065 Tissue type prothallium Developmental stage...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU0...cids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU001_000039_E01. (548 lette

  8. AcEST: BP914069 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E05 368 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E05. BP91406...9 CL2761Contig1 Show BP914069 Clone id YMU001_000039_E05 Library YMU01 Length 368 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_E05. Accession BP914069 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001_0000...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001

  9. AcEST: BP914060 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D08 539 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D08. BP91406...0 CL1835Contig1 Show BP914060 Clone id YMU001_000039_D08 Library YMU01 Length 539 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D08. Accession BP914060 Tissue type prothallium Developmental stag...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris ...Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris mRNA, clone: YMU001_000039_D08. (539 lett

  10. AcEST: BP920146 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E12 401 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E12. BP92014...6 CL388Contig1 Show BP920146 Clone id YMU001_000133_E12 Library YMU01 Length 401 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_E12. Accession BP920146 Tissue type prothallium Developmental stage...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum ca...rams, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum capillus-veneris mRNA, clone: YMU001_000133_

  11. AcEST: BP920149 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F03 624 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F03. BP92014...9 CL2860Contig1 Show BP920149 Clone id YMU001_000133_F03 Library YMU01 Length 624 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F03. Accession BP920149 Tissue type prothallium Developmental stag...ic Acids Res. 25:3389-3402. Query= BP920149|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F03. (624 l...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  12. Around and beyond 53BP1 Nuclear Bodies.

    Science.gov (United States)

    Fernandez-Vidal, Anne; Vignard, Julien; Mirey, Gladys

    2017-12-05

    Within the nucleus, sub-nuclear domains define territories where specific functions occur. Nuclear bodies (NBs) are dynamic structures that concentrate nuclear factors and that can be observed microscopically. Recently, NBs containing the p53 binding protein 1 (53BP1), a key component of the DNA damage response, were defined. Interestingly, 53BP1 NBs are visualized during G1 phase, in daughter cells, while DNA damage was generated in mother cells and not properly processed. Unlike most NBs involved in transcriptional processes, replication has proven to be key for 53BP1 NBs, with replication stress leading to the formation of these large chromatin domains in daughter cells. In this review, we expose the composition and organization of 53BP1 NBs and focus on recent findings regarding their regulation and dynamics. We then concentrate on the importance of the replication stress, examine the relation of 53BP1 NBs with DNA damage and discuss their dysfunction.

  13. AcEST: BP920994 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_C10 322 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C10. BP92099...4 CL2871Contig1 Show BP920994 Clone id YMU001_000144_C10 Library YMU01 Length 322 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C10. Accession BP920994 Tissue type prothallium Developmental stag...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

  14. AcEST: BP920990 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_C03 445 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C03. BP92099...0 CL4123Contig1 Show BP920990 Clone id YMU001_000144_C03 Library YMU01 Length 445 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C03. Accession BP920990 Tissue type prothallium Developmental stag...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9209...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

  15. AcEST: BP920999 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D04 588 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D04. BP92099...9 CL317Contig1 Show BP920999 Clone id YMU001_000144_D04 Library YMU01 Length 588 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D04. Accession BP920999 Tissue type prothallium Developmental stage...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

  16. AcEST: BP920993 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_C06 517 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C06. BP92099...3 CL547Contig1 Show BP920993 Clone id YMU001_000144_C06 Library YMU01 Length 517 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_C06. Accession BP920993 Tissue type prothallium Developmental stage...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum capillus-veneris mRNA, clone: YMU001_0001...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum

  17. AcEST: BP920991 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_C04 521 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C04. BP92099...1 CL3173Contig1 Show BP920991 Clone id YMU001_000144_C04 Library YMU01 Length 521 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C04. Accession BP920991 Tissue type prothallium Developmental stag...s. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (521 letters) Dat...ucleic Acids Res. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (5

  18. AcEST: BP920992 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_C05 525 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C05. BP92099...2 CL2523Contig1 Show BP920992 Clone id YMU001_000144_C05 Library YMU01 Length 525 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C05. Accession BP920992 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C05. (525 lett...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_00014

  19. Around and beyond 53BP1 Nuclear Bodies

    Directory of Open Access Journals (Sweden)

    Anne Fernandez-Vidal

    2017-12-01

    Full Text Available Within the nucleus, sub-nuclear domains define territories where specific functions occur. Nuclear bodies (NBs are dynamic structures that concentrate nuclear factors and that can be observed microscopically. Recently, NBs containing the p53 binding protein 1 (53BP1, a key component of the DNA damage response, were defined. Interestingly, 53BP1 NBs are visualized during G1 phase, in daughter cells, while DNA damage was generated in mother cells and not properly processed. Unlike most NBs involved in transcriptional processes, replication has proven to be key for 53BP1 NBs, with replication stress leading to the formation of these large chromatin domains in daughter cells. In this review, we expose the composition and organization of 53BP1 NBs and focus on recent findings regarding their regulation and dynamics. We then concentrate on the importance of the replication stress, examine the relation of 53BP1 NBs with DNA damage and discuss their dysfunction.

  20. AcEST: BP919801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_C11 513 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C11. BP919801... CL1Contig3 Show BP919801 Clone id YMU001_000129_C11 Library YMU01 Length 513 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000129_C11. Accession BP919801 Tissue type prothallium Developmental stage -...es. 25:3389-3402. Query= BP919801|Adiantum capillus-veneris mRNA, clone: YMU001_000129_C11. (435 letters) Da...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919801|Adiantum capil

  1. AcEST: BP918016 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F04 434 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F04. BP91801...6 CL3779Contig1 Show BP918016 Clone id YMU001_000108_F04 Library YMU01 Length 434 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000108_F04. Accession BP918016 Tissue type prothallium Developmental stag..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...ic Acids Res. 25:3389-3402. Query= BP918016|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F04. (434 l

  2. AcEST: BP914801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000063_A07 396 Adiantum capillus-veneris mRNA. clone: YMU001_000063_A07. BP914801... CL1121Contig1 Show BP914801 Clone id YMU001_000063_A07 Library YMU01 Length 396 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000063_A07. Accession BP914801 Tissue type prothallium Developmental stag...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801|Adiantum capillus-veneris mRNA, clone:

  3. Personal peculiarities in patients with middle cerebral artery infarction

    Directory of Open Access Journals (Sweden)

    Antonova N.A.

    2013-12-01

    Full Text Available The purpose of the work is to reveal personal peculiarities in patients who have suffered middle cerebral artery infarction. Material and Methods. 39 patients with middle cerebral artery infarction have been under the study. All patients have received clinical instrumental inspection (neurologic survey, duplex ultrasound investigation of vessels of neck, head and brain, the research CT or MRT. Personal peculiarities have been studied by "The standard multiple-factor method of research of the personality" (PITCHES. Results. Psychological reactions for the disease have been determined. They include hypochondria, depression, psychasthenia and anxiety. Conclusion. Personal peculiarities in patients suffered from middle cerebral artery infarction may be characterized by the appearance of psychological response to the psychotraumatic situation. Therefore it is necessary to give psychotherapeutic aid.

  4. The preliminary study on peculiar flavor from irradiated dried duck

    International Nuclear Information System (INIS)

    Li Zongju; Chen Zongdao; Xu Denyi

    1992-01-01

    Peculiar flavor may be induced from irradiative preservation of meat with higher dose. The study on the irradiation of dried duck indicated that peculiar flavor is produced by a threshold of 1.5 kGy and intensifies with the increase of dose. The flavor primarily comes from muscle of dried duck especially from its water soluble protein. With the increase of dose, volatile carbonyl compounds, amines and sulfur compounds increased significantly. Paper chromatography analysis shows that two new volatile carbonyl compounds (R f =0.23 and 0.28) and a new volatile amine-propamine are induced by irradiation. This compounds may be the source of peculiar flavor in irradiated dried duck

  5. The preliminary study on peculiar flavor from irradiated dried duck

    Energy Technology Data Exchange (ETDEWEB)

    Zongju, Li; Zongdao, Chen; Denyi, Xu [Southwest Agricultural Univ., Chongqing, SC (China)

    1992-11-01

    Peculiar flavor may be induced from irradiative preservation of meat with higher dose. The study on the irradiation of dried duck indicated that peculiar flavor is produced by a threshold of 1.5 kGy and intensifies with the increase of dose. The flavor primarily comes from muscle of dried duck especially from its water soluble protein. With the increase of dose, volatile carbonyl compounds, amines and sulfur compounds increased significantly. Paper chromatography analysis shows that two new volatile carbonyl compounds (R[sub f] =0.23 and 0.28) and a new volatile amine-propamine are induced by irradiation. This compounds may be the source of peculiar flavor in irradiated dried duck.

  6. Expanding the BP1-BP2 15q11.2 Microdeletion Phenotype: Tracheoesophageal Fistula and Congenital Cataracts

    Directory of Open Access Journals (Sweden)

    D. Wong

    2013-01-01

    Full Text Available The proximal q arm of chromosome 15 contains breakpoint regions BP1–BP5 with the classic deletion of BP1–BP3 best known to be associated with Prader-Willi and Angelman syndromes. The region is approximately 500 kb and microdeletions within the BP1-BP2 region have been reported in patients with developmental delay, behavioral abnormalities, and motor apraxia as well as dysmorphic features including hypertelorism, cleft or narrow palate, ear abnormalities, and recurrent upper airway infections. We report two patients with unique, never-before-reported 15q11.2 BP1-2 microdeletion syndrome findings, one with proximal esophageal atresia and distal tracheoesophageal fistula (type C and one with congenital cataracts. Cataracts have been described in Prader-Willi syndrome but we could not find any description of cataracts in Angelman syndrome. Esophageal atresia and tracheoesophageal fistula have not been reported to our knowledge in either syndrome. A chance exists that both cases are sporadic birth defects; however, the findings of the concomitant microdeletion cannot be overlooked as a possible cause. Based on our review of the literature and the presentation of our patients, we recommend that esophageal atresia and distal tracheoesophageal fistula as well as congenital cataracts be included in the phenotypic spectrum of 15q11.2 BP1-2 microdeletion syndrome.

  7. Spectroscopic survey of Kepler stars - II. FIES/NOT observations of A- and F-type stars

    Science.gov (United States)

    Niemczura, E.; Polińska, M.; Murphy, S. J.; Smalley, B.; Kołaczkowski, Z.; Jessen-Hansen, J.; Uytterhoeven, K.; Lykke, J. M.; Triviño Hage, A.; Michalska, G.

    2017-09-01

    We have analysed high-resolution spectra of 28 A and 22 F stars in the Kepler field, observed using the Fibre-Fed Échelle Spectrograph at the Nordic Optical Telescope. We provide spectral types, atmospheric parameters and chemical abundances for 50 stars. Balmer, Fe I and Fe II lines were used to derive effective temperatures, surface gravities and microturbulent velocities. We determined chemical abundances and projected rotational velocities using a spectrum synthesis technique. Effective temperatures calculated by spectral energy distribution fitting are in good agreement with those determined from the spectral line analysis. The stars analysed include chemically peculiar stars of the Am and λ Boo types, as well as stars with approximately solar chemical abundances. The wide distribution of projected rotational velocity, vsin I, is typical for A and F stars. The microturbulence velocities obtained are typical for stars in the observed temperature and surface gravity ranges. Moreover, we affirm the results of Niemczura et al. that Am stars do not have systematically higher microturbulent velocities than normal stars of the same temperature.

  8. Tunneling in BP-MoS2 heterostructure

    Science.gov (United States)

    Liu, Xiaochi; Qu, Deshun; Kim, Changsik; Ahmed, Faisal; Yoo, Won Jong

    Tunnel field effect transistor (TFET) is considered to be a leading option for achieving SS mV/dec. In this work, black phosphorus (BP) and molybdenum disulfide (MoS2) heterojunction devices are fabricated. We find that thin BP flake and MoS2 form normal p-n junctions, tunneling phenomena can be observed when BP thickness increases to certain level. PEO:CsClO4 is applied on the surface of the device together with a side gate electrode patterned together with source and drain electrodes. The Fermi level of MoS2 on top of BP layer can be modulated by the side gating, and this enables to vary the MoS2-BP tunnel diode property from off-state to on-state. Since tunneling is the working mechanism of MoS2-BP junction, and PEO:CsClO4\\ possesses ultra high dielectric constant and small equivalent oxide thickness (EOT), a low SS of 55 mV/dec is obtained from MoS2-BP TFET. This work was supported by the Global Research Laboratory and Global Frontier R&D Programs at the Center for Hybrid Interface Materials, both funded by the Ministry of Science, ICT & Future Planning via the National Research Foundation of Korea (NRF).

  9. Peculiarities of conducting an advertising campaign of a commercial bank

    OpenAIRE

    Platonov K. A.; Glinskaya I. Yu.

    2016-01-01

    the article outlines special characteristics of banking advertising. It describes the main types of banking advertising as well as the main types of banking products and services. What is more, the authors discovered the peculiarities of advertising budgeting of a commercial bank, analyzes different methods of determining the advertising budget and controlling the work of an advertising department of a commercial bank.

  10. Psychological Peculiarities of Judge Professional Activity and Decision-Making

    Science.gov (United States)

    Uspanov, Zholdybai T.; Turabayeva, Dana S.

    2016-01-01

    The article considers the psychological peculiarities of judge professional activity and decision-making, judge's mental set and requirements to ethical and moral requirements and quality. Moreover, this work offers original job analysis and competency model of judge professional activity. The authors have studied the problems concerning the…

  11. Peculiarities of the early Universe (Universes) birth and positron annihilation

    International Nuclear Information System (INIS)

    Svetlov-Prokop'ev, E.P.

    2003-01-01

    Works on the problem of quantum birth of the Universe are reviewed. Possible peculiarities of electron-positron annihilation at the early stages of the Universe (s) birth in connection with black holes are considered. Possible concept of Eternity is discussed. (author)

  12. Phytoremediation technology: dynamic peculiarities and perspectives of further development

    International Nuclear Information System (INIS)

    Kravets', O.P.; Pavlenko, Yu.O.

    2002-01-01

    Dynamic peculiarities of soil phytoremediation have been investigated by means of mathematic models of radionuclide migration into system 'soil - plant', 'soil- many years' crops'. Modern possibilities and efficiency of phytoremediation technology has been estimated. It is calculated that only the increase of annual radionuclide release to 2 - 3 % permit to avoid the pollutant delay into topsoil during the first 8 - 10 years after fallout

  13. ANALYSIS OF DESIGN PECULIARITIES PERTAINING TO DRUMS OF CONTINUOUS MACHINES

    Directory of Open Access Journals (Sweden)

    V. Yu. Prushak

    2007-01-01

    Full Text Available The paper considers design peculiarities of belt conveyor drums in respect of their operational reliability; their advantages and disadvantages have been analyzed. There are some proposals presenting technical solutions to modernization of belt conveyor drum designs which presuppose reduction of their material consumption while preserving their strength and general rigidity. 

  14. Peculiarities of the Digital Divide in Sub-Saharan Africa

    Science.gov (United States)

    Mutula, Stephen M.

    2005-01-01

    Purpose: Seeks to argue that the peculiarities of sub-Saharan Africa, in terms of its socio-cultural diversity, low economic development, linguistic factors, HIV/AIDS pandemic, gender discrimination, low ICT awareness and so on, demand a new model of addressing the digital divide. Design/methodology/approach: Paper largely based on literature…

  15. Peculiarities of phase transformation in Ni3Fe powder alloy

    International Nuclear Information System (INIS)

    Nuzhdin, A.A.

    1990-01-01

    Ordering process in sintered powder alloy Ni 3 Fe by normal and high temperatures was studied. Thermal stresses connected with porosity level of material effect on transformation peculiarities. The changes of electric conductivity, thermal expansion coefficient, bulk modulus during transformation were studied. The analysis of this changes was made

  16. Planck intermediate results: XIII. Constraints on peculiar velocities

    DEFF Research Database (Denmark)

    Cardoso, J.-F.; Delabrouille, J.; Ganga, K.

    2014-01-01

    Using Planck data combined with the Meta Catalogue of X-ray detected Clusters of galaxies (MCXC), we address the study of peculiar motions by searching for evidence of the kinetic Sunyaev-Zeldovich effect (kSZ). By implementing various filters designed to extract the kSZ generated at the position...

  17. Civil Cases Proof Peculiarities of Road Traffic Accidents Damages

    Directory of Open Access Journals (Sweden)

    Polyakov D. N.

    2012-11-01

    Full Text Available The author reveals proof peculiarities in civil cases of reparation of damages harmed by road traffic accident, in relation to the determination of a respondent (debtor. In the article are analyzed the appropriate norms of the RF Civil code regulating the rules and conditions of civil liability for damage caused by using a transport facility as a source of danger

  18. Fracture peculiarities in ceramic tungsten at different temperatures in vacuum

    International Nuclear Information System (INIS)

    Uskov, E.I.; Babak, A.V.

    1981-01-01

    Stress-strain diagrams and results of metallographic analyses are presented for the ceramic tungsten samples tested for fracture toughness under conditions of eccentric tension at different temperatures (20...1600 deg C) in vacuum. The tungsten fracture is shown to be of brittle nature within the whole temperature range studied, but the fracture process has its own peculiarities at different test temperatures

  19. The first stars: CEMP-no stars and signatures of spinstars

    Science.gov (United States)

    Maeder, André; Meynet, Georges; Chiappini, Cristina

    2015-04-01

    Aims: The CEMP-no stars are "carbon-enhanced-metal-poor" stars that in principle show no evidence of s- and r-elements from neutron captures. We try to understand the origin and nucleosynthetic site of their peculiar CNO, Ne-Na, and Mg-Al abundances. Methods: We compare the observed abundances to the nucleosynthetic predictions of AGB models and of models of rotating massive stars with internal mixing and mass loss. We also analyze the different behaviors of α- and CNO-elements, as well the abundances of elements involved in the Ne-Na and Mg-Al cycles. Results: We show that CEMP-no stars exhibit products of He-burning that have gone through partial mixing and processing by the CNO cycle, producing low 12C/13C and a broad variety of [C/N] and [O/N] ratios. From a 12C/13C vs. [C/N] diagram, we conclude that neither the yields of AGB stars (in binaries or not) nor the yields of classic supernovae can fully account for the observed CNO abundances in CEMP-no stars. Better agreement is obtained once the chemical contribution by stellar winds of fast-rotating massive stars is taken into account, where partial mixing takes place, leading to various amounts of CNO being ejected. The [(C+N+O)/H] ratios of CEMP-no stars vary linearly with [Fe/H] above [Fe/H] = -4.0 indicating primary behavior by (C+N+O). Below [Fe/H] = -4.0, [(C+N+O)/H] is almost constant as a function of [Fe/H], implying very high [(C+N+O)/Fe] ratios up to 4 dex. In view of the timescales, such abundance ratios reflect more individual nucleosynthetic properties, rather than an average chemical evolution. The high [(C+N+O)/Fe] ratios (as well as the high [(C+N+O)/α-elements]) imply that stellar winds from partially mixed stars were the main source of these excesses of heavy elements now observed in CEMP-no stars. The ranges covered by the variations of [Na/Fe], [Mg/Fe], and [Al/Fe] are much broader than for the α-elements (with an atomic mass number above 24) and are comparable to the wide ranges covered

  20. Rayleigh scattering in the atmospheres of hot stars

    Czech Academy of Sciences Publication Activity Database

    Fišák, J.; Krtička, J.; Munzar, D.; Kubát, Jiří

    2016-01-01

    Roč. 590, June (2016), A95/1-A95/6 ISSN 0004-6361 R&D Projects: GA ČR(CZ) GA14-02385S Grant - others:GA MŠk(CZ) LM2010005 Institutional support: RVO:67985815 Keywords : atomic processes * scattering * stars: chemically peculiar Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.378, year: 2014

  1. Hearily reddened Hg-Mn star HD 29647

    International Nuclear Information System (INIS)

    Strajzhis, V.; Glagolevskij, Yu.V.; Romanyuk, I.I.; Bychkov, V.D.; AN SSSR, Nizhnij Arkhyz. Spetsial'naya Astrofizicheskaya Observatoriya)

    1982-01-01

    A heavily reddened HD 29647 (V=8sup(m).4) star is investigated using the 6-meter telescope spectrograms with dispersions 9 and 28 A/mm and photometric observations in the Vilnius seven- color system. Parameters Tsub(e)=15600 K (corresponding spectral type B5) and log g=3.70 from hydrogen lines and Balmer jump were obtained. HD 29647 is a peculiar star of the Hg-Mn type. The radial velocity of the star is+14.1+-1.0 km/s, almost identical with that of the dark Taurus cloud and its T Tauri-type variables. If the star is near the front edge of the dark cloud at the distance of 165 pc and has Esub(B-V)=1.06, its visual absolute magnitude is - 0sup(m).9. Photometric observations permit to suspect a slight varia bility in the U, P, and X colors [ru

  2. Atomic hydrogen in the Orion star-forming region

    International Nuclear Information System (INIS)

    Chromey, F.R.; Elmegreen, B.G.; Elmegreen, D.M.

    1989-01-01

    A large-scale survey of atomic hydrogen in Orion reveals low-density material with a total mass comparable to that in dense molecular clouds. The atomic gas is sufficiently dense that it can shield the molecular material from photodissociative radiation and provide a pressure link to the low-density intercloud medium. An excess of H I emission comes from photodissociation fronts near the bright stars and from a giant shell in the Orion Belt region. This shell may have caused the apparent bifurcation between the Orion A and B clouds, and the associated pressures may have induced peculiar motions and star formation in NGC 2023 and 2024. 49 refs

  3. Torsional oscillations and observed rotational period variations in early-type stars

    Czech Academy of Sciences Publication Activity Database

    Krtička, J.; Mikulášek, Z.; Henry, G.W.; Kurfürst, P.; Karlický, Marian

    2017-01-01

    Roč. 464, č. 1 (2017), s. 933-939 ISSN 0035-8711 R&D Projects: GA ČR(CZ) GA16-01116S; GA ČR GAP209/12/0103 Institutional support: RVO:67985815 Keywords : MHD * chemically peculiar stars * early-type stars Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 4.961, year: 2016

  4. UTILIZING SYNTHETIC VISIBLE SPECTRA TO EXPLORE THE PHYSICAL BASIS FOR THE CLASSIFICATION OF LAMBDA BOÖTIS STARS

    Energy Technology Data Exchange (ETDEWEB)

    Cheng, Kwang-Ping; Johnson, Dustin M.; Tarbell, Erik S.; Romo, Christopher A. [California State University, Fullerton CA (United States); Neff, James E. [College of Charleston, Charleston, SC (United States); Gray, Richard O. [Appalachian State University, Boone, NC (United States); Corbally, Christopher J. [Vatican Observatory, Tucson, AZ (United States)

    2017-01-01

    Since the peculiar nature of Lambda Boötis was first noticed in 1943, the Lambda Boo stars have been recognized as a group of peculiar A-type stars. They are Population I dwarfs that show deficiencies of iron-peak elements (up to 2 dex), but have near-solar C, N, O, and S abundances. In a previous paper, we used both observed and synthetic ultraviolet spectra to demonstrate that the C i 1657 Å/Al ii 1671 Å equivalent width ratio can help distinguish between Lambda Boo stars and other metal-weak stars hotter than 8000 K. In this paper, using observed and synthetic visible (4000–6800 Å) spectra, we demonstrate that the C i 5052.17 Å/Mg ii 4481 Å equivalent width ratio can be used as a quantitative diagnostic for cooler Lambda Boo stars.

  5. AcEST: BP912124 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D06 531 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D06. BP91212...4 CL2988Contig1 Show BP912124 Clone id YMU001_000015_D06 Library YMU01 Length 531 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D06. Accession BP912124 Tissue type prothallium Developmental stag...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912124|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D06. (531 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total

  6. AcEST: BP912125 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D07 558 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D07. BP912125 - Show BP91212...is mRNA. clone: YMU001_000015_D07. Accession BP912125 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912125|Adiantum capillus-veneris mRN...A, clone: YMU001_000015_D07. (558 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...copeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12

  7. AcEST: BP912120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D01 500 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D01. BP912120 - Show BP91212...is mRNA. clone: YMU001_000015_D01. Accession BP912120 Tissue type prothallium Developmental stage - Contig I...elated Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum Align length 130 Score (bit) 124.0 E-va...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...0|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D01. (500 letters) Database: uniprot_sprot.fasta 412

  8. AcEST: BP921212 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A09 361 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A09. BP921212 - Show BP921212...is mRNA. clone: YMU001_000147_A09. Accession BP921212 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921212|Adiantum capillus-veneris... mRNA, clone: YMU001_000147_A09. (361 letters) Database: uniprot_sprot.fasta 412,...itol-4,5-bisphosphate 3-ki... 30 2.9 sp|O14338|YB33_SCHPO Uncharacterized serine-rich protein C2F12.0... 29

  9. AcEST: BP912812 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000023_B07 575 Adiantum capillus-veneris mRNA. clone: YMU001_000023_B07. BP912812... CL2610Contig1 Show BP912812 Clone id YMU001_000023_B07 Library YMU01 Length 575 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000023_B07. Accession BP912812 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912812|Adiant...um capillus-veneris mRNA, clone: YMU001_000023_B07. (575 letters) Database: uniprot_sprot.fasta 412,525 sequ

  10. AcEST: BP912122 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D04 544 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D04. BP91212...2 CL3363Contig1 Show BP912122 Clone id YMU001_000015_D04 Library YMU01 Length 544 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D04. Accession BP912122 Tissue type prothallium Developmental stag...obium aromaticivorans (strain DSM 12444) Align length 58 Score (bit) 33.1 E-value 0.89 Report BLASTX 2.2.19 ...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912122|Adiantum

  11. AcEST: BP912127 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D09 582 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D09. BP912127 - Show BP91212...is mRNA. clone: YMU001_000015_D09. Accession BP912127 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912127|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D09. (582 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total ...p|P42825|DNAJ2_ARATH Chaperone protein dnaJ 2 OS=Arabidopsis th... 79 2e-14 sp|Q09912|PSI1_SCHPO Protein psi

  12. AcEST: BP912112 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_C08 546 Adiantum capillus-veneris mRNA. clone: YMU001_000015_C08. BP912112 - Show BP912112...is mRNA. clone: YMU001_000015_C08. Accession BP912112 Tissue type prothallium Developmental stage - Contig I...Arabidopsis thaliana Align length 171 Score (bit) 121.0 E-value 3.0e-27 Report BLASTX 2.2.19 [Nov-02-2008] R... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912112|Adiantum capillus-veneri...s mRNA, clone: YMU001_000015_C08. (546 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765

  13. AcEST: BP912412 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_G03 551 Adiantum capillus-veneris mRNA. clone: YMU001_000018_G03. BP912412... CL4248Contig1 Show BP912412 Clone id YMU001_000018_G03 Library YMU01 Length 551 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_G03. Accession BP912412 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912412|Adiantum capillus-veneris mR...NA, clone: YMU001_000018_G03. (551 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tot

  14. AcEST: BP912512 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000019_D01 513 Adiantum capillus-veneris mRNA. clone: YMU001_000019_D01. BP912512... CL17Contig1 Show BP912512 Clone id YMU001_000019_D01 Library YMU01 Length 513 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000019_D01. Accession BP912512 Tissue type prothallium Developmental stage ...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP912512|Adiantum capillus-veneris mRNA, clone: YMU0...01_000019_D01. (489 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Sear

  15. AcEST: BP912129 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D11 268 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D11. BP91212...9 CL691Contig1 Show BP912129 Clone id YMU001_000015_D11 Library YMU01 Length 268 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D11. Accession BP912129 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912129|Adiantum capillus-veneris mRNA, clo...ne: YMU001_000015_D11. (268 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total lett

  16. BP Spill in the Gulf of Mexico Sediment Data

    Data.gov (United States)

    U.S. Environmental Protection Agency — In response to the BP oil spill, EPA monitored sediment near the spill. While emergency response data collection has ended, results continue to be available on this...

  17. AcEST: BP913939 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_B01 468 Adiantum capillus-veneris mRNA. clone: YMU001_000038_B01. BP913939 - Show BP913939...is mRNA. clone: YMU001_000038_B01. Accession BP913939 Tissue type prothallium Developmental stage - Contig I...Nucleic Acids Res. 25:3389-3402. Query= BP913939|Adiantum capillus-veneris mRNA, ... F member 3... 86 9e-17 sp|Q66H39|ABCF3_RAT ATP-binding cassette sub-family F member 3 O... 85 1e-16 sp|Q5R9...aracterized ABC transporter ATP-binding... 56 6e-08 sp|P63390|YHES_ECO57 Uncharacterized ABC transporter ATP

  18. BP erioperatsioon naftalekke peatamiseks nurjus / Jürgen Tamme

    Index Scriptorium Estoniae

    Tamme, Jürgen

    2010-01-01

    Naftakompanii BP katse peatada Mehhiko lahe naftaleke ebaõnnestus, nüüd püütakse reostust peatada uue toru paigaldamise abil. USA president Barack Obama avaldas taas rahulolematust naftakompaniiga. Kaart

  19. Evaluation of the Specificity of BP3385 for Bordetella pertussis

    Science.gov (United States)

    BP3385 has been proposed as a diagnostic PCR target for discriminating between Bordetella pertussis and other Bordetella species that also infect humans. Our results demonstrate this gene is also present in some strains of Bordetella hinzii and Bordetella bronchiseptica....

  20. The Discovery of λ Bootis Stars: The Southern Survey I

    Energy Technology Data Exchange (ETDEWEB)

    Gray, R. O.; Riggs, Q. S.; Newsome, I. M. [Department of Physics and Astronomy, Appalachian State University, Boone, NC 26808 (United States); Koen, C. [Department of Statistics, University of the Western Cape, Private Bag X17, Bellville, 7535 Cape Town (South Africa); Murphy, S. J. [Sydney Institute for Astronomy (SIfA), School of Physics, University of Sydney, NSW 2006 (Australia); Corbally, C. J. [Vatican Observatory Research Group, Steward Observatory, Tucson, AZ, 85721-0065 (United States); Cheng, K.-P. [California State University, Fullerton, Fullerton, CA (United States); Neff, J. E. [National Science Foundation, Arlington, VA (United States)

    2017-07-01

    The λ Boo stars are a class of chemically peculiar Population I A-type stars characterized by under-abundances of the refractory elements, but near-solar abundances of carbon, nitrogen, oxygen, and sulfur. There is some evidence that λ Boo stars have higher frequencies of “bright” debris disks than normal A-type stars. The discovery of four exoplanets orbiting HR 8799, a λ Boo star with a resolved debris disk, suggests that the λ Boo phenomenon may be related to the presence of a dynamic debris disk, perhaps perturbed by migrating planets. However, only 64 λ Boo stars are known, and those stars were discovered with different techniques, making it problematic to use that sample for statistical purposes, including determining the frequency of debris disks. The purpose of this paper is to derive a new sample of λ Boo stars using a technique that does not lead to biases with respect to the presence of infrared excesses. Through spectroscopic observations in the southern hemisphere, we have discovered 33 λ Boo stars and have confirmed 12 others. As a step toward determining the proportion of λ Boo stars with infrared excesses, we have used WISE data to examine the infrared properties of this sample out to 22 μ m. On this basis, we cannot conclude that λ Boo stars have a greater tendency than normal A-type stars to show infrared excesses. However, observing this sample at longer wavelengths may change that conclusion, as many λ Boo debris disks are cool and do not radiate strongly at 22 μ m.

  1. The Discovery of λ Bootis Stars: The Southern Survey I

    International Nuclear Information System (INIS)

    Gray, R. O.; Riggs, Q. S.; Newsome, I. M.; Koen, C.; Murphy, S. J.; Corbally, C. J.; Cheng, K.-P.; Neff, J. E.

    2017-01-01

    The λ Boo stars are a class of chemically peculiar Population I A-type stars characterized by under-abundances of the refractory elements, but near-solar abundances of carbon, nitrogen, oxygen, and sulfur. There is some evidence that λ Boo stars have higher frequencies of “bright” debris disks than normal A-type stars. The discovery of four exoplanets orbiting HR 8799, a λ Boo star with a resolved debris disk, suggests that the λ Boo phenomenon may be related to the presence of a dynamic debris disk, perhaps perturbed by migrating planets. However, only 64 λ Boo stars are known, and those stars were discovered with different techniques, making it problematic to use that sample for statistical purposes, including determining the frequency of debris disks. The purpose of this paper is to derive a new sample of λ Boo stars using a technique that does not lead to biases with respect to the presence of infrared excesses. Through spectroscopic observations in the southern hemisphere, we have discovered 33 λ Boo stars and have confirmed 12 others. As a step toward determining the proportion of λ Boo stars with infrared excesses, we have used WISE data to examine the infrared properties of this sample out to 22 μ m. On this basis, we cannot conclude that λ Boo stars have a greater tendency than normal A-type stars to show infrared excesses. However, observing this sample at longer wavelengths may change that conclusion, as many λ Boo debris disks are cool and do not radiate strongly at 22 μ m.

  2. The Discovery of λ Bootis Stars: The Southern Survey I

    Science.gov (United States)

    Gray, R. O.; Riggs, Q. S.; Koen, C.; Murphy, S. J.; Newsome, I. M.; Corbally, C. J.; Cheng, K.-P.; Neff, J. E.

    2017-07-01

    The λ Boo stars are a class of chemically peculiar Population I A-type stars characterized by under-abundances of the refractory elements, but near-solar abundances of carbon, nitrogen, oxygen, and sulfur. There is some evidence that λ Boo stars have higher frequencies of “bright” debris disks than normal A-type stars. The discovery of four exoplanets orbiting HR 8799, a λ Boo star with a resolved debris disk, suggests that the λ Boo phenomenon may be related to the presence of a dynamic debris disk, perhaps perturbed by migrating planets. However, only 64 λ Boo stars are known, and those stars were discovered with different techniques, making it problematic to use that sample for statistical purposes, including determining the frequency of debris disks. The purpose of this paper is to derive a new sample of λ Boo stars using a technique that does not lead to biases with respect to the presence of infrared excesses. Through spectroscopic observations in the southern hemisphere, we have discovered 33 λ Boo stars and have confirmed 12 others. As a step toward determining the proportion of λ Boo stars with infrared excesses, we have used WISE data to examine the infrared properties of this sample out to 22 μm. On this basis, we cannot conclude that λ Boo stars have a greater tendency than normal A-type stars to show infrared excesses. However, observing this sample at longer wavelengths may change that conclusion, as many λ Boo debris disks are cool and do not radiate strongly at 22 μm.

  3. SPECTRAL CLASSIFICATION AND PROPERTIES OF THE O Vz STARS IN THE GALACTIC O-STAR SPECTROSCOPIC SURVEY (GOSSS)

    Energy Technology Data Exchange (ETDEWEB)

    Arias, Julia I.; Barbá, Rodolfo H.; Sabín-Sanjulián, Carolina [Departamento de Física y Astronomía, Universidad de La Serena, Av. Cisternas 1200 Norte, La Serena (Chile); Walborn, Nolan R. [Space Telescope Science Institute, 3700 San Martin Drive, MD 21218, Baltimore (United States); Díaz, Sergio Simón [Instituto de Astrofísica de Canarias, E-38200, Departamento de Astrofísica, Universidad de La Laguna, E-38205, La Laguna, Tenerife (Spain); Apellániz, Jesús Maíz [Centro de Astrobiología, CSIC-INTA, campus ESAC, Camino Bajo del Castillo s/n, E-28 692 Madrid (Spain); Gamen, Roberto C. [Instituto de Astrofísica de La Plata (CONICET, UNLP), Facultad de Ciencias Astronómicas y Geofísicas, Universidad Nacional de La Plata, Paseo del Bosque s/n, 1900 La Plata (Argentina); Morrell, Nidia I. [Las Campanas Observatory, Carnegie Observatories, Casilla 601, La Serena (Chile); Sota, Alfredo [Instituto de Astrofísica de Andalucía-CSIC, Glorieta de la Astronomía s/n, E-18 008 Granada (Spain); Marco, Amparo; Negueruela, Ignacio, E-mail: jarias@userena.cl [Departamento de Física, Ingeniería de Sistemas y Teoría de la Señal, Escuela Politécnica Superior, Universidad de Alicante, Carretera San Vicente del Raspeig s/n, E03690, San Vicente del Raspeig (Spain); and others

    2016-08-01

    On the basis of the Galactic O Star Spectroscopic Survey (GOSSS), we present a detailed systematic investigation of the O Vz stars. The currently used spectral classification criteria are rediscussed, and the Vz phenomenon is recalibrated through the addition of a quantitative criterion based on the equivalent widths of the He i λ 4471, He ii λ 4542, and He ii λ 4686 spectral lines. The GOSSS O Vz and O V populations resulting from the newly adopted spectral classification criteria are comparatively analyzed. The locations of the O Vz stars are probed, showing a concentration of the most extreme cases toward the youngest star-forming regions. The occurrence of the Vz spectral peculiarity in a solar-metallicity environment, as predicted by the fastwind code, is also investigated, confirming the importance of taking into account several processes for the correct interpretation of the phenomenon.

  4. SPECTRAL CLASSIFICATION AND PROPERTIES OF THE O Vz STARS IN THE GALACTIC O-STAR SPECTROSCOPIC SURVEY (GOSSS)

    International Nuclear Information System (INIS)

    Arias, Julia I.; Barbá, Rodolfo H.; Sabín-Sanjulián, Carolina; Walborn, Nolan R.; Díaz, Sergio Simón; Apellániz, Jesús Maíz; Gamen, Roberto C.; Morrell, Nidia I.; Sota, Alfredo; Marco, Amparo; Negueruela, Ignacio

    2016-01-01

    On the basis of the Galactic O Star Spectroscopic Survey (GOSSS), we present a detailed systematic investigation of the O Vz stars. The currently used spectral classification criteria are rediscussed, and the Vz phenomenon is recalibrated through the addition of a quantitative criterion based on the equivalent widths of the He i λ 4471, He ii λ 4542, and He ii λ 4686 spectral lines. The GOSSS O Vz and O V populations resulting from the newly adopted spectral classification criteria are comparatively analyzed. The locations of the O Vz stars are probed, showing a concentration of the most extreme cases toward the youngest star-forming regions. The occurrence of the Vz spectral peculiarity in a solar-metallicity environment, as predicted by the fastwind code, is also investigated, confirming the importance of taking into account several processes for the correct interpretation of the phenomenon.

  5. BP/Mobil. Joint-venture directions for use

    International Nuclear Information System (INIS)

    Anon.

    1997-01-01

    This paper analyzes the economical reasons which have led BP and Mobil companies to join their forces in 1996. Thanks to their complementarity and to their European implantation, the two companies could win the first or second position in petroleum products marketing in 8 European countries. The cumulated petrol sales and the number of petrol stations of the BP/Mobil joint venture are the highest in Europe (800 petrol stations in France). (J.S.)

  6. The human element of right-sizing. BP experiences

    International Nuclear Information System (INIS)

    Hollis, J.W.

    1994-01-01

    BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning

  7. Gear Fault Diagnosis Based on BP Neural Network

    Science.gov (United States)

    Huang, Yongsheng; Huang, Ruoshi

    2018-03-01

    Gear transmission is more complex, widely used in machinery fields, which form of fault has some nonlinear characteristics. This paper uses BP neural network to train the gear of four typical failure modes, and achieves satisfactory results. Tested by using test data, test results have an agreement with the actual results. The results show that the BP neural network can effectively solve the complex state of gear fault in the gear fault diagnosis.

  8. Bp'S Baku-Tbilisi-Ceyhan pipeline: the new corporate colonialism.

    Science.gov (United States)

    Marriott, James; Muttitt, Greg

    2006-01-01

    An international campaign was waged questioning the benefits of BP's Baku-Tbilisi-Ceyhan pipeline in an effort to avoid a "zone of sacrifice" there. This article is an offshoot of that effort and explains the contemporary struggle over the pipeline project. The authors describe the project's background and evaluate the actual and potential impacts of the project in which they consider eight areas. They also assess BP's capacity to confront resistance to the pipeline.

  9. The human element of right-sizing. BP experiences

    Energy Technology Data Exchange (ETDEWEB)

    Hollis, J W [BP Norge (Norway)

    1994-12-31

    BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning

  10. Life of a star

    International Nuclear Information System (INIS)

    Henbest, Nigel.

    1988-01-01

    The paper concerns the theory of stellar evolution. A description is given of:- how a star is born, main sequence stars, red giants, white dwarfs, supernovae, neutron stars and black holes. A brief explanation is given of how the death of a star as a supernova can trigger off the birth of a new generation of stars. Classification of stars and the fate of our sun, are also described. (U.K.)

  11. Massive Star Burps, Then Explodes

    Science.gov (United States)

    2007-04-01

    evolved stars that have shed their outer envelopes. Swift XRT Image Swift XRT Image (Credit: NASA / GSFC / CXC /S.Immler) Most astronomers did not expect that a massive star would explode so soon after a major outburst, or that a Wolf-Rayet star would produce such a luminous eruption, so SN 2006jc represents a puzzle for theorists. "It challenges some aspects of our current model of stellar evolution," says Foley. "We really don't know what caused this star to have such a large eruption so soon before it went supernova." "SN 2006jc provides us with an important clue that LBV-style eruptions may be related to the deaths of massive stars, perhaps more closely than we used to think," adds coauthor and UC Berkeley astronomer Nathan Smith. "The fact that we have no well-established theory for what actually causes these outbursts is the elephant in the living room that nobody is talking about." SN 2006jc occurred in galaxy UGC 4904, located 77 million light years from Earth in the constellation Lynx. The supernova explosion, a peculiar variant of a Type Ib, was first sighted by Itagaki, American amateur astronomer Tim Puckett and Italian amateur astronomer Roberto Gorelli. See also NASA Goddard press release at: http://www.nasa.gov/centers/goddard/news/topstory/ 2007/supernova_imposter.html

  12. Very massive runaway stars from three-body encounters

    Science.gov (United States)

    Gvaramadze, Vasilii V.; Gualandris, Alessia

    2011-01-01

    Very massive stars preferentially reside in the cores of their parent clusters and form binary or multiple systems. We study the role of tight very massive binaries in the origin of the field population of very massive stars. We performed numerical simulations of dynamical encounters between single (massive) stars and a very massive binary with parameters similar to those of the most massive known Galactic binaries, WR 20a and NGC 3603-A1. We found that these three-body encounters could be responsible for the origin of high peculiar velocities (≥70 km s-1) observed for some very massive (≥60-70 M⊙) runaway stars in the Milky Way and the Large Magellanic Cloud (e.g. λ Cep, BD+43°3654, Sk -67°22, BI 237, 30 Dor 016), which can hardly be explained within the framework of the binary-supernova scenario. The production of high-velocity massive stars via three-body encounters is accompanied by the recoil of the binary in the opposite direction to the ejected star. We show that the relative position of the very massive binary R145 and the runaway early B-type star Sk-69°206 on the sky is consistent with the possibility that both objects were ejected from the central cluster, R136, of the star-forming region 30 Doradus via the same dynamical event - a three-body encounter.

  13. Massive runaway stars in the Small Magellanic Cloud

    Science.gov (United States)

    Gvaramadze, V. V.; Pflamm-Altenburg, J.; Kroupa, P.

    2011-01-01

    Using archival Spitzer Space Telescope data, we identified for the first time a dozen runaway OB stars in the Small Magellanic Cloud (SMC) through the detection of their bow shocks. The geometry of detected bow shocks allows us to infer the direction of motion of the associated stars and to determine their possible parent clusters and associations. One of the identified runaway stars, AzV 471, was already known as a high-velocity star on the basis of its high peculiar radial velocity, which is offset by ≃ 40 km s-1 from the local systemic velocity. We discuss implications of our findings for the problem of the origin of field OB stars. Several of the bow shock-producing stars are found in the confines of associations, suggesting that these may be “alien” stars contributing to the age spread observed for some young stellar systems. We also report the discovery of a kidney-shaped nebula attached to the early WN-type star SMC-WR3 (AzV 60a). We interpreted this nebula as an interstellar structure created owing to the interaction between the stellar wind and the ambient interstellar medium.

  14. 4977-bp mitochondrial DNA deletion in infertile patients with varicocele.

    Science.gov (United States)

    Gashti, N G; Salehi, Z; Madani, A H; Dalivandan, S T

    2014-04-01

    Varicocele is the abnormal inflexion and distension of veins of the pampiniform plexus within spermatic cord and is one of the amendable causes of male infertility. It can increase reactive oxygen species (ROS) production in semen and cause oxidative stress. The purpose of this study was to analyse spermatozoa mtDNA 4977-bp deletion in infertile men with varicocele. To detect 4977-bp deletion in spermatozoa mtDNA, semen samples of 60 infertile patients with clinical varicocele and 90 normal men from northern Iran were prepared. After extraction of spermatozoa total DNA, Gap polymerase chain reaction (Gap PCR) was performed. 4977-bp deletion was observed in 81.66% of patients with varicocele, while approximately 15.55% of controls had this deletion. As spermatozoa from patients with varicocele had a high frequency of occurrence of 4977-bp deletion in mtDNA [OR = 24.18, 95% confidence interval (CI) = 10.15-57.57, P deletion in spermatozoa and cause infertility in north Iranian men. However, to determine the relation between sperm mtDNA 4977-bp deletion and varicocele-induced infertility, larger population-based studies are needed. It is concluded that there is an association between sperm mtDNA 4977-bp deletion and varicocele-induced infertility in the population studied. © 2013 Blackwell Verlag GmbH.

  15. Asteroseismology of δ Scuti Stars: Problems and Prospects M.-J ...

    Indian Academy of Sciences (India)

    overshoot, time dependent convection, rotation interaction with oscillation and with convection. 2.2 Oscillations δ Scuti stars are pulsating with periods of a few hours. The mechanism which excites the observed modes is similar to that of a thermal machine or heat engine in that, energy is stored in some peculiar region of ...

  16. Discovery of new magnetic early-B stars within the MiMeS HARPSpol survey

    Czech Academy of Sciences Publication Activity Database

    Alecian, E.; Kochukhov, O.; Petit, V.; Grunhut, J.; Landstreet, J.; Oksala, Mary E.; Wade, G.A.; Hussain, G.; Neiner, C.; Bohlender, D.A.

    2014-01-01

    Roč. 567, July (2014), A28/1-A28/19 ISSN 0004-6361 R&D Projects: GA ČR(CZ) GAP209/11/1198 Institutional support: RVO:67985815 Keywords : star s * magnetic field * chemically peculiar Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.378, year: 2014

  17. O stars and Wolf-Rayet stars

    International Nuclear Information System (INIS)

    Conti, P.S.; Underhill, A.B.; Jordan, S.; Thomas, R.

    1988-01-01

    Basic information is given about O and Wolf-Rayet stars indicating how these stars are defined and what their chief observable properties are. Part 2 of the volume discussed four related themes pertaining to the hottest and most luminous stars. Presented are: an observational overview of the spectroscopic classification and extrinsic properties of O and Wolf-Rayet stars; the intrinsic parameters of luminosity, effective temperature, mass, and composition of the stars, and a discussion of their viability; stellar wind properties; and the related issues concerning the efforts of stellar radiation and wind on the immediate interstellar environment are presented

  18. O stars and Wolf-Rayet stars

    Science.gov (United States)

    Conti, Peter S.; Underhill, Anne B.; Jordan, Stuart (Editor); Thomas, Richard (Editor)

    1988-01-01

    Basic information is given about O and Wolf-Rayet stars indicating how these stars are defined and what their chief observable properties are. Part 2 of the volume discussed four related themes pertaining to the hottest and most luminous stars. Presented are: an observational overview of the spectroscopic classification and extrinsic properties of O and Wolf-Rayet stars; the intrinsic parameters of luminosity, effective temperature, mass, and composition of the stars, and a discussion of their viability; stellar wind properties; and the related issues concerning the efforts of stellar radiation and wind on the immediate interstellar environment are presented.

  19. Influence of peculiarities of transition economy on real estate market

    OpenAIRE

    Venclauskienė, Deimantė; Snieška, Vytautas

    2010-01-01

    Global integration processes highlight relevance and weight of real estate market in determining economic cycle processes in different countries. Real estate market processes in countries with transition economy differ from real estate market processes in countries with developed economy in their peculiarities, possible reactions of market participators to economic shocks and consequences to country‘s economy. Common problems with property privatization, formation of legal and financial syste...

  20. The peculiar velocity of the Local Group: Pt. 3

    International Nuclear Information System (INIS)

    Staveley-Smith, L.; Davies, R.D.

    1989-01-01

    Utilizing our all-sky survey of spiral galaxies, we have derived a basic description of the extragalactic peculiar velocity field. In agreement with the results of previous authors, highly significant dipole and quadrupole terms are found. These are interpreted using a number of physically simple, but plausible models. No single attractor is able to explain all of the motions observed in nearby galaxies, but the region surrounding the Centaurus cluster appears to have the dominant effect. (author)

  1. Peculiarities of formation and sintering of fine dispersed molybdenum powders

    International Nuclear Information System (INIS)

    Kalamazov, R.U.; Pak, V.I.; Tsvetkov, Yu.V.; Lem, I.N.

    1989-01-01

    Pressing of fine dispersed Mo powders sintering of compacts in H 2 and vacuum is studied. It is shown that powder preannealing at 600 deg C in H 2 for 2 hours is necessary for formation of dense sintered compacts. Qualitatively choice of pressing conditions is possible when using electron-positron annihilation method. Peculiarities of compacting and sintering of fine- and coarse-dispersed powder mixtures are considered. The obtained results are discussed from the view point of sintering recrystallization mechanism

  2. Individually-Personal Peculiarities of Younger Preschoolers’ Speech

    Directory of Open Access Journals (Sweden)

    M E Novikova

    2013-12-01

    Full Text Available Studying the speech of the younger preschoolers is a major factor in designing educational methods and preparing children for school. There exist individual and gender differences in the way children acquire speech skills. Word comprehension and idea interpretation depend on the child’s upbringing, his or her environment, the interaction within the family. This article submits the research data obtained from the study of the individual peculiarities of the younger preschool children’s speech.

  3. Peculiar dietetic products (1900-1950 (II: scientism and advertising

    Directory of Open Access Journals (Sweden)

    Josep Boatella

    2013-09-01

    Full Text Available As a continuation of the article “Peculiar dietetic products (1850-1950” (Act Diet. 2009; 13:27-30, this paper discusses various dietetic foods developed in Spain during the period 1900-1950. This time, the uniqueness of them focuses on aspects of their formulation (unreported, doubtful effectiveness, erroneous based on current knowledge, etc.. or with the advertising strategies used.DOI: http://dx.doi.org/10.14306/renhyd.17.3.10

  4. Peculiarities of conducting an advertising campaign of a commercial bank

    Directory of Open Access Journals (Sweden)

    Platonov K. A.

    2016-05-01

    Full Text Available the article outlines special characteristics of banking advertising. It describes the main types of banking advertising as well as the main types of banking products and services. What is more, the authors discovered the peculiarities of advertising budgeting of a commercial bank, analyzes different methods of determining the advertising budget and controlling the work of an advertising department of a commercial bank.

  5. Peculiarities of the Woody Plants Re-Bloom

    OpenAIRE

    Opalko Olga Anatolievna; Opalko Anatoly Ivanovich

    2015-01-01

    The data of literary sources concerning the bloom of angiosperm plants and deviation in the development of a flower and inflorescence, in particular untimely flowering, was generalized; our observation results of some peculiarities of re-bloom of woody plants in the National Dendrological Park “Sofiyivka” of NAS of Ukraine (NDP “Sofiyivka”) were discussed. The flowering process was formed during a long-term evolution of a propagation system of angiosperm plants as a basis of fertilization and...

  6. Unsuccessful immigration: the peculiarities of homeless Lithuanians’ lives in London

    OpenAIRE

    Malinauskas, Gedas; Blažytė, Vilma

    2010-01-01

    Using the data of a pilot study, this article deals with unsuccessful cases of Lithuanian immigration, i.e., lifestyle peculiarities of Lithuanians who became homeless in the capital of Great Britain. While analyzing the phenomenon in a descriptive manner, the authors sought an answer the question of why Lithuanian emigrants who had family and work in their homeland became homeless after they had come to search for a better life. The issues of homeless Lithuanians‘ daily life and life princip...

  7. Egyptian "Star Clocks"

    Science.gov (United States)

    Symons, Sarah

    Diagonal, transit, and Ramesside star clocks are tables of astronomical information occasionally found in ancient Egyptian temples, tombs, and papyri. The tables represent the motions of selected stars (decans and hour stars) throughout the Egyptian civil year. Analysis of star clocks leads to greater understanding of ancient Egyptian constellations, ritual astronomical activities, observational practices, and pharaonic chronology.

  8. Profile of NF-κBp(65/NFκBp50) among prostate specific antigen sera levels in prostatic pathologies.

    Science.gov (United States)

    Bouraoui, Y; Ben Jemaa, A; Rodriguez, G; Ben Rais, N; Fraile, B; Paniagua, R; Sellemi, S; Royuela, M; Oueslati, R

    2012-10-01

    The aim of this work was to characterise the immunoexpression of NF-κB (p50/p65) in human prostatic pathologies and to study its profiles of activation among sera prostate specific antigen antigen (PSA) according the three groups: 0-4ng/mL, 4-20ng/mL and >20ng/mL. Twenty-four men with benign prostate hyperplasia (BPH); 19 men with prostate cancer (PC) and five men with normal prostates (NP). Immunohistochemical and western blot analysis was performed. Serum levels of PSA were assayed by immulite autoanalyser. In BPH and PC samples, immunoexpressions were observed for NF-κBp65 and NF-κBp50; while in NP samples, only were detected NF-κBp50. PC samples showed immunoreactions to NF-κBp65 and NF-κBp50 more intense (respectively 24.18±0.67 and 28.23±2.01) than that observed in BPH samples (respectively18.46±2.04 and 18.66±1.59) with special localisation in the nucleus. Different profiles of NF-κBp65 immunoexpressions were observed and BPH patients with sera PSA levels between 0-4ng/mL presented a significant weak percentage compared to BPH patients with sera PSA levels between 4-20ng/mL and >20ng/mL. No immunoreactions to NF-κBp65 were observed in PC patients with sera PSA levels between 4-20ng/mL. The sensibility of both NF-κB and PSA to inflammation allowed confirming the relationship between these two molecules and its involvement in prostatic diseases progression (inflammatory and neoplasic). Copyright © 2011 Elsevier Masson SAS. All rights reserved.

  9. Compact stars

    Science.gov (United States)

    Estevez-Delgado, Gabino; Estevez-Delgado, Joaquin

    2018-05-01

    An analysis and construction is presented for a stellar model characterized by two parameters (w, n) associated with the compactness ratio and anisotropy, respectively. The reliability range for the parameter w ≤ 1.97981225149 corresponds with a compactness ratio u ≤ 0.2644959374, the density and pressures are positive, regular and monotonic decrescent functions, the radial and tangential speed of sound are lower than the light speed, moreover, than the plausible stability. The behavior of the speeds of sound are determinate for the anisotropy parameter n, admitting a subinterval where the speeds are monotonic crescent functions and other where we have monotonic decrescent functions for the same speeds, both cases describing a compact object that is also potentially stable. In the bigger value for the observational mass M = 2.05 M⊙ and radii R = 12.957 Km for the star PSR J0348+0432, the model indicates that the maximum central density ρc = 1.283820319 × 1018 Kg/m3 corresponds to the maximum value of the anisotropy parameter and the radial and tangential speed of the sound are monotonic decrescent functions.

  10. Strömgren uvby photometry of the peculiar globular cluster NGC 2419

    Science.gov (United States)

    Frank, Matthias J.; Koch, Andreas; Feltzing, Sofia; Kacharov, Nikolay; Wilkinson, Mark I.; Irwin, Mike

    2015-09-01

    NGC 2419 is a peculiar Galactic globular cluster offset from the others in the size-luminosity diagram, and showing several chemical abundance anomalies. Here, we present Strömgren uvby photometry of the cluster. Using the gravity- and metallicity-sensitive c1 and m1 indices, we identify a sample of likely cluster members extending well beyond the formal tidal radius. The estimated contamination by cluster non-members is only one per cent, making our catalogue ideally suited for spectroscopic follow-up. We derive photometric [Fe/H] of red giants, and depending on which metallicity calibration from the literature we use, we find reasonable to excellent agreement with spectroscopic [Fe/H], both for the cluster mean metallicity and for individual stars. We demonstrate explicitly that the photometric uncertainties are not Gaussian and this must be accounted for in any analysis of the metallicity distribution function. Using a realistic, non-Gaussian model for the photometric uncertainties, we find a formal internal [Fe/H] spread of σ=0.11+0.02-0.01 dex. This is an upper limit to the cluster's true [Fe/H] spread and may partially, and possibly entirely, reflect the limited precision of the photometric metallicity estimation and systematic effects. The lack of correlation between spectroscopic and photometric [Fe/H] of individual stars is further evidence against a [Fe/H] spread on the 0.1 dex level. Finally, the CN-sensitive δ4, among other colour indices, anti-correlates strongly with magnesium abundance, indicating that the second-generation stars are nitrogen enriched. The absence of similar correlations in some other CN-sensitive indices supports the second generation being enriched in He, which in these indices approximately compensates the shift due to CN. Compared to a single continuous distribution with finite dispersion, the observed δ4 distribution of red giants is slightly better fit by two distinct populations with no internal spread, with the nitrogen

  11. Study on MPGA-BP of Gravity Dam Deformation Prediction

    Directory of Open Access Journals (Sweden)

    Xiaoyu Wang

    2017-01-01

    Full Text Available Displacement is an important physical quantity of hydraulic structures deformation monitoring, and its prediction accuracy is the premise of ensuring the safe operation. Most existing metaheuristic methods have three problems: (1 falling into local minimum easily, (2 slowing convergence, and (3 the initial value’s sensitivity. Resolving these three problems and improving the prediction accuracy necessitate the application of genetic algorithm-based backpropagation (GA-BP neural network and multiple population genetic algorithm (MPGA. A hybrid multiple population genetic algorithm backpropagation (MPGA-BP neural network algorithm is put forward to optimize deformation prediction from periodic monitoring surveys of hydraulic structures. This hybrid model is employed for analyzing the displacement of a gravity dam in China. The results show the proposed model is superior to an ordinary BP neural network and statistical regression model in the aspect of global search, convergence speed, and prediction accuracy.

  12. Preliminary Geological Findings on the BP-1 Simulant

    Science.gov (United States)

    Stoeser, D. B.; Rickman, D. L.; Wilson, S.

    2010-01-01

    A waste material from an aggregate producing quarry has been used to make an inexpensive lunar simulant called BP-1. The feedstock is the Black Point lava flow in northern Arizona. Although this is part of the San Francisco volcanic field, which is also the source of the JSC-1 series feedstock, BP-1 and JSC-1 are distinct. Chemically, the Black Point flow is an amygdaloidal nepheline-bearing basalt. The amygdules are filled with secondary minerals containing opaline silica, calcium carbonate, and ferric iron minerals. X-ray diffraction (XRD) detected approximately 3% quartz, which is in line with tests done by the Kennedy Space Center Industrial Hygiene Office. Users of this material should use appropriate protective equipment. XRD also showed the presence of significant halite and some bassanite. Both are interpreted to be evaporative residues due to recycling of wash water at the quarry. The size distribution of BP-1 may be superior to some other simulants for some applications.

  13. Neutron Stars and NuSTAR

    Science.gov (United States)

    Bhalerao, Varun

    2012-05-01

    My thesis centers around the study of neutron stars, especially those in massive binary systems. To this end, it has two distinct components: the observational study of neutron stars in massive binaries with a goal of measuring neutron star masses and participation in NuSTAR, the first imaging hard X-ray mission, one that is extremely well suited to the study of massive binaries and compact objects in our Galaxy. The Nuclear Spectroscopic Telescope Array (NuSTAR) is a NASA Small Explorer mission that will carry the first focusing high energy X-ray telescope to orbit. NuSTAR has an order-of-magnitude better angular resolution and has two orders of magnitude higher sensitivity than any currently orbiting hard X-ray telescope. I worked to develop, calibrate, and test CdZnTe detectors for NuSTAR. I describe the CdZnTe detectors in comprehensive detail here - from readout procedures to data analysis. Detailed calibration of detectors is necessary for analyzing astrophysical source data obtained by the NuSTAR. I discuss the design and implementation of an automated setup for calibrating flight detectors, followed by calibration procedures and results. Neutron stars are an excellent probe of fundamental physics. The maximum mass of a neutron star can put stringent constraints on the equation of state of matter at extreme pressures and densities. From an astrophysical perspective, there are several open questions in our understanding of neutron stars. What are the birth masses of neutron stars? How do they change in binary evolution? Are there multiple mechanisms for the formation of neutron stars? Measuring masses of neutron stars helps answer these questions. Neutron stars in high-mass X-ray binaries have masses close to their birth mass, providing an opportunity to disentangle the role of "nature" and "nurture" in the observed mass distributions. In 2006, masses had been measured for only six such objects, but this small sample showed the greatest diversity in masses

  14. Acute Toxicity and Ecological Risk Assessment of Benzophenone-3 (BP-3 and Benzophenone-4 (BP-4 in Ultraviolet (UV-Filters

    Directory of Open Access Journals (Sweden)

    Yang Du

    2017-11-01

    Full Text Available Ultraviolet (UV-absorbing chemicals (UV filters are used in personal care products for the protection of human skin and hair from damage by UV radiation. Although these substances are released into the environment in the production and consumption processes, little is known about their ecotoxicology effects. The acute toxicity and potential ecological risk of UV filters benzophenone-3 (BP-3 and benzophenone-4 (BP-4 on Chlorella vulgaris, Daphnia magna, and Brachydanio rerio were analyzed in the present study. The EC50 values (96 h of BP-3 and BP-4 on C. vulgaris were 2.98 and 201.00 mg/L, respectively. The 48 h-LC50 of BP-3 and BP-4 on D. magna were 1.09 and 47.47 mg/L, respectively. The 96 h-LC50 of BP-3 and BP-4 on B. rerio were 3.89 and 633.00 mg/L, respectively. The toxicity of a mixture of BP-3 and BP-4 on C. vulgaris, D. magna, and B. rerio all showed antagonistic effects. The induced predicted no-effect concentrations of BP-3 and BP-4 by the assessment factor method were 1.80 × 10−3 and 0.47 mg/L, respectively, by assessment factor (AF method, which were both lower than the concentrations detected in the environment at present, verifying that BP-3 and BP-4 remain low-risk chemicals to the aquatic ecosystem.

  15. 200-BP-5 operable unit treatability test report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-04-01

    The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites.

  16. 200-BP-5 operable unit Technical Baseline report

    International Nuclear Information System (INIS)

    Jacques, I.D.; Kent, S.K.

    1991-10-01

    This report supports development of a remedial investigation/feasibility study work plan for the 200-BP-5 operable unit. The report summarizes baseline information for waste sites and unplanned release sites located in the 200-BP-5 operable unit. The sites were investigated by the Technical Baseline Section of the Environmental Engineering Group, Westinghouse Hanford Company (Westinghouse Hanford). The investigation consisted of review and evaluation of current and historical Hanford Site reports, drawings, and photographs, and was supplemented with recent inspections of the Hanford Site and employee interviews. No field investigations or sampling were conducted

  17. 200-BP-5 operable unit treatability test report

    International Nuclear Information System (INIS)

    1996-04-01

    The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites

  18. HR 8844: A New Transition Object between the Am Stars and the HgMn Stars?

    Science.gov (United States)

    Monier, R.; Gebran, M.; Royer, F.; Kilicoglu, T.; Frémat, Y.

    2018-02-01

    While monitoring a sample of apparently slowly rotating superficially normal early-A stars, we have discovered that HR 8844 (A0 V) is actually a new chemically peculiar star. We first compared the high-resolution spectrum of HR 8844 with that of four slow rotators near A0V (ν Cap, ν Cnc, Sirius A, and HD 72660) to highlight similarities and differences. The lines of Ti II, Cr II, Sr II, and Ba II are conspicuous features in the high-resolution high signal-to-noise SOPHIE spectra of HR 8844 and much stronger than in the spectra of the normal star ν Cap. The Hg II line at 3983.93 Å is also present in a 3.5% blend. Selected unblended lines of 31 chemical elements from He up to Hg have been synthesized using model atmospheres computed with ATLAS9 and the spectrum synthesis code SYNSPEC48 including hyperfine structure of various isotopes when relevant. These synthetic spectra have been adjusted to the mean SOPHIE spectrum of HR 8844, and high-resolution spectra of the comparison stars. Chi-squares were minimized to derive abundances or upper limits to the abundances of these elements for HR 8844 and the comparison stars. HR 8844 is found to have underabundances of He, C, O, Mg, Ca, and Sc, mild enhancements of Ti, V, Cr, Mn, and distinct enhancements of the heavy elements Sr, Y, Zr, Ba, La, Pr, Sm, Eu, and Hg, the overabundances increasing steadily with atomic number. This chemical pattern suggests that HR 8844 may actually be a new transition object between the coolest HgMn stars and the Am stars.

  19. MASSIVE INFANT STARS ROCK THEIR CRADLE

    Science.gov (United States)

    2002-01-01

    Extremely intense radiation from newly born, ultra-bright stars has blown a glowing spherical bubble in the nebula N83B, also known as NGC 1748. A new NASA Hubble Space Telescope image has helped to decipher the complex interplay of gas and radiation of a star-forming region in a nearby galaxy. The image graphically illustrates just how these massive stars sculpt their environment by generating powerful winds that alter the shape of the parent gaseous nebula. These processes are also seen in our Milky Way in regions like the Orion Nebula. The Hubble telescope is famous for its contribution to our knowledge about star formation in very distant galaxies. Although most of the stars in the Universe were born several billions of years ago, when the Universe was young, star formation still continues today. This new Hubble image shows a very compact star-forming region in a small part of one of our neighboring galaxies - the Large Magellanic Cloud. This galaxy lies only 165,000 light-years from our Milky Way and can easily be seen with the naked eye from the Southern Hemisphere. Young, massive, ultra-bright stars are seen here just as they are born and emerge from the shelter of their pre-natal molecular cloud. Catching these hefty stars at their birthplace is not as easy as it may seem. Their high mass means that the young stars evolve very rapidly and are hard to find at this critical stage. Furthermore, they spend a good fraction of their youth hidden from view, shrouded by large quantities of dust in a molecular cloud. The only chance is to observe them just as they start to emerge from their cocoon - and then only with very high-resolution telescopes. Astronomers from France, the U.S., and Germany have used Hubble to study the fascinating interplay between gas, dust, and radiation from the newly born stars in this nebula. Its peculiar and turbulent structure has been revealed for the first time. This high-resolution study has also uncovered several individual stars

  20. GRB 110530A: Peculiar Broad Bump and Delayed Plateau in Early Optical Afterglows

    Science.gov (United States)

    Zhong, Shu-Qing; Xin, Li-Ping; Liang, En-Wei; Wei, Jian-Yan; Urata, Yuji; Huang, Kui-Yun; Qiu, Yu-Lei; Deng, Can-Min; Wang, Yuan-Zhu; Deng, Jin-Song

    2016-11-01

    We report our very early optical observations of GRB 110530A and investigate its jet properties together with its X-ray afterglow data. A peculiar broad onset bump followed by a plateau is observed in its early R band afterglow light curve. The optical data in the other bands and the X-ray data are well consistent with the temporal feature of the R band light curve. Our joint spectral fits of the optical and X-ray data show that they are in the same regime, with a photon index of ∼1.70. The optical and X-ray afterglow light curves are well fitted with the standard external shock model by considering a delayed energy injection component. Based on our modeling results, we find that the radiative efficiency of the gamma-ray burst jet is ∼ 1 % and the magnetization parameter of the afterglow jet is \\lt 0.04 with a derived extremely low {ε }B (the ratio of shock energy to the magnetic field) of (1.64+/- 0.25)× {10}-6. These results indicate that the jet may be matter dominated. A discussion on delayed energy injection from the accretion of the late fall-back material of its pre-supernova star is also presented.

  1. Bc→BP,BV Decays with the QCD Factorization Approach

    International Nuclear Information System (INIS)

    Chang, Qin; Wang, Na; Sun, Junfeng; Yang, Yueling

    2015-01-01

    We studied the nonleptonic B c →BP, BV decays with the QCD factorization approach. It is found that the Cabibbo favored processes of B c →B s π, B s ρ, B u K - are the promising decay channels with branching ratio larger than 1%, which should be observed earlier by the LHCb collaboration

  2. EST Table: BP124521 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP124521 epV32477 10/09/28 59 %/164 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 55 %/163 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1

  3. EST Table: BP123885 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP123885 epV31590 10/09/28 57 %/174 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 55 %/163 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1

  4. EST Table: BP125106 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP125106 fbpv0387 10/09/28 58 %/165 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 56 %/165 aa FBpp0212871|DsimGD14469-PA 10/08/28 n.h 10/09/1

  5. EST Table: BP125521 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP125521 fbpv0944 10/09/28 59 %/165 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 56 %/164 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1

  6. EST Table: BP125005 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP125005 fbpv0197 10/09/28 58 %/185 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 58 %/173 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1

  7. TopBP1-mediated DNA processing during mitosis.

    Science.gov (United States)

    Gallina, Irene; Christiansen, Signe Korbo; Pedersen, Rune Troelsgaard; Lisby, Michael; Oestergaard, Vibe H

    2016-01-01

    Maintenance of genome integrity is crucial to avoid cancer and other genetic diseases. Thus faced with DNA damage, cells mount a DNA damage response to avoid genome instability. The DNA damage response is partially inhibited during mitosis presumably to avoid erroneous processing of the segregating chromosomes. Yet our recent study shows that TopBP1-mediated DNA processing during mitosis is highly important to reduce transmission of DNA damage to daughter cells. (1) Here we provide an overview of the DNA damage response and DNA repair during mitosis. One role of TopBP1 during mitosis is to stimulate unscheduled DNA synthesis at underreplicated regions. We speculated that such genomic regions are likely to hold stalled replication forks or post-replicative gaps, which become the substrate for DNA synthesis upon entry into mitosis. Thus, we addressed whether the translesion pathways for fork restart or post-replicative gap filling are required for unscheduled DNA synthesis in mitosis. Using genetics in the avian DT40 cell line, we provide evidence that unscheduled DNA synthesis in mitosis does not require the translesion synthesis scaffold factor Rev1 or PCNA ubiquitylation at K164, which serve to recruit translesion polymerases to stalled forks. In line with this finding, translesion polymerase η foci do not colocalize with TopBP1 or FANCD2 in mitosis. Taken together, we conclude that TopBP1 promotes unscheduled DNA synthesis in mitosis independently of the examined translesion polymerases.

  8. EST Table: BP117517 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP117517 ce--0464 10/09/28 63 %/173 aa ref|XP_002092422.1| GE14184 [Drosophila yakuba] gb|EDW92134.1| GE14...184 [Drosophila yakuba] 10/08/28 63 %/173 aa FBpp0259194|DyakGE14184-PA 10/08/28 35 %

  9. EST Table: BP121749 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP121749 ceN-5256 10/09/28 100 %/172 aa ref|NP_001036831.1| saposin-related [Bombyx...|GB16561-PA 10/09/10 44 %/178 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS791050 ceN- ...

  10. EST Table: BP121763 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP121763 ceN-5273 10/09/28 99 %/184 aa ref|NP_001036831.1| saposin-related [Bombyx ...GB16561-PA 10/09/10 43 %/192 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS791050 ceN- ...

  11. Note: Primer Amysat 001; Fragment size is 211bp

    Indian Academy of Sciences (India)

    Renuka

    Bhandara : Lanes 1–14 represent different strains of Bhandara Ecorace. Note: Primer Amysat 001; Fragment size is 211bp. Fig. 1. SSR profiles generated from genomic DNA of 16 strains from different individuals of (A.L, D. TV, D. BV, Modal, Sukinda, Raily, Bhandara) ecoraces of tasar silk worm, Antheraea mylitta using the.

  12. EST Table: BP182610 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP182610 NRPG0829 10/09/28 35 %/122 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...nl|Amel|GB19565-PA 10/09/10 35 %/122 aa gi|91093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 NRPG ...

  13. EST Table: BP121050 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP121050 ceN-4078 10/09/28 35 %/122 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...nl|Amel|GB19565-PA 10/09/10 35 %/122 aa gi|91093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 ceN- ...

  14. PM : Cabinet likely to choose TNK-BP

    Index Scriptorium Estoniae

    2005-01-01

    Tõenäoliselt saab Mazeikiu Nafta aktsiate ostjaks Suurbritannia-Vene ettevõte TNK-BP. Endiselt soovib ka Leedu Jukose osa naftakompaniist osta, kuid selleks raha laenamine võib mõjutada riigi majandust ja üleminekut eurole

  15. Cabinet chooses TNK-BP, but doors remain open

    Index Scriptorium Estoniae

    2005-01-01

    Leedu valitsus alustab Vene-Suurbritannia ühisfirmaga TNK-BP läbirääkimisi Mazeikiu Nafta aktsiaenamuse omandamiseks. Kuid samal ajal on võimalik alustada läbirääkimisi ka teiste võimalike investoritega

  16. Low resolution spectroscopic investigation of Am stars using Automated method

    Science.gov (United States)

    Sharma, Kaushal; Joshi, Santosh; Singh, Harinder P.

    2018-04-01

    The automated method of full spectrum fitting gives reliable estimates of stellar atmospheric parameters (Teff, log g and [Fe/H]) for late A, F, G, and early K type stars. Recently, the technique was further improved in the cooler regime and the validity range was extended up to a spectral type of M6 - M7 (Teff˜ 2900 K). The present study aims to explore the application of this method on the low-resolution spectra of Am stars, a class of chemically peculiar stars, to examine its robustness for these objects. We use ULySS with the Medium-resolution INT Library of Empirical Spectra (MILES) V2 spectral interpolator for parameter determination. The determined Teff and log g values are found to be in good agreement with those obtained from high-resolution spectroscopy.

  17. Rates of star formation

    International Nuclear Information System (INIS)

    Larson, R.B.

    1977-01-01

    It is illustrated that a theoretical understanding of the formation and evolution of galaxies depends on an understanding of star formation, and especially of the factors influencing the rate of star formation. Some of the theoretical problems of star formation in galaxies, some approaches that have been considered in models of galaxy evolution, and some possible observational tests that may help to clarify which processes or models are most relevant are reviewed. The material is presented under the following headings: power-law models for star formation, star formation processes (conditions required, ways of achieving these conditions), observational indications and tests, and measures of star formation rates in galaxies. 49 references

  18. Energy production in stars

    International Nuclear Information System (INIS)

    Bethe, Hans.

    1977-01-01

    Energy in stars is released partly by gravitation, partly by nuclear reactions. For ordinary stars like our sun, nuclear reactions predominate. However, at the end of the life of a star very large amounts of energy are released by gravitational collapse; this can amount to as much as 10 times the total energy released nuclear reactions. The rotational energy of pulsars is a small remnant of the energy of gravitation. The end stage of small stars is generally a white dwarf, of heavy stars a neutron star of possibly a black hole

  19. Movimientos peculiares de galaxias en el Universo cercano

    Science.gov (United States)

    Alonso, M. V.

    Se presenta un resumen de los resultados más importantes obtenidos en los últimos años sobre movimientos peculiares en el Universo Cercano. En el escenario de inestabilidad gravitacional, el campo de velocidades peculiares es una herramienta muy útil para estimar las fluctuaciones en la distribución de masa que generan los movimientos observados. Esta aproximación puede, además, ser utilizada para poner restricciones al espectro de potencia de la masa, a la relación entre las distribuciones de galaxias y de materia y al valor del parámetro de densidad cosmológico, Ω, a grandes escalas. Son además presentados una reconstrucción preliminar de los campos de densidad de masa y velocidades peculiares en el universo cercano usando nuevas medidas de distancias obtenidas con la relación Dn - σ, para una muestra de galaxias elípticas y lenticulares. Dos subestructuras prominentes son encontradas en la región del Gran Atractor, que corresponden a los complejos de Centaurus y Pavo--Indus. Estos últimos, junto a los complejos de Perseus--Piscis y Cetus parecen ser importantes estructuras que determinan el flujo global. El patrón obtenido a través de una muestra de galaxias elípticas muestra variaciones con respecto al obtenido por galaxias espirales. Estos nuevos resultados muestran una coherencia menor en el flujo global, cuando son comparados con resultados obtenidos anteriormente.

  20. Regular Generalized Star Star closed sets in Bitopological Spaces

    OpenAIRE

    K. Kannan; D. Narasimhan; K. Chandrasekhara Rao; R. Ravikumar

    2011-01-01

    The aim of this paper is to introduce the concepts of τ1τ2-regular generalized star star closed sets , τ1τ2-regular generalized star star open sets and study their basic properties in bitopological spaces.

  1. Effect of nutrition peculiarities on 137Cs uptake

    International Nuclear Information System (INIS)

    Knizhnikov, V.A.; Marej, A.N.; Borisov, B.K.; Petukhova, Eh.V.

    1980-01-01

    Reasons for different 137 Cs uptake from diets of the vegetable-animal type are studied. Indexes of accumulation multiplicity for Moscow and the Byelorussian-Ukrainian wooded district are compared. 137 Cs buildup levels in the organism of the USSR and the USA population are presented. The most probable reason for peculiarities in 137 Cs uptake from various types of diet, as well as the reason for the alterations in the uptake of this radionuclide from the diet of the same type, is the non-uniformity of 137 Cs contribution of aerial and nonaerial origin

  2. Psychological Peculiarities of Teachers with Different Work Capacity Levels

    Directory of Open Access Journals (Sweden)

    O. I. Dorogina

    2012-01-01

    Full Text Available The paper considers the issue of teacher’s work capacity optimization. The research is aimed at defining teachers’ psychological peculiarities relating to their work capacity level and creating the assistance program for its optimization. In the course of the program implementation, its effectiveness has being proved, the low work capacity being optimized by developing self-control, emotional stability and decreasing the aggressive reactions in frustrating situations. The research findings can be applied while creating programs for teachers’ further training as well as for students training courses. 

  3. Some Peculiarities of Newton-Hooke Space-Times

    OpenAIRE

    Tian, Yu

    2011-01-01

    Newton-Hooke space-times are the non-relativistic limit of (anti-)de Sitter space-times. We investigate some peculiar facts about the Newton-Hooke space-times, among which the "extraordinary Newton-Hooke quantum mechanics" and the "anomalous Newton-Hooke space-times" are discussed in detail. Analysis on the Lagrangian/action formalism is performed in the discussion of the Newton-Hooke quantum mechanics, where the path integral point of view plays an important role, and the physically measurab...

  4. Peculiar features in formation of diffusion layer properties during nitridation

    International Nuclear Information System (INIS)

    Gulyaev, A.P.; Konoval'tsev, V.I.; Nikitin, V.V.

    1983-01-01

    Peculiarities of the formation of multiphase nitridated layer at samples of commercial iron, 20, 40Kh and 38KhMYu6A steels are studied with the help of high-temperature methods of investigation (X-ray diffraction analysis, hardening and thickness measuring). It is found out that during the saturation the solid solution oversaturated with nitrogen is formed; some increase in hardness in the process is a result of solid solution hardening and the increase of thickness of nitride zone; however the main growth of the layer hardness is achieved during the cooling as a result of α phase precipitating hardening

  5. Peculiarities of roentgenosemiotics of ulcerous disease in different age groups

    International Nuclear Information System (INIS)

    Kinoshenko, Yu.T.; Reztsova, N.S.

    1984-01-01

    Roentgenomorphological and functional signs of stomach and duodenum ulcer disease was studied in different age groups in 382 patients that were subjected to a complex of clinico-laboratory and roentgenological examinations. It is concluded that in different age groups ulcerous disease of stomach and duodenum is characterized by a considerable peculiarities of roengenomorphologic characters. In some age groups disclosed are characteristic symptomocomplexes of roentgenofunctional shifts typical of ulcers of different localisations. It is shown that there is a regular relation between the type of functional shifts, age of a patient and location of ulcers

  6. Peculiarities of the ionosphere monitoring from low-flying satellites

    International Nuclear Information System (INIS)

    Danilkin, N.P.; Denisenko, P.F.; Mal'tseva, O.A.

    1998-01-01

    Peculiarities of the HF-radiowave propagation between ground stations and low-flying satellites near and below the maximum of the F area are studied through the method of mathematical modeling. It is established that the signal may propagate by three trajectories. The first one is below the satellite orbit. The turn altitudes of the second and the third beams are above the satellite orbit. Availability of three trajectories leads to the three-digit dependence of the group ways on the working frequency F. The P(f) curves for different satellite distances from a reception point and its orbit altitudes for the isotropic and magnetoactive ionosphere are presented

  7. Quark core stars, quark stars and strange stars

    International Nuclear Information System (INIS)

    Grassi, F.

    1988-01-01

    A recent one flavor quark matter equation of state is generalized to several flavors. It is shown that quarks undergo a first order phase transition. In addition, this equation of state depends on just one parameter in the two flavor case, two parameters in the three flavor case, and these parameters are constrained by phenomenology. This equation of state is then applied to the hadron-quark transition in neutron stars and the determination of quark star stability, the investigation of strange matter stability and possible strange star existence. 43 refs., 6 figs

  8. 76 FR 69712 - Application To Export Electric Energy; BP Energy Company

    Science.gov (United States)

    2011-11-09

    ... DEPARTMENT OF ENERGY [OE Docket No. EA-315-A] Application To Export Electric Energy; BP Energy.... SUMMARY: BP Energy Company (BP Energy) has applied to renew its authority to transmit electric energy from... BP Energy to transmit electric energy from the United States to Canada as a power marketer for a five...

  9. ENERGY STAR Certified Displays

    Data.gov (United States)

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 7.0 ENERGY STAR Program Requirements for Displays that are effective as of July 1, 2016....

  10. ENERGY STAR Certified Boilers

    Data.gov (United States)

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 3.0 ENERGY STAR Program Requirements for Boilers that are effective as of October 1,...

  11. ENERGY STAR Certified Televisions

    Data.gov (United States)

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 7.0 ENERGY STAR Program Requirements for Televisions that are effective as of October 30,...

  12. ENERGY STAR Certified Dehumidifiers

    Data.gov (United States)

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 4.0 ENERGY STAR Program Requirements for Dehumidifiers that are effective as of October...

  13. ENERGY STAR Certified Telephones

    Data.gov (United States)

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 3.0 ENERGY STAR Program Requirements for Telephony (cordless telephones and VoIP...

  14. Wolf-Rayet stars

    Energy Technology Data Exchange (ETDEWEB)

    Sahade, J

    1981-12-01

    Aspects of the problems of the Wolf-Rayet stars related to their chemical composition, their evolutionary status, and their apparent dichotomy in two spectral sequences are discussed. Dogmas concerning WR stars are critically discussed, including the belief that WR stars lack hydrogen, that they are helium stars evolved from massive close binaries, and the existence of a second WR stage in which the star is a short-period single-lined binary. The relationship of WR stars with planetary nebulae is addressed, as is the membership of these stars in clusters and associations. The division of WR stars into WN and WC sequences is considered, questioning the reasonability of accounting for WR line formation in terms of abundance differences.

  15. Star formation: Cosmic feast

    Science.gov (United States)

    Scaringi, Simone

    2017-03-01

    Low-mass stars form through a process known as disk accretion, eating up material that orbits in a disk around them. It turns out that the same mechanism also describes the formation of more massive stars.

  16. Peculiarities of formation of accounting policy of the catering company

    Directory of Open Access Journals (Sweden)

    I.M. Vygivska

    2018-04-01

    Full Text Available Restaurant business in Ukraine is developing quite dynamically. Today, services of off-premise catering have become an integral part of each business process. Insufficient level of theoretical and practical developments of domestic scientists in catering actualizes the study of the organization of their accounting process. The article investigates one of the newest Ukrainian market restaurant services i.e. catering. We determined that catering is a service activity sphere of the restaurant business, the purpose of which is to satisfy social and personal needs of the population. Thus, the main peculiarity of catering is outdoor servicing in the places selected by the customers of catering services. Two catering areas are pointed out: corporate services and individual services that affect the organization of accounting processes. The article presents the author's position regarding the allocation of the individual accounting policies of the catering company in which it is necessary to provide the specifics of the inventory and containers, their revaluation, product losses, discounts and loyalty programs, pricing, direct and indirect cost structure, peculiarities of their distribution, methods of cost accounting and calculation, etc.

  17. The regulation of peculiarities of electronic contracting: comparative analysis

    Directory of Open Access Journals (Sweden)

    Наталія Юліївна Філатова

    2017-12-01

    Full Text Available Contract formation by electronic means nowadays is a widespread phenomenon. Nevertheless electronic contracting has been thoroughly explored by scholars all over the world and regulated both internationally and domestically, there still remain some issues which need to be carefully analyzed. In our view, the most essential question raised by electronic contracting is whether there is a need to amend substantial contract law provisions with regard to peculiarities of contracts concluded by electronic means. Seeking the answer to this question several approaches have been formulated, but none of them seems to be completely appropriate. In this paper the answer is also attempted to be found. For this purpose a comparative analysis of doctrine, legislation and judicial practice of certain states is performed. Particularly, offer, acceptance and moment of electronic contract formation are explored. On the basis of this research the following conclusion is done: amendments to substantial contract law provisions are not always necessary to improve the regulation of electronic contracting. Nevertheless the provisions of law should be applied correctly to the disputes arising from electronic contract formation taking into account the peculiarities of such contracts.

  18. The Peculiarities of the Outbound Tourist Market of China

    Directory of Open Access Journals (Sweden)

    Romanova Anna A.

    2017-12-01

    Full Text Available The outbound tourist market of China was analyzed as the priority target audience of consumers of the Ukrainian tourism product. A wording of the diplomatic preconditions for development of tourism relations with the People’s Republic of China and the partner countries of the economic and humanitarian project «One Belt, One Way» has been provided. The main characteristics of the outbound Chinese tourist market have been allocated and researched: hyper size; significant purchasing power; sustained growth pace; priority of Asian destinations, at the same time emergence of interest in the EU and Russia; organization, group character; seasonality; short-term traveling; cluster (combined travels; predominance of women tourists; priority of on-line booking of tours; peculiarities of travel behavior; predominance of certain types of tourism; preference of national Chinese cuisine, etc. These peculiarities of the Chinese outbound tourist market must be considered when developing tourism product for the Chinese and creating a strategy to increase the tourist flows from China to any destination and tourism facility. Recommendations for the entities of tourism activity which plan to work with the Chinese consumer of the national tourism product have been formulated.

  19. The effect of peculiar velocities on supernova cosmology

    DEFF Research Database (Denmark)

    Davis, Tamara Maree; Hui, Lam; Frieman, Joshua A.

    2011-01-01

    We analyze the effect that peculiar velocities have on the cosmological inferences we make using luminosity distance indicators, such as Type Ia supernovae. In particular we study the corrections required to account for (1) our own motion, (2) correlations in galaxy motions, and (3) a possible lo...... when future surveys aim for percent-level accuracy and we recommend our statistical approach to down-weighting peculiar velocities as a more robust option than a sharp low-redshift cut....... local under- or overdensity. For all of these effects we present a case study showing the impact on the cosmology derived by the Sloan Digital Sky Survey-II Supernova Survey (SDSS-II SN Survey). Correcting supernova (SN) redshifts for the cosmic microwave background (CMB) dipole slightly overcorrects...... nearby SNe that share some of our local motion. We show that while neglecting the CMB dipole would cause a shift in the derived equation of state of ¿w ~ 0.04 (at fixed O m ), the additional local-motion correction is currently negligible (¿w

  20. Autonomous Star Tracker Algorithms

    DEFF Research Database (Denmark)

    Betto, Maurizio; Jørgensen, John Leif; Kilsgaard, Søren

    1998-01-01

    Proposal, in response to an ESA R.f.P., to design algorithms for autonomous star tracker operations.The proposal also included the development of a star tracker breadboard to test the algorithms performances.......Proposal, in response to an ESA R.f.P., to design algorithms for autonomous star tracker operations.The proposal also included the development of a star tracker breadboard to test the algorithms performances....

  1. Infrared properties of Mira-type variables and other cool stars as determined from JHKL photometry

    Energy Technology Data Exchange (ETDEWEB)

    Feast, M W; Robertson, B S.C.; Catchpole, R M; Evans, T L; Glass, I S; Carter, B S [South African Astronomical Observatory, Cape

    1982-11-01

    Extensive infrared photometry of Me(Mira) variables and of C, S, SC and related stars is used to establish two-colour diagrams and period-colour relations. The characteristic areas in these plots occupied by the different classes of objects are delineated. The main aim is to provide a norm with which other stars (e.g. red variables in the Galactic Center and in the Magellanic Clouds and peculiar stars) can be compared. The (J-H) versus period relation offers a method for determining the interstellar reddenings of Me variables. The strong concentration to the longer periods of Miras which are OH masers is probably due primarily to the fact that in the sample surveyed, these stars also have the brightest apparent bolometric magnitudes. Period-amplitude plots are shown for Me variables. The Mira components in symbiotic stars are found to have exceptionally large amplitudes.

  2. Covering tree with stars

    DEFF Research Database (Denmark)

    Baumbach, Jan; Guo, Jian-Ying; Ibragimov, Rashid

    2013-01-01

    We study the tree edit distance problem with edge deletions and edge insertions as edit operations. We reformulate a special case of this problem as Covering Tree with Stars (CTS): given a tree T and a set of stars, can we connect the stars in by adding edges between them such that the resulting ...

  3. America's Star Libraries

    Science.gov (United States)

    Lyons, Ray; Lance, Keith Curry

    2009-01-01

    "Library Journal"'s new national rating of public libraries, the "LJ" Index of Public Library Service, identifies 256 "star" libraries. It rates 7,115 public libraries. The top libraries in each group get five, four, or three Michelin guide-like stars. All included libraries, stars or not, can use their scores to learn from their peers and improve…

  4. Microdeletion/microduplication of proximal 15q11.2 between BP1 and BP2: a susceptibility region for neurological dysfunction including developmental and language delay.

    Science.gov (United States)

    Burnside, Rachel D; Pasion, Romela; Mikhail, Fady M; Carroll, Andrew J; Robin, Nathaniel H; Youngs, Erin L; Gadi, Inder K; Keitges, Elizabeth; Jaswaney, Vikram L; Papenhausen, Peter R; Potluri, Venkateswara R; Risheg, Hiba; Rush, Brooke; Smith, Janice L; Schwartz, Stuart; Tepperberg, James H; Butler, Merlin G

    2011-10-01

    The proximal long arm of chromosome 15 has segmental duplications located at breakpoints BP1-BP5 that mediate the generation of NAHR-related microdeletions and microduplications. The classical Prader-Willi/Angelman syndrome deletion is flanked by either of the proximal BP1 or BP2 breakpoints and the distal BP3 breakpoint. The larger Type I deletions are flanked by BP1 and BP3 in both Prader-Willi and Angelman syndrome subjects. Those with this deletion are reported to have a more severe phenotype than individuals with either Type II deletions (BP2-BP3) or uniparental disomy 15. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes that are not imprinted. Reports of mutations or disturbed expression of these genes appear to impact behavioral and neurological function in affected individuals. Recently, reports of deletions and duplications flanked by BP1 and BP2 suggest an association with speech and motor delays, behavioral problems, seizures, and autism. We present a large cohort of subjects with copy number alteration of BP1 to BP2 with common phenotypic features. These include autism, developmental delay, motor and language delays, and behavioral problems, which were present in both cytogenetic groups. Parental studies demonstrated phenotypically normal carriers in several instances, and mildly affected carriers in others, complicating phenotypic association and/or causality. Possible explanations for these results include reduced penetrance, altered gene dosage on a particular genetic background, or a susceptibility region as reported for other areas of the genome implicated in autism and behavior disturbances.

  5. Validation of the Welch Allyn SureBP (inflation) and StepBP (deflation) algorithms by AAMI standard testing and BHS data analysis.

    Science.gov (United States)

    Alpert, Bruce S

    2011-04-01

    We evaluated two new Welch Allyn automated blood pressure (BP) algorithms. The first, SureBP, estimates BP during cuff inflation; the second, StepBP, does so during deflation. We followed the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard for testing and data analysis. The data were also analyzed using the British Hypertension Society analysis strategy. We tested children, adolescents, and adults. The requirements of the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard were fulfilled with respect to BP levels, arm sizes, and ages. Association for the Advancement of Medical Instrumentation SP10 Method 1 data analysis was used. The mean±standard deviation for the device readings compared with auscultation by paired, trained, blinded observers in the SureBP mode were -2.14±7.44 mmHg for systolic BP (SBP) and -0.55±5.98 mmHg for diastolic BP (DBP). In the StepBP mode, the differences were -3.61±6.30 mmHg for SBP and -2.03±5.30 mmHg for DBP. Both algorithms achieved an A grade for both SBP and DBP by British Hypertension Society analysis. The SureBP inflation-based algorithm will be available in many new-generation Welch Allyn monitors. Its use will reduce the time it takes to estimate BP in critical patient care circumstances. The device will not need to inflate to excessive suprasystolic BPs to obtain the SBP values. Deflation is rapid once SBP has been determined, thus reducing the total time of cuff inflation and reducing patient discomfort. If the SureBP fails to obtain a BP value, the StepBP algorithm is activated to estimate BP by traditional deflation methodology.

  6. BP-Mobil partnership. The common network takes place

    International Nuclear Information System (INIS)

    Anon.

    1997-01-01

    After the partnership between BP and Mobil was signed, the program of transformation of the petrol stations network started in November 1996 in the UK and concern 3300 stations in Europe and 800 stations in France. About 9100 stations will be transformed by the end of 1998. BP France is the operator for petroleum products (petrol, fuel, bitumens, LPG..) with a 70% share holding (30% for Mobil) while Mobil is the major shareholder (51%) for the lubricants and special products activities. The chemical, aviation nd maritime activities are not concerned. Thanks to the fusion of their down-file activities in Europe, the benefits of the partnership should reach 600 to 700 million of US Dollars each year. However the restructuring cost should reach 740 millions of US Dollars in two years, which doubles the initial estimation. Short paper. (J.S.)

  7. EST Table: BP183868 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP183868 P5PG0462 10/09/28 50 %/126 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti] 10/08/29 ...33738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 P5PG ...

  8. EST Table: BP126151 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP126151 ps4M0084 10/09/28 52 %/232 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti] 10/08/29 ...33738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 ps4M ...

  9. EST Table: BP182659 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP182659 NRPG0886 10/09/28 51 %/153 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti] 10/08/29 ...33738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 NRPG ...

  10. Bank Organizational Structure Choice Dilemma. Case of PKO BP

    Directory of Open Access Journals (Sweden)

    Adam Szafarczyk

    2008-06-01

    Full Text Available Organizational structures are differing for different banks. They depend on individual bank economic situation, its technology, strategy and form of competition struggle. Usually the biggest EU banks are consists from formally or really independent divisions. The most common divisions are Retail Banking, Corporate Banking, Treasury and Investment, sometimes Insurance. PKO BP, the biggest Polish Bank, ought to change its structure due to implementation new IT system.

  11. EST Table: BP125370 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 10 56 %/150 aa gi|189241063|ref|XP_967018.2| PREDICTED: similar to restin (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] FS906662 fbpv ... ...n (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] 10/08/29 55...BP125370 fbpv0758 10/09/28 56 %/150 aa ref|XP_967018.2| PREDICTED: similar to resti

  12. EST Table: BP182152 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP182152 NRPG0186 10/09/28 87 %/125 aa ref|NP_001098702.1| nanos-like protein [Bomb...yx mori] gb|ABS17681.1| nanos-like protein [Bombyx mori] 10/08/29 low homology 10/08/28 n.h 10/09/10 low homology 10/09/10 low homology 10/09/10 low homology NM_001105232 NRPG ...

  13. BP Canada Energy Company energy efficiency and GHG reduction opportunities

    Energy Technology Data Exchange (ETDEWEB)

    Forsyth, B. [BP Canada Energy Company, Calgary, AB (Canada)

    2004-07-01

    This paper presented an outline of the BP Canada Energy Company's energy efficiency program, which uses an innovative approach that relies on front line operations staff to generate, evaluate and implement ideas for energy reduction projects. An outline of the organization team was presented, with details of the small central Calgary group responsible for coordination, technical support and tracking of data. Key objectives of the team were identified as: the promotion of energy efficiency; sharing of best practices; and coordination of efforts at operations at both the development and corporate level. An outline of BP upstream operations and emissions reduction strategies was provided along with a timeline of BP Canada greenhouse gas (GHG) emissions and sustainable reductions projects. A chart representing energy savings through conversion to natural gas was also presented, sorted by project type. Results included over 400 GHG or energy reduction projects completed, with an average pay out of 30 months as well as 300,000 tonnes equivalent of GHGs reduced at an estimated value of of $13,000,000. Areas of focus for future projects include: compression; fired equipment; flaring; venting; and fugitive emissions. Strategies to reduce emissions in all areas of future research were also provided. tabs, figs.

  14. White Dwarf Stars

    OpenAIRE

    Kepler, S. O.; Romero, Alejandra Daniela; Pelisoli, Ingrid; Ourique, Gustavo

    2017-01-01

    White dwarf stars are the final stage of most stars, born single or in multiple systems. We discuss the identification, magnetic fields, and mass distribution for white dwarfs detected from spectra obtained by the Sloan Digital Sky Survey up to Data Release 13 in 2016, which lead to the increase in the number of spectroscopically identified white dwarf stars from 5000 to 39000. This number includes only white dwarf stars with log g >= 6.5 stars, i.e., excluding the Extremely Low Mass white dw...

  15. Rotating Stars in Relativity

    Directory of Open Access Journals (Sweden)

    Stergioulas Nikolaos

    2003-01-01

    Full Text Available Rotating relativistic stars have been studied extensively in recent years, both theoretically and observationally, because of the information they might yield about the equation of state of matter at extremely high densities and because they are considered to be promising sources of gravitational waves. The latest theoretical understanding of rotating stars in relativity is reviewed in this updated article. The sections on the equilibrium properties and on the nonaxisymmetric instabilities in f-modes and r-modes have been updated and several new sections have been added on analytic solutions for the exterior spacetime, rotating stars in LMXBs, rotating strange stars, and on rotating stars in numerical relativity.

  16. Nuclear physics of stars

    CERN Document Server

    Iliadis, Christian

    2015-01-01

    Most elements are synthesized, or ""cooked"", by thermonuclear reactions in stars. The newly formed elements are released into the interstellar medium during a star's lifetime, and are subsequently incorporated into a new generation of stars, into the planets that form around the stars, and into the life forms that originate on the planets. Moreover, the energy we depend on for life originates from nuclear reactions that occur at the center of the Sun. Synthesis of the elements and nuclear energy production in stars are the topics of nuclear astrophysics, which is the subject of this book

  17. UTILIZING SYNTHETIC UV SPECTRA TO EXPLORE THE PHYSICAL BASIS FOR THE CLASSIFICATION OF LAMBDA BOÖTIS STARS

    Energy Technology Data Exchange (ETDEWEB)

    Cheng, Kwang-Ping; Johnson, Dustin M.; Tarbell, Erik S.; Romo, Christopher A.; Prabhaker, Arvind [Cal. State Univ., Fullerton, Fullerton, CA (United States); Neff, James E.; Steele, Patricia A. [College of Charleston, Charleston, SC (United States); Gray, Richard O. [Appalachian State Univ., Boone, NC (United States); Corbally, Christopher J. [Vatican Observatory, Tucson, AZ (United States)

    2016-04-15

    Lambda Boo-type stars are a group of late B to early F-type Population I dwarfs that show mild to extreme deficiencies of iron-peak elements (up to 2 dex), but their C, N, O, and S abundances are near solar. This intriguing stellar class has recently regained the spotlight because of the directly imaged planets around a confirmed Lambda Boo star, HR 8799, and a suggested Lambda Boo star, Beta Pictoris. The discovery of a giant asteroid belt around Vega, another possible Lambda Boo star, also suggests hidden planets. The possible link between Lambda Boo stars and planet-bearing stars motivates us to study Lambda Boo stars systematically. Since the peculiar nature of the prototype Lambda Boötis was first noticed in 1943, Lambda Boo candidates published in the literature have been selected using widely different criteria. In order to determine the origin of Lambda Boo stars’ unique abundance pattern and to better discriminate between theories explaining the Lambda Boo phenomenon, a consistent working definition of Lambda Boo stars is needed. We have re-evaluated all published Lambda Boo candidates and their available ultraviolet and visible spectra. In this paper, using observed and synthetic spectra, we explore the physical basis for the classification of Lambda Boo stars, and develop quantitative criteria that discriminate metal-poor stars from bona fide Lambda Boo stars. Based on these stricter Lambda Boo classification criteria, we conclude that neither Beta Pictoris nor Vega should be classified as Lambda Boo stars.

  18. UTILIZING SYNTHETIC UV SPECTRA TO EXPLORE THE PHYSICAL BASIS FOR THE CLASSIFICATION OF LAMBDA BOÖTIS STARS

    International Nuclear Information System (INIS)

    Cheng, Kwang-Ping; Johnson, Dustin M.; Tarbell, Erik S.; Romo, Christopher A.; Prabhaker, Arvind; Neff, James E.; Steele, Patricia A.; Gray, Richard O.; Corbally, Christopher J.

    2016-01-01

    Lambda Boo-type stars are a group of late B to early F-type Population I dwarfs that show mild to extreme deficiencies of iron-peak elements (up to 2 dex), but their C, N, O, and S abundances are near solar. This intriguing stellar class has recently regained the spotlight because of the directly imaged planets around a confirmed Lambda Boo star, HR 8799, and a suggested Lambda Boo star, Beta Pictoris. The discovery of a giant asteroid belt around Vega, another possible Lambda Boo star, also suggests hidden planets. The possible link between Lambda Boo stars and planet-bearing stars motivates us to study Lambda Boo stars systematically. Since the peculiar nature of the prototype Lambda Boötis was first noticed in 1943, Lambda Boo candidates published in the literature have been selected using widely different criteria. In order to determine the origin of Lambda Boo stars’ unique abundance pattern and to better discriminate between theories explaining the Lambda Boo phenomenon, a consistent working definition of Lambda Boo stars is needed. We have re-evaluated all published Lambda Boo candidates and their available ultraviolet and visible spectra. In this paper, using observed and synthetic spectra, we explore the physical basis for the classification of Lambda Boo stars, and develop quantitative criteria that discriminate metal-poor stars from bona fide Lambda Boo stars. Based on these stricter Lambda Boo classification criteria, we conclude that neither Beta Pictoris nor Vega should be classified as Lambda Boo stars

  19. Spectrographic study of λ 4200 silicon particular stars

    International Nuclear Information System (INIS)

    Didelon, Pierre

    1983-01-01

    This research thesis reports a spectrographic study of sample of particular stars belonging to the Si(II) λ 4200 subgroup which builds up the hot end of conventional 'Ap,Bp' stars. Twenty snapshots taken at the Haute-Provence observatory have been studied and compared with the observation of 17 standard stars. All these snapshots have been digitalised and processed. This allowed the identification of lines which indicated the presence of gallium and the absence of manganese which contradicts the close correlation between these elements that was generally admitted. An inexplicable and until now non observed duplication of Si(II) lines has also been observed. The problem of spectral classification of these stars has been studied. In order to study the concerned stars without calculation of atmospheric models, a comparative method between group stars and reference stars has been used. Results are discussed and seem to indicate an erratic and non-correlated behaviour of light elements (C, Mg, Ca, Si), and a presence of heavier elements (Ga, Sr) and rare earths (Eu, Gd) only when elements of the iron peak are stronger [fr

  20. SPITZER SAGE-SMC INFRARED PHOTOMETRY OF MASSIVE STARS IN THE SMALL MAGELLANIC CLOUD

    International Nuclear Information System (INIS)

    Bonanos, A. Z.; Lennon, D. J.; Massa, D. L.

    2010-01-01

    We present a catalog of 5324 massive stars in the Small Magellanic Cloud (SMC), with accurate spectral types compiled from the literature, and a photometric catalog for a subset of 3654 of these stars, with the goal of exploring their infrared properties. The photometric catalog consists of stars with infrared counterparts in the Spitzer SAGE-SMC survey database, for which we present uniform photometry from 0.3to24 μm in the UBVIJHK s +IRAC+MIPS24 bands. We compare the color-magnitude diagrams and color-color diagrams to those of stars in the Large Magellanic Cloud (LMC), finding that the brightest infrared sources in the SMC are also the red supergiants, supergiant B[e] (sgB[e]) stars, luminous blue variables, and Wolf-Rayet stars, with the latter exhibiting less infrared excess, the red supergiants being less dusty and the sgB[e] stars being on average less luminous. Among the objects detected at 24 μm in the SMC are a few very luminous hypergiants, four B-type stars with peculiar, flat spectral energy distributions, and all three known luminous blue variables. We detect a distinct Be star sequence, displaced to the red, and suggest a novel method of confirming Be star candidates photometrically. We find a higher fraction of Oe and Be stars among O and early-B stars in our SMC catalog, respectively, when compared to the LMC catalog, and that the SMC Be stars occur at higher luminosities. We estimate mass-loss rates for the red supergiants, confirming the correlation with luminosity even at the metallicity of the SMC. Finally, we confirm the new class of stars displaying composite A and F type spectra, the sgB[e] nature of 2dFS1804 and find the F0 supergiant 2dFS3528 to be a candidate luminous blue variable with cold dust.

  1. The Dilemma for USSOCOM: Transitioning SOF-Peculiar to Service-Common

    Science.gov (United States)

    2012-02-15

    Operations-peculiar (SO-peculiar or SOF-peculiar) to Service-common, while the third implication suggests a lack of “ advertising ”, i.e. the need for a...Portfolio Management ( CPM ) system which seeks to optimize capability investments across the defense enterprise.59 Though CPMs are charged to identify...capabilities as Service-common. Collectively though they do offer several avenues in which SOCOM can “ advertise ” them, and whereby through mutual

  2. Evolution of variable stars

    International Nuclear Information System (INIS)

    Becker, S.A.

    1986-08-01

    Throughout the domain of the H R diagram lie groupings of stars whose luminosity varies with time. These variable stars can be classified based on their observed properties into distinct types such as β Cephei stars, δ Cephei stars, and Miras, as well as many other categories. The underlying mechanism for the variability is generally felt to be due to four different causes: geometric effects, rotation, eruptive processes, and pulsation. In this review the focus will be on pulsation variables and how the theory of stellar evolution can be used to explain how the various regions of variability on the H R diagram are populated. To this end a generalized discussion of the evolutionary behavior of a massive star, an intermediate mass star, and a low mass star will be presented. 19 refs., 1 fig., 1 tab

  3. Stellar parameters of Be stars observed with X-shooter

    Science.gov (United States)

    Shokry, A.; Rivinius, Th.; Mehner, A.; Martayan, C.; Hummel, W.; Townsend, R. H. D.; Mérand, A.; Mota, B.; Faes, D. M.; Hamdy, M. A.; Beheary, M. M.; Gadallah, K. A. K.; Abo-Elazm, M. S.

    2018-01-01

    Aims: The X-shooter archive of several thousand telluric standard star spectra was skimmed for Be and Be shell stars to derive the stellar fundamental parameters and statistical properties, in particular for the less investigated late-type Be stars and the extension of the Be phenomenon into early A stars. Methods: An adapted version of the BCD method is used, using the Balmer discontinuity parameters to determine effective temperature and surface gravity. This method is optimally suited for late B stars. The projected rotational velocity was obtained by profile fitting to the Mg ii lines of the targets, and the spectra were inspected visually for the presence of peculiar features such as the infrared Ca ii triplet or the presence of a double Balmer discontinuity. The Balmer line equivalent widths were measured, but they are only useful for determining the pure emission contribution in a subsample of Be stars owing to uncertainties in determining the photospheric contribution. Results: A total of 78, mostly late-type, Be stars, were identified in the X-shooter telluric standard star archive, out of which 48 had not been reported before. We confirm the general trend that late-type Be stars have more tenuous disks and are less variable than early-type Be stars. The relatively large number (48) of relatively bright (V> 8.5) additional Be stars casts some doubt on the statistics of late-type Be stars; they are more common than currently thought. The Be/B star fraction may not strongly depend on spectral subtype. Based on observations made with ESO Telescopes at the La Silla Paranal Observatory under program IDs 60.A-9022, 60.A-9024, 077.D-0085, 085.A-0962, 185.D-0056, 091.B-0900, and 093.D-0415.Table 6 is only available at the CDS via anonymous ftp to cdsarc.u-strasbg.fr (130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/609/A108

  4. Peculiarities of binding composition production in vortex jet mill

    Science.gov (United States)

    Zagorodnyuk, L. Kh; Lesovik, V. S.; Sumskoy, D. A.; Elistratkin, M. Yu; Makhortov, D. S.

    2018-03-01

    The article investigates the disintegration of perlite production waste in a vortex jet mill; the regularities of milling were established. Binding compositions were obtained at different ratios of cement vs. perlite sand production waste in the vortex jet mill in various milling regimes. The peculiarities of milling processes were studied, and technological and physicomechanical properties of the binding compositions were determined as well. The microstructure of the cement stones made of activated Portland cement and binding compositions in the vortex jet mill was elucidated by electron microscopy. The open pores of the cement-binding compositions prepared using perlite fillers were found to be filled by newgrowths at different stages of collective growth. The microstructure of the binding compositions is dense due to rationally proportioned composition, effective mineral filler— perlite waste — that creates additional substrates for internal composite microstructure formation, mechanochemical activation of raw mixture, which allows obtaining composites with required properties.

  5. Treatment Planning Systems for BNCT Requirements and Peculiarities

    CERN Document Server

    Daquino, G G

    2003-01-01

    The main requirements and peculiarities expected from the BNCT-oriented treatment planning system (TPS) are summarized in this paper. The TPS is a software, which can be integrated or composed by several auxiliary programs. It plays important roles inside the whole treatment planning of the patient's organ in BNCT. However, the main goal is the simulation of the irradiation, in order to obtain the optimal configuration, in terms of neutron spectrum, patient positioning and dose distribution in the tumour and healthy tissues. The presence of neutrons increases the level of complexity, because much more nuclear reactions need to be monitored and properly calculated during the simulation of the patient's treatment. To this purposes several 3D geometry reconstruction techniques, generally based on the CT scanning data, are implemented and Monte Carlo codes are normally used. The TPSs are expected to show also the results (basically doses and fluences) in a proper format, such as isocurves (or isosurfaces) along t...

  6. Seizure freedom after lamotrigine rash: a peculiar phenomenon in epilepsy.

    Science.gov (United States)

    Kakisaka, Yosuke; Jin, Kazutaka; Kato, Kazuhiro; Iwasaki, Masaki; Nakasato, Nobukazu

    2014-01-01

    A 57-year-old right-handed woman with a history of left frontal lobe stroke had experienced episodes of language-expression difficulty followed by paraphasia lasting for approximately 30 seconds two years earlier. She was diagnosed with left frontal lobe epilepsy, and a lamotrigine regimen was initiated. This treatment had to be stopped five weeks after initiation because she developed a rash, and her drug lymphocyte stimulation test result was positive. Interestingly, she has since remained seizure free without requiring any antiepileptic medications. This adult case with a peculiar clinical course provides support for the hypothesis of immunomodulation process involvement in epilepsy, a phenomenon that was previously mainly seen in pediatric patients.

  7. Linguistic Peculiarities of Methodical Educational Publications Issued in 2012

    Directory of Open Access Journals (Sweden)

    Regina Žukienė

    2016-06-01

    Full Text Available The article presents linguistic peculiarities of methodical educational publications prepared and published using European structural funds allocated to the VGTU Transport Engineering, Biomechanics and Aviation Mechanical Engineering project “Renewal of the Study Programmes in Accordance with the EU Requirements by Improving the Quality of the Studies and Applying Innovative Study Methods” carried out in accordance with the Lithuania’s 2007–2013 year Human Resources Development Operational Programme, priority axis 2 “Education and Lifelong Learning”, measure VP1-2.2-MES-07-K “Improving Studies Quality, Increasing Internationalization”. Characteristic properties of style and culture of writing, compliance with language norms, and instances of foreign words used in aviation are analysed.

  8. Graham Greene's novel: The peculiar experiment in modern fiction

    Directory of Open Access Journals (Sweden)

    Lončar-Vujnović Mirjana N.

    2011-01-01

    Full Text Available Graham Greene's The Quiet American could be understood as the specific and unique example in experimental modern and post modern fiction during the twentieth century. This novel could be accepted as the peculiar application of the experiment what makes it almost the exceptional case in modern fiction. Greene used some innovative and usual modern elements expressing them through the prism of completely unusual experimental aspect of form. In the novel, Greene made the combination of already known innovative and usual modern elements and traditional elements of form. Actually, he covered the experimental innovations with the common thematic structure, narrative form and partly with the specific psychoanalytical presentation of character's minds, observing and expressing them all at the same time.

  9. COMMUNICATIVE PECULIARITY OF INTERPRETATIVE AND DELIBERATIVE STYLE IN PEDAGOGICAL DISCOURSE

    Directory of Open Access Journals (Sweden)

    Tsinkerman Tamara Nikolaevna

    2013-04-01

    Full Text Available The aim of the paper is to characterize the communicative peculiarities of the interpretative-deliberative style in pedagogical discourse. The object of the study is interpretative-deliberative style viewed as one of the communication forms in pedagogical discourse; the subject of the analysis is the stratagem and tactics characteristics of the interpretative-deliberative communicative style. Descriptive and analytical as well as stylistic and discourse analysis methods are employed. The author reveals the most prevalent strategies–explanatory, interpretative and deliberative–employed in communicative interaction in situations of educative persuasion. The communicative characteristics of the analyzed style are: a rational type of the communicative action, a trust-based tone and the emotional involvement of the communication participants. The results can be used for clarifying specifics of speech behavior in educative communication as well as for comparing styles of educative communication in different enthnocultural traditions.

  10. Some Peculiarities of the Economic Growth in ECOWAS Countries

    Directory of Open Access Journals (Sweden)

    Babacar NDIAYE

    2017-12-01

    Full Text Available This article seeks to determine some of the peculiarities of the economic growth in the countries from the Economic Community of West African States (ECOWAS. Thus, the study is based on the country approach and uses econometric regression tests. In fact, in the context of the determination of the real GDP per capita growth rate of the countries in this region during the period 1987-2014, the results obtained show that it is still weak and unstable. Moreover, the weak convergence that has only been observed beginning with 2008 feeds the hope that ECOWAS can truly improve its level of development despite the heterogeneous nature of the countries. In order to overcome these difficulties, improving the socio-economic performance through the growth rate of real GDP per capita represents, among others, a necessity in relation to economic policy decisions.

  11. Laser printed nano-gratings: orientation and period peculiarities

    Science.gov (United States)

    Stankevič, Valdemar; Račiukaitis, Gediminas; Bragheri, Francesca; Wang, Xuewen; Gamaly, Eugene G.; Osellame, Roberto; Juodkazis, Saulius

    2017-01-01

    Understanding of material behaviour at nanoscale under intense laser excitation is becoming critical for future application of nanotechnologies. Nanograting formation by linearly polarised ultra-short laser pulses has been studied systematically in fused silica for various pulse energies at 3D laser printing/writing conditions, typically used for the industrial fabrication of optical elements. The period of the nanogratings revealed a dependence on the orientation of the scanning direction. A tilt of the nanograting wave vector at a fixed laser polarisation was also observed. The mechanism responsible for this peculiar dependency of several features of the nanogratings on the writing direction is qualitatively explained by considering the heat transport flux in the presence of a linearly polarised electric field, rather than by temporal and spatial chirp of the laser beam. The confirmed vectorial nature of the light-matter interaction opens new control of material processing with nanoscale precision.

  12. Peculiarities of immune status in uterine cervix carcinoma patients

    International Nuclear Information System (INIS)

    Dekster, L.I.

    1981-01-01

    On the basis of investigating the peripheral blood lymphocytes the immunologic state in 81 patients with uterine cervix carcinoma is estimated. It is established that there is a considerable decrease of indices in the T-immune system in patients with uterine cervix carcinoma. The detection of reductions in the immunogram indices in the initial stage plays a definte diagnostic role in the detection of metastases, permits to forecast the process generalization, and consequently, to determine the treatment tactics. It is established that under the effect of combined radiation treatment the T-system is mostly injured. Consequently, pronounced postradiation depression is prognostically unfavourable. The examination of another group of patients has shown that the probability of development of lymphogenic metastases in uterine cervix carcinoma is mainly determined by immuno-morphological peculiarities of regional lymph nodes [ru

  13. Brain-computer interfaces for EEG neurofeedback: peculiarities and solutions.

    Science.gov (United States)

    Huster, René J; Mokom, Zacharais N; Enriquez-Geppert, Stefanie; Herrmann, Christoph S

    2014-01-01

    Neurofeedback training procedures designed to alter a person's brain activity have been in use for nearly four decades now and represent one of the earliest applications of brain-computer interfaces (BCI). The majority of studies using neurofeedback technology relies on recordings of the electroencephalogram (EEG) and applies neurofeedback in clinical contexts, exploring its potential as treatment for psychopathological syndromes. This clinical focus significantly affects the technology behind neurofeedback BCIs. For example, in contrast to other BCI applications, neurofeedback BCIs usually rely on EEG-derived features with only a minimum of additional processing steps being employed. Here, we highlight the peculiarities of EEG-based neurofeedback BCIs and consider their relevance for software implementations. Having reviewed already existing packages for the implementation of BCIs, we introduce our own solution which specifically considers the relevance of multi-subject handling for experimental and clinical trials, for example by implementing ready-to-use solutions for pseudo-/sham-neurofeedback. © 2013.

  14. On peculiarities of distribution of some elements in vegetation samples

    International Nuclear Information System (INIS)

    Bakiev, S.A.; Rakhmanov, J.; Khakimov, Z.M.; Turayev, S.

    2005-01-01

    This work is devoted to the neutron-activation analysis of medicines of vegetation origin and some herbs, vegetables, fruits and cereals, which are used in oriental medicine, in order to reveal peculiarities of distribution of studied elements in them and possible relations between this distribution and parameters of oriental medicine. The sampling involving 85 species and their preparation for analysis, as well as complex of necessary methodological studies were performed and the method of sample analysis for 14 macro- and microelements (Na, Al, Cl, K, Sc, Mn, Fe, Co, Cu, Zn, Br, J, La, Au) was developed. The studies carried out have enabled one to obtain data on concentrations of these elements and to reveal peculiarities of their distribution in the samples under interest. It was revealed herbs, fruits and cereals with pronounced higher concentrations (with respect to the mean values) of one or another element, which are perhaps concentrators of those elements, as well as samples with lower concentrations of elements (see table). It is indicative that in all herbs only enhanced concentrations of elements are observed, but in fruits and cereals-only lowered concentrations of elements. These results can be of interest for geochemical ecology, dietology, therapy, as well as for activities on correction of elemental content of ecosystems, including soils, and alive organisms It is suggested to continue studies with extension of range of object types and analysed elements. Mathematical analysis of the obtained results was performed with comparison of concentrations of a number of elements in the different objects with classifying parameters ('cold-hot' and 'dry-wet') of these objects according to oriental medicine. In the current stage of studies no relation between these parameters and concentrations has been found. It does not mean that there are not such relations at all, they may be revealed with extension and development of our' studies.

  15. Peculiarities of Grammatical Properties in Nominal Word Combinations

    Directory of Open Access Journals (Sweden)

    Irina B. Klienkova

    2014-01-01

    Full Text Available The article examines some peculiarities if grammatical properties of nominal word combinations based on the study of German-speaking Swiss press. The accumulated experience of linguists is analyzed and certain factors influencing the choice of syntactic relations in nominal word combinations with quantitative meaning are researched. It has been established that the choice of syntactic relations in such word combinations is determined by functional style, semantics and grammatical features of nouns - first or second components in a word combination. The aforementioned factors influencing the choice of syntactic relations in quantitative nominal word combinations are studied on the material of Germanspeaking Swiss press. The research revealed a number of peculiarities. First of all, German-speaking Swiss press uses such syntactic relation as genitive subordination quite often, not only on "special occasion" and unlike its use in Germany does not produce a magniloquent, pompous impression. Secondly, it has been established that the choice of syntactic relations in word combinations of the above-mentioned type of word combinations greatly depends on the semantic meaning of the noun - the first component of the word combination - and does not always coincide with the grammatical properties in nominal combinations in Germany. Thirdly, a clear dependence of syntactic relations choice is observed. Moreover, the article highlights the importance of grammatical features of the second component. These are such features as gender, number, case accompanied by noun declension. All the afore-mentioned features help to define the type of syntactic relations, which nominal quantitative word combinations may be connected by. The results of the comparisons of grammatical properties of quantitative nominal word combinations in German and Swiss press are demonstrated in a table below.

  16. Star-Branched Polymers (Star Polymers)

    KAUST Repository

    Hirao, Akira; Hayashi, Mayumi; Ito, Shotaro; Goseki, Raita; Higashihara, Tomoya; Hadjichristidis, Nikolaos

    2015-01-01

    The synthesis of well-defined regular and asymmetric mixed arm (hereinafter miktoarm) star-branched polymers by the living anionic polymerization is reviewed in this chapter. In particular, much attention is being devoted to the synthetic

  17. Evidence for circumstellar obscuration of OB stars

    International Nuclear Information System (INIS)

    Bohannan, B.

    1975-01-01

    Reddish found a strong increase of color excess with increasing stellar luminosity: here referred to as the Reddish Effect: in ten young galactic clusters and associations. New photometric and spectroscopic observations drawn from the literature are combined with data used by Reddish to reconsider the color excess versus intrinsic magnitude diagrams of the same ten stellar groups. The reality of the Effect is questioned in all but one of the systems; this was accomplished by identifying possible foreground stars and by recognizing some of the brightest stars as supergiants, then applying correct intrinsic color indices. After careful reanalysis, the one stellar group to retain an indication of the Reddish Effect is Cygnus OB2. No correlation of reddening with luminosity was found for five additional very young stellar groups in the southern hemisphere; these groups should exhibit the Effect if it is a natural consequence of stellar evolution. Reddish ascribed the correlation to massive circumstellar remnants of material from which the stars formed. However, a peculiar dispersion in color excess could also be attributed to patchy dust within the stellar group. In several stellar systems previously identified as displaying the Reddish Effect, a correlation of observed color excess with dust and gas concentrations is noted on Palomar Sky Survey prints. If present, circumstellar dust clouds should []anifest their existence in modes other than a correlation of color excess with luminosity. The following possibilities are considered and all show negative results: correlation of color excess with spectral type; correlation of reddening slope E/subU//sub -//subB//E/subB//sub -//subV/ with spectral type; observable infrared excess. The preceding astrophysical arguments strongly imply that circumstellar dust remnants from stellar formation do not remain around stars during their main-sequence lifetimes. (auth)

  18. FEROS Finds a Strange Star

    Science.gov (United States)

    1999-02-01

    responsible for the overall design and construction, as well as the data reduction software; this institution was also involved in the construction of the first major instrument for the VLT, FORS. The Copenhagen University Observatory provided the detector controller and took care of the associated installation and tests. ESO supplied the first concept for the new spectrograph, its infrastructure, the fibre link between the telescope and the instrument, and the CCD detector by means of which the spectra are recorded. FEROS is a rather unique instrument. It combines a very large spectral coverage from the near-ultraviolet to the infrared region of the spectrum (360 to 920 nm, altogether 560 nm in one exposure) and a high resolving power. The full spectral range is divided into about 100,000 separate pixels, each of which corresponds to a velocity interval of about 3 km/sec. Moreover, FEROS is extremely light-efficient for an instrument of this complex type. Despite the large number of optical elements needed to produce exceedingly detailed spectra of very high quality, 46% of the light entering the spectrograph is actually recorded by the detector. FEROS is mounted on an optical bench in an isolated and thermally controlled room next to the telescope and is an extremely stable instrument. It is operated in a very user-friendly way, and the observing astronomer can obtain quick-look results directly at the telescope using the FEROS on-line data reduction pipeline that is integrated into the ESO-MIDAS image processing system. Notes: [1]: In addition to very young stars that have not yet destroyed their "original" Lithium, this element is also found in the upper atmospheres of some peculiar stars of the so-called Asymptotic Giant Branch (AGB) type. It is believed that this is the result of nuclear burning of the Helium isotope 3 He that has been produced inside such stars during an earlier evolutionary phase. The Lithium is then brought to the surface by means of "convection", i

  19. Star-Branched Polymers (Star Polymers)

    KAUST Repository

    Hirao, Akira

    2015-09-01

    The synthesis of well-defined regular and asymmetric mixed arm (hereinafter miktoarm) star-branched polymers by the living anionic polymerization is reviewed in this chapter. In particular, much attention is being devoted to the synthetic development of miktoarm star polymers since 2000. At the present time, the almost all types of multiarmed and multicomponent miktoarm star polymers have become feasible by using recently developed iterative strategy. For example, the following well-defined stars have been successfully synthesized: 3-arm ABC, 4-arm ABCD, 5-arm ABCDE, 6-arm ABCDEF, 7-arm ABCDEFG, 6-arm ABC, 9-arm ABC, 12-arm ABC, 13-arm ABCD, 9-arm AB, 17-arm AB, 33-arm AB, 7-arm ABC, 15-arm ABCD, and 31-arm ABCDE miktoarm star polymers, most of which are quite new and difficult to synthesize by the end of the 1990s. Several new specialty functional star polymers composed of vinyl polymer segments and rigid rodlike poly(acetylene) arms, helical polypeptide, or helical poly(hexyl isocyanate) arms are introduced.

  20. "Movie Star" Acting Strangely, Radio Astronomers Find

    Science.gov (United States)

    1999-01-01

    Astronomers have used the National Science Foundation's Very Long Baseline Array (VLBA) radio telescope to make the first-ever time-lapse "movie" showing details of gas motions around a star other than our Sun. The study, the largest observational project yet undertaken using Very Long Baseline Interferometry, has produced surprising results that indicate scientists do not fully understand stellar atmospheres. The "movie" shows that the atmosphere of a pulsating star more than 1,000 light-years away continues to expand during a part of the star's pulsation period in which astronomers expected it to start contracting. Philip Diamond and Athol Kemball, of the National Radio Astronomy Observatory (NRAO) in Socorro, New Mexico, announced their findings at the American Astronomical Society's meeting in Austin, TX, today. "The continued expansion we're seeing contradicts current theoretical models for how these stars work," Diamond said. "The models have assumed spherical symmetry in the star's atmosphere, and our movie shows that this is not the case. Such models suggest that a shock wave passes outward from the star. Once it's passed, then the atmosphere should begin to contract because of the star's gravity. We've long passed that point and the contraction has not begun." The time-lapse images show that the gas motions are not uniform around the star. Most of the motion is that of gas moving directly outward from the star's surface. However, in about one-fourth of the ring, there are peculiar motions that do not fit this pattern. The scientists speculate that the rate of mass loss may not be the same from all parts of the star's surface. "A similar star behaved as predicted when studied a few years ago, so we're left to wonder what's different about this one," Diamond said. "Right now, we think that different rates of mass loss in the two stars may be the cause of the difference. This star is losing mass at 100 times the rate of the star in the earlier study." "This

  1. The incidence of stellar mergers and mass gainers among massive stars

    International Nuclear Information System (INIS)

    De Mink, S. E.; Sana, H.; Langer, N.; Izzard, R. G.; Schneider, F. R. N.

    2014-01-01

    Because the majority of massive stars are born as members of close binary systems, populations of massive main-sequence stars contain stellar mergers and products of binary mass transfer. We simulate populations of massive stars accounting for all major binary evolution effects based on the most recent binary parameter statistics and extensively evaluate the effect of model uncertainties. Assuming constant star formation, we find that 8 −4 +9 % of a sample of early-type stars are the products of a merger resulting from a close binary system. In total we find that 30 −15 +10 % of massive main-sequence stars are the products of binary interaction. We show that the commonly adopted approach to minimize the effects of binaries on an observed sample by excluding systems detected as binaries through radial velocity campaigns can be counterproductive. Systems with significant radial velocity variations are mostly pre-interaction systems. Excluding them substantially enhances the relative incidence of mergers and binary products in the non-radial velocity variable sample. This poses a challenge for testing single stellar evolutionary models. It also raises the question of whether certain peculiar classes of stars, such as magnetic O stars, are the result of binary interaction and it emphasizes the need to further study the effect of binarity on the diagnostics that are used to derive the fundamental properties (star-formation history, initial mass function, mass-to-light ratio) of stellar populations nearby and at high redshift.

  2. Feasibility study report for the 200-BP-1 operable unit

    International Nuclear Information System (INIS)

    1993-06-01

    This feasibility study examines a range of alternatives and provides recommendations for selecting a preferred alternative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965--1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area, groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-levels of contamination with cesium-137, radium-226, strontium-90, thorium-228, and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9x10 -5

  3. Feasibility study report for the 200-BP-1 operable unit

    International Nuclear Information System (INIS)

    1994-01-01

    This feasibility study (FS) examines a range of alternatives and provides recommendations for selecting a preferred altemative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965-1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-:levels of contamination with cesium-137, radium-226, strontium-90, thorium-228 and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9 x 10 5

  4. Feasibility study report for the 200-BP-1 operable unit

    Energy Technology Data Exchange (ETDEWEB)

    1993-06-01

    This feasibility study examines a range of alternatives and provides recommendations for selecting a preferred alternative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965--1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area, groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-levels of contamination with cesium-137, radium-226, strontium-90, thorium-228, and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9{times}10{sup {minus}5}.

  5. BP and sustainable development and biodiversity in Azerbaijan

    International Nuclear Information System (INIS)

    Grant, Vidrine; Askerov, Faig

    2002-01-01

    Full text: BP takes its commitment to the environmental extremely seriously. BP believes it is essential to ensure that our operations and activities comply with the environmental standards in our PSAs and with the laws of Azerbaijan. To achieve this we have developed Environmental Operating Procedures. These procedures are currently being audited and we expect to receive ISO 14001 certification for all of our operations. Together with our Emergency Response and Oil Spill Response Plans we are able to manage our operations to ensure minimum impact and regulatory compliance. Additional, AIOC contributed to opening the Caspian Environmental Laboratory in 1999 to provide on a commercial basis, environmental services in Azerbaijan of an internationally recognized standard. We have conducted many other activities to promote biodiversity. In absence of the appropriate infrastructure we have built a waste management site at Serenja where we are currently disposing of synthetic based muds from our offshore drilling operations. We have also developed and implemented a Research and Monitoring Program in co-operation with representatives from SOCAR, Academy of Sciences, Azgipromorneftegaz and State Committee of Ecology. We have conducted Seals mortality investigation, Birds monitoring, Fish monitoring, Offshore surveys studying macrobenthos, water chemistry, sediments, groundwater monitoring, re-vegetation, etc. In developing our overall strategy BP has set some long term environmental aspirations or expectations: stop the use of halocarbons; to reduce Green House Gases by 10% by 20 lOin comparison with baseline data for 1990; stop venting and flaring; stop discharges to water of synthetic and oil based muds. BP recognizes that this is a goal. It is something we commit to and aspire to achieve and something we are wise enough to realize cannot be achieved overnight. None-the-less, it is something we constantly work towards. We also realize that this goal cannot be achieved in

  6. Risk assessment of logistics outsourcing based on BP neural network

    Science.gov (United States)

    Liu, Xiaofeng; Tian, Zi-you

    The purpose of this article is to evaluate the risk of the enterprises logistics outsourcing. To get this goal, the paper first analysed he main risks existing in the logistics outsourcing, and then set up a risk evaluation index system of the logistics outsourcing; second applied BP neural network into the logistics outsourcing risk evaluation and used MATLAB to the simulation. It proved that the network error is small and has strong practicability. And this method can be used by enterprises to evaluate the risks of logistics outsourcing.

  7. EST Table: BP183486 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available n (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] 10/08/29 56...43 aa gnl|Amel|GB30360-PB 10/09/10 54 %/174 aa gi|189241063|ref|XP_967018.2| PREDICTED: similar to restin (Reed-Steinberg cell-expres...sed intermediate filament-associated protein) [Tribolium castaneum] FS906662 NRPG ... ...BP183486 NRPG1970 10/09/28 54 %/174 aa ref|XP_967018.2| PREDICTED: similar to resti

  8. Lines profile variations and binarity in Wolf-Rayet stars

    International Nuclear Information System (INIS)

    Bisiacchi, G.F.; Firmani, C.; Lara, E. de

    1982-01-01

    Recently, HD50896, a WN5 star, for a long time considered as isolated, has been demonstrated to be a binary. This star shows very small displacement of the lines due to orbital motion and no evidence of the secondary spectrum. Is HD50896 a rare system in which the profile variations are peculiarly strong and easy to be detected, or are there many of these undetected binaries for which the analysis of the profile variation may be a powerful method to determine the periodicity. With this problem in mind the authors have observed a sample of 17 WR stars during a week to analyze both profile and radial velocity variations. This sample includes all the WR stars with Msub(v) 0 0 except for five stars that are binaries with determined period. All the spectra have been taken with a dispersion of 1.1 A channel -1 using a SIT television camera and a low dispersion spectrograph attached to the 2-meter telescope of the Observatorio Astronomico Nacional in San Pedro Martir, Baja California (Mexico). (Auth.)

  9. Assembly of human C-terminal binding protein (CtBP) into tetramers.

    Science.gov (United States)

    Bellesis, Andrew G; Jecrois, Anne M; Hayes, Janelle A; Schiffer, Celia A; Royer, William E

    2018-06-08

    C-terminal binding protein 1 (CtBP1) and CtBP2 are transcriptional coregulators that repress numerous cellular processes, such as apoptosis, by binding transcription factors and recruiting chromatin-remodeling enzymes to gene promoters. The NAD(H)-linked oligomerization of human CtBP is coupled to its co-transcriptional activity, which is implicated in cancer progression. However, the biologically relevant level of CtBP assembly has not been firmly established; nor has the stereochemical arrangement of the subunits above that of a dimer. Here, multi-angle light scattering (MALS) data established the NAD + - and NADH-dependent assembly of CtBP1 and CtBP2 into tetramers. An examination of subunit interactions within CtBP1 and CtBP2 crystal lattices revealed that both share a very similar tetrameric arrangement resulting from assembly of two dimeric pairs, with specific interactions probably being sensitive to NAD(H) binding. Creating a series of mutants of both CtBP1 and CtBP2, we tested the hypothesis that the crystallographically observed interdimer pairing stabilizes the solution tetramer. MALS data confirmed that these mutants disrupt both CtBP1 and CtBP2 tetramers, with the dimer generally remaining intact, providing the first stereochemical models for tetrameric assemblies of CtBP1 and CtBP2. The crystal structure of a subtle destabilizing mutant suggested that small structural perturbations of the hinge region linking the substrate- and NAD-binding domains are sufficient to weaken the CtBP1 tetramer. These results strongly suggest that the tetramer is important in CtBP function, and the series of CtBP mutants reported here can be used to investigate the physiological role of the tetramer. © 2018 Bellesis et al.

  10. Massive stars in galaxies

    International Nuclear Information System (INIS)

    Humphreys, R.M.

    1987-01-01

    The relationship between the morphologic type of a galaxy and the evolution of its massive stars is explored, reviewing observational results for nearby galaxies. The data are presented in diagrams, and it is found that the massive-star populations of most Sc spiral galaxies and irregular galaxies are similar, while those of Sb spirals such as M 31 and M 81 may be affected by morphology (via differences in the initial mass function or star-formation rate). Consideration is also given to the stability-related upper luminosity limit in the H-R diagram of hypergiant stars (attributed to radiation pressure in hot stars and turbulence in cool stars) and the goals of future observation campaigns. 88 references

  11. Evolution of massive stars

    International Nuclear Information System (INIS)

    Loore, C. de

    1984-01-01

    The evolution of stars with masses larger than 15 sun masses is reviewed. These stars have large convective cores and lose a substantial fraction of their matter by stellar wind. The treatment of convection and the parameterisation of the stellar wind mass loss are analysed within the context of existing disagreements between theory and observation. The evolution of massive close binaries and the origin of Wolf-Rayet Stars and X-ray binaries is also sketched. (author)

  12. Peculiarities of Future Finance and Economics Specialists' Training in Western European Countries and Ukraine

    Science.gov (United States)

    Homoniuk, Olena; Pokudina, Larysa

    2016-01-01

    The article touches on the peculiarities of future finance and economics specialists' training in educational establishments of Western Europe and Ukraine. The problem of higher economic education has been considered. The experience of higher economic education organization in developed European countries has been generalized. The peculiarities of…

  13. Age peculiarities of the structure of senior pupils' and students' initiativity

    Directory of Open Access Journals (Sweden)

    V V Alekseyeva

    2009-03-01

    Full Text Available The results of this research of age peculiarities of senior pupils' and students' initiativity based on multimeasureble-functional model of personal structure of their qualities, which gives an opportunity to study, the display of individual peculiarities of initiativity are considered in this article.

  14. Fast pulsars, strange stars

    International Nuclear Information System (INIS)

    Glendenning, N.K.

    1990-02-01

    The initial motivation for this work was the reported discovery in January 1989 of a 1/2 millisecond pulsar in the remnant of the spectacular supernova, 1987A. The status of this discovery has come into grave doubt as of data taken by the same group in February, 1990. At this time we must consider that the millisecond signal does not belong to the pulsar. The existence of a neutron star in remnant of the supernova is suspected because of recent observations on the light curve of the remnant, and of course by the neutrino burst that announced the supernova. However its frequency is unknown. I can make a strong case that a pulsar rotation period of about 1 ms divides those that can be understood quite comfortably as neutron stars, and those that cannot. What we will soon learn is whether there is an invisible boundary below which pulsar periods do not fall, in which case, all are presumable neutron stars, or whether there exist sub- millisecond pulsars, which almost certainly cannot be neutron stars. Their most plausible structure is that of a self-bound star, a strange-quark-matter star. The existence of such stars would imply that the ground state of the strong interaction is not, as we usually assume, hadronic matter, but rather strange quark matter. Let us look respectively at stars that are bound only by gravity, and hypothetical stars that are self-bound, for which gravity is so to speak, icing on the cake

  15. Covering tree with stars

    DEFF Research Database (Denmark)

    Baumbach, Jan; Guo, Jiong; Ibragimov, Rashid

    2015-01-01

    We study the tree edit distance problem with edge deletions and edge insertions as edit operations. We reformulate a special case of this problem as Covering Tree with Stars (CTS): given a tree T and a set of stars, can we connect the stars in by adding edges between them such that the resulting...... tree is isomorphic to T? We prove that in the general setting, CST is NP-complete, which implies that the tree edit distance considered here is also NP-hard, even when both input trees having diameters bounded by 10. We also show that, when the number of distinct stars is bounded by a constant k, CTS...

  16. Introduction to neutron stars

    Energy Technology Data Exchange (ETDEWEB)

    Lattimer, James M. [Dept. of Physics and Astronomy, Stony Brook University, Stony Brook, NY 11794-3800 (United States)

    2015-02-24

    Neutron stars contain the densest form of matter in the present universe. General relativity and causality set important constraints to their compactness. In addition, analytic GR solutions are useful in understanding the relationships that exist among the maximum mass, radii, moments of inertia, and tidal Love numbers of neutron stars, all of which are accessible to observation. Some of these relations are independent of the underlying dense matter equation of state, while others are very sensitive to the equation of state. Recent observations of neutron stars from pulsar timing, quiescent X-ray emission from binaries, and Type I X-ray bursts can set important constraints on the structure of neutron stars and the underlying equation of state. In addition, measurements of thermal radiation from neutron stars has uncovered the possible existence of neutron and proton superfluidity/superconductivity in the core of a neutron star, as well as offering powerful evidence that typical neutron stars have significant crusts. These observations impose constraints on the existence of strange quark matter stars, and limit the possibility that abundant deconfined quark matter or hyperons exist in the cores of neutron stars.

  17. Strangeon and Strangeon Star

    Science.gov (United States)

    Xiaoyu, Lai; Renxin, Xu

    2017-06-01

    The nature of pulsar-like compact stars is essentially a central question of the fundamental strong interaction (explained in quantum chromo-dynamics) at low energy scale, the solution of which still remains a challenge though tremendous efforts have been tried. This kind of compact objects could actually be strange quark stars if strange quark matter in bulk may constitute the true ground state of the strong-interaction matter rather than 56Fe (the so-called Witten’s conjecture). From astrophysical points of view, however, it is proposed that strange cluster matter could be absolutely stable and thus those compact stars could be strange cluster stars in fact. This proposal could be regarded as a general Witten’s conjecture: strange matter in bulk could be absolutely stable, in which quarks are either free (for strange quark matter) or localized (for strange cluster matter). Strange cluster with three-light-flavor symmetry is renamed strangeon, being coined by combining “strange nucleon” for the sake of simplicity. A strangeon star can then be thought as a 3-flavored gigantic nucleus, and strangeons are its constituent as an analogy of nucleons which are the constituent of a normal (micro) nucleus. The observational consequences of strangeon stars show that different manifestations of pulsarlike compact stars could be understood in the regime of strangeon stars, and we are expecting more evidence for strangeon star by advanced facilities (e.g., FAST, SKA, and eXTP).

  18. Interacting binary stars

    CERN Document Server

    Sahade, Jorge; Ter Haar, D

    1978-01-01

    Interacting Binary Stars deals with the development, ideas, and problems in the study of interacting binary stars. The book consolidates the information that is scattered over many publications and papers and gives an account of important discoveries with relevant historical background. Chapters are devoted to the presentation and discussion of the different facets of the field, such as historical account of the development in the field of study of binary stars; the Roche equipotential surfaces; methods and techniques in space astronomy; and enumeration of binary star systems that are studied

  19. Polarization of Be stars

    International Nuclear Information System (INIS)

    Johns, M.W.

    1975-01-01

    Linear polarization of starlight may be produced by electron scattering in the extended atmospheres of early type stars. Techniques are investigated for the measurement and interpretation of this polarization. Polarimetric observations were made of twelve visual double star systems in which at least one member was a B type star as a means of separating the intrinsic stellar polarization from the polarization produced in the interstellar medium. Four of the double stars contained a Be star. Evidence for intrinsic polarization was found in five systems including two of the Be systems, one double star with a short period eclipsing binary, and two systems containing only normal early type stars for which emission lines have not been previously reported. The interpretation of these observations in terms of individual stellar polarizations and their wavelength dependence is discussed. The theoretical basis for the intrinsic polarization of early type stars is explored with a model for the disk-like extended atmospheres of Be stars. Details of a polarimeter for the measurement of the linear polarization of astronomical point sources are also presented with narrow band (Δ lambda = 100A) measurements of the polarization of γ Cas from lambda 4000 to lambda 5800

  20. ENERGY STAR Unit Reports

    Data.gov (United States)

    Department of Housing and Urban Development — These quarterly Federal Fiscal Year performance reports track the ENERGY STAR qualified HOME units that Participating Jurisdictions record in HUD's Integrated...

  1. Effect of turmeric and curcumin on BP-DNA adducts.

    Science.gov (United States)

    Mukundan, M A; Chacko, M C; Annapurna, V V; Krishnaswamy, K

    1993-03-01

    Many human cancers that are widely prevalent today can be prevented through modifications in life-styles, of which diet appears to be an important agent. Several dietary constituents modulate the process of carcinogenesis and prevent genotoxicity. Many plant constituents including turmeric appear to be potent antimutagens and antioxidants. Therefore the modulatory effects of turmeric and curcumin on the levels of benzo[a]pyrene induced DNA adducts in the livers of rats were studied by the newly developed 32P-postlabelling assay method. Turmeric when fed at 0.1, 0.5 and 3% and the active principle of turmeric (curcumin) when fed at a level of 0.03% in the diet for 4 weeks significantly reduced the level of BP-DNA adducts including the major adduct dG-N2-BP, formed within 24 h in response to a single i.p. injection of benzo[a]pyrene. The significance of these effects in terms of the potential anticarcinogenic effects of turmeric is discussed. Further, these results strengthen the various other biological effects of turmeric which have direct relevance to anticarcinogenesis and chemoprevention.

  2. Research on AHP decision algorithms based on BP algorithm

    Science.gov (United States)

    Ma, Ning; Guan, Jianhe

    2017-10-01

    Decision making is the thinking activity that people choose or judge, and scientific decision-making has always been a hot issue in the field of research. Analytic Hierarchy Process (AHP) is a simple and practical multi-criteria and multi-objective decision-making method that combines quantitative and qualitative and can show and calculate the subjective judgment in digital form. In the process of decision analysis using AHP method, the rationality of the two-dimensional judgment matrix has a great influence on the decision result. However, in dealing with the real problem, the judgment matrix produced by the two-dimensional comparison is often inconsistent, that is, it does not meet the consistency requirements. BP neural network algorithm is an adaptive nonlinear dynamic system. It has powerful collective computing ability and learning ability. It can perfect the data by constantly modifying the weights and thresholds of the network to achieve the goal of minimizing the mean square error. In this paper, the BP algorithm is used to deal with the consistency of the two-dimensional judgment matrix of the AHP.

  3. Peculiarities of the Woody Plants Re-Bloom

    Directory of Open Access Journals (Sweden)

    Opalko Olga Anatolievna

    2015-09-01

    Full Text Available The data of literary sources concerning the bloom of angiosperm plants and deviation in the development of a flower and inflorescence, in particular untimely flowering, was generalized; our observation results of some peculiarities of re-bloom of woody plants in the National Dendrological Park “Sofiyivka” of NAS of Ukraine (NDP “Sofiyivka” were discussed. The flowering process was formed during a long-term evolution of a propagation system of angiosperm plants as a basis of fertilization and further fruit and seed development. As a result of vernalization and photoperiodism reactions, flowering (under regular conditions occurs in the most favorable period for pollination and fertilization of every plant. However, various deviations, in particular, the untimely (most frequently double, sometimes three- and four-fold flowering occurs in this perfect process of generative organ formation of angiosperm plants. An increased number of reports about re-bloom (at the end of summer – at the beginning of fall of the representatives of various woody plant species whose flowers usually blossom in May-June prompts the analysis of the available information concerning the mechanisms of flowering and the causes which lead to deviation of flowering processes. Flowering of the woody plant representatives of the collection fund of the NDP “Sofiyivka” was studied; statistics about re-bloom in different cities of Ukraine were monitored. The classification of re-bloom facts was carried out according to V.L. Vitkovskiy (1984. Although this classification has mostly a stated nature, it was good enough when being formulated and, with certain conditions, it can be applied nowadays. Accordingly, using this classification, abnormal cases can include facts of early summer-fall flowering and early winter flowering. A late spring flowering can be adaptive response of damaged plants to exogenous stresses, due to which the probability of sexual propagation remains

  4. Immunity peculiarities of neonates in case of perinatal pathology

    Directory of Open Access Journals (Sweden)

    О. S. Godovanets

    2018-02-01

    Full Text Available The immune system as one of the regulating systems of the body determined peculiarities of child adaptation after birth stipulating physiology of adaptation or perinatal pathology formation. Objective: to study peculiarities of immunological indices in case of neonates’ perinatal pathology to detect their role in pathogenesis and formation of diseases severity. Materials and methods. The group of term infants with clinical signs of perinatal pathology (173 individuals was examined. They were divided into two groups: group A included those with diagnosed severe forms of diseases (121 individuals, and group B included 52 infants with general moderate severity of perinatal pathology. The group of comparison included 82 newborns without substantial adaptive deviations after birth. IL1 and IL6 levels were examined by means of immunofluorescence method “Clonospectr” using the reagents produced by “ProCon”. Absolute and relative amount of СD2+-associated Т and NK-lymphocytes, СD14+-associated monocytes, СD15+-associated neutrophils, СD19+-associated В-lymphocytes and СD54+-associated ІСАМ-1 cells were determined by means of immunofluorescence method “Status” using the set of monoclonal and polyclonal antibodies produced by “Sorbent”. The data obtained were statistically processed with the application of applied programs package used for medical-biological studies “Statgraphics Centurion XVI.I” [2011] on the personal computer Pentium MMX CPU. Results. The results obtained were indicative of considerable changes in the immune system indices in newborns under conditions of birth stress and hypoxia. It has been found that a term newborn has a special different from that of adults biologically mediated state of immune system, that can determine both the development of physiological adaptation and under certain circumstances excessive reactions of systemic inflammation, autoimmune processes and destruction of tissues. One

  5. RanBP2 modulates Cox11 and hexokinase I activities and haploinsufficiency of RanBP2 causes deficits in glucose metabolism.

    Directory of Open Access Journals (Sweden)

    Azamat Aslanukov

    2006-10-01

    Full Text Available The Ran-binding protein 2 (RanBP2 is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/- are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/- mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.

  6. RanBP2 modulates Cox11 and hexokinase I activities and haploinsufficiency of RanBP2 causes deficits in glucose metabolism.

    Science.gov (United States)

    Aslanukov, Azamat; Bhowmick, Reshma; Guruju, Mallikarjuna; Oswald, John; Raz, Dorit; Bush, Ronald A; Sieving, Paul A; Lu, Xinrong; Bock, Cheryl B; Ferreira, Paulo A

    2006-10-01

    The Ran-binding protein 2 (RanBP2) is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s) of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI) via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/-) are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/-) mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.

  7. Correlation of expression of BP1, a homeobox gene, with estrogen receptor status in breast cancer

    International Nuclear Information System (INIS)

    Fu, Sidney W; Poola, Indira; Stephan, Dietrich A; Berg, Patricia E; Schwartz, Arnold; Stevenson, Holly; Pinzone, Joseph J; Davenport, Gregory J; Orenstein, Jan M; Gutierrez, Peter; Simmens, Samuel J; Abraham, Jessy

    2003-01-01

    BP1 is a novel homeobox gene cloned in our laboratory. Our previous studies in leukemia demonstrated that BP1 has oncogenic properties, including as a modulator of cell survival. Here BP1 expression was examined in breast cancer, and the relationship between BP1 expression and clinicopathological data was determined. Total RNA was isolated from cell lines, tumors, and matched normal adjacent tissue or tissue from autopsy. Reverse transcription polymerase chain reaction was performed to evaluate BP1 expression. Statistical analysis was accomplished with SAS. Analysis of 46 invasive ductal breast tumors demonstrated BP1 expression in 80% of them, compared with a lack of expression in six normal breast tissues and low-level expression in one normal breast tissue. Remarkably, 100% of tumors that were negative for the estrogen receptor (ER) were BP1-positive, whereas 73% of ER-positive tumors expressed BP1 (P = 0.03). BP1 expression was also associated with race: 89% of the tumors of African American women were BP1-positive, whereas 57% of those from Caucasian women expressed BP1 (P = 0.04). However, there was no significant difference in BP1 expression between grades I, II, and III tumors. Interestingly, BP1 mRNA expression was correlated with the ability of malignant cell lines to cause breast cancer in mice. Because BP1 is expressed abnormally in breast tumors, it could provide a useful target for therapy, particularly in patients with ER-negative tumors. The frequent expression of BP1 in all tumor grades suggests that activation of BP1 is an early event

  8. Diffuse remnants of supernova explosions of moving massive stars

    Science.gov (United States)

    Gvaramadze, V. V.

    The modification of the ambient interstellar medium by the wind of massive stars (the progenitors of most of supernovae) results in that the structure and evolution of diffuse supernova remnants (SNRs) significantly deviate from those derived from standard models of SNRs based of the Sedov-Taylor solution. The stellar proper motion and the regular interstellar magnetic field affect the symmetry of the processed medium and cause the SNR to be non-spherically-symmetric. We show that taking into account these effects allows us to explain the diverse morphologies of the known SNRs (the particular attention is paid to the elongated axisymmetric SNRs and the SNRs consisting of two partially overlapping shells) and to infer the ``true" supernova explosion sites in some peculiar SNRs (therefore to search for new neutron stars associated with them).

  9. Polymer-Based Black Phosphorus (bP) Hybrid Materials by in Situ Radical Polymerization: An Effective Tool To Exfoliate bP and Stabilize bP Nanoflakes

    Science.gov (United States)

    2018-01-01

    Black phosphorus (bP) has been recently investigated for next generation nanoelectronic multifunctional devices. However, the intrinsic instability of exfoliated bP (the bP nanoflakes) toward both moisture and air has so far overshadowed its practical implementation. In order to contribute to fill this gap, we report here the preparation of new hybrid polymer-based materials where bP nanoflakes (bPn) exhibit a significantly improved stability. The new materials have been prepared by different synthetic paths including: (i) the mixing of conventionally liquid-phase exfoliated bP (in dimethyl sulfoxide, DMSO) with poly(methyl methacrylate) (PMMA) solution; (ii) the direct exfoliation of bP in a polymeric solution; (iii) the in situ radical polymerization after exfoliating bP in the liquid monomer (methyl methacrylate, MMA). This last methodology concerns the preparation of stable suspensions of bPn–MMA by sonication-assisted liquid-phase exfoliation (LPE) of bP in the presence of MMA followed by radical polymerization. The hybrids characteristics have been compared in order to evaluate the bP dispersion and the effectiveness of the bPn interfacial interactions with polymer chains aimed at their long-term environmental stabilization. The passivation of the bPn is particularly effective when the hybrid material is prepared by in situ polymerization. By using this synthetic methodology, the nanoflakes, even if with a gradient of dispersion (size of aggregates), preserve their chemical structure from oxidation (as proved by both Raman and 31P-solid state NMR studies) and are particularly stable to air and UV light exposure. The feasibility of this approach, capable of efficiently exfoliating bP while protecting the bPn, has been then verified by using different vinyl monomers (styrene and N-vinylpyrrolidone), thus obtaining hybrids where the nanoflakes are embedded in polymer matrices with a variety of intriguing thermal, mechanical, and solubility characteristics.

  10. Discovery of a magnetic field in the δ Scuti F2m star ρ Pup

    Science.gov (United States)

    Neiner, C.; Wade, G. A.; Sikora, J.

    2017-06-01

    ρ Pup is a δ Scuti F2 pulsator, known to host a main radial mode as well as non-radial pulsations, with chemical peculiarities typical of evolved Am stars. We present a high-precision spectropolarimetric observations of this star, obtained with ESPaDOnS at the Canada-France-Hawaii Telescope in the frame of the BRITE spectropolarimetric survey. A magnetic field is clearly detected in ρ Pup, with a longitudinal field strength below 1 G. This makes ρ Pup the second known magnetic δ Scuti discovered, after HD 188774, and a possible cool evolved counterpart of the recently discovered ultraweakly magnetic Am family.

  11. NuSTAR DISCOVERY OF A 3.76 s TRANSIENT MAGNETAR NEAR SAGITTARIUS A*

    DEFF Research Database (Denmark)

    Mori, Kaya; Gotthelf, Eric V.; Zhang, Shuo

    2013-01-01

    We report the discovery of 3.76 s pulsations from a new burst source near Sgr A* observed by the NuSTAR observatory. The strong signal from SGR J1745-29 presents a complex pulse profile modulated with pulsed fraction 27% +/- 3% in the 3-10 keV band. Two observations spaced nine days apart yield a......-ray band or have been detected as high-B radio pulsars. The peculiar location of SGR J1745-29 has important implications for the formation and dynamics of neutron stars in the Galactic center region....

  12. Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication

    Energy Technology Data Exchange (ETDEWEB)

    Kanginakudru, Sriramana, E-mail: skangina@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); DeSmet, Marsha, E-mail: mdesmet@iupui.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Thomas, Yanique, E-mail: ysthomas@umail.iu.edu [Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States); Morgan, Iain M., E-mail: immorgan@vcu.edu [VCU Philips Institute for Oral Health Research, Virginia Commonwealth University, Richmond, Virginia (United States); Androphy, Elliot J., E-mail: eandro@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States)

    2015-04-15

    The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication.

  13. Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication

    International Nuclear Information System (INIS)

    Kanginakudru, Sriramana; DeSmet, Marsha; Thomas, Yanique; Morgan, Iain M.; Androphy, Elliot J.

    2015-01-01

    The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication

  14. INTCAL09 AND MARINE09 RADIOCARBON AGE CALIBRATION CURVES, 0-50,000 YEARS CAL BP

    NARCIS (Netherlands)

    Reimer, P. J.; Baillie, M. G. L.; Bard, E.; Bayliss, A.; Beck, J. W.; Blackwell, P. G.; Ramsey, C. Bronk; Buck, C. E.; Burr, G. S.; Edwards, R. L.; Friedrich, M.; Grootes, P. M.; Guilderson, T. P.; Hajdas, I.; Heaton, T. J.; Hogg, A. G.; Hughen, K. A.; Kaiser, K. F.; Kromer, B.; McCormac, F. G.; Manning, S. W.; Reimer, R. W.; Richards, D. A.; Southon, J. R.; Talamo, S.; Turney, C. S. M.; van der Plicht, J.; Weyhenmeye, C. E.; Weyhenmeyer, C.E.

    2009-01-01

    The IntCal04 and Marine04 radiocarbon calibration curves have been updated from 12 cal kBP (cal kBP is here defined as thousands of calibrated years before AD 1950), and extended to 50 cal kBP, utilizing newly available data sets that meet the IntCal Working Group criteria for pristine corals and

  15. 76 FR 69713 - Application To Export Electric Energy; BP Energy Company

    Science.gov (United States)

    2011-11-09

    ... DEPARTMENT OF ENERGY [OE Docket No. EA-314-A] Application To Export Electric Energy; BP Energy.... SUMMARY: BP Energy Company (BP Energy) has applied to renew its authority to transmit electric energy from... electric energy from the United States to Mexico as a power marketer for a five-year term using existing...

  16. Peculiarities of Corporate Culture Development under Conditions of Remote Working

    Directory of Open Access Journals (Sweden)

    Shchetinina Ludmila V

    2015-03-01

    Full Text Available The paper analyzes the significance and peculiarities of corporate culture formation for remote employees. Particular attention is paid to instruments that allow creating a team in the absence of the usual office environment. There have been defined the signs of trust manifestation that distinguish the corporate culture in a team with experience of teamwork and without such experience — a level of weakness manifestation and recognition of mistakes, presence of critics from colleagues, asking for recourse, interest in colleagues’ experience and skills. According to the signs the necessary management practices for the development and creation of the corporate culture has been offered. It is noted that the team with the experience of teamwork at the early stages acts quite consistently adhering to the declared standards, rules and basic values. However, even under these conditions, the corporate culture is growing weaker in time. And here it would be helpful to use the management practices that do not replace personal contact but are maximally close to it. All management practices are classified in accordance with the directions of the corporate culture development, namely, creation of effective social intranet, establishment of quality communication, transparent motivation and clear description of the control sequences, description and establishment of clear guidelines, development of personal effectiveness of employees, simplification of the project communication process, creation of “virtual coolers”, the philosophy of “getting into the body” of a remote employee, monitoring professional burnout, etc.

  17. Peculiarities of communicative rationality in the structural field of education

    Directory of Open Access Journals (Sweden)

    Y. S. Kravtsov

    2017-07-01

    Full Text Available The article deals with the new situation in the education sector, which is characterized by the peculiarities of modern stage of the educational system’s development and by the necessity to rethink the principles of educational values in the XXI century through the prism of sustainable development’s priorities. Sociological ideas of phenomenology, which do not form social reality things or events of the material world in terms of supporters, have actively been used bu the authors and also the meaning given to these objects and events have been used in the article. Ontological and epistemological factors emergence of a new historical type of society, in our case, the information, have been disclosed from a philosophical position.  According to the authors, the state of postmodern society is primarily determined by culture. It is cultural society, which studies different external influences, including economic life, in the human world. Feature of modern social cognition that sets a new paradigm is as follows: it is carried out through the analysis of which representations had mediated self cognitive attitude to social phenomena, accompanied by the deep mentally communicative nature of social reality and brought changes in the socio-communicative sphere.

  18. The Peculiarities of Cluster Formation in the Russian Nanotechnology Industry

    Directory of Open Access Journals (Sweden)

    Kurchenkov Vladimir Viktorovich

    2015-05-01

    Full Text Available The innovative development of the Russian economy in modern conditions should be based on the development of advanced nanotechnology. The formation of the nanotechnology industry in Russia requires optimal organization, the development of networking, the search for new forms of integrating the primary and secondary productions. The cluster organization in nanotech industry is based on high-tech production and has a number of advantages: uncertainty elimination, restriction of the competition by monopolization of supply with raw materials and semi-finished products, improvement of quality and decrease in expenses. The main forms of interaction of the enterprises and organizations which are a part of a nanoindustrial cluster are allocated. The article describes the peculiarities of the Russian nanoidustry formation, determines the significance of the cluster policy in this sphere. The author develops the criteria for identifying the nanoclusters on the basis of the basic nanotechnology and the nomenclature of final product. The author also proposes the approach to the analysis of cluster interaction and determines the boundaries of the cluster based on the difference between system and quasisystem cluster interaction. In this regard it is necessary to consider possibilities of the analysis of both system, and quasisystem interaction of the main participants of a nanoindustrial cluster.

  19. THE PSYCHOLOGICAL PECULIARITIES OF THE INFORMATION-COMMUNICATION COMPETENCE FORMATION

    Directory of Open Access Journals (Sweden)

    Pyannikov Mikhail Mikhailovich

    2013-01-01

    Full Text Available Informatization of society has significantly changed the paradigm of education, posing the new problems to the scientists. One of such problems is the formation of new conscience – conscience, whose inalienable part is the information culture. The information-communication competence is the basis for the formation of such conscience. In this connection the aim of study is the analysis of psychological peculiarities of the formation of information-communication competence and determination of the role of this personality new formation in conscience of a modern human. The characteristic features of psychological new formations, the stages of cultural development and the role of cultural level of society in the formation of world outlook of a child are studied in this work. In the result of study there was found out the basis of psychic development. The sphere of results application includes the conclusions received in the result of study, which can be used by scholars, who deal with the problem of psychic development of a child. In practice the data of study help to understand better the stages of skill formation and the role of elementary actions in the formation of complex behavioral system.

  20. THE PSYCHOLOGICAL PECULIARITIES OF THE INFORMATION-COMMUNICATION COMPETENCE FORMATION

    Directory of Open Access Journals (Sweden)

    Михаил Михайлович Пьянников

    2013-04-01

    Full Text Available Informatization of society has significantly changed the paradigm of education, posing the new problems to the scientists. One of such problems is the formation of new conscience – conscience, whose inalienable part is the information culture. The information-communication competence is the basis for the formation of such conscience. In this connection the aim of study is the analysis of psychological peculiarities of the formation of information-communication competence and determination of the role of this personality new formation in conscience of a modern human. The characteristic features of psychological new formations, the stages of cultural development and the role of cultural level of society in the formation of world outlook of a child are studied in this work. In the result of study there was found out the basis of psychic development. The sphere of results application includes the conclusions received in the result of study, which can be used by scholars, who deal with the problem of psychic development of a child. In practice the data of study help to understand better the stages of skill formation and the role of elementary actions in the formation of complex behavioral system.DOI: http://dx.doi.org/10.12731/2218-7405-2013-1-33

  1. Peculiar velocity effects in high-resolution microwave background experiments

    International Nuclear Information System (INIS)

    Challinor, Anthony; Leeuwen, Floor van

    2002-01-01

    We investigate the impact of peculiar velocity effects due to the motion of the solar system relative to the cosmic microwave background (CMB) on high resolution CMB experiments. It is well known that on the largest angular scales the combined effects of Doppler shifts and aberration are important; the lowest Legendre multipoles of total intensity receive power from the large CMB monopole in transforming from the CMB frame. On small angular scales aberration dominates and is shown here to lead to significant distortions of the total intensity and polarization multipoles in transforming from the rest frame of the CMB to the frame of the solar system. We provide convenient analytic results for the distortions as series expansions in the relative velocity of the two frames, but at the highest resolutions a numerical quadrature is required. Although many of the high resolution multipoles themselves are severely distorted by the frame transformations, we show that their statistical properties distort by only an insignificant amount. Therefore, the cosmological parameter estimation is insensitive to the transformation from the CMB frame (where theoretical predictions are calculated) to the rest frame of the experiment

  2. Visualization of political communication space: peculiarities and tendencies

    Directory of Open Access Journals (Sweden)

    O. O. Zaslavska

    2016-06-01

    Internet grows to everyday practice of objective reality of average Ukrainians. Internet actively builds up its social influence on society and turns to be such a social environment which like barometer reflects social and political situation in the country and determines integration processes in Ukrainian society. Ukrainians consider Internet at present time as potential resource to realize social and civil activity, the resource which makes it possible to impact on power structures and to control power by citizens. Still the social and civil practices in Internet have not become the everyday practice of average Ukrainians. This outcome is caused because of Ukrainians assess their ability too low as regards the impact on power as well as objective reasons of internet technologies development in modern society. The Internet democracy development has still young history of its emerge and social development. E-government, provision of e-services by e-governments, e-interaction of different social objects today, all of those things have just begun to grow and to win out their rights for existing in full value in the society. Undoubtedly, all of those peculiarities affect the special features of citizens’ participation in Internet in modern word. Such development needs the formation of public culture how to utilize the net and certain experience and skills to implement such interaction.

  3. Peculiarities of endotoxemia during radiotherapy of cervical carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Gabelov, A A; Kiselev, P N; Shul' s, T S [Tsentral' nyj Nauchno-Issledovatel' skij Rentgeno-Radiologicheskij Inst., Leningrad (USSR)

    1981-11-01

    Radiotherapy in cervical carcinoma patients is frequently followed by severe intestinal injuries which serve as prerequisites for the penetration of endotoxins of intestinal microflora into the systemic circulation. Peculiarities of possible development of endotoxemia were studied in 45 women with cervical carcinoma (Stages 2, 3). Radiotherapy was performed by routine methods (long-focus irradiation with subsequent intracavitary irradiation, or simultaneous long-focus and intracavitary irradiation). The presence of bacterial endotoxins in the patients blood was revealed by the testing of the lethal effect after intraperitoneal administration of the examined blood (0.1 ml) to random-bred albino mice simultaneously with actinomycin D(10 ..mu..g/mouse) that sharply increases the sensitivity of animals to a toxic effect of endotoxins. It has been established that involvement of the intestine in irradiation is followed by endotoxemia regardless of radiotherapeutic methods. The degree of severity of endotoxemia developing in the first half of a radiotherapeutic course depends on a radiation dose. On reaching a certain level, endotoxemia preserves its severity up to the end of irradiation and at early time after its completion.

  4. COMMUNICATIVE PECULIARITY OF INTERPRETATIVE AND DELIBERATIVE STYLE IN PEDAGOGICAL DISCOURSE

    Directory of Open Access Journals (Sweden)

    Тамара Николаевна Цинкерман

    2013-05-01

    Full Text Available The aim of the paper is to characterize the communicative peculiarities of the interpretative-deliberative style in pedagogical discourse. The object of the study is interpretative-deliberative style viewed as one of the communication forms in pedagogical discourse; the subject of the analysis is the stratagem and tactics characteristics of the interpretative-deliberative communicative style.  Descriptive and analytical as well as stylistic and discourse analysis methods are employed. The author reveals the most prevalent strategies–explanatory, interpretative and deliberative–employed in communicative interaction in situations of educative persuasion. The communicative characteristics of the analyzed style are: a rational type of the communicative action, a trust-based tone and the emotional involvement of the communication participants. The results can be used for clarifying specifics of speech behavior in educative communication as well as for comparing styles of educative communication in different enthnocultural traditions.DOI: http://dx.doi.org/10.12731/2218-7405-2013-4-32

  5. Dubowitz syndrome: common findings and peculiar urine odor

    Directory of Open Access Journals (Sweden)

    Chehade C

    2013-10-01

    Full Text Available Cynthia Chehade,1 Johnny Awwad,2 Nadine Yazbeck,1 Marianne Majdalani,1 Rima Wakim,1 Hala Tfayli,1 Chantal Farra1,31Department of Pediatrics and Adolescent Medicine, American University of Beirut Medical Center, Beirut, Lebanon; 2Department of Obstetrics and Gynecology, American University of Beirut Medical Center, Beirut, Lebanon; 3Department of Pathology and Laboratory Medicine, American University of Beirut Medical Center, Beirut, LebanonBackground: Dubowitz syndrome is a rare, autosomal recessive disorder characterized by intrauterine and postnatal growth retardation, severe microcephaly, psychomotor retardation, hyperactivity, eczema, and characteristic dysmorphic facial features. Although many cases have been reported, the cause of this disease is still unknown.Case: We present here the case of a Lebanese girl with Dubowitz syndrome in whom an unpleasant urine odor was persistently reported since birth.Conclusion: Although Dubowitz syndrome has been largely described in the medical literature, this is the first time that a peculiar urine odor was reported. This case report adds a new and unusual feature to the numerous findings related to this rare polymorphous syndrome.Keywords: Dubowitz syndrome, autosomal recessive, developmental delay, odorous urine

  6. Peculiarities of the organizational behavior of Russian doctors

    Directory of Open Access Journals (Sweden)

    Zh V Puzanova

    2014-12-01

    Full Text Available The article considers the peculiarities of the organizational behavior of Russian doctors and conditions of its formation determined by the development of the national health care system in the Russian and Soviet periods. The authors analyze the changes in the national health care system since the Semashko model that was created in the first years of Soviet power and evolved in the post-war period into a multi-level system of medical care with clearly differentiated structure of services and later into the Soviet model focusing on specialized outpatient care and large staff of narrowly focused specialists; from the first private medical clinics in the late 1980s to the decline of the sphere in the 1990s and the reforms of the beginning of the XXI century. All stages of the national health care system evolution are the determinants of the Russian doctors’ organizational behavior changes, the crisis of professional ethics, the transformations of the professional consciousness from the ideas of service and medical care to the principle of providing medical services. The authors also consider some implications of the national project ‘Health’ in the contemporary Russia.

  7. Stars and Flowers, Flowers and Stars

    Science.gov (United States)

    Minti, Hari

    2012-12-01

    The author, a graduated from the Bucharest University (1964), actually living and working in Israel, concerns his book to variable stars and flowers, two domains of his interest. The analogies includes double stars, eclipsing double stars, eclipses, Big Bang. The book contains 34 chapters, each of which concerns various relations between astronomy and other sciences and pseudosciences such as Psychology, Religion, Geology, Computers and Astrology (to which the author is not an adherent). A special part of the book is dedicated to archeoastronomy and ethnoastronomy, as well as to history of astronomy. Between the main points of interest of these parts: ancient sanctuaries in Sarmizegetusa (Dacia), Stone Henge(UK) and other. The last chapter of the book is dedicated to flowers. The book is richly illustrated. It is designed for a wide circle of readers.

  8. Global and radial variations in the efficiency of massive star formation among galaxies

    International Nuclear Information System (INIS)

    Allen, L.E.; Young, J.S.

    1990-01-01

    In order to determine the regions within galaxies which give rise to the most efficient star formation and to test the hypothesis that galaxies with high infrared luminosities per unit molecular mass are efficiently producing high mass stars, researchers have undertaken an H alpha imaging survey in galaxies whose CO distributions have been measured as part of the Five College Radio Astronomy Observatory (FCRAO) Extragalactic CO Survey. From these images researchers have derived global H alpha fluxes and distributions for comparison with far infrared radiation (FIR) fluxes and CO fluxes and distributions. Here, researchers present results on the global massive star formation efficiency (SFE = L sub H sub alpha/M(H2)) as a function of morphological type and environment, and on the radial distribution of the SFE within both peculiar and isolated galaxies. On the basis of comparison of the global L sub H sub alpha/M(H2) and L sub FIR/M(H2) for 111 galaxies, researchers conclude that environment rather than morphological type has the strongest effect on the global efficiency of massive star formation. Based on their study of a small sample, they find that the largest radial gradients are observed in the interacting/peculiar galaxies, indicating that environment affects the star formation efficiency within galaxies as well

  9. Modification of the Clinical Global Impressions (CGI) Scale for use in bipolar illness (BP): the CGI-BP.

    Science.gov (United States)

    Spearing, M K; Post, R M; Leverich, G S; Brandt, D; Nolen, W

    1997-12-05

    The Clinical Global Impressions Scale (CGI) was modified specifically for use in assessing global illness severity and change in patients with bipolar disorder. Criticisms of the original CGI were addressed by correcting inconsistencies in scaling, identifying time frames for comparison, clarifying definitions of illness severity and change, and separating out assessment of treatment side effects from illness improvement during treatment. A Detailed User's Guide was developed to train clinicians in the use of the new CGI-Bipolar Version (CGI-BP) for rating severity of manic and depressive episodes and the degree of change from the immediately preceding phase and from the worst phase of illness. The revised scale and manual provide a focused set of instructions to facilitate the reliability of these ratings of mania, depression, and overall bipolar illness during treatment of an acute episode or in longer-term illness prophylaxis. Interrater reliability of the scale was demonstrated in preliminary analyses. Thus, the modified CGI-BP is anticipated to be more useful than the original CGI in studies of bipolar disorder.

  10. Science Through ARts (STAR)

    Science.gov (United States)

    Kolecki, Joseph; Petersen, Ruth; Williams, Lawrence

    2002-01-01

    Science Through ARts (STAR) is an educational initiative designed to teach students through a multidisciplinary approach to learning. This presentation describes the STAR pilot project, which will use Mars exploration as the topic to be integrated. Schools from the United Kingdom, Japan, the United States, and possibly eastern Europe are expected to participate in the pilot project.

  11. European Stars and Stripes

    National Research Council Canada - National Science Library

    Hendricks, Nancy

    1994-01-01

    The European Stars and Stripes (ES&S) organization publishes a daily newspaper, The Stars and Stripes, for DoD personnel stationed in Germany, Italy, the United Kingdom, and other DoD activities in the U.S. European Command...

  12. Nebraska STARS: Achieving Results

    Science.gov (United States)

    Roschewski, Pat; Isernhagen, Jody; Dappen, Leon

    2006-01-01

    In 2000, the state of Nebraska passed legislation requiring the assessment of student performance on content standards, but its requirements were very different from those of any other state. Nebraska created what has come to be known as STARS (School-based Teacher-led Assessment and Reporting System). Under STARS, each of Nebraska's nearly 500…

  13. Convective overshooting in stars

    NARCIS (Netherlands)

    Andrássy, R.

    2015-01-01

    Numerous observations provide evidence that the standard picture, in which convective mixing is limited to the unstable layers of a star, is incomplete. The mixing layers in real stars are significantly more extended than what the standard models predict. Some of the observations require changing

  14. By Draconis Stars

    Science.gov (United States)

    Bopp, Bernard W.

    An optical spectroscopic survey of dK-M stars has resulted in the discovery of several new H-alpha emission objects. Available optical data suggest these stars have a level of chromospheric activity midway between active BY Dra stars and quiet dM's. These "marginal" BY Dra stars are single objects that have rotation velocities slightly higher than that of quiet field stars but below that of active flare/BY Dra objects. The marginal BY Dra stars provide us with a class of objects rotating very near a "trigger velocity" (believed to be 5 km/s) which appears to divide active flare/BY Dra stars from quiet dM's. UV data on Mg II emission fluxes and strength of transition region features such as C IV will serve to fix activity levels in the marginal objects and determine chromosphere and transition-region heating rates. Simultaneous optical magnetic field measures will be used to explore the connection between fieldstrength/filling-factor and atmospheric heating. Comparison of these data with published information on active and quiet dM stars will yield information on the character of the stellar dynamo as it makes a transition from "low" to "high" activity.

  15. Observing Double Stars

    Science.gov (United States)

    Genet, Russell M.; Fulton, B. J.; Bianco, Federica B.; Martinez, John; Baxter, John; Brewer, Mark; Carro, Joseph; Collins, Sarah; Estrada, Chris; Johnson, Jolyon; Salam, Akash; Wallen, Vera; Warren, Naomi; Smith, Thomas C.; Armstrong, James D.; McGaughey, Steve; Pye, John; Mohanan, Kakkala; Church, Rebecca

    2012-05-01

    Double stars have been systematically observed since William Herschel initiated his program in 1779. In 1803 he reported that, to his surprise, many of the systems he had been observing for a quarter century were gravitationally bound binary stars. In 1830 the first binary orbital solution was obtained, leading eventually to the determination of stellar masses. Double star observations have been a prolific field, with observations and discoveries - often made by students and amateurs - routinely published in a number of specialized journals such as the Journal of Double Star Observations. All published double star observations from Herschel's to the present have been incorporated in the Washington Double Star Catalog. In addition to reviewing the history of visual double stars, we discuss four observational technologies and illustrate these with our own observational results from both California and Hawaii on telescopes ranging from small SCTs to the 2-meter Faulkes Telescope North on Haleakala. Two of these technologies are visual observations aimed primarily at published "hands-on" student science education, and CCD observations of both bright and very faint doubles. The other two are recent technologies that have launched a double star renaissance. These are lucky imaging and speckle interferometry, both of which can use electron-multiplying CCD cameras to allow short (30 ms or less) exposures that are read out at high speed with very low noise. Analysis of thousands of high speed exposures allows normal seeing limitations to be overcome so very close doubles can be accurately measured.

  16. Infrared spectroscopy of four carbon stars with 9.8 micron emission from silicate grains

    International Nuclear Information System (INIS)

    Lambert, D.L.; Smith, V.V.; Hinkle, K.H.

    1990-01-01

    High-resolution K band and low resolution 4 micron spectra were obtained for four carbon stars showing IR emission by silicate grains. The results of the analysis of the K band spectra show that they are J-type stars. These results, together with published spectral classifications, show that all known carbon stars with a silicate emission feature are J-type stars. The 4 micron spectra are very similar to the spectra of classical J-type carbon stars, and do not show SiO bands that might come from a M giant companion. A binary model with a luminous M giant companion as a source of the silicate grain is rejected. It is proposed that the silicate grains formed from gas ejecta at or before the He-core flash, and that the flash initiates severe mixing, leading to the star's conversion to a J-type carbon star. The ejecta are stored in an accretion disk around a low mass unevolved companion. If it can be shown that the hypothesized accretion disk is stable and may be heated adequately, this binary model appears to account for these peculiar carbon stars. 41 refs

  17. Radioisotope dating beyond 50,000 years BP

    International Nuclear Information System (INIS)

    Beukens, R.P.

    1980-01-01

    A counting method for radiocarbon dating has been developed by the Toronto-Rochester-General Ionex group over the past two years using electrostatic tandem-accelerators as part of a mass spectrometer. The method uses very small samples of 1 mg or less and reaches high accuracy after counting for only a few hours. In principle this 14 C method can be used to date samples up to 100,000 years old but severe problems are anticipated with respect to sample contamination, particularly beyond 70,000 years BP. The counting method can also be applied to the detection of longer lived radioisotopes created in the upper atmosphere by the interaction of cosmic radiation, such as 36 Cl, 26 Al and 10 Be. (author)

  18. BP and Mobil present a united front in Europe

    International Nuclear Information System (INIS)

    Jackson, Kim.

    1997-01-01

    BP and Mobil announced the pooling of their European refining, marketing and lubricants businesses in February last year in an unprecedented step to cut costs and improve their competitive position in what is becoming an increasingly cut-throat market. Like their competitors, the two companies had been battling to contented with the continuing surplus refining capacity throughout Europe as well as significantly reduced profit margins on gasoline and other products sold at the pumps. This was particularly the case in the United Kingdom which is still reeling from the effects of the petrol pump price war waged over the past year and in France, too, where the hypermarkets are fiercely battling to retain their market share. (author)

  19. Neutron Stars and Pulsars

    CERN Document Server

    Becker, Werner

    2009-01-01

    Neutron stars are the most compact astronomical objects in the universe which are accessible by direct observation. Studying neutron stars means studying physics in regimes unattainable in any terrestrial laboratory. Understanding their observed complex phenomena requires a wide range of scientific disciplines, including the nuclear and condensed matter physics of very dense matter in neutron star interiors, plasma physics and quantum electrodynamics of magnetospheres, and the relativistic magneto-hydrodynamics of electron-positron pulsar winds interacting with some ambient medium. Not to mention the test bed neutron stars provide for general relativity theories, and their importance as potential sources of gravitational waves. It is this variety of disciplines which, among others, makes neutron star research so fascinating, not only for those who have been working in the field for many years but also for students and young scientists. The aim of this book is to serve as a reference work which not only review...

  20. Spectrophotometry of carbon stars

    Energy Technology Data Exchange (ETDEWEB)

    Oganesyan, R.K.; Karapetyan, M.S.; Nersisyan, S.E.

    1986-01-01

    The results are given of the spectrophotometric investigation of 56 carbon stars in the spectral range from 4000 to 6800 A with resolution 3 A. The observed energy distributions of these stars are determined relative to the flux at the wavelength /sub 0/ = 5556; they are presented in the form of graphs. The energy distributions have been obtained for the first time for 35 stars. Variation in the line Ba II 4554 A has been found in the spectra of St Cam, UU Aur, and RV Mon. Large changes have taken place in the spectra of RT UMa and SS Vir. It is noted that the spectra of carbon stars have a depression, this being situated in different spectral regions for individual groups of stars.

  1. Rotating stars in relativity.

    Science.gov (United States)

    Paschalidis, Vasileios; Stergioulas, Nikolaos

    2017-01-01

    Rotating relativistic stars have been studied extensively in recent years, both theoretically and observationally, because of the information they might yield about the equation of state of matter at extremely high densities and because they are considered to be promising sources of gravitational waves. The latest theoretical understanding of rotating stars in relativity is reviewed in this updated article. The sections on equilibrium properties and on nonaxisymmetric oscillations and instabilities in f -modes and r -modes have been updated. Several new sections have been added on equilibria in modified theories of gravity, approximate universal relationships, the one-arm spiral instability, on analytic solutions for the exterior spacetime, rotating stars in LMXBs, rotating strange stars, and on rotating stars in numerical relativity including both hydrodynamic and magnetohydrodynamic studies of these objects.

  2. THE PECULIAR PULSAR POPULATION OF THE CENTRAL PARSEC

    Energy Technology Data Exchange (ETDEWEB)

    Dexter, Jason; O' Leary, Ryan M., E-mail: jdexter@berkeley.edu, E-mail: oleary@berkeley.edu [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States)

    2014-03-01

    Pulsars orbiting the Galactic center black hole, Sgr A*, would be potential probes of its mass, distance, and spin, and may even be used to test general relativity. Despite predictions of large populations of both ordinary and millisecond pulsars in the Galactic center, none have been detected within 25 pc by deep radio surveys. One explanation has been that hyperstrong temporal scattering prevents pulsar detections, but the recent discovery of radio pulsations from a highly magnetized neutron star (magnetar) within 0.1 pc shows that the temporal scattering is much weaker than predicted. We argue that an intrinsic deficit in the ordinary pulsar population is the most likely reason for the lack of detections to date: a ''missing pulsar problem'' in the Galactic center. In contrast, we show that the discovery of a single magnetar implies efficient magnetar formation in the region. If the massive stars in the central parsec form magnetars rather than ordinary pulsars, their short lifetimes could explain the missing pulsars. Efficient magnetar formation could be caused by strongly magnetized progenitors, or could be further evidence of a top-heavy initial mass function. Furthermore, current high-frequency surveys should already be able to detect bright millisecond pulsars, given the measured degree of temporal scattering.

  3. On the evolution of stars

    International Nuclear Information System (INIS)

    Kippenhahn, R.

    1989-01-01

    A popular survey is given of the present knowledge on evolution and ageing of stars. Main sequence stars, white dwarf stars, and red giant stars are classified in the Hertzsprung-Russell (HR)-diagram by measurable quantities: surface temperature and luminosity. From the HR-diagram it can be concluded to star mass and age. Star-forming processes in interstellar clouds as well as stellar burning processes are illustrated. The changes occurring in a star due to the depletion of the nuclear energy reserve are described. In this frame the phenomena of planetary nebulae, supernovae, pulsars, neutron stars as well as of black holes are explained

  4. Monte Carlo simulation of star/linear and star/star blends with chemically identical monomers

    Energy Technology Data Exchange (ETDEWEB)

    Theodorakis, P E [Department of Materials Science and Engineering, University of Ioannina, 45110 Ioannina (Greece); Avgeropoulos, A [Department of Materials Science and Engineering, University of Ioannina, 45110 Ioannina (Greece); Freire, J J [Departamento de Ciencias y Tecnicas FisicoquImicas, Universidad Nacional de Educacion a Distancia, Facultad de Ciencias, Senda del Rey 9, 28040 Madrid (Spain); Kosmas, M [Department of Chemistry, University of Ioannina, 45110 Ioannina (Greece); Vlahos, C [Department of Chemistry, University of Ioannina, 45110 Ioannina (Greece)

    2007-11-21

    The effects of chain size and architectural asymmetry on the miscibility of blends with chemically identical monomers, differing only in their molecular weight and architecture, are studied via Monte Carlo simulation by using the bond fluctuation model. Namely, we consider blends composed of linear/linear, star/linear and star/star chains. We found that linear/linear blends are more miscible than the corresponding star/star mixtures. In star/linear blends, the increase in the volume fraction of the star chains increases the miscibility. For both star/linear and star/star blends, the miscibility decreases with the increase in star functionality. When we increase the molecular weight of linear chains of star/linear mixtures the miscibility decreases. Our findings are compared with recent analytical and experimental results.

  5. Monte Carlo simulation of star/linear and star/star blends with chemically identical monomers

    Science.gov (United States)

    Theodorakis, P. E.; Avgeropoulos, A.; Freire, J. J.; Kosmas, M.; Vlahos, C.

    2007-11-01

    The effects of chain size and architectural asymmetry on the miscibility of blends with chemically identical monomers, differing only in their molecular weight and architecture, are studied via Monte Carlo simulation by using the bond fluctuation model. Namely, we consider blends composed of linear/linear, star/linear and star/star chains. We found that linear/linear blends are more miscible than the corresponding star/star mixtures. In star/linear blends, the increase in the volume fraction of the star chains increases the miscibility. For both star/linear and star/star blends, the miscibility decreases with the increase in star functionality. When we increase the molecular weight of linear chains of star/linear mixtures the miscibility decreases. Our findings are compared with recent analytical and experimental results.

  6. Monte Carlo simulation of star/linear and star/star blends with chemically identical monomers

    International Nuclear Information System (INIS)

    Theodorakis, P E; Avgeropoulos, A; Freire, J J; Kosmas, M; Vlahos, C

    2007-01-01

    The effects of chain size and architectural asymmetry on the miscibility of blends with chemically identical monomers, differing only in their molecular weight and architecture, are studied via Monte Carlo simulation by using the bond fluctuation model. Namely, we consider blends composed of linear/linear, star/linear and star/star chains. We found that linear/linear blends are more miscible than the corresponding star/star mixtures. In star/linear blends, the increase in the volume fraction of the star chains increases the miscibility. For both star/linear and star/star blends, the miscibility decreases with the increase in star functionality. When we increase the molecular weight of linear chains of star/linear mixtures the miscibility decreases. Our findings are compared with recent analytical and experimental results

  7. RanBP3 influences interactions between CRM1 and its nuclear protein export substrates

    OpenAIRE

    Englmeier, Ludwig; Fornerod, Maarten; Bischoff, F. Ralf; Petosa, Carlo; Mattaj, Iain W.; Kutay, Ulrike

    2001-01-01

    We investigated the role of RanBP3, a nuclear member of the Ran-binding protein 1 family, in CRM1-mediated protein export in higher eukaryotes. RanBP3 interacts directly with CRM1 and also forms a trimeric complex with CRM1 and RanGTP. However, RanBP3 does not bind to CRM1 like an export substrate. Instead, it can stabilize CRM1–export substrate interaction. Nuclear RanBP3 stimulates CRM1-dependent protein export in permeabilized cells. These data indicate that RanBP3 functions by a novel mec...

  8. AMP-activated protein kinase phosphorylates CtBP1 and down-regulates its activity

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jae-Hwan; Choi, Soo-Youn; Kang, Byung-Hee; Lee, Soon-Min [National Creative Research Center for Epigenome Reprogramming Network, Departments of Biomedical Sciences and Biochemistry and Molecular Biology, Ischemic/Hypoxic Disease Institute, Seoul National University College of Medicine, Seoul 110-799 (Korea, Republic of); Park, Hyung Soon; Kang, Gum-Yong; Bang, Joo Young [Center for Biomedical Mass Spectrometry, Diatech Korea Co., Ltd., Seoul (Korea, Republic of); Cho, Eun-Jung [National Research Laboratory for Chromatin Dynamics, College of Pharmacy, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of); Youn, Hong-Duk, E-mail: hdyoun@snu.ac.kr [National Creative Research Center for Epigenome Reprogramming Network, Departments of Biomedical Sciences and Biochemistry and Molecular Biology, Ischemic/Hypoxic Disease Institute, Seoul National University College of Medicine, Seoul 110-799 (Korea, Republic of); WCU Department of Molecular Medicine and Biopharmaceutical Sciences, Graduate School of Convergence and Technology, Seoul National University, Seoul (Korea, Republic of)

    2013-02-01

    Highlights: ► AMPK phosphorylates CtBP1 on serine 158. ► AMPK-mediated phosphorylation of CtBP1 causes the ubiquitination and nuclear export of CtBP1. ► AMPK downregulates the CtBP1-mediated repression of Bax transcription. -- Abstract: CtBP is a transcriptional repressor which plays a significant role in the regulation of cell proliferation and tumor progression. It was reported that glucose withdrawal causes induction of Bax due to the dissociation of CtBP from the Bax promoter. However, the precise mechanism involved in the regulation of CtBP still remains unclear. In this study, we found that an activated AMP-activated protein kinase (AMPK) phosphorylates CtBP1 on Ser-158 upon metabolic stresses. Moreover, AMPK-mediated phosphorylation of CtBP1 (S158) attenuates the repressive function of CtBP1. We also confirmed that triggering activation of AMPK by various factors resulted in an increase of Bax gene expression. These findings provide connections of AMPK with CtBP1-mediated regulation of Bax expression for cell death under metabolic stresses.

  9. Star Cluster Structure from Hierarchical Star Formation

    Science.gov (United States)

    Grudic, Michael; Hopkins, Philip; Murray, Norman; Lamberts, Astrid; Guszejnov, David; Schmitz, Denise; Boylan-Kolchin, Michael

    2018-01-01

    Young massive star clusters (YMCs) spanning 104-108 M⊙ in mass generally have similar radial surface density profiles, with an outer power-law index typically between -2 and -3. This similarity suggests that they are shaped by scale-free physics at formation. Recent multi-physics MHD simulations of YMC formation have also produced populations of YMCs with this type of surface density profile, allowing us to narrow down the physics necessary to form a YMC with properties as observed. We show that the shallow density profiles of YMCs are a natural result of phase-space mixing that occurs as they assemble from the clumpy, hierarchically-clustered configuration imprinted by the star formation process. We develop physical intuition for this process via analytic arguments and collisionless N-body experiments, elucidating the connection between star formation physics and star cluster structure. This has implications for the early-time structure and evolution of proto-globular clusters, and prospects for simulating their formation in the FIRE cosmological zoom-in simulations.

  10. PECULIARITIES OF TREATMENT OF EPILEPSY AT GIRLS AND WOMEN

    Directory of Open Access Journals (Sweden)

    O. A. Pylaeva

    2015-01-01

    Full Text Available The epilepsy treatment is to be based on existing general principles and standards of therapy with differential approach to each patient. Besides peculiarities of treatment of different types of seizures and forms of epilepsy there are also differential approaches to special groups of patients. To one of such groups are referred to women of reproductive age. These patients are referred to special group of risk due to the development of certain side effects of antiepileptic drugs (АED. This article focuses in details on peculiarities of treatment of women of reproductive age with epilepsy with accent made on tolerability and safety of the antiepileptic therapy. It is necessary to take into consideration, that at women neuroendocrinal disorders can be caused both by the disease itself – epilepsy (in such case disorders depend on the starting age, form of epilepsy, focal localization, duration of disorder and other factors, referred to the disease, as well as by the undertaken therapy. The articlehereunder considers only issues, referred to the treatment, i. e. AED side effects and its input in the decrease of life quality of women with epilepsy. As women’s reproductive function starts forming long ago before childbearing age, it is necessary for this category to comprise not only women and adolescents, but girls as well. Notwithstanding the fact that so called benign forms of epilepsy pass before the pubescence period (idiopathic focal epilepsies, several forms of idiopathic generalized epilepsy, in many cases the epilepsy, which has started in childhood, continues in the adult age as well. In the same time there can be possible remote negative consequences of the antiepileptic therapy, which can show at a woman of a reproductive age. The data, given in the article, witnesses the need of the right AED selection at women of reproductive age, suffering from epilepsy. The AED should be selected not only depending on the form of the

  11. The peculiarities of the masticator muscles in rodents

    Directory of Open Access Journals (Sweden)

    C. Spataru

    2013-06-01

    Full Text Available Comparative research concerning masticatory musculature in squirrel, muskrat and rabbit, take into account the emphasizing and morphofunctional interpretation of the osteomuscular particularities involved in the prehension and mastication processes. The development of the coronoid process on the muskrat and squirrel demonstrates the growing of the force when raising the mandible by increasing the action force attached to the temporal muscle, with insertion on the coronoid process. In comparison with that, in the case of rabbits, both the coronoid process and the temporal muscle are reduced. From a philogenetic point of view, it has been found that the species that have the articular condyle lowered at or under the level of the dental tables (carnivores present a greater pressure force between the dental tables. Analyzing this aspect of the rodents taken into discussion, we noticed the lowering of the articular condyle up to the inferior molars' plane, in the case of squirrels and muskrats, but through obliquity, namely through cranial caudal and dorsoventral movement. This peculiarity is emphasized through the analysis of the angle formed by the axis of the mandible recurved branch (passing through the mandibular condyle with the axis of the horizontal branch of the mandible, where it was noticed that along with the increase in the angle formed by the two axes, which becomes an obtuse 160 degree angle on the squirrel and 130 degrees on the muskrat, there is also a lowering of the articular condyle up to the molar level, while in the case of carnivores, the lowering of the condyle is done without the modification of the angle between the two axes, which measures approximately 90 degrees.

  12. An Analysis of the Peculiar Type IIn Supernova 1995N

    Science.gov (United States)

    Baird, M. D.; Garnavich, P. M.; Schlegel, E. M.; Challis, P. M.; Kirshner, R. P.

    1998-12-01

    SN 1995N is a peculiar type IIn supernova. Spectroscopic and photometric data for this analysis were gathered between May 10, 1995 (two days after discovery) and July 18, 1998. A total of twenty two photometric images and eight spectra were obtained at the FLWO and MMTO. The photometric data show a broad maximum at R=17.0 occurred in late October, 1995, followed by a very slow decline at a rate of 2.39 millimag-day(-1) for R and 1.37 millimag-day(-1) for V. The R decay rate corresponds to a half life of 315 days, which is much longer than that of (56) Co. The spectra show broad hydrogen (1500 km/s FWHM) and oxygen (10000 km/s FWZI) emission features along with many unresolved emission lines. Some of the more interesting narrow lines identified correspond to high ionization states for iron such as Fe VII and Fe X which indicate temperatures as high as 10(6) degrees K. These high ionization states, the X-ray detection by Lewin et al. (1996, IAUC 6445) and the slow photometric decay suggest that SN 1995N is powered by a shock propagating through a dense circumstellar environment. From the earliest observations the energy output appears dominated by the interaction and not by radioactivity, implying that the progenitor exploded well before the discovery of SN 1995N. The situation may be similar to SN 1987A, where the rise in emission from a circumstellar interaction is only now beginning and is expected to peak some 15 years after the supernova explosion.

  13. THE SUBLUMINOUS AND PECULIAR TYPE Ia SUPERNOVA PTF 09dav

    International Nuclear Information System (INIS)

    Sullivan, M.; Ofek, E. O.; Blake, S.; Podsiadlowski, P.; Kasliwal, M. M.; Cooke, J.; Quimby, R.; Kulkarni, S. R.; Nugent, P. E.; Thomas, R. C.; Poznanski, D.; Howell, D. A.; Arcavi, I.; Gal-Yam, A.; Hook, I. M.; Mazzali, P.; Bildsten, L.; Bloom, J. S.; Cenko, S. B.; Law, N.

    2011-01-01

    PTF 09dav is a peculiar subluminous Type Ia supernova (SN) discovered by the Palomar Transient Factory (PTF). Spectroscopically, it appears superficially similar to the class of subluminous SN1991bg-like SNe, but it has several unusual features which make it stand out from this population. Its peak luminosity is fainter than any previously discovered SN1991bg-like SN Ia (M B ∼ -15.5), but without the unusually red optical colors expected if the faint luminosity were due to extinction. The photospheric optical spectra have very unusual strong lines of Sc II and Mg I, with possible Sr II, together with stronger than average Ti II and low velocities of ∼6000 km s -1 . The host galaxy of PTF09dav is ambiguous. The SN lies either on the extreme outskirts (∼41 kpc) of a spiral galaxy or in an very faint (M R ≥ -12.8) dwarf galaxy, unlike other 1991bg-like SNe which are invariably associated with massive, old stellar populations. PTF 09dav is also an outlier on the light-curve-width-luminosity and color-luminosity relations derived for other subluminous SNe Ia. The inferred 56 Ni mass is small (0.019 ± 0.003 M sun ), as is the estimated ejecta mass of 0.36 M sun . Taken together, these properties make PTF 09dav a remarkable event. We discuss various physical models that could explain PTF 09dav. Helium shell detonation or deflagration on the surface of a CO white dwarf can explain some of the features of PTF 09dav, including the presence of Sc and the low photospheric velocities, but the observed Si and Mg are not predicted to be very abundant in these models. We conclude that no single model is currently capable of explaining all of the observed signatures of PTF 09dav.

  14. Stars and Seasons in Southern Africa

    Science.gov (United States)

    Snedegar, K. V.

    Although the indigenous people of Southern Africa traditionally viewed the sky as a place quite apart from the Earth, they believed celestial phenomena to be natural signs united with those of the Earth in a harmonious synchronicity. There is no substantial evidence that the precolonial Africans imagined a casual relationship between celestial bodies and the seasonal patterns of life on Earth. They did, however, recognize a coincidental relationship. The traditional African cosmos, then, worked as a noetic principle unifying the observed motions of celestial bodies, the sequence of seasons, and the behavior of plants and animals. Such a cosmos, with local peculiarities, was widely understood in Southern Africa before the end of the last century. By the early 20th century European colonial paradigms had largely obliterated this African worldview. This paper will offer a partial reconstruction. Pre-colonial South African people viewed time as a sequence of discrete natural events; through annual repetition these events served as a guide for proper human action. The South Africans analyzed the passage of time in terms of the motions of celestial bodies, the maturation of beneficial plants, and the mating patterns of animals. The rightful course of human life was seen to fit within the seasonal context of these natural phenomena. The visibility of conspicuous stars and asterisms marked significant times of year. For instance, the Lovedu people greeted the dawn rising of Canopus with joy: "The boy has come out." The star was a signal for rainmaking and boys' initiation ceremonies to proceed. The Venda constellation Thutlwa, the giraffes, comprises α and β Crucis and α and β Centauri. In October Thutlwa skims the trees of the evening horizon. The Venda Thutlwa literally means 'rising above the trees,' an allusion to the majestic vegetarian creatures and the stars advising the people to be done with their spring planting. This paper will describe stellar associations

  15. The peculiar velocities of rich clusters in the hot and cold dark matter scenarios

    Science.gov (United States)

    Rhee, George F.; West, Michael J.; Villumsen, Jens V.

    1993-01-01

    We present the results of a study of the peculiar velocities of rich clusters of galaxies. The peculiar motion of rich clusters in various cosmological scenarios is of interest for a number of reasons. Observationally, one can measure the peculiar motion of clusters to greater distances than galaxies because cluster peculiar motions can be determined to greater accuracy. One can also test the slope of distance indicator relations using clusters to see if galaxy properties vary with environment. We have used N-body simulations to measure the amplitude and rms cluster peculiar velocity as a function of bias parameter in the hot and cold dark matter scenarios. In addition to measuring the mean and rms peculiar velocity of clusters in the two models, we determined whether the peculiar velocity vector of a given cluster is well aligned with the gravity vector due to all the particles in the simulation and the gravity vector due to the particles present only in the clusters. We have investigated the peculiar velocities of rich clusters of galaxies in the cold dark matter and hot dark matter galaxy formation scenarios. We have derived peculiar velocities and associated errors for the scenarios using four values of the bias parameter ranging from b = 1 to b = 2.5. The growth of the mean peculiar velocity with scale factor has been determined and compared to that predicted by linear theory. In addition, we have compared the orientation of force and velocity in these simulations to see if a program such as that proposed by Bertschinger and Dekel (1989) for elliptical galaxy peculiar motions can be applied to clusters. The method they describe enables one to recover the density field from large scale redshift distance samples. The method makes it possible to do this when only radial velocities are known by assuming that the velocity field is curl free. Our analysis suggests that this program if applied to clusters is only realizable for models with a low value of the bias

  16. Making star teams out of star players.

    Science.gov (United States)

    Mankins, Michael; Bird, Alan; Root, James

    2013-01-01

    Top talent is an invaluable asset: In highly specialized or creative work, for instance, "A" players are likely to be six times as productive as "B" players. So when your company has a crucial strategic project, why not multiply all that firepower and have a team of your best performers tackle it? Yet many companies hesitate to do this, believing that all-star teams don't work: Big egos will get in the way. The stars won't be able to work with one another. They'll drive the team Leader crazy. Mankins, Bird, and Root of Bain & Company believe it's time to set aside that thinking. They have seen all-star teams do extraordinary work. But there is a right way and a wrong way to organize them. Before you can even begin to assemble such a team, you need to have the right talent management practices, so you hire and develop the best people and know what they're capable of. You have to give the team appropriate incentives and leaders and support staffers who are stars in their own right. And projects that are ill-defined or small scale are not for all-star teams. Use them only for critical missions, and make sure their objectives are clear. Even with the right setup, things can still go wrong. The wise executive will take steps to manage egos, prune non-team-players, and prevent average coworkers from feeling completely undervalued. She will also invest a lot of time in choosing the right team Leader and will ask members for lots of feedback to monitor how that leader is doing.

  17. Stability of boson stars

    International Nuclear Information System (INIS)

    Gleiser, M.

    1988-01-01

    Boson stars are gravitationally bound, spherically symmetric equilibrium configurations of cold, free, or interacting complex scalar fields phi. As these equilibrium configurations naturally present local anisotropy, it is sensible to expect departures from the well-known stability criteria for fluid stars. With this in mind, I investigate the dynamical instability of boson stars against charge-conserving, small radial perturbations. Following the method developed by Chandrasekhar, a variational base for determining the eigenfrequencies of the perturbations is found. This approach allows one to find numerically an upper bound for the central density where dynamical instability occurs. As applications of the formalism, I study the stability of equilibrium configurations obtained both for the free and for the self-interacting [with V(phi) = (λ/4)chemical bondphichemical bond 4 ] massive scalar field phi. Instabilities are found to occur not for the critical central density as in fluid stars but for central densities considerably higher. The departure from the results for fluid stars is sensitive to the coupling λ; the higher the value of λ, the more the stability properties of boson stars approach those of a fluid star. These results are linked to the fractional anisotropy at the radius of the configuration

  18. From clouds to stars

    International Nuclear Information System (INIS)

    Elmegreen, B.G.

    1982-01-01

    At the present time, the theory of star formation must be limited to what we know about the lowest density gas, or about the pre-main sequence stars themselves. We would like to understand two basic processes: 1) how star-forming clouds are created from the ambient interstellar gas in the first place, and 2) how small parts of these clouds condense to form individual stars. We are interested also in knowing what pre-main sequence stars are like, and how they can interact with their environment. These topics are reviewed in what follows. In this series of lectures, what we know about the formation of stars is tentatively described. The lectures begin with a description of the interstellar medium, and then they proceed along the same direction that a young star would follow during its creation, namely from clouds through the collapse phase and onto the proto-stellar phase. The evolution of viscous disks and two models for the formation of the solar system are described in the last lectures. The longest lectures, and the topics that are covered in most detail, are not necessarily the ones for which we have the most information. Physically intuitive explanations for the various processes are emphasized, rather then mathematical explanations. In some cases, the mathematical aspects are developed as well, but only when the equations can be used to give important numerical values for comparison with the observations

  19. The Peculiar Multiwavelength Evolution Of V1535 Sco

    Science.gov (United States)

    Linford, J. D.; Chomiuk, L.; Nelson, T.; Finzell, T.; Walter, F. M.; Sokoloski, J. L.; Mukai, K.; Mioduszewski, A. J.; van der Horst, A. J.; Weston, J. H. S.; Rupen, M. P.

    2017-06-01

    We present multiwavelength observations of the unusual nova V1535 Sco throughout its outburst in 2015. Early radio observations were consistent with synchrotron emission, and early X-ray observations revealed the presence of high-energy (>1 keV) photons. These indicated that strong shocks were present during the first ∼2 weeks of the nova's evolution. The radio spectral energy distribution was consistent with thermal emission from week 2 to week 6. Starting in week 7, the radio emission again showed evidence of synchrotron emission, and there was an increase in X-ray emission, indicating a second shock event. The optical spectra show evidence of at least two separate outflows, with the faster outflow possibly having a bipolar morphology. The optical and near-infrared light curves and the X-ray {N}{{H}} measurements indicated that the companion star is likely a K giant.

  20. Nuclear physics of stars

    CERN Document Server

    Iliadis, Christian

    2007-01-01

    Thermonuclear reactions in stars is a major topic in the field of nuclear astrophysics, and deals with the topics of how precisely stars generate their energy through nuclear reactions, and how these nuclear reactions create the elements the stars, planets and - ultimately - we humans consist of. The present book treats these topics in detail. It also presents the nuclear reaction and structure theory, thermonuclear reaction rate formalism and stellar nucleosynthesis. The topics are discussed in a coherent way, enabling the reader to grasp their interconnections intuitively. The book serves bo

  1. Entropy Production of Stars

    Directory of Open Access Journals (Sweden)

    Leonid M. Martyushev

    2015-06-01

    Full Text Available The entropy production (inside the volume bounded by a photosphere of main-sequence stars, subgiants, giants, and supergiants is calculated based on B–V photometry data. A non-linear inverse relationship of thermodynamic fluxes and forces as well as an almost constant specific (per volume entropy production of main-sequence stars (for 95% of stars, this quantity lies within 0.5 to 2.2 of the corresponding solar magnitude is found. The obtained results are discussed from the perspective of known extreme principles related to entropy production.

  2. Peculiarities of neutron interaction with boron containing semiconductors

    International Nuclear Information System (INIS)

    Didyk, A.Yu.; ); Hofman, A.; Institute of Atomic Energy, Otwock/Swierk; Vlasukova, L.A.

    2009-01-01

    The results of point defect creation calculation in B 4 C, BN and BP semiconductor single crystals irradiated in the fast neutron reactor IBR-2 are presented. It has been shown that during the thermal neutron interaction with light isotope boron atoms ( 10 B) the damage creation by means of fission nuclear reaction fragments (alpha particles and 7 Li recoil nuclei) exceeds the damage created by fast neutrons (E n > 0.1 MeV) by more than two orders of value. It has been concluded that such irradiation can create a well developed radiation defect structure in boron-containing crystals with nearly homogeneous vacancy depth distribution. This may be used in technological applications for more effective diffusion of impurities implanted at low energies or deposited onto the semiconductor surface. The developed homogeneous vacancy structure is very suitable for the radiation enhanced diffusion of electrically charged or neutral impurities from the surface into the technological depth of semiconductor devices under post irradiation treatment. (authors)

  3. Extreme isolation of WN3/O3 stars and implications for their evolutionary origin as the elusive stripped binaries

    Science.gov (United States)

    Smith, Nathan; Götberg, Ylva; de Mink, Selma E.

    2018-03-01

    Recent surveys of the Magellanic Clouds have revealed a subtype of Wolf-Rayet (WR) star with peculiar properties. WN3/O3 spectra exhibit both WR-like emission and O3 V-like absorption - but at lower luminosity than O3 V or WN stars. We examine the projected spatial distribution of WN3/O3 stars in the Large Magellanic Cloud as compared to O-type stars. Surprisingly, WN3/O3 stars are among the most isolated of all classes of massive stars; they have a distribution similar to red supergiants dominated by initial masses of 10-15 M⊙, and are far more dispersed than classical WR stars or luminous blue variables. Their lack of association with clusters of O-type stars suggests strongly that WN3/O3 stars are not the descendants of single massive stars (30 M⊙ or above). Instead, they are likely products of interacting binaries at lower initial mass (10-18 M⊙). Comparison with binary models suggests a probable origin with primaries in this mass range that were stripped of their H envelopes through non-conservative mass transfer by a low-mass secondary. We show that model spectra and positions on the Hertzsprung-Russell diagram for binary-stripped stars are consistent with WN3/O3 stars. Monitoring radial velocities with high-resolution spectra can test for low-mass companions or runaway velocities. With lower initial mass and environments that avoid very massive stars, the WN3/O3 stars fit expectations for progenitors of Type Ib and possibly Type Ibn supernovae.

  4. One common structural peculiarity of the Solar system bodies including the star, planets, satellites and resulting from their globes rotation

    Science.gov (United States)

    Kochemasov, G. G.

    2008-09-01

    Often observed a sensible difference in appearance and structure between tropical and extra-tropical zones of various heavenly bodies including rocky and gas planets, satellites and Sun compels to look for a common reason of such phenomenon. All bodies rotate and their spherical shape makes zones at different latitudes to have differing angular momenta as a distance to the rotation axis diminishes gradually from the equator to the poles (this is felt particularly when one launches rockets into space -preferable more cheap launches are from the equatorial regions - Kourou is better than Baikonur). One of remarkable changes occurs at tropics. As a single rotating planetary body tends to have angular momenta of its tectonic blocks equilibrated it starts mechanisms leveling this basic physical property. At tropical zones (bulged also due to the rotation ellipsoid) the outer shell - crust as a consequence tends to be destroyed, sunk, subsided and shrunk; a density of crust material changes; the atmosphere reacts changing chemistry and structure; in terrestrial anthroposphere man looses its mass and stature. But according to the Le Chatelier rule mechanisms with an opposing tendency also begin to act. At Earth the wide planetary long tropical zone is marked by destruction of the crust. It is demonstrated by development of numerous islands of the Malay Archipelago (the Sunda Isls., Maluku Isls, Philippines) between the Southeastern Asia and Australia. In Africa and South America huge depressions of the Congo and Amazon Rivers develops where the Archean crust is subsided to depths of more than 2 km. In the Pacific along the equator numerous islands of Micronesia occur. Subsidence of the basaltic oceanic crust is followed by an intensive folding and faulting of basalt and sedimentary layers (Fig. 1) as a larger mass must be held by a smaller space (a planetary radius is diminished). The central Atlantic is very demonstrative in this sense suffering huge transform fault zones changing to more quite tectonics to the north and south where basaltic effusions form large provinces. This addition of dense basalts to the crust plays to increasing angular momentum of the extra-tropical blocks. At Mars the widespread enigmatic chaotic and fretted terrains at the highland-lowland boundary could be considered as traces of the crust destruction along the wide tropical belt. A system of hillocks and their relics and separating them depressions is controlled by a crosscutting tectonics. Prevailing subsidence here is characteristic. At Saturn a wide tropical zone usually has higher albedo than extra-tropical ones. Relatively heavier methane clouds in the H-He atmosphere are absent around the equator and concentrated on the higher latitudes (Fig. 2). In the tropical zone of Titan the darker methane lowlands (Fig. 3) are normally rippled in at least two directions with spacing a few km to 20 km (such forms erroneously are taken as dunes) (Fig. 4). This subsidence rippling gradually is replaced by smooth surfaces of dark basins (possibly liquid methane) at the higher northern and at lesser degree southern latitudes. This planetary pattern (Fig. 3, 4) is comparable with a behavior of the basalt floor of terrestrial oceans. On Iapetus the wide equatorial zone of the bright trailing hemisphere is distinguished by relatively numerous craters with darkened floors (Fig. 5). This terrain connects both flanks of the dark leading hemisphere and is a continuation of its equatorial bulge (a squeezed out feature as a result of the dark hemisphere subsidence). Thus looks tending subside and disintegrate tropical terrain on the uplifted bright hemisphere. Around the Tethys' equator there is a band of slightly darker surface material (Fig. 6). It may be an area of less contaminated ice and ice with a different structure than ice at higher latitudes as think Cassini scientists. If it is coarser-grained (more loosely packed) and purer then the equatorial region tends to be less dense diminishing its angular momentum. A crosscutting wave rippling producing chains of square craters here is also clearly visible. Sun presents a special case because its equatorial region rotates faster than the higher latitudes. It could be attributed to an important loss of angular momentum by this region during formation of planets (significant transfer of momentum to the planetary system) and its compensation according to the Le Chatelier rule by the faster rotation. But, in turn, this faster rotation causes an intensive destruction of this region in tendency to keep " status quo". The photosphere is "perforated" by darker colder spots deep up to 300 (maybe more?) km - famous solar spots long to 200000 km and smaller pores (Fig. 7). In the chromosphere there is a remarkable loss of "heavy" Ca ion from this region (compare with the loss of methane from the equatorial region of Saturn). Under more close inspection of other planetary bodies this uniform separation of tropical and extra-tropical zones should be discovered.

  5. Strong far-infrared cooling lines, peculiar CO kinematics, and possible star-formation suppression in Hickson compact group 57

    DEFF Research Database (Denmark)

    Alatalo, K.; Appleton, P. N.; Lisenfeld, U.

    2014-01-01

    We present [C II] and [O I] observations from Herschel and CO(1-0) maps from the Combined Array for Research in Millimeter Astronomy (CARMA) of the Hickson compact group HCG 57, focusing on the galaxies HCG 57a and HCG 57d. HCG 57a has been previously shown to contain enhanced quantities of warm ...

  6. The unusual gamma-ray burst GRB 101225A explained as a minor body falling onto a neutron star.

    Science.gov (United States)

    Campana, S; Lodato, G; D'Avanzo, P; Panagia, N; Rossi, E M; Della Valle, M; Tagliaferri, G; Antonelli, L A; Covino, S; Ghirlanda, G; Ghisellini, G; Melandri, A; Pian, E; Salvaterra, R; Cusumano, G; D'Elia, V; Fugazza, D; Palazzi, E; Sbarufatti, B; Vergani, S D

    2011-11-30

    The tidal disruption of a solar-mass star around a supermassive black hole has been extensively studied analytically and numerically. In these events, the star develops into an elongated banana-shaped structure. After completing an eccentric orbit, the bound debris falls into the black hole, forming an accretion disk and emitting radiation. The same process may occur on planetary scales if a minor body passes too close to its star. In the Solar System, comets fall directly into our Sun or onto planets. If the star is a compact object, the minor body can become tidally disrupted. Indeed, one of the first mechanisms invoked to produce strong gamma-ray emission involved accretion of comets onto neutron stars in our Galaxy. Here we report that the peculiarities of the 'Christmas' gamma-ray burst (GRB 101225A) can be explained by a tidal disruption event of a minor body around an isolated Galactic neutron star. This would indicate either that minor bodies can be captured by compact stellar remnants more frequently than occurs in the Solar System or that minor-body formation is relatively easy around millisecond radio pulsars. A peculiar supernova associated with a gamma-ray burst provides an alternative explanation.

  7. Carbon Stars T. Lloyd Evans

    Indian Academy of Sciences (India)

    that the features used in estimating luminosities of ordinary giant stars are just those whose abundance ... This difference between the spectral energy distributions (SEDs) of CH stars and the. J stars, which belong to .... that the first group was binaries, as for the CH stars of the solar vicinity, while those of the second group ...

  8. Rotation and magnetism in intermediate-mass stars

    Science.gov (United States)

    Quentin, Léo G.; Tout, Christopher A.

    2018-06-01

    Rotation and magnetism are increasingly recognized as important phenomena in stellar evolution. Surface magnetic fields from a few to 20 000 G have been observed and models have suggested that magnetohydrodynamic transport of angular momentum and chemical composition could explain the peculiar composition of some stars. Stellar remnants such as white dwarfs have been observed with fields from a few to more than 109 G. We investigate the origin of and the evolution, on thermal and nuclear rather than dynamical time-scales, of an averaged large-scale magnetic field throughout a star's life and its coupling to stellar rotation. Large-scale magnetic fields sustained until late stages of stellar evolution with conservation of magnetic flux could explain the very high fields observed in white dwarfs. We include these effects in the Cambridge stellar evolution code using three time-dependant advection-diffusion equations coupled to the structural and composition equations of stars to model the evolution of angular momentum and the two components of the magnetic field. We present the evolution in various cases for a 3 M_{⊙} star from the beginning to the late stages of its life. Our particular model assumes that turbulent motions, including convection, favour small-scale field at the expense of large-scale field. As a result, the large-scale field concentrates in radiative zones of the star and so is exchanged between the core and the envelope of the star as it evolves. The field is sustained until the end of the asymptotic giant branch, when it concentrates in the degenerate core.

  9. 4E-BP1 regulates the differentiation of white adipose tissue.

    Science.gov (United States)

    Tsukiyama-Kohara, Kyoko; Katsume, Asao; Kimura, Kazuhiro; Saito, Masayuki; Kohara, Michinori

    2013-07-01

    4E Binding protein 1 (4E-BP1) suppresses translation initiation. The absence of 4E-BP1 drastically reduces the amount of adipose tissue in mice. To address the role of 4E-BP1 in adipocyte differentiation, we characterized 4E-BP1(-/-) mice in this study. The lack of 4E-BP1 decreased the amount of white adipose tissue and increased the amount of brown adipose tissue. In 4E-BP1(-/-) MEF cells, PPARγ coactivator 1 alpha (PGC-1α) expression increased and exogenous 4E-BP1 expression suppressed PGC-1α expression. The level of 4E-BP1 expression was higher in white adipocytes than in brown adipocytes and showed significantly greater up-regulation in white adipocytes than in brown adipocytes during preadipocyte differentiation into mature adipocytes. The amount of PGC-1α was consistently higher in HB cells (a brown preadipocyte cell line) than in HW cells (a white preadipocyte cell line) during differentiation. Moreover, the ectopic over-expression of 4E-BP1 suppressed PGC-1α expression in white adipocytes, but not in brown adipocytes. Thus, the results of our study indicate that 4E-BP1 may suppress brown adipocyte differentiation and PGC-1α expression in white adipose tissues. © 2013 The Authors Genes to Cells © 2013 by the Molecular Biology Society of Japan and Wiley Publishing Asia Pty Ltd.

  10. Peculiarities of application the method of autogenic training in the correction of eating behavior

    OpenAIRE

    Shebanova, Vitaliya

    2014-01-01

    The article presented peculiarities of applying the method of autogenic training in the correction of eating disorders. Described stages of correction work with desadaptive eating behavior. Author makes accent on the rules self-assembly formula intentions.

  11. Size distribution of interstellar particles. III. Peculiar extinctions and normal infrared extinction

    International Nuclear Information System (INIS)

    Mathis, J.S.; Wallenhorst, S.G.

    1981-01-01

    The effect of changing the upper and lower size limits of a distribution of bare graphite and silicate particles with n(a)αa/sup -q/ is investigated. Mathis, Rumpl, and Nordsieck showed that the normal extinction is matched very well by having the small-size cutoff, a/sub -/, roughly-equal0.005 or 0.01 μm, and the large size a/sub +/, about 0.25 μm, and q = 3.5 for both substances. We consider the progressively peculiar extinctions exhibited by the well-observed stars, sigma Sco, rho Oph, and theta 1 Ori C, with values of R/sub v/[equivalentA/sub v//E(B--V)] of 3.4, 4.4, and 5.5 compared to the normal 3.1. Two (sigma Sco, rho Oph) are in a neutral dense cloud; theta 1 Ori C is in the Orion Nebula. We find that sigma Sco has a normal graphite distribution but has had its small silicate particles removed, so that a/sub -/(sil)roughly-equal0.04 μm if q = 3.5, or q(sil) = 2.6 if the size limits are fixed. However, the upper size limit on silicates remains normal. In rho Oph, the graphite is still normal, but both a/sub -/(sil) and a/sub +/(sil) are increased, to about 0.04 μm and 0.4 or 0.5 μm, respectively, if q = 3.5, or q(sil)roughly-equal1.3 if the size limits are fixed. In theta 1 Ori, the small limit on graphite has increased to about 0.04 μm, or q(gra)roughly-equal3, while the silicates are about like those in rho Oph. The calculated lambda2175 bump is broader than the observed, but normal foreground extinction probably contributes appreciably to the observed bump. The absolute amount of extinction per H atom for rho Oph is not explained. The column density of H is so large that systematic effects might be present. Very large graphite particles (a>3 μm) are required to ''hide'' the graphite without overly affecting the visual extinction, but a normal (small) graphite size distribution is required by the lambda2175 bump. We feel that it is unlikely that such a bimodal distribution exists

  12. Intensive Versus Standard Blood Pressure Control in SPRINT-Eligible Participants of ACCORD-BP.

    Science.gov (United States)

    Buckley, Leo F; Dixon, Dave L; Wohlford, George F; Wijesinghe, Dayanjan S; Baker, William L; Van Tassell, Benjamin W

    2017-12-01

    We sought to determine the effect of intensive blood pressure (BP) control on cardiovascular outcomes in participants with type 2 diabetes mellitus (T2DM) and additional risk factors for cardiovascular disease (CVD). This study was a post hoc, multivariate, subgroup analysis of ACCORD-BP (Action to Control Cardiovascular Risk in Diabetes Blood Pressure) participants. Participants were eligible for the analysis if they were in the standard glucose control arm of ACCORD-BP and also had the additional CVD risk factors required for SPRINT (Systolic Blood Pressure Intervention Trial) eligibility. We used a Cox proportional hazards regression model to compare the effect of intensive versus standard BP control on CVD outcomes. The "SPRINT-eligible" ACCORD-BP participants were pooled with SPRINT participants to determine whether the effects of intensive BP control interacted with T2DM. The mean baseline Framingham 10-year CVD risk scores were 14.5% and 14.8%, respectively, in the intensive and standard BP control groups. The mean achieved systolic BP values were 120 and 134 mmHg in the intensive and standard BP control groups ( P control reduced the composite of CVD death, nonfatal myocardial infarction (MI), nonfatal stroke, any revascularization, and heart failure (hazard ratio 0.79; 95% CI 0.65-0.96; P = 0.02). Intensive BP control also reduced CVD death, nonfatal MI, and nonfatal stroke (hazard ratio 0.69; 95% CI 0.51-0.93; P = 0.01). Treatment-related adverse events occurred more frequently in participants receiving intensive BP control (4.1% vs. 2.1%; P = 0.003). The effect of intensive BP control on CVD outcomes did not differ between patients with and without T2DM ( P > 0.62). Intensive BP control reduced CVD outcomes in a cohort of participants with T2DM and additional CVD risk factors. © 2017 by the American Diabetes Association.

  13. Relations between constructive peculiarities and structural behavior in Venice buildings

    Directory of Open Access Journals (Sweden)

    Doglioni, F.

    2012-12-01

    Full Text Available Here we are synthetically describing some constructive peculiarities of Venice civil buildings, analyzing the relation with the features of their structural decay and behavior in the long run. We suppose Venetian buildings, especially those parts which are conceived to suit the lagoon environment, to have undergone an evolution made of some adjustments, which were based on the observation of damages in previous buildings. That is we suppose ancient builders to rely on their awareness of the behavior of structures yet to come, and to be able to forecast it in part. This process brought some building contrivances to perfection, as exclusive and enduring features of Venice, overcoming changes in style and architectural layout, till they grew into essential elements of a whole and adaptable “device”. This writing is meant for a concise interpretation of this device, which is the result of some research works carried out at Venice IUAV University.

    En este texto, se describen sintéticamente algunas peculiaridades de la edificación residencial de Venecia, analizando su relación con el abanico de problemas estructurales que caracterizan el comportamiento estructural del edificio a lo largo del tiempo. Se aventura la hipótesis que las construcciones venecianas y, en particular, algunos de sus detalles, concebidos específicamente para la laguna donde se enclava, han sido objeto de una adaptación evolutiva a través de la observación de los problemas estructurales de los edificios precedentes. Los alarifes venecianos aprendieron a tener en cuenta el comportamiento estructural posterior del edificio, que previeron en cierta medida. Este proceso ha llevado a perfeccionar algunos detalles constructivos exclusivos de Venecia que han perdurado en el tiempo, que han resistido impertérritos a mutaciones de estilo y de configuración arquitectónica, hasta constituir elementos esenciales de un aparato indivisible y adaptable cuya interpretaci

  14. PECULIARITIES OF GRAMMAR STUDY OF MOUNTAIN FIRST-FORM PUPILS

    Directory of Open Access Journals (Sweden)

    Marija Kiryk

    2015-04-01

    Full Text Available The articles describes the role of analiztor system (auditory, visual, kinesthetic at the initial stage of learning literacy and language development six years old. They from specific integration system, that provides more efficient perception, memorization and reproduction of educational material. The article deals with attempt to ascertain linguadidactic interconnections and interdependence between grammar education (reading, writing and speech of six-year pupils. Summing up it should be mentioned to organize 6-year pupils studing in the country mountain school becides pedagogical, economical, geographic and social problems psychologic linguadidactic are added. Preferences of mountain country children: –                    Formation from childhood ability to live in harmony with nature; –                    Sensitive  perception of alive and inanimate surrounding nature; –                    Life-style form children’s responsibility for entrusted things, labour habits, training by hard nature conditions. They should be solved in complex providing achievents of psychology, pedagogics, linguists and up-to-date technology. The aim of the article  - to reveal individual peculiarities of country mountain child who needs special method of approach to grammar studing as well as to help country teacher who strongly feels lack for efficient method help. All these affect on prepearing level, children’s outlook, general development. Scientific and methodogical institutions have not easy task-system training and skill raising of primary school teachers to realize State standart of primary general education. Acquaintance of country teacher with up-to-date achievements in psychologic, pedagogic and linguistic education will help him to organize his work in the country school on rather higher level as well as let him give more qualitative education services and save country school as the

  15. Exploring cosmic origins with CORE: Effects of observer peculiar motion

    Science.gov (United States)

    Burigana, C.; Carvalho, C. S.; Trombetti, T.; Notari, A.; Quartin, M.; Gasperis, G. D.; Buzzelli, A.; Vittorio, N.; De Zotti, G.; de Bernardis, P.; Chluba, J.; Bilicki, M.; Danese, L.; Delabrouille, J.; Toffolatti, L.; Lapi, A.; Negrello, M.; Mazzotta, P.; Scott, D.; Contreras, D.; Achúcarro, A.; Ade, P.; Allison, R.; Ashdown, M.; Ballardini, M.; Banday, A. J.; Banerji, R.; Bartlett, J.; Bartolo, N.; Basak, S.; Bersanelli, M.; Bonaldi, A.; Bonato, M.; Borrill, J.; Bouchet, F.; Boulanger, F.; Brinckmann, T.; Bucher, M.; Cabella, P.; Cai, Z.-Y.; Calvo, M.; Castellano, M. G.; Challinor, A.; Clesse, S.; Colantoni, I.; Coppolecchia, A.; Crook, M.; D'Alessandro, G.; Diego, J.-M.; Di Marco, A.; Di Valentino, E.; Errard, J.; Feeney, S.; Fernández-Cobos, R.; Ferraro, S.; Finelli, F.; Forastieri, F.; Galli, S.; Génova-Santos, R.; Gerbino, M.; González-Nuevo, J.; Grandis, S.; Greenslade, J.; Hagstotz, S.; Hanany, S.; Handley, W.; Hernández-Monteagudo, C.; Hervias-Caimapo, C.; Hills, M.; Hivon, E.; Kiiveri, K.; Kisner, T.; Kitching, T.; Kunz, M.; Kurki-Suonio, H.; Lamagna, L.; Lasenby, A.; Lattanzi, M.; Lesgourgues, J.; Liguori, M.; Lindholm, V.; Lopez-Caniego, M.; Luzzi, G.; Maffei, B.; Mandolesi, N.; Martinez-Gonzalez, E.; Martins, C. J. A. P.; Masi, S.; Matarrese, S.; McCarthy, D.; Melchiorri, A.; Melin, J.-B.; Molinari, D.; Monfardini, A.; Natoli, P.; Paiella, A.; Paoletti, D.; Patanchon, G.; Piat, M.; Pisano, G.; Polastri, L.; Polenta, G.; Pollo, A.; Poulin, V.; Remazeilles, M.; Roman, M.; Rubiño-Martín, J.-A.; Salvati, L.; Tartari, A.; Tomasi, M.; Tramonte, D.; Trappe, N.; Tucker, C.; Väliviita, J.; Van de Weijgaert, R.; van Tent, B.; Vennin, V.; Vielva, P.; Young, K.; Zannoni, M.

    2018-04-01

    We discuss the effects on the cosmic microwave background (CMB), cosmic infrared background (CIB), and thermal Sunyaev-Zeldovich effect due to the peculiar motion of an observer with respect to the CMB rest frame, which induces boosting effects. After a brief review of the current observational and theoretical status, we investigate the scientific perspectives opened by future CMB space missions, focussing on the Cosmic Origins Explorer (CORE) proposal. The improvements in sensitivity offered by a mission like CORE, together with its high resolution over a wide frequency range, will provide a more accurate estimate of the CMB dipole. The extension of boosting effects to polarization and cross-correlations will enable a more robust determination of purely velocity-driven effects that are not degenerate with the intrinsic CMB dipole, allowing us to achieve an overall signal-to-noise ratio of 13; this improves on the Planck detection and essentially equals that of an ideal cosmic-variance-limited experiment up to a multipole lsimeq2000. Precise inter-frequency calibration will offer the opportunity to constrain or even detect CMB spectral distortions, particularly from the cosmological reionization epoch, because of the frequency dependence of the dipole spectrum, without resorting to precise absolute calibration. The expected improvement with respect to COBE-FIRAS in the recovery of distortion parameters (which could in principle be a factor of several hundred for an ideal experiment with the CORE configuration) ranges from a factor of several up to about 50, depending on the quality of foreground removal and relative calibration. Even in the case of simeq1 % accuracy in both foreground removal and relative calibration at an angular scale of 1o, we find that dipole analyses for a mission like CORE will be able to improve the recovery of the CIB spectrum amplitude by a factor simeq 17 in comparison with current results based on COBE-FIRAS. In addition to the

  16. Regional Peculiarities of Gender Policy in the Republic of Belarus

    Directory of Open Access Journals (Sweden)

    Flura I. Khramtsova

    2017-01-01

    Full Text Available The essence of the state gender policy at the present stage in the Republic of Belarus is substantiated. The regional peculiarities of the implementation of the state program document «The National Plan of Action for Ensuring Gender Equality for 2017-2020» are disclosed. The experience of designing a regional plan for the implementation of the state gender policy of the Minsk City Executive Committee for 2017-2020 is shown on the example of the Academy of Management under the President of the Republic of Belarus. In the broad sense, gender policy is understood as one of the strategic directions of social policy. At the same time, gender policy is aimed at overcoming discrimination based on gender, gender asymmetry in the sphere of power relations, gender imbalance in the labor market, employment. Gender policy in the context of international legislative acts takes into account the national identity, the features of the political system, and the socio-economic development of a concrete state. With all existing differences, gender policy in its narrow meaning is a purposeful, dynamic, adaptive process of public administration, regulation, coordination, control in the sphere of gender relations on three bases: political doctrine; state ideology; program priorities and values of gender equality. The interdisciplinarity of gender policy integrates it with other areas of social policy. Thus, gender policy is implicit in goals, the content of state family policy, demographic, educational, youth, protection of maternity and childhood . Formation and implementation of gender policy is based on analysis, interpretation of statistical data (social policy directions, which are disaggregated by sex, in the dynamics of indicators. Based on the UN used methodology, taking into account the national specifics of the Belarusian society, has been created relevant gender statistics and it is developing as an information resource for decision-making. Gender

  17. Peculiarities of adaptive and compensatory abilities of the modern pupils

    Directory of Open Access Journals (Sweden)

    Тетяна Володимирівна Фролова

    2015-06-01

    Full Text Available In conditions of an intense functioning of child organism an influence of unfavorable factors can result into breakdown of adaptive and compensatory mechanisms and to become a presupposition for forming pathology.Aim: to define peculiarities of adaptive and compensatory abilities of school-aged children during the school year.Methods. 970 children 9-17 years old were examined at the beginning and at the end of school year. Children were divided in 2 groups: I – 673 children with chronic somatic diseases, II – 297 conventionally healthy children.The study of adaptive and compensatory mechanisms was carried out with a glance to vegetative regulation of body functions. Robinson index (IR was used for an express-assessment of somatic health. Statistic data-processing was done according to the requirements of evidence-based medicine.Result. An analysis of an examination results at the beginning of the school year showed that the pupils of the I group have a complex disturbances of vegetative regulation, low level of aerobic abilities of organism. Among the children of the II group no more than 25% have a satisfactory state of adaptive and compensatory mechanisms that ensure an adequate response of child organism on the stress factors of educational process.At the end of the school year the part of children who have a balanced level of neuroreflex systems of organism decreases by 50%, the number of children with an overstrain of regulatory systems of organism increases by 28%, with unsatisfactory state of adaptive and compensatory mechanisms – by 22% that becomes presupposition for formation and chronization of somatic pathology.An examination of pupils health level at the end of the school year showed that the number of conventionally healthy children decreases by 19,2%. The syntropy of pathological states formed in 54,2% of pupils with chronic somatic pathology, in 34,5% of children the functional disturbance transformed into somatic pathology

  18. Comportamiento del Helio en estrellas químicamente peculiares

    Science.gov (United States)

    Malaroda, S. M.; López García, Z.; Leone, F.; Catalano, F.

    Las estrellas químicamente peculiares (CP) se caracterizan por tener deficiencias y sobreabundancias de algunos elementos químicos de hasta 106 veces la abundancia solar. Además presentan variaciones en las líneas espectrales. Se piensa que ello se debe a que los campos magnéticos presentes en este tipo de estrellas son principalmente dipolares, con un eje de simetría diferente del eje de rotación. La distribución de los elementos sobreabundantes y deficientes no es homogénea sobre la superficie estelar y las variaciones observadas serían una consecuencia directa de la rotación estelar. Entre los elementos con abundancia anómala se encuentra el Helio, cuyas líneas tienen intensidades que no son consistentes con una abundancia normal, que no puede ser determinada del modo usual, o sea, considerando una atmósfera con composición solar. Con el fin de determinar la abundancia de este elemento, se inició un estudio de estrellas anómalas de Helio, Hew y He strong. Además se determinarán las abundancias de otros elementos anómalos como ser el Si, Cr, Mg, Mn y Fe. Las mismas se determinan del modo tradicional, o sea: a) medida de los anchos equivalentes de las líneas de los distintos elementos analizados; b) adopción de la temperatura efectiva, gravedad y abundancia del Helio; c) cálculo del modelo de atmósfera d) comparación con las observaciones y reinicio de un proceso iterativo hasta lograr un acuerdo entre todos los parámetros analizados. Las observaciones se llevaron a cabo en el Complejo Astronómico El Leoncito. Se observaron setenta y ocho estrellas anómalas de Helio. En este momento se está procediendo a calcular las abundancias correspondientes a los distintos elementos químicos. Para ello se hace uso de los modelos de Kurucz, ATLAS9. Los cálculos NLTE de las líneas de Helio se llevan a cabo con el programa MULTI y se compararán con los realizados con el programa WIDTH9 de Kurucz (LTE), con el objeto de resaltar la importancia de

  19. AgSTAR

    Science.gov (United States)

    AgSTAR promotes biogas recovery projects, which generate renewable energy and other beneficial products from the anaerobic digestion of livestock manure and organic wastes while decreasing greenhouse gas emissions from the agriculture sector.

  20. Orbiting radiation stars

    International Nuclear Information System (INIS)

    Foster, Dean P; Langford, John; Perez-Giz, Gabe

    2016-01-01

    We study a spherically symmetric solution to the Einstein equations in which the source, which we call an orbiting radiation star (OR-star), is a compact object consisting of freely falling null particles. The solution avoids quantum scale regimes and hence neither relies upon nor ignores the interaction of quantum mechanics and gravitation. The OR-star spacetime exhibits a deep gravitational well yet remains singularity free. In fact, it is geometrically flat in the vicinity of the origin, with the flat region being of any desirable scale. The solution is observationally distinct from a black hole because a photon from infinity aimed at an OR-star escapes to infinity with a time delay. (paper)