WorldWideScience

Sample records for patient mammogram reminders

  1. Assessing the patient's mammogram experience.

    Science.gov (United States)

    Dodendorf, Diane M; Deogun, Gurvinder K; Rodie, Amy Risch; Pol, Louis G

    2004-01-01

    This study overviews an operational blueprint that diagrams the activities and interactions of all participants in a typical screening mammography appointment in a large medical center. The blueprint is constructed from multiple sources of data collected from mammography patients, service providers in the radiology department, and medical records. The benefits from using patient perspectives, the insights gained from the blueprint development process, and the value of the resulting screening mammography appointment blueprint are included.

  2. Getting patients in the door: medical appointment reminder preferences.

    Science.gov (United States)

    Crutchfield, Trisha M; Kistler, Christine E

    2017-01-01

    Between 23% and 34% of outpatient appointments are missed annually. Patients who frequently miss medical appointments have poorer health outcomes and are less likely to use preventive health care services. Missed appointments result in unnecessary costs and organizational inefficiencies. Appointment reminders may help reduce missed appointments; particular types may be more effective than other types. We used a survey with a discrete choice experiment (DCE) to learn why individuals miss appointments and to assess appointment reminder preferences. We enrolled a national sample of adults from an online survey panel to complete demographic and appointment habit questions as well as a 16-task DCE designed in Sawtooth Software's Discover tool. We assessed preferences for four reminder attributes - initial reminder type, arrival of initial reminder, reminder content, and number of reminders. We derived utilities and importance scores. We surveyed 251 adults nationally, with a mean age of 43 (range 18-83) years: 51% female, 84% White, and 8% African American. Twenty-three percent of individuals missed one or more appointments in the past 12 months. Two primary reasons given for missing an appointment include transportation problems (28%) and forgetfulness (26%). Participants indicated the initial reminder type (21%) was the most important attribute, followed by the number of reminders (10%). Overall, individuals indicated a preference for a single reminder, arriving via email, phone call, or text message, delivered less than 2 weeks prior to an appointment. Preferences for reminder content were less clear. The number of missed appointments and reasons for missing appointments are consistent with prior research. Patient-centered appointment reminders may improve appointment attendance by addressing some of the reasons individuals report missing appointments and by meeting patients' needs. Future research is necessary to determine if preferred reminders used in practice

  3. Inhaler Reminders Significantly Improve Asthma Patients' Use of Controller Medications

    Science.gov (United States)

    ... controller medications Share | Inhaler reminders significantly improve asthma patients’ use of controller medications Published Online: July 22, ... the burden and risk of asthma, but many patients do not use them regularly. This poor adherence ...

  4. Patient understanding of the revised USPSTF screening mammogram guidelines: need for development of patient decision aids

    Directory of Open Access Journals (Sweden)

    Allen Summer V

    2012-10-01

    Full Text Available Abstract Background The purpose of the study was to examine patients’ understanding of the revised screening mammogram guidelines released by the United States Preventive Services Task Force (USPSTF in 2009 addressing age at initiation and frequency of screening mammography. Methods Patients from the Departments of Family Medicine, Internal Medicine, and Obstetrics and Gynecology (n = 150 at a tertiary care medical center in the United States completed a survey regarding their understanding of the revised USPSTF guidelines following their release, within four to six months of their scheduled mammogram (March 2010 to May 2010. Results Of the patients surveyed, 97/147 (67% indicated increased confusion regarding the age and frequency of screening mammography, 61/148 (41% reported increased anxiety about mammograms, and 58/146 (40% reported anxiety about their own health status following the release of the revised screening guidelines. Most of the patients surveyed, 111/148 (75%, did not expect to change their timing or frequency of screening mammograms in the future. Conclusion Results from this survey suggested increased confusion and possibly an increase in patients’ anxiety related to screening mammography and their own health status following the release of the revised USPSTF screening mammogram guidelines to the public and subsequent media portrayal of the revised guidelines. Although the study did not specifically address causality for these findings, the results highlight the need for improvements in the communication of guidelines to patients and the public. Development of shared decision-making tools and outcomes should be considered to address the communication challenge.

  5. Patient reminder and recall interventions to improve immunization rates.

    Science.gov (United States)

    Jacobson Vann, Julie C; Jacobson, Robert M; Coyne-Beasley, Tamera; Asafu-Adjei, Josephine K; Szilagyi, Peter G

    2018-01-18

    Immunization rates for children and adults are rising, but coverage levels have not reached optimal goals. As a result, vaccine-preventable diseases still occur. In an era of increasing complexity of immunization schedules, rising expectations about the performance of primary care, and large demands on primary care providers, it is important to understand and promote interventions that work in primary care settings to increase immunization coverage. One common theme across immunization programs in many nations involves the challenge of implementing a population-based approach and identifying all eligible recipients, for example the children who should receive the measles vaccine. However, this issue is gradually being addressed through the availability of immunization registries and electronic health records. A second common theme is identifying the best strategies to promote high vaccination rates. Three types of strategies have been studied: (1) patient-oriented interventions, such as patient reminder or recall, (2) provider interventions, and (3) system interventions, such as school laws. One of the most prominent intervention strategies, and perhaps best studied, involves patient reminder or recall systems. This is an update of a previously published review. To evaluate and compare the effectiveness of various types of patient reminder and recall interventions to improve receipt of immunizations. We searched CENTRAL, MEDLINE, Embase and CINAHL to January 2017. We also searched grey literature and trial registers to January 2017. We included randomized trials, controlled before and after studies, and interrupted time series evaluating immunization-focused patient reminder or recall interventions in children, adolescents, and adults who receive immunizations in any setting. We included no-intervention control groups, standard practice activities that did not include immunization patient reminder or recall, media-based activities aimed at promoting immunizations

  6. re:Mind - A mobile application for bipolar disorder patients

    DEFF Research Database (Denmark)

    Corradini, Andrea; Lyck Festersen, Pia

    2014-01-01

    Several personal healthcare monitoring systems have been proposed to target somatic diseases and specific mental illness. This paper reports on the re:Mind system, which is a helpful tool that supports the treatment of people diagnosed with bipolar disorder. We developed the system as a hybrid...... mobile application to help bipolar patients self-monitor a set of parameters that are known to affect their illness while also allowing them to communicate with their physician. Based on data collected from medical personnel, clinicians, patients, patients’ relatives and persons akin to them, we created...

  7. TU-F-18C-09: Mammogram Surveillance Using Texture Analysis for Breast Cancer Patients After Radiation Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Kuo, H; Tome, W; FOX, J; Hong, L; Yaparpalvi, R; Mehta, K; Bodner, W; Kalnicki, S [Montefiore Medical Center/Albert Einstein College of Medicine, Bronx, New York (United States); Huang, Y [Memorial Sloan-Kettering Cancer Center, Great Neck, NY (United States)

    2014-06-15

    Purpose: To study the feasibility of applying cancer risk model established from treated patients to predict the risk of recurrence on follow-up mammography after radiation therapy for both ipsilateral and contralateral breast. Methods: An extensive set of textural feature functions was applied to a set of 196 Mammograms from 50 patients. 56 Mammograms from 28 patients were used as training set, 44 mammograms from 22 patients were used as test set and the rest were used for prediction. Feature functions include Histogram, Gradient, Co-Occurrence Matrix, Run-Length Matrix and Wavelet Energy. An optimum subset of the feature functions was selected by Fisher Coefficient (FO) or Mutual Information (MI) (up to top 10 features) or a method combined FO, MI and Principal Component (FMP) (up to top 30 features). One-Nearest Neighbor (1-NN), Linear Discriminant Analysis (LDA) and Nonlinear Discriminant Analysis (NDA) were utilized to build a risk model of breast cancer from the training set of mammograms at the time of diagnosis. The risk model was then used to predict the risk of recurrence from mammogram taken one year and three years after RT. Results: FPM with NDA has the best classification power in classifying the training set of the mammogram with lesions versus those without lesions. The model of FPM with NDA achieved a true positive (TP) rate of 82% compared to 45.5% of using FO with 1-NN. The best false positive (FP) rates were 0% and 3.6% in contra-lateral breast of 1-year and 3-years after RT, and 10.9% in ipsi-lateral breast of 3-years after RT. Conclusion: Texture analysis offers high dimension to differentiate breast tissue in mammogram. Using NDA to classify mammogram with lesion from mammogram without lesion, it can achieve rather high TP and low FP in the surveillance of mammogram for patient with conservative surgery combined RT.

  8. Supporting patient adherence to antiretrovirals using mobile phone reminders: patient responses from South India.

    Science.gov (United States)

    Sidney, Kristi; Antony, Jimmy; Rodrigues, Rashmi; Arumugam, Karthika; Krishnamurthy, Shubha; D'souza, George; De Costa, Ayesha; Shet, Anita

    2012-01-01

    There has been exponential growth in the use of mobile phones in India over the last few years, and their potential benefits as a healthcare tool has raised tremendous interest. We used mobile phone reminders to help support adherence to antiretroviral therapy (ART) among HIV patients at an infectious disease clinic in a tertiary hospital in Bangalore. Between March and June 2010, 139 adult HIV patients taking regular ART for at least a month received weekly reminders to support adherence. These reminders consisted of a weekly interactive call and a non-interactive neutral pictorial short message service (SMS). After four weeks of the intervention, participants were interviewed to study perceptions on preference, usefulness, potential stigma and privacy concerns associated with this intervention. Majority of the participants were urban (89%), and had at least a secondary education (85%). A total of 744 calls were made, 545 (76%) of which were received by the participants. In addition, all participants received the weekly pictorial SMS reminder. A month later, 90% of participants reported the intervention as being helpful as medication reminders, and did not feel their privacy was intruded. Participants (87%) reported that they preferred the call as reminders, just 11% favoured SMS reminders alone. Only 59% of participants viewed all the SMSs that were delivered, while 15% never viewed any at all. Participants also denied any discomfort or stigma despite 20% and 13%, respectively, reporting that another person had inadvertently received their reminder call or SMS. Mobile phone interventions are an acceptable way of supporting adherence in this setting. Voice calls rather than SMSs alone seem to be preferred as reminders. Further research to study the influence of this intervention on adherence and health maintenance is warranted.

  9. Effect of mailed reminders on the response rate in surveys among patients in general practice

    DEFF Research Database (Denmark)

    Wensing, M; Mainz, Jan; Kramme, O

    1999-01-01

    Randomized trials were performed in Denmark and The Netherlands to determine the effect of mailed reminders on the response rate in surveys among patients in general practice. In both countries, general practitioners handed out questionnaires to 200 adult patients who came to visit them. An inter...

  10. The relationship of psychosocial factors to mammograms, physical activity, and fruit and vegetable consumption among sisters of breast cancer patients

    Directory of Open Access Journals (Sweden)

    Hartman SJ

    2011-08-01

    Full Text Available Sheri J Hartman1, Shira I Dunsiger1, Paul B Jacobsen21Centers for Behavioral and Preventive Medicine, The Miriam Hospital and W Alpert Medical School of Brown University, Providence, RI; 2Department of Health Outcomes and Behavior, H Lee Moffitt Cancer Center and Research Institute, Tampa, FL, USAAbstract: This study examined the relationship of psychosocial factors to health-promoting behaviors in sisters of breast cancer patients. One hundred and twenty sisters of breast cancer patients completed questionnaires assessing response efficacy of mammography screenings, physical activity, and fruit and vegetable consumption on decreasing breast cancer risk, breast cancer worry, involvement in their sister’s cancer care, mammography screenings, physical activity, and fruit and vegetable consumption. Results indicate that greater perceived effectiveness for mammograms was associated with a 67% increase in odds of yearly mammograms. Greater involvement in the patient’s care was associated with a 7% decrease in odds of yearly mammograms. Greater perceived effectiveness for physical activity was significantly related to greater physical activity. There was a trend for greater perceived effectiveness for fruits and vegetables to be associated with consuming more fruits and vegetables. Breast cancer worry was not significantly associated with the outcomes. While perceived effectiveness for a specific health behavior in reducing breast cancer risk was consistently related to engaging in that health behavior, women reported significantly lower perceived effectiveness for physical activity and fruits and vegetables than for mammograms. Making women aware of the health benefits of these behaviors may be important in promoting changes.Keywords: breast cancer risk, mammograms, physical activity, diet, perceived effectiveness

  11. Towards an in-plane methodology to track breast lesions using mammograms and patient-specific finite-element simulations

    Science.gov (United States)

    Lapuebla-Ferri, Andrés; Cegoñino-Banzo, José; Jiménez-Mocholí, Antonio-José; Pérez del Palomar, Amaya

    2017-11-01

    In breast cancer screening or diagnosis, it is usual to combine different images in order to locate a lesion as accurately as possible. These images are generated using a single or several imaging techniques. As x-ray-based mammography is widely used, a breast lesion is located in the same plane of the image (mammogram), but tracking it across mammograms corresponding to different views is a challenging task for medical physicians. Accordingly, simulation tools and methodologies that use patient-specific numerical models can facilitate the task of fusing information from different images. Additionally, these tools need to be as straightforward as possible to facilitate their translation to the clinical area. This paper presents a patient-specific, finite-element-based and semi-automated simulation methodology to track breast lesions across mammograms. A realistic three-dimensional computer model of a patient’s breast was generated from magnetic resonance imaging to simulate mammographic compressions in cranio-caudal (CC, head-to-toe) and medio-lateral oblique (MLO, shoulder-to-opposite hip) directions. For each compression being simulated, a virtual mammogram was obtained and posteriorly superimposed to the corresponding real mammogram, by sharing the nipple as a common feature. Two-dimensional rigid-body transformations were applied, and the error distance measured between the centroids of the tumors previously located on each image was 3.84 mm and 2.41 mm for CC and MLO compression, respectively. Considering that the scope of this work is to conceive a methodology translatable to clinical practice, the results indicate that it could be helpful in supporting the tracking of breast lesions.

  12. Computer-aided detection system performance on current and previous digital mammograms in patients with contralateral metachronous breast cancer

    International Nuclear Information System (INIS)

    Kim, Seung Ja; Moon, Woo Kyung; Cho, Nariya; Chang, Jung Min

    2012-01-01

    Background: The computer-aided detection (CAD) system is widely used for screening mammography. The performance of the CAD system for contralateral breast cancer has not been reported for women with a history of breast cancer. Purpose: To retrospectively evaluate the performance of a CAD system on current and previous mammograms in patients with contralateral metachronous breast cancer. Material and Methods: During a 3-year period, 4945 postoperative patients had follow-up examinations, from whom we selected 55 women with contralateral breast cancers. Among them, 38 had visible malignant signs on the current mammograms. We analyzed the sensitivity and false-positive marks of the system on the current and previous mammograms according to lesion type and breast density. Results: The total visible lesion components on the current mammograms included 27 masses and 14 calcifications in 38 patients. The case-based sensitivity for all lesion types was 63.2% (24/38) with false-positive marks of 0.71 per patient. The lesion-based sensitivity for masses and calcifications was 59.3% (16/27) and 71.4% (10/14), respectively. The lesion-based sensitivity for masses in fatty and dense breasts was 68.8% (11/16) and 45.5% (5/11), respectively. The lesion-based sensitivity for calcifications in fatty and dense breasts was 100.0% (3/3) and 63.6% (7/11), respectively. The total visible lesion components on the previous mammograms included 13 masses and three calcifications in 16 patients, and the sensitivity for all lesion types was 31.3% (5/16) with false-positive marks of 0.81 per patient. On these mammograms, the sensitivity for masses and calcifications was 30.8% (4/13) and 33.3% (1/3), respectively. The sensitivity in fatty and dense breasts was 28.6% (2/7) and 33.3% (3/9), respectively. Conclusion: In the women with a history of breast cancer, the sensitivity of the CAD system in visible contralateral breast cancer was lower than in most previous reports using the same CAD

  13. The impact of an electronic monitoring and reminder device on patient compliance with antihypertensive therapy

    DEFF Research Database (Denmark)

    Christensen, Arne; Christrup, Lona Louring; Fabricius, Paul Erik

    2010-01-01

    . In the first half of the study, patients using the device reported 91% compliance versus 85% in the control group. This difference diminished after crossover (88 versus 86%). BP was not affected. Electronic monitoring data on compliance revealed taking, dosing and timing compliance between 45 and 52% in study...... to be effective in improving patient compliance to some extent, but the combined effect has not been documented. OBJECTIVE: To assess the impact of an electronic reminder and monitoring device on patient compliance and BP control. METHODS: All patients received medical treatment with telmisartan once daily...... and were randomized to either electronic compliance monitoring with a reminder and monitoring device or standard therapy for 6 months. Both groups were crossed over after 6 months. Intervention effectiveness was assessed using self-reported compliance and BP. RESULTS: Data from 398 patients were analysed...

  14. Feasibility of the evidence-based cognitive telerehabilitation program Remind for patients with primary brain tumors.

    Science.gov (United States)

    van der Linden, Sophie D; Sitskoorn, Margriet M; Rutten, Geert-Jan M; Gehring, Karin

    2018-05-01

    Many patients with primary brain tumors experience cognitive deficits. Cognitive rehabilitation programs focus on alleviating these deficits, but availability of such programs is limited. Our large randomized controlled trial (RCT) demonstrated positive effects of the cognitive rehabilitation program developed by our group. We converted the program into the iPad-based cognitive rehabilitation program ReMind, to increase its accessibility. The app incorporates psychoeducation, strategy training and retraining. This pilot study in patients with primary brain tumors evaluates the feasibility of the use of the ReMind-app in a clinical (research) setting in terms of accrual, attrition, adherence and patient satisfaction. The intervention commenced 3 months after resective surgery and patients were advised to spend 3 h per week on the program for 10 weeks. Of 28 eligible patients, 15 patients with presumed low-grade glioma or meningioma provided informed consent. Most important reason for decline was that patients (7) experienced no cognitive complaints. Participants completed on average 71% of the strategy training and 76% of the retraining. Some patients evaluated the retraining as too easy. Overall, 85% of the patients evaluated the intervention as "good" or "excellent". All patients indicated that they would recommend the program to other patients with brain tumors. The ReMind-app is the first evidence-based cognitive telerehabilitation program for adult patients with brain tumors and this pilot study suggests that postoperative cognitive rehabilitation via this app is feasible. Based on patients' feedback, we have expanded the retraining with more difficult exercises. We will evaluate the efficacy of ReMind in an RCT.

  15. The effectiveness of SMS Reminders and the impact of patient characteristics on missed appointments in a public dental outpatient clinic

    OpenAIRE

    Emilia Bellucci; Lasitha Dharmasena; Lemai Nguyen; Hanny Calache

    2017-01-01

    This paper reports on the Failure To Attend (FTA) rate of appointments as well as patients following the implementation of SMS reminders in a public dental outpatient service.  Given the ineffectiveness of the intervention and a highly representative patient’s profile, this paper identifies the demographic characteristics of patients who miss all of their appointments.  Data on appointment attendance, patient demographics and dental service type was collected over a time period of 46 consecut...

  16. Radiation scars on mammograms

    International Nuclear Information System (INIS)

    Otto, H.; Breining, H.; Knappschafts-Krankenhaus Essen

    1985-01-01

    Six patients with radiation scars are described. In each case the diagnosis was confirmed histologically in five cases corresponding mammograms were available. The histological appearances of radiation scars are described and the radiological features are presented. These lesions can be diagnosed mammographically in vivo. Macroscopically differentiation from a scirrhous carcinoma is not possible and therefore a radiation scar must always be excised; this also leads to definitive cure. On mammographic screening the incidence is 0.5 to 0.9 per thousand. The significance of radiation scars depends on the fact that they are pre-cancerous and therefore are equivalent to the early diagnosis of a carcinoma with the possibility of a complete cure. (orig.) [de

  17. Accident: Reminder

    CERN Multimedia

    2003-01-01

    There is no left turn to Point 1 from the customs, direction CERN. A terrible accident happened last week on the Route de Meyrin just outside Entrance B because traffic regulations were not respected. You are reminded that when travelling from the customs, direction CERN, turning left to Point 1 is forbidden. Access to Point 1 from the customs is only via entering CERN, going down to the roundabout and coming back up to the traffic lights at Entrance B

  18. The clinical significance of normal mammograms and normal sonograms in patients with palpable abnormalities of the breast

    International Nuclear Information System (INIS)

    Lee, Jin Hwa; Yoon, Seong Kuk; Choi, Sun Seob; Nam, Kyung Jin; Cho, Se Heon; Kim, Dae Cheol; Kim, Jung Il; Kim, Eun Kyung

    2006-01-01

    We wanted to evaluate the clinical significance of normal mammograms and normal sonograms in patients with palpable abnormalities of the breast. From Apr 2003 to Feb 2005, 107 patients with 113 palpable abnormalities who had combined normal sonographic and normal mammographic findings were retrospectively studied. The evaluated parameters included age of the patients, the clinical referrals, the distribution of the locations of the palpable abnormalities, whether there was a past surgical history, the mammographic densities and the sonographic echo patterns (purely hyperechoic fibrous tissue, mixed fibroglandular breast tissue, predominantly isoechoic glandular tissue and isoechoic subcutaneous fat tissue) at the sites of clinical concern, whether there was a change in imaging and/or the physical examination results at follow-up, and whether there were biopsy results. This study period was chosen to allow a follow-up period of at least 12 months. The patients' ages ranged from 22 to 66 years (mean age: 48.8 years) and 62 (58%) of the 107 patients were between 41 and 50 years old (58%). The most common location of the palpable abnormalities was the upper outer portion of the breast (45%) and most of the mammographic densities were dense patterns (BI-RADS Type 3 or 4: 91%). Our cases showed similar distribution for all the types of sonographic echo patterns. 23 patients underwent biopsy; all the biopsy specimens were benign. For the 84 patients with 90 palpable abnormalities who were followed, there was no interval development of breast cancer in the areas of clinical concern. Our results suggest that we can follow up and prevent unnecessary biopsies in women with palpable abnormalities when both the mammography and ultrasonography show normal tissue, but this study was limited by its small sample size. Therefore, a larger study will be needed to better define the negative predictive value of combined normal sonographic and mammographic findings

  19. Patient Dashboard: the use of a colour-coded computerised clinical reminder in Whanganui regional general practices.

    Science.gov (United States)

    McMenamin, John; Nicholson, Rick; Leech, Ken

    2011-12-01

    Clinical reminders have been shown to help general practice achieve an increase in some preventive care items, especially if they identify a patient's eligibility for the target item, prompt clinicians at the right time, provide a fast link to management tools and facilitate clinical recording. WRPHO has introduced the Patient Dashboard clinical reminder and monitored its impact on health targets. This paper reports the impact of a computerised colour-coded clinical reminder on achieving agreed health targets in Whanganui regional practices. Patient Dashboard was developed from previous versions in Auckland and Northland and provided to Whanganui regional practices with Primary Health Organisation (PHO) support. The Dashboard was linked with existing and new clinical management tools which automatically updated clinical records. Data from practices was pooled by Whanganui Regional Primary Health Organisation and target achievement rates reported over 15 months. Over the initial 15 months of Patient Dashboard use, recording of smoking status increased from 74% to 82% and of alcohol use from 15% to 47%. Screening for diabetes increased from 62% to 74%, cardiovascular risk assessment from 20% to 43%, cervical screening from 71% to 79%, and breast screening from 60% to 80%. Patient Dashboard was associated with increased performance indicators both for those targets which were part of a PHO programme and for targets without additional support.

  20. The effectiveness of SMS Reminders and the impact of patient characteristics on missed appointments in a public dental outpatient clinic

    Directory of Open Access Journals (Sweden)

    Emilia Bellucci

    2017-03-01

    Full Text Available This paper reports on the Failure To Attend (FTA rate of appointments as well as patients following the implementation of SMS reminders in a public dental outpatient service.  Given the ineffectiveness of the intervention and a highly representative patient’s profile, this paper identifies the demographic characteristics of patients who miss all of their appointments.  Data on appointment attendance, patient demographics and dental service type was collected over a time period of 46 consecutive months.  Using descriptive and inferential statistics (chi-square, two sample tests and Marascuilo procedure we found the SMS intervention was ineffective in reducing the FTA rates. Further, patients associated with high rates of non-attendance exhibited one or more of the following characteristics: male; age 26 – 44; non-concession card holders; a person of Indigenous, local, Asian or African descent, and of refugee status, persons living in low socio-economic areas; and appointments in General Care and Student Clinics. Whilst the literature overwhelmingly attributes SMS reminders to improving the attendance rate of patients in outpatient clinics, our contradictory findings suggest a more targeted approach in settings whose patients exhibit strong characteristics associated with non-attendance.

  1. Dissemination strategies and adherence predictors for web-based interventions-how efficient are patient education sessions and email reminders?

    Science.gov (United States)

    Schweier, R; Romppel, M; Richter, C; Grande, G

    2016-06-01

    The Internet offers the potential to efficaciously deliver health interventions at a low cost and with a low threshold across any distance. However, since many web-based interventions are confronted with low use and adherence, proactive dissemination strategies are needed. We, therefore, tested the efficacy of a 1-h patient education session as part of a rehabilitation program and an email reminder 4 weeks later on the publicity and use of a web-based intervention aimed at lifestyle changes in patients with either coronary heart disease or chronic back pain (CBP) and examined adherence predictors. The website www.lebensstil-aendern.de is a cost-free, German-language website providing more than 1000 patient narratives about successful lifestyle changes. To test the efficacy of the dissemination strategies and to examine adherence predictors, we conducted a sequential controlled trial with heart and CBP patients recruited from German inpatient rehabilitation centers. The dissemination strategies were found to be efficient. Use rates, however, remained low. The email reminder and internal health locus of control emerged as notable factors in motivating patients to participate in the web-based intervention. Other factors that have been suggested to be related to nonuse, e.g. sociodemographic characteristics and medical condition, did not predict use or adherence. © The Author 2016. Published by Oxford University Press. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  2. Influence of reminder therapy for controlling bacterial plaque in patients undergoing orthodontic treatment: A systematic review and meta-analysis.

    Science.gov (United States)

    Lima, Igor Felipe Pereira; de Andrade Vieira, Walbert; de Macedo Bernardino, Ítalo; Costa, Pedro Augusto; Lima, Anderson Paulo Barbosa; Pithon, Matheus Melo; Paranhos, Luiz Renato

    2018-04-17

    To assess the scientific evidence regarding the influence of reminder therapy on plaque index, gingival index, and white spots in patients subjected to orthodontic treatment. Randomized clinical trials were searched in the electronic databases LILACS, PubMed, SciELO, Scopus, Web of Science, Embase, LIVIVO, and Cochrane Library. The databases OpenThesis and OpenGrey were used to capture the "gray literature," preventing selection and publication biases. The risk of bias was assessed by the Joanna Briggs Institute Critical Appraisal Checklist for Randomized Controlled Trials tool. The software Review Manager was used for the meta-analysis. The heterogeneity among studies was assessed through the I 2 statistic. A summary of the overall strength of evidence available was assessed using the Grades of Recommendations Assessment, Development, and Evaluation tool. A total of 332 records were found, from which only 7 articles met the inclusion criteria and were subjected to analysis. Reminder therapy showed improved scores for the plaque index (standardized mean difference = -1.22; 95% confidence interval = -2.03 to -0.42; P = .003) and the gingival index (standardized mean difference = 1.49; 95% confidence interval = -2.61 to 0.37; P = .009). Moreover, there was lower occurrence of white spots (relative risk = 0.53; 95% confidence interval = 0.38 to 0.74; P plaque and gingival indices as well as to the lower occurrence of white spots in patients subjected to orthodontic treatment.

  3. Motivational counselling and SMS-reminders for reduction of daily sitting time in patients with rheumatoid arthritis

    DEFF Research Database (Denmark)

    Thomsen, T; Aadahl, Mette; Beyer, Nina Ann-Marie

    2016-01-01

    for daily leisure time sitting > 4 h. The 16-week intervention included 1) three individual motivational counselling sessions and 2) individual text message reminders aimed at reducing daily sitting time. The control group was encouraged to maintain their usual lifestyles. Outcomes were assessed at baseline...... and screened before 20 met eligibility criteria and consented; reasons for declining study participation were mostly flares, lack of time and co-morbidities. One patient from the control group dropped out before end of intervention (due to a RA flare). Intervention participants completed all counselling...... tailored, theory-based behavioural intervention targeting reduction in daily sitting time in patients with RA. METHODS: A randomised, controlled trial with two parallel groups. RA patients >18 years of age and Health Assessment Questionnaire (HAQ) score 

  4. The efficacy of motivational counseling and SMS-reminders on daily sitting time in patients with rheumatoid arthritis

    DEFF Research Database (Denmark)

    Esbensen, Bente Appel; Thomsen, Tanja; Hetland, Merete L

    2015-01-01

    group receiving usual care. The intervention includes: 1) individual motivational counseling (in total 3 sessions) on reduction of daily sitting time in combination with 2) individual Short Text Message Service (SMS) reminders over a 16-week intervention period. Primary outcome is change in daily...... that SB can be reduced by behavioural interventions in healthy populations. However, it remains unexplored whether it is valid for patients with RA also. Therefore, the aim of this trial is to investigate the efficacy of an individually tailored, theory-based motivational counseling intervention......, and finally to assess the cost-effectiveness of the intervention. METHODS/DESIGN: For this parallel group randomized trial, 150 patients with RA and at least 5 hours of sitting time per day, will be recruited from a rheumatology outpatient clinic, and block-randomized to the intervention group or the control...

  5. Risks of mammograms

    International Nuclear Information System (INIS)

    Swartz, H.M.; Reichling, B.A.

    1977-01-01

    In summary, the following practical guidelines for mammography are offered: 1. Any woman, regardless of age, with signs or symptoms that indicate breast cancer should have a mammogram. 2. A woman who has a high risk for breast cancer (e.g., strong family history, no pregnancy before 30 years of age, or a previous breast cancer) should receive periodic screening examinations, including mammography. 3. Periodic screening for asymptomatic women over the age of 50 is indicated. 4. The value of periodic screening for asymptomatic women who are not considered to be at high risk and are under the age of 50 years is not established. Such screening should be carried out only when useful data can be collected on the benefits and risks of this procedure. 5. For any individual woman, the risk of inducing breast cancer by mammography is very low. 6. Mammograms should be made only with modern equipment and techniques designed to provide optimum information with minimal dose

  6. Systematic review and meta-analysis: reminder systems to reduce catheter-associated urinary tract infections and urinary catheter use in hospitalized patients.

    Science.gov (United States)

    Meddings, Jennifer; Rogers, Mary A M; Macy, Michelle; Saint, Sanjay

    2010-09-01

    Prolonged catheterization is the primary risk factor for catheter-associated urinary tract infection (CAUTI). Reminder systems are interventions used to prompt the removal of unnecessary urinary catheters. To summarize the effect of urinary catheter reminder systems on the rate of CAUTI, urinary catheter use, and the need for recatheterization, we performed a systematic review and meta-analysis. Studies were identified in MEDLINE, the Cochrane Library, Biosis, the Web of Science, EMBASE, and CINAHL through August 2008. Only interventional studies that used reminders to physicians or nurses that a urinary catheter was in use or stop orders to prompt catheter removal in hospitalized adults were included. A total of 6679 citations were identified; 118 articles were reviewed, and 14 articles met the selection criteria. The rate of CAUTI (episodes per 1000 catheter-days) was reduced by 52% (P SMD) in the duration of catheterization was -1.11 overall (P = 070), including a statistically significant decrease in studies that used a stop order (SMD, -0.30; P = .001) but not in those that used a reminder (SMD, -1.54; P = .071). Recatheterization rates were similar in control and intervention groups. Urinary catheter reminders and stop orders appear to reduce the rate of CAUTI and should be strongly considered to enhance the safety of hospitalized patients.

  7. Use of a verbal electronic audio reminder with a patient hand hygiene bundle to increase independent patient hand hygiene practices of older adults in an acute care setting.

    Science.gov (United States)

    Knighton, Shanina C; Dolansky, Mary; Donskey, Curtis; Warner, Camille; Rai, Herleen; Higgins, Patricia A

    2018-03-01

    We hypothesized that the addition of a novel verbal electronic audio reminder to an educational patient hand hygiene bundle would increase performance of self-managed patient hand hygiene. We conducted a 2-group comparative effectiveness study randomly assigning participants to patient hand hygiene bundle 1 (n = 41), which included a video, a handout, and a personalized verbal electronic audio reminder (EAR) that prompted hand cleansing at 3 meal times, or patient hand hygiene bundle 2 (n = 34), which included the identical video and handout, but not the EAR. The primary outcome was alcohol-based hand sanitizer use based on weighing bottles of hand sanitizer. Participants that received the EAR averaged significantly more use of hand sanitizer product over the 3 days of the study (mean ± SD, 29.97 ± 17.13 g) than participants with no EAR (mean ± SD, 10.88 ± 9.27 g; t 73  = 5.822; P ≤ .001). The addition of a novel verbal EAR to a patient hand hygiene bundle resulted in a significant increase in patient hand hygiene performance. Our results suggest that simple audio technology can be used to improve patient self-management of hand hygiene. Future research is needed to determine if the technology can be used to promote other healthy behaviors, reduce infections, and improve patient-centered care without increasing the workload of health care workers. Published by Elsevier Inc.

  8. Hospitalized women's willingness to pay for an inpatient screening mammogram.

    Science.gov (United States)

    Khaliq, Waseem; Harris, Ché Matthew; Landis, Regina; Bridges, John F P; Wright, Scott M

    2014-01-01

    Lower rates for breast cancer screening persist among low income and uninsured women. Although Medicare and many other insurance plans would pay for screening mammograms done during hospital stays, breast cancer screening has not been part of usual hospital care. This study explores the mean amount of money that hospitalized women were willing to contribute towards the cost of a screening mammogram. Of the 193 enrolled patients, 72% were willing to pay a mean of $83.41 (95% CI, $71.51-$95.31) in advance towards inpatient screening mammogram costs. The study's findings suggest that hospitalized women value the prospect of screening mammography during the hospitalization. It may be wise policy to offer mammograms to nonadherent hospitalized women, especially those who are at high risk for developing breast cancer. © 2014 Annals of Family Medicine, Inc.

  9. Comparison versus reminding.

    Science.gov (United States)

    Tullis, Jonathan G; Goldstone, Robert L

    2016-01-01

    Comparison and reminding have both been shown to support learning and transfer. Comparison is thought to support transfer because it allows learners to disregard non-matching features of superficially different episodes in order to abstract the essential structure of concepts. Remindings promote memory for the individual episodes and generalization because they prompt learners to retrieve earlier episodes during the encoding of later related episodes and to compare across episodes. Across three experiments, we compared the consequences of comparison and reminding on memory and transfer. Participants studied a sequence of related, but superficially different, proverb pairs. In the comparison condition, participants saw proverb pairs presented together and compared their meaning. In the reminding condition, participants viewed proverbs one at a time and retrieved any prior studied proverb that shared the same deep meaning as the current proverb. Experiment 1 revealed that participants in the reminding condition recalled more proverbs than those in the comparison condition. Experiment 2 showed that the mnemonic benefits of reminding persisted over a one-week retention interval. Finally, in Experiment 3, we examined the ability of participants to generalize their remembered information to new items in a task that required participants to identify unstudied proverbs that shared the same meaning as studied proverbs. Comparison led to worse discrimination between proverbs related to studied proverbs and proverbs unrelated to studied proverbs than reminding. Reminding supported better memory for individual instances and transfer to new situations than comparison.

  10. Consensus double reading of mammograms in private practice

    International Nuclear Information System (INIS)

    Pacher, B.; Tscherney, R.; Litmann-Rowenta, B.; Liskutin, J.; Mazewski, I.; Leitner, H.; Tscholakoff, D.

    2004-01-01

    Purpose: To evaluate retrospectively the results of consensus double reading of mammograms in a private practice for a period of 1.5 years (November 2001 to March 2003). Materials and Method: Two independent experts with dedicated training read all mammograms on a weekly basis. All mammograms including sonographic examinations were evaluated independently and categorized using the Bl-RADS classification. The achieved consensus included a possible recommendation for recall or therapy. A total of 3936 mammograms and 1912 sonography studies were evaluated. All cases with BI-RADS 4 and 5 categories were compared with the histologic results. For a period of three months, the acceptance of double reading including a delay of the final report by one week was tested with a questionnaire and informed consent sheet. Results: BI-RADS categories 4 and 5 were found in 57 cases, with 41 consensus results by two independent readers and 26 carcinomas verified by histology. No consensus could be reached in 16 patients, of which 10 had a final histologic result, with 5 benign lesions and 5 carcinomas of less than 1 cm in diameter. Clinical symptoms or alterations were absent in all patients. The 5 carcinomas were discovered by the double reading procedure. The result of the questionnaire (695 questionnaires) showed a refusal rate of 0.7%, with only 5 women refusing the opportunity of double reading their mammograms. Conclusion: Double reading of mammograms by independent experts is feasible, shows a measurable increase in quality and is accepted by almost all women. (orig.)

  11. Mobile phone reminders and peer counseling improve adherence and treatment outcomes of patients on ART in Malaysia: A randomized clinical trial.

    Science.gov (United States)

    Abdulrahman, Surajudeen Abiola; Rampal, Lekhraj; Ibrahim, Faisal; Radhakrishnan, Anuradha P; Kadir Shahar, Hayati; Othman, Norlijah

    2017-01-01

    Adherence to treatment remains the cornerstone of long term viral suppression and successful treatment outcomes among patients receiving Antiretroviral Therapy (ART). Evaluate the effectiveness of mobile phone reminders and peer counseling in improving adherence and treatment outcomes among HIV positive patients on ART in Malaysia. A single-blind, parallel group RCT conducted in Hospital Sungai Buloh, Malaysia in which 242 adult Malaysian patients were randomized to intervention or control groups. Intervention consisted of a reminder module delivered through SMS and telephone call reminders by trained research assistants for 24 consecutive weeks (starting from date of ART initiation), in addition to adherence counseling at every clinic visit. The length of intended follow up for each patient was 6 months. Data on adherence behavior of patients was collected using specialized, pre-validated Adult AIDS Clinical Trial Group (AACTG) adherence questionnaires. Data on weight, clinical symptoms, CD4 count and viral load tests were also collected. Data was analyzed using SPSS version 22 and R software. Repeated measures ANOVA, Friedman's ANOVA and Multivariate regression models were used to evaluate efficacy of the intervention. The response rate after 6 months follow up was 93%. There were no significant differences at baseline in gender, employment status, income distribution and residential location of respondents between the intervention and control group. After 6 months follow up, the mean adherence was significantly higher in the intervention group (95.7; 95% CI: 94.39-96.97) as compared to the control group (87.5; 95% CI: 86.14-88.81). The proportion of respondents who had Good (>95%) adherence was significantly higher in the intervention group (92.2%) compared to the control group (54.6%). A significantly lower frequency in missed appointments (14.0% vs 35.5%) (p = 0.001), lower viral load (p = 0.001), higher rise in CD4 count (p = 0.017), lower incidence of

  12. Mobile phone reminders and peer counseling improve adherence and treatment outcomes of patients on ART in Malaysia: A randomized clinical trial.

    Directory of Open Access Journals (Sweden)

    Surajudeen Abiola Abdulrahman

    Full Text Available Adherence to treatment remains the cornerstone of long term viral suppression and successful treatment outcomes among patients receiving Antiretroviral Therapy (ART.Evaluate the effectiveness of mobile phone reminders and peer counseling in improving adherence and treatment outcomes among HIV positive patients on ART in Malaysia.A single-blind, parallel group RCT conducted in Hospital Sungai Buloh, Malaysia in which 242 adult Malaysian patients were randomized to intervention or control groups. Intervention consisted of a reminder module delivered through SMS and telephone call reminders by trained research assistants for 24 consecutive weeks (starting from date of ART initiation, in addition to adherence counseling at every clinic visit. The length of intended follow up for each patient was 6 months. Data on adherence behavior of patients was collected using specialized, pre-validated Adult AIDS Clinical Trial Group (AACTG adherence questionnaires. Data on weight, clinical symptoms, CD4 count and viral load tests were also collected. Data was analyzed using SPSS version 22 and R software. Repeated measures ANOVA, Friedman's ANOVA and Multivariate regression models were used to evaluate efficacy of the intervention.The response rate after 6 months follow up was 93%. There were no significant differences at baseline in gender, employment status, income distribution and residential location of respondents between the intervention and control group. After 6 months follow up, the mean adherence was significantly higher in the intervention group (95.7; 95% CI: 94.39-96.97 as compared to the control group (87.5; 95% CI: 86.14-88.81. The proportion of respondents who had Good (>95% adherence was significantly higher in the intervention group (92.2% compared to the control group (54.6%. A significantly lower frequency in missed appointments (14.0% vs 35.5% (p = 0.001, lower viral load (p = 0.001, higher rise in CD4 count (p = 0.017, lower incidence of

  13. Evaluation of mammogram compression efficiency

    International Nuclear Information System (INIS)

    Przelaskowski, A.; Surowski, P.; Kukula, A.

    2005-01-01

    Lossy image coding significantly improves performance over lossless methods, but a reliable control of diagnostic accuracy regarding compressed images is necessary. The acceptable range of compression ratios must be safe with respect to as many objective criteria as possible. This study evaluates the compression efficiency of digital mammograms in both numerically lossless (reversible) and lossy (irreversible) manner. Effective compression methods and concepts were examined to increase archiving and telediagnosis performance. Lossless compression as a primary applicable tool for medical applications was verified on a set 131 mammograms. Moreover, nine radiologists participated in the evaluation of lossy compression of mammograms. Subjective rating of diagnostically important features brought a set of mean rates given for each test image. The lesion detection test resulted in binary decision data analyzed statistically. The radiologists rated and interpreted malignant and benign lesions, representative pathology symptoms, and other structures susceptible to compression distortions contained in 22 original and 62 reconstructed mammograms. Test mammograms were collected in two radiology centers for three years and then selected according to diagnostic content suitable for an evaluation of compression effects. Lossless compression efficiency of the tested coders varied, but CALIC, JPEG-LS, and SPIHT performed the best. The evaluation of lossy compression effects affecting detection ability was based on ROC-like analysis. Assuming a two-sided significance level of p=0.05, the null hypothesis that lower bit rate reconstructions are as useful for diagnosis as the originals was false in sensitivity tests with 0.04 bpp mammograms. However, verification of the same hypothesis with 0.1 bpp reconstructions suggested their acceptance. Moreover, the 1 bpp reconstructions were rated very similarly to the original mammograms in the diagnostic quality evaluation test, but the

  14. The visibility of cancer on previous mammograms in retrospective review

    International Nuclear Information System (INIS)

    Saarenmaa, I.; Salminen, T.; Geiger, U.; Heikkinen, P.; Hyvarinen, S.; Isola, J.; Kataja, V.; Kokko, M.-L.; Kokko, R.; Kumpulainen, E.; Karkkainen, A.; Pakkanen, J.; Peltonen, P.; Piironen, A.; Salo, A.; Talviala, M.-L.; Hakama, M.

    2001-01-01

    AIM: To study how many tumours were visible in restrospect on mammograms originally reported as normal or benign in patients coming to surgery with proven breast cancer. The effect of making the pre--operative mammogram available was also assessed. MATERIALS AND METHODS: Three hundred and twenty initial mammograms of consecutive new breast cancer cases were analysed by a group of radiologists in the knowledge that all patients were later diagnosed with breast cancer. The films were read twice, first without and then with the later (pre-operative) mammograms available. The parenchymal density in the location of the tumour was classified as fatty, mixed or dense, and the tumours were classified as visible or not visible. The reasons for the invisibility of the tumour in the earlier examination were analysed. RESULTS: Fourteen per cent (45) of cancers were retrospectively visible in earlier mammograms without the pre-operative mammograms having been shown, and 29% (95) when pre-operative mammograms were shown. Breast parenchymal density decreased with age and the visibility of tumours increased with age. When considered simultaneously, the effect of age (over 55 vs under 55) was greater (OR = 2.9) than the effect of density (fatty vs others) (OR = 1.5). The most common reasons for non-detection were that the lesion was overlooked (55%), diagnosed as benign (33%) or was visible only in one projection (26%). Growing density was the most common (37%) feature of those lesions originally overlooked or regarded as benign. CONCLUSIONS: Tumours are commonly visible in retrospect, but few of them exhibit specific signs of cancer, and are recognized only if they grow or otherwise change. It is not possible to differentiate most of them from normal parenchymal densities. Saaremaa, I. (2001)

  15. Effects of tooth scaling reminders for dental outpatients.

    Science.gov (United States)

    Cheng, Chi-Chia J; Li, Chung-Yi; Hu, Yih-Jin; Shen, Hsi-Che; Huang, Shay-Min

    2013-06-01

    We investigated the effect of sending reminders for patients to attend appointments for tooth scaling. A total of 389 outpatients were assigned to three intervention groups (reminders sent by postcard, mobile-phone text message or telephone call) and one control group. Reminders accompanied by short health education messages were sent to patients in each of the intervention groups. The outpatient revisiting behaviour of the patients was monitored. Patients who were reminded to come in for tooth scaling were 2.6 (95% CI 1.3-5.4) to 2.9 (CI 1.1-7.8) times more likely to revisit compared to those who were not reminded. For every one point increase in the patient satisfaction score, patients were 3.8 (CI 1.2-11.6) times more likely to revisit. Patients with a high level of patient satisfaction and who had also received a reminder had the highest return rates (26%). Most patients (89-96%) had good feelings regarding the reminders; 65% of the patients agreed that reminders had enhanced their intention to revisit; 91% of patients hoped to continue to receive reminders concerning broader dental health information. A reminder combined with health education is an effective way of improving preventative dental visiting behaviour.

  16. Home exercise programmes supported by video and automated reminders compared with standard paper-based home exercise programmes in patients with stroke: a randomized controlled trial.

    Science.gov (United States)

    Emmerson, Kellie B; Harding, Katherine E; Taylor, Nicholas F

    2017-08-01

    To determine whether patients with stroke receiving rehabilitation for upper limb deficits using smart technology (video and reminder functions) demonstrate greater adherence to prescribed home exercise programmes and better functional outcomes when compared with traditional paper-based exercise prescription. Randomized controlled trial comparing upper limb home exercise programmes supported by video and automated reminders on smart technology, with standard paper-based home exercise programmes. A community rehabilitation programme within a large metropolitan health service. Patients with stroke with upper limb deficits, referred for outpatient rehabilitation. Participants were randomly assigned to the control (paper-based home exercise programme) or intervention group (home exercise programme filmed on an electronic tablet, with an automated reminder). Both groups completed their prescribed home exercise programme for four weeks. The primary outcome was adherence using a self-reported log book. Secondary outcomes were change in upper limb function and patient satisfaction. A total of 62 participants were allocated to the intervention ( n = 30) and control groups ( n = 32). There were no differences between the groups for measures of adherence (mean difference 2%, 95% CI -12 to 17) or change in the Wolf Motor Function Test log transformed time (mean difference 0.02 seconds, 95% CI -0.1 to 0.1). There were no between-group differences in how participants found instructions ( p = 0.452), whether they remembered to do their exercises ( p = 0.485), or whether they enjoyed doing their exercises ( p = 0.864). The use of smart technology was not superior to standard paper-based home exercise programmes for patients recovering from stroke. This trial design was registered prospectively with the Australian and New Zealand Clinical Trials Register, ID: ACTRN 12613000786796. http://www.anzctr.org.au/trialSearch.aspx.

  17. An Investigation into Patient Non-Attendance and Use of a Short-Message Reminder System at a University Dental Clinic.

    Science.gov (United States)

    Storrs, Mark J; Ramov, Helen M; Lalloo, Ratilal

    2016-01-01

    Non-attended appointments in health care facilities create inefficiencies and loss of clinical productivity: clinical teaching hours are reduced, impacting students' ability to meet the competencies necessary for professional registration. The aim of this study was to assess demographic and time-related factors for patient non-attendance at a dental school clinic in Australia. Appointment data were extracted from the patient management system for the years 2011 and 2012. Data included the status of appointment (attended, cancelled, or failed to attend [FTA]) and an array of demographic and time-related factors. Multinomial logistic regression was conducted to assess relationships between these factors and appointment status. Attendance rates were also compared by year following implementation of a short message service (SMS) reminder at the beginning of 2012. The results showed that, of 58,622 appointments booked with students during 2011 and 2012, 68% of patients attended, 23% cancelled, and 9% were FTA. The percentage of non-attended (cancelled or FTA) appointments differed by demographic and time-related factors. Females were 7% less likely to be FTA, those aged 16-24 years were five times more likely to be FTA, and early morning appointments were 18% less likely to be cancelled and FTA. With the SMS reminder system, the odds of a cancellation were 15% higher, but FTAs were 14% lower (both were statistically significant differences). This study found that failing to attend an appointment was significantly related to a number of factors. Clinical scheduling and reminder systems may need to take these factors into account to decrease the number of teaching hours lost due to patients' missing their appointments.

  18. Seat belt reminders.

    NARCIS (Netherlands)

    2008-01-01

    Seat belts are an effective way of reducing the number or road deaths and severe road injuries in crashes. Seat belt reminders warn car drivers and passengers if the seat belt is not fastened. This can be done by a visual signal or an acoustic signal or by a combination of the two. Seat belt

  19. REMINDER FROM MEDIAL SERVICE

    CERN Multimedia

    Service médical

    2000-01-01

    For medical problems, we would like to remind all personnel working on the CERN sites, be they staff or from outside firms, that they are welcome at the Infirmary, building 57, ground floor. For information, call the Nurses - on Telephone: 73802. - by electronic mail: Infirmary.Service@cern.ch Marion.Diedrich@cern.ch Janet.Doody@cern.ch Mireille.Vosdey@cern.ch

  20. REMINDER FROM MEDICAL SERVICE

    CERN Multimedia

    Medical Service

    2001-01-01

    For medical problems, we would like to remind all personnel working on the CERN sites, be they staff or from outside firms, that they are welcome at the Infirmary, building 57, ground floor. For information, call the Nurses on Telephone: 73802. by electronic mail: Infirmary.Service@cern.ch Marion.Diedrich@cern.ch Janet.Doody@cern.ch Mireille.Vosdey@cern.ch

  1. REMINDER FROM MEDICAL SERVICE

    CERN Multimedia

    Medical Service

    2000-01-01

    For medical problems, we would like to remind all personnel working on the CERN sites, be they staff or from outside firms, that they are welcome at the Infirmary, building 57, ground floor. For information, call the Nurses on Telephone: 73802. by electronic mail: Infirmary.Service@cern.ch Marion.Diedrich@cern.ch Janet.Doody@cern.ch Mireille.Vosdey@cern.ch

  2. REMINDER FROM MEDICAL SERVICE

    CERN Multimedia

    Service Médical

    2000-01-01

    For medical problems, we would like to remind all personnel working on the CERN sites, be they staff or from outside firms, that they are welcome at the Infirmary, building 57, ground floor.For information, call the Nurses- on Telephone73802- by electronic mailInfirmary.Service@cern.chMarion.Diedrich@cern.chJanet.Doody@cern.chMireille.Vosdey@cern.chMedical Service

  3. REMINDER FROM MEDICAL SERVICE

    CERN Multimedia

    Medical Service

    2001-01-01

    For medical problems, we would like to remind all personnel working on the CERN sites, be they staff or from outside firms, that they are welcome at the Infirmary, building 57, ground floor. For information, call the Nurses on telephone: 73802. by electronic mail: Infirmary.Service@cern.ch Marion.Diedrich@cern.ch Janet.Doody@cern.ch Mireille.Vosdey@cern.ch

  4. Mammogram CAD, hybrid registration and iconic analysis

    Science.gov (United States)

    Boucher, A.; Cloppet, F.; Vincent, N.

    2013-03-01

    This paper aims to develop a computer aided diagnosis (CAD) based on a two-step methodology to register and analyze pairs of temporal mammograms. The concept of "medical file", including all the previous medical information on a patient, enables joint analysis of different acquisitions taken at different times, and the detection of significant modifications. The developed registration method aims to superimpose at best the different anatomical structures of the breast. The registration is designed in order to get rid of deformation undergone by the acquisition process while preserving those due to breast changes indicative of malignancy. In order to reach this goal, a referent image is computed from control points based on anatomical features that are extracted automatically. Then the second image of the couple is realigned on the referent image, using a coarse-to-fine approach according to expert knowledge that allows both rigid and non-rigid transforms. The joint analysis detects the evolution between two images representing the same scene. In order to achieve this, it is important to know the registration error limits in order to adapt the observation scale. The approach used in this paper is based on an image sparse representation. Decomposed in regular patterns, the images are analyzed under a new angle. The evolution detection problem has many practical applications, especially in medical images. The CAD is evaluated using recall and precision of differences in mammograms.

  5. Interobserver variability in interpretation of mammogram

    International Nuclear Information System (INIS)

    Lee, Kyung Jae; Lee, Hae Kyung; Lee, Won Chul; Hwang, In Young; Park, Young Gyu; Jung, Sang Seol; Kim, Hoon Kyo; Kim, Mi Hye; Kim, Hak Hee

    2004-01-01

    The purpose of this study was to evaluate the performance of radiologists for mammographic screening, and to analyze interobserver agreement in the interpretation of mammograms. 50 women were selected as subjects from the patients who were screened with mammograms at two university hospitals. The images were analyzed by five radiologists working independently and without their having any knowledge of the final diagnosis. The interobserver variation was analyzed by using the kappa statistic. There were moderate agreements for the findings of the parenchymal pattern (k=0.44; 95% CI 0.39-0.49). calcification type (k=0.66; 95% CI 0.60-0.72) and calcification distribution (K=0.43; 95% CI 0.38-0.48). The mean kappa values ranged from 0.66 to 0.42 for the mass findings. The mean kappa value for the final conclusion was 0.44 (95% CI 0.38-0.51). In general, moderate agreement was evident for all the categories that were evaluated. The general agreement was moderate, but there was wide variability in some findings. To improve the accuracy and reduce variability among physicians in interpretation, proper training of radiologists and standardization of criteria are essential for breast screening

  6. REMINDER FROM MEDICAL SERVICE

    CERN Multimedia

    Service Médical

    2000-01-01

    For medical problems, we would like to remind all personnel working on the CERN sites, be they staff or from outside firms, that they are welcome at the Infirmary, building 57, ground floor. For information, call the Nurses on telephone: 73802. by electronic mail to: Infirmary.Service@cern.chMarion.Diedrich@cern.ch Janet.Doody@cern.ch Mireille.Vosdey@cern.ch Medical Service

  7. REMINDER FROM MEDICAL SERVICE

    CERN Multimedia

    Service Médical

    2000-01-01

    iFor medical problems, we would like to remind all personnel working on the CERN sites, be they staff or from outside firms, that they are welcome at the Infirmary, building 57, ground floor. For information, call the Nurses on Telephone: 73802. by electronic mail: Infirmary.Service@cern.ch Marion.Diedrich@cern.ch Janet.Doody@cern.ch Mireille.Vosdey@cern.ch

  8. REMINDER FROM MEDICAL SERVICE

    CERN Multimedia

    2003-01-01

    For medical problems, we would like to remind all personnel working on the CERN sites, staff members or from outside firms, that they are welcome at the Infirmary, building 57, ground floor. For information, call the nurses - on telephone: 73802 - by e-mail:Service.Médical@cern.ch Francoise.Lebrun-Klauser@cern.ch Mireille.Vosdey@cern.ch Katie.Warrillow-Thomson@cern.ch Medical Service

  9. REMINDER FROM MEDICAL SERVICE

    CERN Multimedia

    Medical Service

    2002-01-01

    For medical problems, we would like to remind all personnel working on the CERN sites, staff members or from outside firms, that they are welcome at the Infirmary, building 57, ground floor. For information, call the nurses: on telephone: 73802 by e-mail: Service.Medical@cern.ch Francoise.Lebrun-Klauser@cern.ch Mireille.Vosdey@cern.ch Katie.Warrillow-Thomson@cern.ch Medical Service

  10. REMINDER FROM MEDICAL SERVICE

    CERN Multimedia

    2003-01-01

    For medical problems, we would like to remind all personnel working on the CERN sites, staff members or from outside firms, that they are welcome at the Infirmary, building 57, ground floor. For information, call the nurses - on telephone: 73802 - by e-mail: Service.Médical@cern.ch Francoise.Lebrun-Klauser@cern.ch Mireille.Vosdey@cern.ch Katie.Warrillow-Thomson@cern.ch Medical Service

  11. REMINDER FROM MEDICAL SERVICE

    CERN Multimedia

    Medical Service

    2000-01-01

    For medical problems, we would like to remind all personnel working on the CERN sites, be they staff or from outside firms, that they are welcome at the Infirmary, building 57, ground floor.For information, call the Nurses on Telephone: 73802 or by electronic mail:Infirmary.Service@cern.chMarion.Diedrich@cern.ch Janet.Doody@cern.ch Mireille.Vosdey@cern.chMedicalService

  12. Reminder from Medical Service

    CERN Multimedia

    2003-01-01

    For medical problems, we would like to remind all personnel working on the CERN sites, staff members or from outside firms, that they are welcome at the Infirmary, building 57, ground floor. For information, contact the nurses on telephone: 73802 by e-mail: Service.Médical@cern.ch Francoise.Lebrun-Klauser@cern.ch Mireille.Vosdey@cern.ch Katie.Warrillow-Thomson@cern.ch Medical Service

  13. REMINDER FROM MEDICAL SERVICE

    CERN Multimedia

    Service médical

    2000-01-01

    For medical problems, we would like to remind all personnel working on the CERN sites,be they staff or from outside firms, that they are welcome at the Infirmary, building 57, ground floor.For information, call the Nurseson telephone: 73802.by electronic mail to:Infirmary.Service@cern.chMarion.Diedrich@cern.ch Janet.Doody@cern.ch Mireille.Vosdey@cern.chMedicalService

  14. REMINDER FROM MEDICAL SERVICE

    CERN Multimedia

    Medical Service

    2001-01-01

    For medical problems, we would like to remind all personnel working on the CERN sites, be they staff or from outside firms, that they are welcome at the Infirmary, building 57, ground floor. For information, call the Nurses on Telephone: 73802 by electronic mail: Infirmary.Service@cern.ch Marion.Diedrich@cern.ch Janet.Doody@cern.ch Mireille.Vosdey@cern.ch  

  15. Reminder from Medical Service

    CERN Multimedia

    Medical Service

    2004-01-01

    For medical problems, we would like to remind all personnel working on the CERN sites, staff members or from outside firms, that they are welcome at the Infirmary, building 57, ground floor. For information, call the nurses on telephone: 73802 by e-mail: Service.Medical@cern.ch Francoise.Lebrun-Klauser@cern.ch Mireille.Vosdey@cern.ch Katie.Warrillow-Thomson@cern.ch Medical Service

  16. Intelligent detection of microcalcification from digitized mammograms

    Indian Academy of Sciences (India)

    Permanent link: https://www.ias.ac.in/article/fulltext/sadh/036/01/0125-0139. Keywords. Breast cancer; digital mammogram; artificial neural networks; microcalcification detection. Abstract. This paper reports the design and implementation of an intelligent system for detection of microcalcification from digital mammograms.

  17. Mammograms

    Science.gov (United States)

    ... Reporting & Auditing Grant Transfer Grant Closeout Contracts & Small Business Training Cancer Training at NCI (Intramural) Resources for ... several new technologies to detect breast tumors. This research ranges from methods being developed in research labs to those that ...

  18. Mammograms

    Science.gov (United States)

    ... federal government website managed by the Office on Women's Health in the Office of the Assistant Secretary for Health at the U.S. Department of Health and Human Services . 200 Independence Avenue, S.W., Washington, DC 20201 1-800-994- ...

  19. Used batteries - REMINDER

    CERN Multimedia

    2006-01-01

    With colder weather drawing in, it is quite likely that older car batteries will fail. On this subject, the Safety Commission wishes to remind everyone that CERN is not responsible for the disposal of used batteries from private vehicles. So please refrain from abandoning them on pavements or around or inside buildings. Used batteries can be disposed of safely, free-of-charge and without any damage to the environment at waste disposal sites (déchetteries) close to CERN in both France (Ain and Haute-Savoie) and in the Canton of Geneva in Switzerland (Cheneviers). Since the average car battery lasts a number of years, this only represents a small effort on your part over the whole lifetime of your vehicle. Most people don't need reminding that car batteries contain concentrated sulphuric acid, which can cause severe burns. Despite this, we frequently find them casually dumped in scrap metal bins! For more information, please contact R. Magnier/SC-GS 160879 We all have a responsibility for safety and th...

  20. Decision support system for breast cancer detection using mammograms.

    Science.gov (United States)

    Ganesan, Karthikeyan; Acharya, Rajendra U; Chua, Chua K; Min, Lim C; Mathew, Betty; Thomas, Abraham K

    2013-07-01

    Mammograms are by far one of the most preferred methods of screening for breast cancer. Early detection of breast cancer can improve survival rates to a greater extent. Although the analysis and diagnosis of breast cancer are done by experienced radiologists, there is always the possibility of human error. Interobserver and intraobserver errors occur frequently in the analysis of medical images, given the high variability between every patient. Also, the sensitivity of mammographic screening varies with image quality and expertise of the radiologist. So, there is no golden standard for the screening process. To offset this variability and to standardize the diagnostic procedures, efforts are being made to develop automated techniques for diagnosis and grading of breast cancer images. This article presents a classification pipeline to improve the accuracy of differentiation between normal, benign, and malignant mammograms. Several features based on higher-order spectra, local binary pattern, Laws' texture energy, and discrete wavelet transform were extracted from mammograms. Feature selection techniques based on sequential forward, backward, plus-l-takeaway-r, individual, and branch-and-bound selections using the Mahalanobis distance criterion were used to rank the features and find classification accuracies for combination of several features based on the ranking. Six classifiers were used, namely, decision tree classifier, fisher classifier, linear discriminant classifier, nearest mean classifier, Parzen classifier, and support vector machine classifier. We evaluated our proposed methodology with 300 mammograms obtained from the Digital Database for Screening Mammography and 300 mammograms from the Singapore Anti-Tuberculosis Association CommHealth database. Sensitivity, specificity, and accuracy values were used to compare the performances of the classifiers. Our results show that the decision tree classifier demonstrated an excellent performance compared to

  1. Using autoencoders for mammogram compression.

    Science.gov (United States)

    Tan, Chun Chet; Eswaran, Chikkannan

    2011-02-01

    This paper presents the results obtained for medical image compression using autoencoder neural networks. Since mammograms (medical images) are usually of big sizes, training of autoencoders becomes extremely tedious and difficult if the whole image is used for training. We show in this paper that the autoencoders can be trained successfully by using image patches instead of the whole image. The compression performances of different types of autoencoders are compared based on two parameters, namely mean square error and structural similarity index. It is found from the experimental results that the autoencoder which does not use Restricted Boltzmann Machine pre-training yields better results than those which use this pre-training method.

  2. The efficacy of motivational counselling and SMS reminders on daily sitting time in patients with rheumatoid arthritis

    DEFF Research Database (Denmark)

    Thomsen, Tanja; Aadahl, Mette; Beyer, Nina

    2017-01-01

    biomarkers in patients with rheumatoid arthritis (RA). METHODS: In this randomised controlled trial 150 patients with RA were randomised to an intervention or a no-intervention control group. The intervention group received three individual motivational counselling sessions and short message service or text...... lipids, haemoglobin A1c, body weight, body mass index, waist circumference and waist-hip ratio. RESULTS: 75 patients were allocated to each group. Mean reduction in daily sitting time was -1.61 hours/day in the intervention versus 0.59 hours/day increase in the control group between-group difference -2.......20 (95% CI -2.72 to -1.69; pgroup. Most of the secondary outcomes were also in favour of the intervention. CONCLUSION: An individually tailored, behavioural intervention reduced daily sitting time in patients with RA and improved patient-reported outcomes...

  3. Feasibility of the evidence-based cognitive telerehabilitation program ReMind for patients with primary brain tumors

    NARCIS (Netherlands)

    van der Linden, S.D.; Sitskoorn, M.M.; Rutten, G.J.M.; Gehring, K.

    2018-01-01

    Many patients with primary brain tumors experience cognitive deficits. Cognitive rehabilitation programs focus on alleviating these deficits, but availability of such programs is limited. Our large randomized controlled trial (RCT) demonstrated positive effects of the cognitive rehabilitation

  4. "You Get Reminded You're a Sick Person": Personal Data Tracking and Patients With Multiple Chronic Conditions.

    Science.gov (United States)

    Ancker, Jessica S; Witteman, Holly O; Hafeez, Baria; Provencher, Thierry; Van de Graaf, Mary; Wei, Esther

    2015-08-19

    Consumer health information technologies (HIT) that encourage self-tracking, such as diet and fitness tracking apps and disease journals, are attracting widespread interest among technology-oriented consumers (such as "quantified self" advocates), entrepreneurs, and the health care industry. Such electronic technologies could potentially benefit the growing population of patients with multiple chronic conditions (MCC). However, MCC is predominantly a condition of the elderly and disproportionately affects the less affluent, so it also seems possible that the barriers to use of consumer HIT would be particularly severe for this patient population. Our aim was to explore the perspectives of individuals with MCC using a semistructured interview study. Our research questions were (1) How do individuals with MCC track their own health and medical data? and (2) How do patients and providers perceive and use patient-tracked data? We used semistructured interviews with patients with multiple chronic diseases and providers with experience caring for such patients, as well as participation in a diabetes education group to triangulate emerging themes. Data were analyzed using grounded theory and thematic analysis. Recruitment and analysis took place iteratively until thematic saturation was reached. Interviews were conducted with 22 patients and 7 health care providers. The patients had an average of 3.5 chronic conditions, including type 2 diabetes, heart disease, chronic pain, and depression, and had regular relationships with an average of 5 providers. Four major themes arose from the interviews: (1) tracking this data feels like work for many patients, (2) personal medical data for individuals with chronic conditions are not simply objective facts, but instead provoke strong positive and negative emotions, value judgments, and diverse interpretations, (3) patients track for different purposes, ranging from sense-making to self-management to reporting to the doctor, and (4

  5. The effect of short message system (SMS) reminder on adherence to a healthy diet, medication, and cessation of smoking among adult patients with cardiovascular diseases.

    Science.gov (United States)

    Akhu-Zaheya, Laila M; Shiyab, Wa'ed Y

    2017-02-01

    Cardiovascular Disease is the leading cause of death worldwide. Non-adherence to a recommended regimen among patients with Cardiovascular Diseases represents a significant problem which could lead to an increase in Cardiovascular Diseases. This study aimed to assess the effects of Short Message System (SMS) reminders on adherence to a healthy diet, medication, and cessation of smoking among adult patients with Cardiovascular Diseases. Randomized controlled trial design with three groups was used for this study. A non-probability convenient sample of 160 patients was recruited in this study. The participants were assigned randomly to an experimental group (received SMS regarding adherence to a healthy diet, medication, and smoking cessation), placebo group (received general messages) and control group (routine care). Morisky 8-Item Medication Adherence Scale (MMAS), Mediterranean Diet Adherence Screener (MEDAS), and Readiness to Quit Ladder, were used to assess patients' adherence to medication, adherence to Mediterranean diet, and smoking cessation, respectively. The outcomes were assessed at the beginning of the study and three months later, following completion of the intervention. One way ANONVA was used to assess the study hypothesis. Significant differences between study groups found in terms of adherence to medication (p=.001) and adherence to a healthy diet (p=.000); however, no significant difference was found between groups, in terms of intention to quit smoking, and/or the number of cigarettes smoked (p= .327), (p=.34), respectively. It is documented that SMS is effective in improving adherence to a healthy diet and medication. SMS could be a promising solution for management of different chronic diseases. It is recommended to apply Short Message System (SMS) via cellphone services to improve patient's adherence to a healthy diet and medication. However, further research is needed to support the effectiveness of SMS. Copyright © 2016 Elsevier Ireland

  6. Estimating average glandular dose by measuring glandular rate in mammograms

    International Nuclear Information System (INIS)

    Goto, Sachiko; Azuma, Yoshiharu; Sumimoto, Tetsuhiro; Eiho, Shigeru

    2003-01-01

    The glandular rate of the breast was objectively measured in order to calculate individual patient exposure dose (average glandular dose) in mammography. By employing image processing techniques and breast-equivalent phantoms with various glandular rate values, a conversion curve for pixel value to glandular rate can be determined by a neural network. Accordingly, the pixel values in clinical mammograms can be converted to the glandular rate value for each pixel. The individual average glandular dose can therefore be calculated using the individual glandular rates on the basis of the dosimetry method employed for quality control in mammography. In the present study, a data set of 100 craniocaudal mammograms from 50 patients was used to evaluate our method. The average glandular rate and average glandular dose of the data set were 41.2% and 1.79 mGy, respectively. The error in calculating the individual glandular rate can be estimated to be less than ±3%. When the calculation error of the glandular rate is taken into consideration, the error in the individual average glandular dose can be estimated to be 13% or less. We feel that our method for determining the glandular rate from mammograms is useful for minimizing subjectivity in the evaluation of patient breast composition. (author)

  7. Fibrocystic change of breast : relation with parenchymal pattern on mammogram and fibroadenoma

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Ki Yeol; Cha, In Ho; Kang, Eun Young; Kim, Jung Hyuk [Korea Univ. College of Medicine, Seoul (Korea, Republic of)

    1996-10-01

    To determine the relationship between fibrocystic change and parenchymal pattern and fibroadenoma on mammogram. Mammograms of 135 patients with histologically- diagnosed fibrocystic disease after excisional biopsy were retrospectively analyzed and correlated with pathologic specimens. Classification of the parenchymal pattern was based on Wolfe's method. On mammogram, we observed abnormality in 88 out of the 135 cases;these latter consisted of 70 cases of DY, 30 of P2, 20 of P1, and 15 of Nl, following Wolfe's parenchymal patterns. Among the 88 abnormal cases we obseved 37 cases of mass with clear boundaries, five cases of mass with unclear boundaries, 22 with clustered microcalcifications, six with macrocalcifications and 18 with asymmetric dense breast. Histologic examination revealed a varying composition of stromal fibrosis, epithelial hyperplasia,cyst formation, apocrine metaplasia, etc. Histologically fibroadenomatoid change in 18 cases was appeared as a radiopaque mass on mammogram, especially in those cases where the change was well-defined, which were all except three. Fibrocystic disease was prevalent in Wolfe's P2 and DY patterns(about 80%). About 40% of fibrocystic change appearing as a well defined mass on mammogram showed fibroadenomatoid chage histologically and was difficult to differentiate from fibroadenoma. Fibrocystic disease should therefore be included in the differential diagnosis of a mass which on mammogram is well-defined.

  8. Fibrocystic change of breast : relation with parenchymal pattern on mammogram and fibroadenoma

    International Nuclear Information System (INIS)

    Lee, Ki Yeol; Cha, In Ho; Kang, Eun Young; Kim, Jung Hyuk

    1996-01-01

    To determine the relationship between fibrocystic change and parenchymal pattern and fibroadenoma on mammogram. Mammograms of 135 patients with histologically- diagnosed fibrocystic disease after excisional biopsy were retrospectively analyzed and correlated with pathologic specimens. Classification of the parenchymal pattern was based on Wolfe's method. On mammogram, we observed abnormality in 88 out of the 135 cases;these latter consisted of 70 cases of DY, 30 of P2, 20 of P1, and 15 of Nl, following Wolfe's parenchymal patterns. Among the 88 abnormal cases we obseved 37 cases of mass with clear boundaries, five cases of mass with unclear boundaries, 22 with clustered microcalcifications, six with macrocalcifications and 18 with asymmetric dense breast. Histologic examination revealed a varying composition of stromal fibrosis, epithelial hyperplasia,cyst formation, apocrine metaplasia, etc. Histologically fibroadenomatoid change in 18 cases was appeared as a radiopaque mass on mammogram, especially in those cases where the change was well-defined, which were all except three. Fibrocystic disease was prevalent in Wolfe's P2 and DY patterns(about 80%). About 40% of fibrocystic change appearing as a well defined mass on mammogram showed fibroadenomatoid chage histologically and was difficult to differentiate from fibroadenoma. Fibrocystic disease should therefore be included in the differential diagnosis of a mass which on mammogram is well-defined

  9. Automated detection of microcalcification clusters in mammograms

    Science.gov (United States)

    Karale, Vikrant A.; Mukhopadhyay, Sudipta; Singh, Tulika; Khandelwal, Niranjan; Sadhu, Anup

    2017-03-01

    Mammography is the most efficient modality for detection of breast cancer at early stage. Microcalcifications are tiny bright spots in mammograms and can often get missed by the radiologist during diagnosis. The presence of microcalcification clusters in mammograms can act as an early sign of breast cancer. This paper presents a completely automated computer-aided detection (CAD) system for detection of microcalcification clusters in mammograms. Unsharp masking is used as a preprocessing step which enhances the contrast between microcalcifications and the background. The preprocessed image is thresholded and various shape and intensity based features are extracted. Support vector machine (SVM) classifier is used to reduce the false positives while preserving the true microcalcification clusters. The proposed technique is applied on two different databases i.e DDSM and private database. The proposed technique shows good sensitivity with moderate false positives (FPs) per image on both databases.

  10. Performance of computer-aided detection in false-negative screening mammograms of breast cancers

    International Nuclear Information System (INIS)

    Han, Boo Kyung; Kim, Ji Young; Shin, Jung Hee; Choe, Yeon Hyeon

    2004-01-01

    To analyze retrospectively the abnormalities visible on the false-negative screening mammograms of patients with breast cancer and to determine the performance of computer-aided detection (CAD) in the detection of cancers. Of 108 consecutive cases of breast cancer diagnosed over a period of 6 years, of which previous screening mammograms were available, 32 retrospectively visible abnormalities (at which locations cancer later developed) were found in the previous mammograms, and which were originally reported as negative. These 32 patients ranged in age from 38 to 72 years (mean 52 years). We analyzed their previous mammographic findings, and assessed the ability of CAD to mark cancers in previous mammograms, according to the clinical presentation, the type of abnormalities and the mammographic parenchymal density. In these 32 previous mammograms of breast cancers (20 asymptomatic, 12 symptomatic), the retrospectively visible abnormalities were identified as densities in 22, calcifications in 8, and densities with calcifications in 2. CAD marked abnormalities in 20 (63%) of the 32 cancers with false-negative screening mammograms; 14 (70%) of the 20 subsequent screening-detected cancers, 5 (50%) of the 10 interval cancers, and 1 (50%) of the 2 cancers palpable after the screening interval. CAD marked 12 (50%) of the 24 densities and 9 (90%) of the 10 calcifications. CAD marked abnormalities in 7 (50%) of the 14 predominantly fatty breasts, and 13 (72%) of the 18 dense breasts. CAD-assisted diagnosis could potentially decrease the number of false-negative mammograms caused by the failure to recognize the cancer in the screening program, although its usefulness in the prevention of interval cancers appears to be limited

  11. Quantitative assessment of breast density from mammograms

    International Nuclear Information System (INIS)

    Jamal, N.; Ng, K.H.

    2004-01-01

    Full text: It is known that breast density is increasingly used as a risk factor for breast cancer. This study was undertaken to develop and validate a semi-automated computer technique for the quantitative assessment of breast density from digitised mammograms. A computer technique had been developed using MATLAB (Version 6.1) based GUI applications. This semi-automated image analysis tool consists of gradient correction, segmentation of breast region from background, segmentation of fibroglandular and adipose region within the breast area and calculation of breast density. The density is defined as the percentage of fibroglandular tissue area divided by the total breast area in the mammogram. This technique was clinically validated with 122 normal mammograms; these were subjectively evaluated and classified according to the five parenchyma patterns of the Tabar's scheme (Class I- V) by a consultant radiologist. There was a statistical significant correlation between the computer technique and subjective classification (r 2 = 0.84, p<0.05). 71.3% of subjective classification was correctly classified using the computer technique. We had developed a computer technique for the quantitative assessment of breast density and validated its accuracy for computerized classification based on Tabar's scheme. This quantitative tool is useful for the evaluation of a large dataset of mammograms to predict breast cancer risk based on density. Furthermore it has the potential to provide an early marker for success or failure in chemoprevention studies such as hormonal replacement therapy. Copyright (2004) Australasian College of Physical Scientists and Engineers in Medicine

  12. REMINDER FROM THE MEDICAL SERVICE

    CERN Multimedia

    Medical Service

    2000-01-01

    For medical problems, we would like to remind all personnel working on the CERN sites, be they staff or from outside firms, that they are welcome at the Infirmary, building 57, ground floor. For information, call the Nurses on Telephone: 73802 by electronic mail: Infirmary.Service@cern.ch Marion.Diedrich@cern.ch Janet.Doody@cern.ch Mireille.Vosdey@cern.ch

  13. Mobile phone messaging reminders for attendance at healthcare appointments.

    Science.gov (United States)

    Gurol-Urganci, Ipek; de Jongh, Thyra; Vodopivec-Jamsek, Vlasta; Atun, Rifat; Car, Josip

    2013-12-05

    This review is an update of the original Cochrane review published in July 2012. Missed appointments are a major cause of inefficiency in healthcare delivery with substantial monetary costs for the health system, leading to delays in diagnosis and appropriate treatment. Patients' forgetfulness is one of the main reasons for missed appointments. Patient reminders may help reduce missed appointments. Modes of communicating reminders for appointments to patients include face-to-face communication, postal messages, calls to landlines or mobile phones, and mobile phone messaging. Mobile phone messaging applications, such as Short Message Service (SMS) and Multimedia Message Service (MMS), could provide an important, inexpensive delivery medium for reminders for healthcare appointments. To update our review assessing the effects of mobile phone messaging reminders for attendance at healthcare appointments. Secondary objectives include assessment of costs; health outcomes; patients' and healthcare providers' evaluation of the intervention and perceptions of safety; and possible harms and adverse effects associated with the intervention. Original searches were run in June 2009. For this update, we searched the Cochrane Central Register of Controlled Trials (CENTRAL,The Cochrane Library 2012, Issue 8), MEDLINE (OvidSP) (January 1993 to August 2012), EMBASE (OvidSP) (January 1993 to August 2012), PsycINFO (OvidSP) (January 1993 to August 2012) and CINAHL (EbscoHOST) (January 1993 to August 2012). We also reviewed grey literature (including trial registers) and reference lists of articles. Randomised controlled trials (RCTs) assessing mobile phone messaging as reminders for healthcare appointments. We only included studies in which it was possible to assess effects of mobile phone messaging independent of other technologies or interventions.   Two review authors independently assessed all studies against the inclusion criteria, with any disagreements resolved by a third

  14. INDIAM--an e-learning system for the interpretation of mammograms.

    Science.gov (United States)

    Guliato, Denise; Bôaventura, Ricardo S; Maia, Marcelo A; Rangayyan, Rangaraj M; Simedo, Mariângela S; Macedo, Túlio A A

    2009-08-01

    We propose the design of a teaching system named Interpretation and Diagnosis of Mammograms (INDIAM) for training students in the interpretation of mammograms and diagnosis of breast cancer. The proposed system integrates an illustrated tutorial on radiology of the breast, that is, mammography, which uses education techniques to guide the user (doctors, students, or researchers) through various concepts related to the diagnosis of breast cancer. The user can obtain informative text about specific subjects, access a library of bibliographic references, and retrieve cases from a mammographic database that are similar to a query case on hand. The information of each case stored in the mammographic database includes the radiological findings, the clinical history, the lifestyle of the patient, and complementary exams. The breast cancer tutorial is linked to a module that simulates the analysis and diagnosis of a mammogram. The tutorial incorporates tools for helping the user to evaluate his or her knowledge about a specific subject by using the education system or by simulating a diagnosis with appropriate feedback in case of error. The system also makes available digital image processing tools that allow the user to draw the contour of a lesion, the contour of the breast, or identify a cluster of calcifications in a given mammogram. The contours provided by the user are submitted to the system for evaluation. The teaching system is integrated with AMDI-An Indexed Atlas of Digital Mammograms-that includes case studies, e-learning, and research systems. All the resources are accessible via the Web.

  15. HELTH INFO SANTÉ - REMINDER

    CERN Multimedia

    HR Division

    2000-01-01

    Information from the CHIS Board and the Personnel Division:Going to hospital?Private room or public ward: Careful!Depending on whether you choose a private or semi-private room or a public ward, the cost of a lengthy stay in hospital can change dramatically.First remember that for treatment in hospital, as opposed to outpatient treatment, the cost i.e. board and lodging and care, are reimbursed at 100% in the public ward. The same treatment in a private or semi-private room is reimbursed at 90%. Before deciding which category you want, you should try to estimate the cost you are letting yourself in for. One essential point to bear in mind is that the limit of CHF 69,862. -, which appears on the benefits flyer for 2000 in front of lines 1 to 5, does not apply to treatment in hospital as an in-patient.In the public ward that does not matter since 100% of the costs are reimbursed. But in a private or semi-private room - particularly for lengthy stays requiring a lot of care (resuscitation, intensive care) the 10...

  16. Reproducibility of computer-aided detection system in digital mammograms

    International Nuclear Information System (INIS)

    Kim, Seung Ja; Cho, Nariya; Cha, Joo Hee; Chung, Hye Kyung; Lee, Sin Ho; Cho, Kyung Soo; Kim, Sun Mi; Moon, Woo Kyung

    2005-01-01

    To evaluate the reproducibility of the computer-aided detection (CAD) system for digital mammograms. We applied the CAD system (ImageChecker M1000-DM, version 3.1; R2 Technology) to full field digital mammograms. These mammograms were taken twice at an interval of 10-45 days (mean:25 days) for 34 preoperative patients (breast cancer n=27, benign disease n=7, age range:20-66 years, mean age:47.9 years). On the mammograms, lesions were visible in 19 patients and these were depicted as 15 masses and 12 calcification clusters. We analyzed the sensitivity, the false positive rate (FPR) and the reproducibility of the CAD marks. The broader sensitivities of the CAD system were 80% (12 of 15), 67%(10 of 15) for masses and those for calcification clusters were 100% (12 of 12). The strict sensitivities were 50% (15 of 30) and 50% (15 of 30) for masses and 92% (22 of 24) and 79% (19 of 24) for the clusters. The FPR for the masses was 0.21-0.22/image, the FPR for the clusters was 0.03-0.04/image and the total FPR was 0.24-0.26/image. Among 132 mammography images, the identical images regardless of the existence of CAD marks were 59% (78 of 132), and the identical images with CAD marks were 22% (15 of 69). The reproducibility of the CAD marks for the true positive mass was 67% (12 of 18) and 71% (17 of 24) for the true positive cluster. The reproducibility of CAD marks for the false positive mass was 8% (4 of 53), and the reproducibility of CAD marks for the false positive clusters was 14% (1 of 7). The reproducibility of the total mass marks was 23% (16 of 71), and the reproducibility of the total cluster marks was 58% (18 of 31). CAD system showed higher sensitivity and reproducibility of CAD marks for the calcification clusters which are related to breast cancer. Yet the overall reproducibility of CAD marks was low; therefore, the CAD system must be applied considering this limitation

  17. A retrospective study of the performance of radiographers in interpreting screening mammograms

    International Nuclear Information System (INIS)

    Moran, S.; Warren-Forward, H.

    2011-01-01

    Purpose: This paper provides data on the continued success of radiographers in reviewing mammograms with similar accuracy to screen readers. Method: The participants consisted of 7 radiographers and 2 current official screen readers. Two hundred and fifty sets of mammograms from 2003 were used in this study. Each participant reviewed each set of mammograms as a Rescreen or Recall. Patient outcomes were assessed by following up the results of any histology or pathology tests in 2003 or the 2005/2006 screening results. Results: The screen reader's sensitivities ranged from 79% to 93% and the specificities ranged from 82% to 84%. The radiographer values ranged from 57% to 97% and 63% to 80% respectively. Conclusion: The sensitivity and specificity values attained by some radiographers were equivalent to those of both the screen readers. Accuracy rates of the radiographers suggest that screen reading by selected and appropriately trained radiographers should be achievable in Australia.

  18. Reminder from the Medical Service

    CERN Multimedia

    2003-01-01

    For medical problems, we would like to remind all personnel working on the CERN sites, staff members or from outside firms, that they are welcome at the Infirmary, building 57, ground floor. For information, call the nurses - on telephone: 73802 - by e-mail: Service.Médical@cern.ch Francoise.Lebrun-Klauser@cern.ch Mireille.Vosdey@cern.ch Katie.Warrillow-Thomson@cern.ch Medical Service

  19. Anatomic breast coordinate system for mammogram analysis

    DEFF Research Database (Denmark)

    Karemore, Gopal; Brandt, S.; Karssemeijer, N.

    2011-01-01

    was represented by geodesic distance (s) from nipple and parametric angle (¿) as shown in figure 1. The scoring technique called MTR (mammographic texture resemblance marker) used this breast coordinate system to extract Gaussian derivative features. The features extracted using the (x,y) and the curve......Purpose Many researchers have investigated measures also other than density in the mammogram such as measures based on texture to improve breast cancer risk assessment. However, parenchymal texture characteristics are highly dependent on the orientation of vasculature structure and fibrous tissue...... methodologies as seen from table 2 in given temporal study. Conclusion The curve-linear anatomical breast coordinate system facilitated computerized analysis of mammograms. The proposed coordinate system slightly improved the risk segregation by Mammographic Texture Resemblance and minimized the geometrical...

  20. Clustering microcalcifications techniques in digital mammograms

    Science.gov (United States)

    Díaz, Claudia. C.; Bosco, Paolo; Cerello, Piergiorgio

    2008-11-01

    Breast cancer has become a serious public health problem around the world. However, this pathology can be treated if it is detected in early stages. This task is achieved by a radiologist, who should read a large amount of mammograms per day, either for a screening or diagnostic purpose in mammography. However human factors could affect the diagnosis. Computer Aided Detection is an automatic system, which can help to specialists in the detection of possible signs of malignancy in mammograms. Microcalcifications play an important role in early detection, so we focused on their study. The two mammographic features that indicate the microcalcifications could be probably malignant are small size and clustered distribution. We worked with density techniques for automatic clustering, and we applied them on a mammography CAD prototype developed at INFN-Turin, Italy. An improvement of performance is achieved analyzing images from a Perugia-Assisi Hospital, in Italy.

  1. Association between Radiologists' Experience and Accuracy in Interpreting Screening Mammograms

    Directory of Open Access Journals (Sweden)

    Maristany Maria-Teresa

    2008-04-01

    Full Text Available Abstract Background Radiologists have been observed to differ, sometimes substantially, both in their interpretations of mammograms and in their recommendations for follow-up. The aim of this study was to determine how factors related to radiologists' experience affect the accuracy of mammogram readings. Methods We selected a random sample of screening mammograms from a population-based breast cancer screening program. The sample was composed of 30 women with histopathologically-confirmed breast cancer and 170 women without breast cancer after a 2-year follow-up (the proportion of cancers was oversampled. These 200 mammograms were read by 21 radiologists routinely interpreting mammograms, with different amount of experience, and by seven readers who did not routinely interpret mammograms. All readers were blinded to the results of the screening. A positive assessment was considered when a BI-RADS III, 0, IV, V was reported (additional evaluation required. Diagnostic accuracy was calculated through sensitivity and specificity. Results Average specificity was higher in radiologists routinely interpreting mammograms with regard to radiologists who did not (66% vs 56%; p Conclusion Among radiologists who read routinely, volume is not associated with better performance when interpreting screening mammograms, although specificity decreased in radiologists not routinely reading mammograms. Follow-up of cases for which further workup is recommended might reduce variability in mammogram readings and improve the quality of breast cancer screening programs.

  2. Mobile phone messaging reminders for attendance at healthcare appointments.

    Science.gov (United States)

    Car, Josip; Gurol-Urganci, Ipek; de Jongh, Thyra; Vodopivec-Jamsek, Vlasta; Atun, Rifat

    2012-07-11

    Missed appointments are a major cause of inefficiency in healthcare delivery, with substantial monetary costs for the health system, leading to delays in diagnosis and appropriate treatment. Patients' forgetfulness is one of the main reasons for missed appointments, and reminders may help alleviate this problem. Modes of communicating reminders for appointments to patients include face-to-face communication, postal messages, calls to landlines or mobile phones, and mobile phone messaging. Mobile phone messaging applications such as Short Message Service (SMS) and Multimedia Message Service (MMS) could provide an important, inexpensive delivery medium for reminders for healthcare appointments. To assess the effects of mobile phone messaging reminders for attendance at healthcare appointments. Secondary objectives include assessment of patients' and healthcare providers' evaluation of the intervention; costs; and possible risks and harms associated with the intervention. We searched the Cochrane Central Register of Controlled Trials (CENTRAL,The Cochrane Library 2009, Issue 2), MEDLINE (OvidSP) (January 1993 to June 2009), EMBASE (OvidSP) (January 1993 to June 2009), PsycINFO (OvidSP) (January 1993 to June 2009), CINAHL (EbscoHOST) (January 1993 to June 2009), LILACS (January 1993 to June 2009) and African Health Anthology (January 1993 to June 2009). We also reviewed grey literature (including trial registers) and reference lists of articles. We included randomised controlled trials (RCTs), quasi-randomised controlled trials (QRCTs), controlled before-after (CBA) studies, or interrupted time series (ITS) studies with at least three time points before and after the intervention. We included studies assessing mobile phone messaging as reminders for healthcare appointments. We only included studies in which it was possible to assess effects of mobile phone messaging independent of other technologies or interventions.   Two review authors independently assessed all

  3. The Effect of Breast Implants on Mammogram Outcomes.

    Science.gov (United States)

    Kam, Kelli; Lee, Esther; Pairawan, Seyed; Anderson, Kendra; Cora, Cherie; Bae, Won; Senthil, Maheswari; Solomon, Naveenraj; Lum, Sharon

    2015-10-01

    Breast cancer detection in women with implants has been questioned. We sought to evaluate the impact of breast implants on mammographic outcomes. A retrospective review of women undergoing mammography between March 1 and October 30, 2013 was performed. Demographic characteristics and mammogram results were compared between women with and without breast implants. Overall, 4.8 per cent of 1863 women identified during the study period had breast implants. Median age was 59 years (26-93). Women with implants were younger (53.9 vs 59.2 years, P breast tissue (72.1% vs 56.4%, P = 0.004) than those without. There were no statistically significant differences with regards to Breast Imaging Recording and Data System 0 score (13.3% with implants vs 21.4% without), call back exam (18.9% with vs 24.1% without), time to resolution of abnormal imaging (58.6 days with vs 43.3 without), or cancer detection rate (0% with implants vs 1.0% without). Because implants did not significantly affect mammogram results, women with implants should be reassured that mammography remains useful in detecting cancer. However, future research is required to determine whether lower call back rates and longer time to resolution of imaging findings contribute to delays in diagnosis in patients with implants.

  4. Developing the Medication Reminder Mobile Application "Seeb".

    Science.gov (United States)

    Saghaeiannejad-Isfahani, Sakineh; Ehteshami, Asghar; Savari, Ebtesam; Samimi, Ali

    2017-06-01

    Today, the structure of comprehensive health care emphasizes self-care more than therapy. Medication therapy is a strong instrument for therapy received through the health setting, especially in medication area. Error in medication administration has produced different problems and they cost billions of dollars every year. Regarding mobile phone extensions, we developed a local medication reminder mobile application called "Seeb" as a suitable solution for decreasing medication errors for Iranians. We conducted a mixed methods study in three Phases: 1) Comparative study of existing mobile applications; 2) developed its object-oriented model; 3) Developed the initial version of "Seeb" that was approved for production. This application was designed for the appropriate medication administration including time and dosages through: recording patient and medication data; scheduling patients' medication; and reporting medication administration on progress. "Seeb" has been designed in compliance with Iranian health information technologists and pharmacists requirements. It is expected to reduce medication error and improve patient adherence to medical prescriptions.

  5. Appointment reminder systems are effective but not optimal: results of a systematic review and evidence synthesis employing realist principles.

    Science.gov (United States)

    McLean, Sionnadh Mairi; Booth, Andrew; Gee, Melanie; Salway, Sarah; Cobb, Mark; Bhanbhro, Sadiq; Nancarrow, Susan A

    2016-01-01

    Missed appointments are an avoidable cost and resource inefficiency which impact upon the health of the patient and treatment outcomes. Health care services are increasingly utilizing reminder systems to manage these negative effects. This study explores the effectiveness of reminder systems for promoting attendance, cancellations, and rescheduling of appointments across all health care settings and for particular patient groups and the contextual factors which indicate that reminders are being employed sub-optimally. We used three inter-related reviews of quantitative and qualitative evidence. Firstly, using pre-existing models and theories, we developed a conceptual framework to inform our understanding of the contexts and mechanisms which influence reminder effectiveness. Secondly, we performed a review following Centre for Reviews and Dissemination guidelines to investigate the effectiveness of different methods of reminding patients to attend health service appointments. Finally, to supplement the effectiveness information, we completed a review informed by realist principles to identify factors likely to influence non-attendance behaviors and the effectiveness of reminders. We found consistent evidence that all types of reminder systems are effective at improving appointment attendance across a range of health care settings and patient populations. Reminder systems may also increase cancellation and rescheduling of unwanted appointments. "Reminder plus", which provides additional information beyond the reminder function may be more effective than simple reminders (ie, date, time, place) at reducing non-attendance at appointments in particular circumstances. We identified six areas of inefficiency which indicate that reminder systems are being used sub-optimally. Unless otherwise indicated, all patients should receive a reminder to facilitate attendance at their health care appointment. The choice of reminder system should be tailored to the individual service

  6. Diagnostic image quality of mammograms in German outpatient medical care

    International Nuclear Information System (INIS)

    Pfandzelter, R.; Wuelfing, U.; Boedeker, B.

    2010-01-01

    Purpose: A total of 79 115 mammograms from statutory health insurance (SHI) physicians within German outpatient care were evaluated with respect to the diagnostic image quality. Materials and Methods: Mammograms were randomly selected between 2006 and 2008 by the regional Associations of Statutory Health Insurance Physicians and submitted to regional boards of experts for external evaluation. The mammogram quality was evaluated using a 3-point scale (adequate, borderline, failure) and documented using a nationally standardized protocol. Results: 87.6 % of the mammograms were classified as adequate, 11.0 % as borderline and 1.4 % as failure. Mediolateral oblique mammograms (mlo) had worse ratings than craniocaudal mammograms (cc). Main reasons for classifying the mammograms as borderline or failure were 'inframammary fold not adequately visualized' (mlo), 'pectoral muscle not in the correct angle or not to the level with the nipple' (mlo), 'the nipple not in profile' (mlo, cc) and 'breast not completely or not adequately visualized' (cc). Conclusion: The results show a good overall quality of mammograms in German outpatient medical care. Failures can be associated predominantly with incorrect positioning of the breast. More precisely defined quality criteria using objective measures are recommended, especially for craniocaudal mammograms (cc). (orig.)

  7. Effectiveness of mobile-phone short message service (SMS reminders for ophthalmology outpatient appointments: Observational study

    Directory of Open Access Journals (Sweden)

    Car Josip

    2008-05-01

    Full Text Available Abstract Background Non-attendance for hospital outpatient appointments is a significant problem in many countries. It causes suboptimal use of clinical and administrative staff and financial losses, as well as longer waiting times. The use of Short Message Service (SMS appointment reminders potentially offers a cost-effective and time-efficient strategy to decrease non-attendance and so improve the efficiency of outpatient healthcare delivery. Methods An SMS text message was sent to patients with scheduled appointments between April and September 2006 in a hospital ophthalmology department in London, reminding them of their appointments. This group acted as the intervention group. Controls were patients with scheduled ophthalmology appointments who did not receive an SMS or any alternative reminder. Results During the period of the study, 11.2% (50/447 of patients who received an SMS appointment reminder were non-attenders, compared to 18.1% (1720/9512 who did not receive an SMS reminder. Non-attendance rates were 38% lower in patients who received an SMS reminder than in patients who did not receive a reminder (RR of non-attendance = 0.62; 95% CI = 0.48 – 0.80. Conclusion The use of SMS reminders for ophthalmology outpatient appointments was associated with a reduction of 38% in the likelihood of patients not attending their appointments, compared to no appointment reminder. The use of SMS reminders may also be more cost-effective than traditional appointment reminders and require less labour. These findings should be confirmed with a more rigorous study design before a wider roll-out.

  8. The classification of normal screening mammograms

    Science.gov (United States)

    Ang, Zoey Z. Y.; Rawashdeh, Mohammad A.; Heard, Robert; Brennan, Patrick C.; Lee, Warwick; Lewis, Sarah J.

    2016-03-01

    Rationale and objectives: To understand how breast screen readers classify the difficulty of normal screening mammograms using common lexicon describing normal appearances. Cases were also assessed on their suitability for a single reader strategy. Materials and Methods: 15 breast readers were asked to interpret a test set of 29 normal screening mammogram cases and classify them by rating the difficulty of the case on a five-point Likert scale, identifying the salient features and assessing their suitability for single reading. Using the False Positive Fractions from a previous study, the 29 cases were classified into 10 "low", 10 "medium" and nine "high" difficulties. Data was analyzed with descriptive statistics. Spearman's correlation was used to test the strength of association between the difficulty of the cases and the readers' recommendation for single reading strategy. Results: The ratings from readers in this study corresponded to the known difficulty level of cases for the 'low' and 'high' difficulty cases. Uniform ductal pattern and density, symmetrical mammographic features and the absence of micro-calcifications were the main reasons associated with 'low' difficulty cases. The 'high' difficulty cases were described as having `dense breasts'. There was a statistically significant negative correlation between the difficulty of the cases and readers' recommendation for single reading (r = -0.475, P = 0.009). Conclusion: The findings demonstrated potential relationships between certain mammographic features and the difficulty for readers to classify mammograms as 'normal'. The standard Australian practice of double reading was deemed more suitable for most cases. There was an inverse moderate association between the difficulty of the cases and the recommendations for single reading.

  9. Detecting microcalcifications in digital mammogram using wavelets

    International Nuclear Information System (INIS)

    Yang Jucheng; Park Dongsun

    2004-01-01

    Breast cancer is still one of main mortality causes in women, but the early detection can increase the chance of cure. Microcalcifications are small size structures, which can indicate the presence of cancer since they are often associated to the most different types of breast tumors. However, they very small size and the X-ray systems limitations lead to constraints to the adequate visualization of such structures, which means that the microcalcifications can be missed many times in mammogram visual examination. In addition, the human eyes are not able to distinguish minimal tonality differences, which can be another constraint when mammogram image presents poor contrast between microcalcifications and the tissues around them. Computer-aided diagnosis (CAD) schemes are being developed in order to increase the probabilities of early detection. To enhance and detect the microcalcifications in the mammograms we use the wavelets transform. From a signal processing point of view, microcalcifications are high frequency components in mammograms. Due to the multi-resolution decomposition capacity of the wavelet transform, we can decompose the image into different resolution levels which sensitive to different frequency bands. By choosing an appropriate wavelet and a right resolution level, we can effectively enhance and detect the microcalcifications in digital mammogram. In this work, we describe a new four-step method for the detection of microcalcifications: segmentation, wavelets transform processing, labeling and post-processing. The segmentation step is to split the breast area into 256x256 segments. For each segmented sub-image, wavelet transform is operated on it. For comparing study wavelet transform method, 4 typical family wavelets and 4 decomposing levels is discussed. We choose four family wavelets for detecting microcalcifications, that is, Daubechies, Biothgonai, Coieflets and Symlets wavelets, for simply, bd4, bior3.7, coif3, sym2 are chosen as the

  10. Normal mammogram detection based on local probability difference transforms and support vector machines

    International Nuclear Information System (INIS)

    Chiracharit, W.; Kumhom, P.; Chamnongthai, K.; Sun, Y.; Delp, E.J.; Babbs, C.F

    2007-01-01

    Automatic detection of normal mammograms, as a ''first look'' for breast cancer, is a new approach to computer-aided diagnosis. This approach may be limited, however, by two main causes. The first problem is the presence of poorly separable ''crossed-distributions'' in which the correct classification depends upon the value of each feature. The second problem is overlap of the feature distributions that are extracted from digitized mammograms of normal and abnormal patients. Here we introduce a new Support Vector Machine (SVM) based method utilizing with the proposed uncrossing mapping and Local Probability Difference (LPD). Crossed-distribution feature pairs are identified and mapped into a new features that can be separated by a zero-hyperplane of the new axis. The probability density functions of the features of normal and abnormal mammograms are then sampled and the local probability difference functions are estimated to enhance the features. From 1,000 ground-truth-known mammograms, 250 normal and 250 abnormal cases, including spiculated lesions, circumscribed masses or microcalcifications, are used for training a support vector machine. The classification results tested with another 250 normal and 250 abnormal sets show improved testing performances with 90% sensitivity and 89% specificity. (author)

  11. Reminder: Mandatory Computer Security Course

    CERN Multimedia

    IT Department

    2011-01-01

    Just like any other organization, CERN is permanently under attack – even right now. Consequently it's important to be vigilant about security risks, protecting CERN's reputation - and your work. The availability, integrity and confidentiality of CERN's computing services and the unhindered operation of its accelerators and experiments come down to the combined efforts of the CERN Security Team and you. In order to remain par with the attack trends, the Security Team regularly reminds CERN users about the computer security risks, and about the rules for using CERN’s computing facilities. Therefore, a new dedicated basic computer security course has been designed informing you about the “Do’s” and “Dont’s” when using CERN's computing facilities. This course is mandatory for all person owning a CERN computer account and must be followed once every three years. Users who have never done the course, or whose course needs to be renewe...

  12. Reminder: Swiss and French cards

    CERN Multimedia

    2012-01-01

    Communication from the HR Department to members of personnel holding an employment or association contract, above 50% and for more than 3 months, with the Organization. The HR Department would like to remind all members of personnel concerned that they are obliged to: • hold a valid Swiss  Légitimation card AND a valid French card (“Titre de séjour spécial” or “attestation de fonctions”) at all times during the exercise of their functions in the Organization; • return these documents as soon as their functions in the Organization cease. Not following these rules could be prejudicial to the Organization and appropriate measures may be taken towards the member of personnel concerned. Information and procedures concerning Swiss and French cards (first application, renewal, theft/loss, etc.) are available in the Admin e-guide. Users and Unpaid Associates must contact the Users Office HR Department Tel.: 729...

  13. Swiss and French cards - Reminder

    CERN Multimedia

    HR Department

    2011-01-01

    Communication from the HR Department to members of personnel holding an employment or association contract, above 50% and for more than 3 months, with the Organization. The HR Department would like to remind all members of the personnel concerned that they are obliged to: hold a valid Swiss Légitimation card AND a valid French card (“Titre de séjour spécial” or “attestation de fonctions”) at all times during the exercise of their functions in the Organization; return these documents as soon as their functions in the Organization cease. Not following these rules could be prejudicial to the Organization and appropriate measures may be taken with respect to the member of the personnel concerned. Information and procedures concerning Swiss and French cards (first application, renewal, theft/loss, etc.) are available in the Admin e-guide: https://cern.ch/admin-eguide/cartes/proc_cartes_home.asp Users and Unpaid Associates must ...

  14. MAMMOGRAMS ANALYSIS USING SVM CLASSIFIER IN COMBINED TRANSFORMS DOMAIN

    Directory of Open Access Journals (Sweden)

    B.N. Prathibha

    2011-02-01

    Full Text Available Breast cancer is a primary cause of mortality and morbidity in women. Reports reveal that earlier the detection of abnormalities, better the improvement in survival. Digital mammograms are one of the most effective means for detecting possible breast anomalies at early stages. Digital mammograms supported with Computer Aided Diagnostic (CAD systems help the radiologists in taking reliable decisions. The proposed CAD system extracts wavelet features and spectral features for the better classification of mammograms. The Support Vector Machines classifier is used to analyze 206 mammogram images from Mias database pertaining to the severity of abnormality, i.e., benign and malign. The proposed system gives 93.14% accuracy for discrimination between normal-malign and 87.25% accuracy for normal-benign samples and 89.22% accuracy for benign-malign samples. The study reveals that features extracted in hybrid transform domain with SVM classifier proves to be a promising tool for analysis of mammograms.

  15. ‘The phone reminder is important, but will others get to know about my illness?’ Patient perceptions of an mHealth antiretroviral treatment support intervention in the HIVIND trial in South India

    Science.gov (United States)

    Rodrigues, Rashmi; Poongulali, S; Balaji, Kavitha; Atkins, Salla; Ashorn, Per; De Costa, Ayesha

    2015-01-01

    Objectives The recent explosion of mHealth applications in the area of HIV care has led to the development of mHealth interventions to support antiretroviral treatment adherence. Several of these interventions have been tested for effectiveness, but few studies have explored patient perspectives of such interventions. Exploring patient perspectives enhances the understanding of how an intervention works or why it does not. We therefore studied perceptions regarding an mHealth adherence intervention within the HIVIND trial in South India. Methods The study was conducted at three clinics in South India. The intervention comprised an automated interactive voice response (IVR) call and a pictorial short messaging service (SMS), each delivered weekly. Sixteen purposively selected participants from the intervention arm in the HIVIND trial were interviewed. All participants had completed at least 84 weeks since enrollment in the trial. Perceptions on the usefulness and perceived benefits and risks of receiving the intervention were sought. The interviews were transcribed and analysed using the framework approach to qualitative data analysis. Results Despite varying perceptions of the intervention, most participants found it useful. The intervention was perceived as a sign of ‘care’ from the clinic. The IVR call was preferred to the SMS reminder. Two-way communication was preferred to automated calls. Participants also perceived a risk of unintentional disclosure of their HIV status and stigma thereof via the intervention and took initiatives to mitigate this risk. Targeting reminders at those with poor adherence and those in need of social support was suggested. Conclusions mHealth adherence interventions go beyond their intended role to provide a sense of care and support to the recipient. Although automated interventions are impersonal, they could be a solution for scale up. Interventions that engage both the recipient and the healthcare provider have greater

  16. Email for the coordination of healthcare appointments and attendance reminders.

    Science.gov (United States)

    Atherton, Helen; Sawmynaden, Prescilla; Meyer, Barbara; Car, Josip

    2012-08-15

    Email is a popular and commonly-used method of communication, but its use in health care is not routine. Where email communication has been utilised in health care, its purposes have included the coordination of healthcare appointments and attendance reminders, but the effects of using email in this way are not known. This review considers the use of email for the coordination of healthcare appointments and reminders for attendance; particularly scheduling, rescheduling and cancelling healthcare appointments, and providing prompts/reminders for attendance at appointments. To assess the effects of using email for the coordination of healthcare appointments and attendance reminders, compared to other forms of coordinating appointments and reminders, on outcomes for health professionals, patients and carers, and health services, including harms. We searched: the Cochrane Consumers and Communication Review Group Specialised Register, the Cochrane Central Register of Controlled Trials (CENTRAL, The Cochrane Library, Issue 1 2010), MEDLINE (OvidSP) (1950 to January 2010), EMBASE (OvidSP) (1980 to January 2010), PsycINFO (OvidSP) (1967 to January 2010), CINAHL (EbscoHOST) (1982 to February 2010),and ERIC (CSA) (1965 to January 2010). We searched grey literature: theses/dissertation repositories, trials registers and Google Scholar (searched July 2010). We used additional search methods: examining reference lists and contacting authors. Randomised controlled trials, quasi-randomised trials, controlled before and after studies and interrupted time series studies of interventions that use email for scheduling health appointments, for reminders for a scheduled health appointment or for ongoing coordination of health appointments and that took the form of 1) unsecured email 2) secure email or 3) web messaging. All healthcare professionals, patients and caregivers in all settings were considered. Two review authors independently assessed the titles and abstracts of retrieved

  17. Improved Classification of Mammograms Following Idealized Training

    Science.gov (United States)

    Hornsby, Adam N.; Love, Bradley C.

    2014-01-01

    People often make decisions by stochastically retrieving a small set of relevant memories. This limited retrieval implies that human performance can be improved by training on idealized category distributions (Giguère & Love, 2013). Here, we evaluate whether the benefits of idealized training extend to categorization of real-world stimuli, namely classifying mammograms as normal or tumorous. Participants in the idealized condition were trained exclusively on items that, according to a norming study, were relatively unambiguous. Participants in the actual condition were trained on a representative range of items. Despite being exclusively trained on easy items, idealized-condition participants were more accurate than those in the actual condition when tested on a range of item types. However, idealized participants experienced difficulties when test items were very dissimilar from training cases. The benefits of idealization, attributable to reducing noise arising from cognitive limitations in memory retrieval, suggest ways to improve real-world decision making. PMID:24955325

  18. Improved Classification of Mammograms Following Idealized Training.

    Science.gov (United States)

    Hornsby, Adam N; Love, Bradley C

    2014-06-01

    People often make decisions by stochastically retrieving a small set of relevant memories. This limited retrieval implies that human performance can be improved by training on idealized category distributions (Giguère & Love, 2013). Here, we evaluate whether the benefits of idealized training extend to categorization of real-world stimuli, namely classifying mammograms as normal or tumorous. Participants in the idealized condition were trained exclusively on items that, according to a norming study, were relatively unambiguous. Participants in the actual condition were trained on a representative range of items. Despite being exclusively trained on easy items, idealized-condition participants were more accurate than those in the actual condition when tested on a range of item types. However, idealized participants experienced difficulties when test items were very dissimilar from training cases. The benefits of idealization, attributable to reducing noise arising from cognitive limitations in memory retrieval, suggest ways to improve real-world decision making.

  19. REMINDER: Saved Leave Scheme (SLS)

    CERN Multimedia

    2003-01-01

    Transfer of leave to saved leave accounts Under the provisions of the voluntary saved leave scheme (SLS), a maximum total of 10 days'* annual and compensatory leave (excluding saved leave accumulated in accordance with the provisions of Administrative Circular No 22B) can be transferred to the saved leave account at the end of the leave year (30 September). We remind you that unused leave of all those taking part in the saved leave scheme at the closure of the leave year accounts is transferred automatically to the saved leave account on that date. Therefore, staff members have no administrative steps to take. In addition, the transfer, which eliminates the risk of omitting to request leave transfers and rules out calculation errors in transfer requests, will be clearly shown in the list of leave transactions that can be consulted in EDH from October 2003 onwards. Furthermore, this automatic leave transfer optimizes staff members' chances of benefiting from a saved leave bonus provided that they ar...

  20. First-aid boxes - Reminder

    CERN Multimedia

    GS Department

    2010-01-01

    With a view to ensuring optimum use of the first-aid boxes on the CERN site, we should like to remind you of various changes introduced in March 2009: The TSO of the buildings concerned is responsible for the first-aid boxes, including checking their contents.   First-aid boxes may be restocked ONLY at the CERN stores (SCEM No. 54.99.80). This is no longer possible at the Infirmary. The associated cost is charged to the Departments.   First-aid boxes should be used only for mild injuries. All other cases should be referred to the Medical Service Infirmary (Bldg. 57 – ground-floor, tel. 73802) between 8.00 a.m. and 5.30 p.m. or to the Fire and Rescue Service (tel. 74444). N.B.: This information does not apply to the red emergency first-aid boxes in the underground areas or to the emergency kits for use in the event of being splashed with hydrofluoric acid.

  1. Improving work-up of the abnormal mammogram through organized assessment: results from the ontario breast screening program.

    Science.gov (United States)

    Quan, May Lynn; Shumak, Rene S; Majpruz, Vicky; Holloway, Claire M D; O'Malley, Frances P; Chiarelli, Anna M

    2012-03-01

    Women with an abnormal screening mammogram should ideally undergo an organized assessment to attain a timely diagnosis. This study evaluated outcomes of women undergoing work-up after abnormal mammogram through a formal breast assessment affiliate (BAA) program with explicit care pathways compared with usual care (UC) using developed quality indicators for screening mammography programs. Between January 1 and December 31, 2007, a total of 320,635 women underwent a screening mammogram through the Ontario Breast Screening Program (OBSP), of whom 25,543 had an abnormal result requiring further assessment. Established indicators assessing timeliness, appropriateness of follow-up, and biopsy rates were compared between women who were assessed through either a BAA or UC using χ(2) analysis. Work-up of the abnormal mammogram for patients screened through a BAA resulted in a greater proportion of women attaining a definitive diagnosis within the recommended time interval when a histologic diagnosis was required. In addition, use of other quality measures including specimen radiography for both core biopsies and surgical specimens and preoperative core needle biopsy was greater in BAA facilities. These findings support future efforts to increase the number of BAAs within the OBSP, because the pathways and reporting methods associated with them result in improvements in our ability to provide timely and appropriate care for women requiring work-up of an abnormal mammogram.

  2. Availability and accessibility of subsidized mammogram screening program in peninsular Malaysia: A preliminary study using travel impedance approach.

    Science.gov (United States)

    Mahmud, Aidalina; Aljunid, Syed Mohamed

    2018-01-01

    Access to healthcare is essential in the pursuit of universal health coverage. Components of access are availability, accessibility (spatial and non-spatial), affordability and acceptability. Measuring spatial accessibility is common approach to evaluating access to health care. This study aimed to determine the availability and spatial accessibility of subsidised mammogram screening in Peninsular Malaysia. Availability was determined from the number and distribution of facilities. Spatial accessibility was determined using the travel impedance approach to represent the revealed access as opposed to potential access measured by other spatial measurement methods. The driving distance of return trips from the respondent's residence to the facilities was determined using a mapping application. The travel expenditure was estimated by multiplying the total travel distance by a standardised travel allowance rate, plus parking fees. Respondents in this study were 344 breast cancer patients who received treatment at 4 referral hospitals between 2015 and 2016. In terms of availability, there were at least 6 major entities which provided subsidised mammogram programs. Facilities with mammogram involved with these programs were located more densely in the central and west coast region of the Peninsula. The ratio of mammogram facility to the target population of women aged 40-74 years ranged between 1: 10,000 and 1:80,000. In terms of accessibility, of the 3.6% of the respondents had undergone mammogram screening, their mean travel distance was 53.4 km (SD = 34.5, range 8-112 km) and the mean travel expenditure was RM 38.97 (SD = 24.00, range RM7.60-78.40). Among those who did not go for mammogram screening, the estimated travel distance and expenditure had a skewed distribution with median travel distance of 22.0 km (IQR 12.0, 42.0, range 2.0-340.0) and the median travel cost of RM 17.40 (IQR 10.40, 30.00, range 3.40-240.00). Higher travel impedance was noted among those who

  3. Telephone reminders reduced the non-attendance rate in a gastroenterology outpatient clinic.

    Science.gov (United States)

    Jeppesen, Maja Haunstrup; Ainsworth, Mark Andrew

    2015-06-01

    Non-attendance is a global health-care problem. The aim of the present study was 1) to investigate if a telephone reminder could reduce the non-attendance rate, 2) to study reasons for non-attendance and 3) to evaluate if a permanent implementation would be economically advantageous in a gastroenterology outpatient clinic like ours. This was a comparative intervention study with a historical control group in a gastroenterology outpatient clinic. The study lasted six months. Patients with a scheduled appointment in the first three-month period received no reminder (control group, n = 2,705). Patients in the following three-month period were reminded by telephone one weekday in advance of their appointment, when possible (intervention group, n = 2,479). Non-attending patients in the intervention group received a questionnaire. Based on the results, a financial cost-benefit analysis was made. In the intervention group, 1,577 (64%) patients answered the reminder telephone call. The non-attendance rate was significantly lower in the intervention group (6.1%) than in the control group (10.5%) (p < 0.00001). Only 1.3% of the patients who answered the reminder turned out to be non-attendees. The most common explanation for non-attendance in the intervention group was forgetfulness (39%). The reminder telephone call was cost-effective. In this outpatient clinic, telephone reminders were cost-effective and significantly reduced the non-attendance rate by 43%.

  4. The effectiveness of interventions using electronic reminders to improve adherence to chronic medication: a systematic review of the literature

    NARCIS (Netherlands)

    Vervloet, M.; Linn, A.J.; van Weert, J.C.M.; de Bakker, D.H.; Bouvy, M.L.; van Dijk, L.

    2012-01-01

    Background: Many patients experience difficulties in adhering to long-term treatment. Although patients' reasons for not being adherent are diverse, one of the most commonly reported barriers is forgetfulness. Reminding patients to take their medication may provide a solution. Electronic reminders

  5. Review and analysis of mammograms of the Servicio de Radiologia, Hospital Calderon Guardia from January 2013 to May 2013

    International Nuclear Information System (INIS)

    Lawrence Villalobos, Andrea; Solis Vargas, Carlos

    2013-01-01

    An analysis of 400 mammograms of the Radiology Service of the Calderon Guardia Hospital is carried out, linking the statistical findings between BIRADS Categorization, family hereditary factors, age groups and pathological personalities, of the patients treated in the period from January 2013 to May 2013 Calcifications are identified as the most frequent pathological findings in mammograms analyzed. Ultrasound is identified as the complementary method to mammography the most frequently used. Mammography is still the screening study for the early detection of breast cancer. The support of specialists in radiology of medical images is recommended to implement early reports in the second level of attention [es

  6. What Is a Mammogram and When Should I Get One?

    Science.gov (United States)

    ... Statistics What CDC Is Doing Research African American Women and Mass Media Campaign Public Service Announcements Print Materials Buttons and Badges Stay Informed Cancer Home What Is a Mammogram? Language: English (US) Español ( ...

  7. Computerized Analysis and Detection of Missed Cancer in Screening Mammogram

    National Research Council Canada - National Science Library

    Li, Lihua

    2005-01-01

    This project is to explore an innovative CAD strategy for improving early detection of breast cancer in screening mammograms by focusing on computerized analysis and detection of cancers missed by radiologists...

  8. Computerized Analysis and Detection of Missed Cancer in Screening Mammogram

    National Research Council Canada - National Science Library

    Li, Lihua

    2004-01-01

    This project is to explore an innovative CAD strategy for improving early detection of breast cancer in screening mammograms by focusing on computerized analysis and detection of cancers missed by radiologists...

  9. 'The phone reminder is important, but will others get to know about my illness?' Patient perceptions of an mHealth antiretroviral treatment support intervention in the HIVIND trial in South India.

    Science.gov (United States)

    Rodrigues, Rashmi; Poongulali, S; Balaji, Kavitha; Atkins, Salla; Ashorn, Per; De Costa, Ayesha

    2015-11-02

    The recent explosion of mHealth applications in the area of HIV care has led to the development of mHealth interventions to support antiretroviral treatment adherence. Several of these interventions have been tested for effectiveness, but few studies have explored patient perspectives of such interventions. Exploring patient perspectives enhances the understanding of how an intervention works or why it does not. We therefore studied perceptions regarding an mHealth adherence intervention within the HIVIND trial in South India. The study was conducted at three clinics in South India. The intervention comprised an automated interactive voice response (IVR) call and a pictorial short messaging service (SMS), each delivered weekly. Sixteen purposively selected participants from the intervention arm in the HIVIND trial were interviewed. All participants had completed at least 84 weeks since enrollment in the trial. Perceptions on the usefulness and perceived benefits and risks of receiving the intervention were sought. The interviews were transcribed and analysed using the framework approach to qualitative data analysis. Despite varying perceptions of the intervention, most participants found it useful. The intervention was perceived as a sign of 'care' from the clinic. The IVR call was preferred to the SMS reminder. Two-way communication was preferred to automated calls. Participants also perceived a risk of unintentional disclosure of their HIV status and stigma thereof via the intervention and took initiatives to mitigate this risk. Targeting reminders at those with poor adherence and those in need of social support was suggested. mHealth adherence interventions go beyond their intended role to provide a sense of care and support to the recipient. Although automated interventions are impersonal, they could be a solution for scale up. Interventions that engage both the recipient and the healthcare provider have greater potential for success. Personalising m

  10. Measuring agreement between decision support reminders: the cloud vs. the local expert.

    Science.gov (United States)

    Dixon, Brian Edward; Simonaitis, Linas; Perkins, Susan M; Wright, Adam; Middleton, Blackford

    2014-04-10

    A cloud-based clinical decision support system (CDSS) was implemented to remotely provide evidence-based guideline reminders in support of preventative health. Following implementation, we measured the agreement between preventive care reminders generated by an existing, local CDSS and the new, cloud-based CDSS operating on the same patient visit data. Electronic health record data for the same set of patients seen in primary care were sent to both the cloud-based web service and local CDSS. The clinical reminders returned by both services were captured for analysis. Cohen's Kappa coefficient was calculated to compare the two sets of reminders. Kappa statistics were further adjusted for prevalence and bias due to the potential effects of bias in the CDS logic and prevalence in the relative small sample of patients. The cloud-based CDSS generated 965 clinical reminders for 405 patient visits over 3 months. The local CDSS returned 889 reminders for the same patient visit data. When adjusted for prevalence and bias, observed agreement varied by reminder from 0.33 (95% CI 0.24 - 0.42) to 0.99 (95% CI 0.97 - 1.00) and demonstrated almost perfect agreement for 7 of the 11 reminders. Preventive care reminders delivered by two disparate CDS systems show substantial agreement. Subtle differences in rule logic and terminology mapping appear to account for much of the discordance. Cloud-based CDSS therefore show promise, opening the door for future development and implementation in support of health care providers with limited resources for knowledge management of complex logic and rules.

  11. The efficacy of motivational counselling and SMS reminders on daily sitting time in patients with rheumatoid arthritis: a randomised controlled trial.

    Science.gov (United States)

    Thomsen, Tanja; Aadahl, Mette; Beyer, Nina; Hetland, Merete Lund; Løppenthin, Katrine; Midtgaard, Julie; Christensen, Robin; Østergaard, Mikkel; Jennum, Poul Jørgen; Esbensen, Bente Appel

    2017-09-01

    The aim of this report is to investigate the efficacy of an individually tailored, theory-based behavioural intervention for reducing daily sitting time, pain and fatigue, as well as improving health-related quality of life, general self-efficacy, physical function and cardiometabolic biomarkers in patients with rheumatoid arthritis (RA). In this randomised controlled trial 150 patients with RA were randomised to an intervention or a no-intervention control group. The intervention group received three individual motivational counselling sessions and short message service or text messages aimed at reduction of sedentary behaviour during the 16-week intervention period. Primary outcome was change in daily sitting time measured objectively by ActivPAL. Secondary outcomes included change in pain, fatigue, physical function, general self-efficacy, quality of life, blood pressure, blood lipids, haemoglobin A1c, body weight, body mass index, waist circumference and waist-hip ratio. 75 patients were allocated to each group. Mean reduction in daily sitting time was -1.61 hours/day in the intervention versus 0.59 hours/day increase in the control group between-group difference -2.20 (95% CI -2.72 to -1.69; pgroup. Most of the secondary outcomes were also in favour of the intervention. An individually tailored, behavioural intervention reduced daily sitting time in patients with RA and improved patient-reported outcomes and cholesterol levels. NCT01969604; Results. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  12. Measuring agreement between decision support reminders: the cloud vs. the local expert

    OpenAIRE

    Dixon, Brian Edward; Simonaitis, Linas; Perkins, Susan M; Wright, Adam; Middleton, Blackford

    2014-01-01

    Background: A cloud-based clinical decision support system (CDSS) was implemented to remotely provide evidence-based guideline reminders in support of preventative health. Following implementation, we measured the agreement between preventive care reminders generated by an existing, local CDSS and the new, cloud-based CDSS operating on the same patient visit data. Methods: Electronic health record data for the same set of patients seen in primary care were sent to both the cloud-based web ser...

  13. The effectiveness of interventions using electronic reminders to improve adherence to chronic medication: a systematic review of the literature.

    NARCIS (Netherlands)

    Vervloet, M.; Linn, A.J.; Weert, J.C.M. van; Bakker, D.H. de; Bouvy, M.L.; Dijk, L. van

    2012-01-01

    Background: Many patients experience difficulties in adhering to long-term treatment. Although patients’ reasons for not being adherent are diverse, one of the most commonly reported barriers is forgetfulness. Reminding patients to take their medication may provide a solution. Electronic reminders

  14. Telephone reminders reduced the non-attendance rate in a gastroenterology outpatient clinic

    DEFF Research Database (Denmark)

    Jeppesen, Maja Haunstrup; Ainsworth, Mark Andrew

    2015-01-01

    in a gastroenterology outpatient clinic like ours. METHODS: This was a comparative intervention study with a historical control group in a gastroenterology outpatient clinic. The study lasted six months. Patients with a scheduled appointment in the first three-month period received no reminder (control group, n = 2......,705). Patients in the following three-month period were reminded by telephone one weekday in advance of their appointment, when possible (intervention group, n = 2,479). Non-attending patients in the intervention group received a questionnaire. Based on the results, a financial cost-benefit analysis was made......-attendees. The most common explanation for non-attendance in the intervention group was forgetfulness (39%). The reminder telephone call was cost-effective. CONCLUSION: In this outpatient clinic, telephone reminders were cost-effective and significantly reduced the non-attendance rate by 43%....

  15. The impacts of email reminder/recall on adolescent influenza vaccination.

    Science.gov (United States)

    Dombkowski, Kevin J; Cowan, Anne E; Reeves, Sarah L; Foley, Matthew R; Dempsey, Amanda F

    2017-05-25

    We sought to: (1) explore the feasibility of using email for seasonal influenza vaccination reminders to parents of adolescents and (2) assess influenza vaccination rates among adolescents whose parents were randomized to either receive or not receive email reminders. Email addresses were obtained for parents of patients 10-18years from 4 practices in Michigan. Addresses were randomized to either receive email reminders, or not. Reminder messages were sent during October 2012-March 2013 (Season 1) and October 2013-March 2014 (Season 2). Vaccination status was determined 60days following the last email reminder for each season using the statewide Michigan Care Improvement Registry (MCIR); per protocol bivariate and multivariate logistic regression analyses were conducted to evaluate reminder notification. After email cleaning, testing, and matching with MCIR, approximately half of email addresses (2348 of 5312 in Season 1; 3457 of 6549 in Season 2) were randomized. Bivariate analyses found that influenza vaccination within 60days after notification date was similar among those notified (34%) versus not notified (29%) in both Season 1 (p=0.06) and Season 2 (39% vs. 37%, p=0.20). However, multivariate models adjusted for season, site, and receipt of notification in two seasons found a higher likelihood of influenza vaccination among children that received notification (aOR=1.28, 95% CI=1.09, 1.51); in addition, differences in influenza vaccination were also observed between practice sites (range: p=0.15 to pemail influenza vaccine reminders to parents of adolescents are feasible, but not without complications. Our study demonstrates that email reminders from practices can yield increases in influenza vaccination rates among adolescents. Practices should consider email as an option for influenza reminders and establish business practices for collecting and maintaining patient email addresses. This study is registered at www.ClinicalTrials.gov id #NCT01732315. Copyright

  16. Evaluation of smartphone oral contraceptive reminder applications.

    Science.gov (United States)

    Gal, Noga; Zite, Nikki B; Wallace, Lorraine S

    2015-01-01

    Oral contraceptives (OCs) are the most widely used contraceptive method among women of reproductive age in the United States (US). Routine download and use of health-related smartphone applications (apps) continues to increase. The purpose of this study was to evaluate the utility of English-language, smartphone-platform OC reminder apps currently available for download in the US. During June-July 2013, official Internet-based, mobile app platforms for the two major smartphone operating systems in the US-Android (Google Play Store) and iPhone (iTunes)-were searched. "Birth control," "the pill," and "contraception" were entered into the search-bar of each Smartphone store. Apps were assessed for the following: cost, health care professionals' involvement in app development, reminder mechanisms, and functionality. Of the 39 unique OC reminder apps meeting inclusion criteria, 7 (18%) did not operate as intended when downloaded. Most apps functioned without an Internet connection (97%) and included pop-up notifications (84%). Certain app features overcome common causes of missing an alarm, and hypothetically, may minimize likelihood of an OC user missing a daily pill. Health care providers should inform users of potential pitfalls and advise them that an OC reminder app should be not be used as a sole reminder method. Copyright © 2015 Elsevier Inc. All rights reserved.

  17. Volumetric breast density estimation from full-field digital mammograms.

    Science.gov (United States)

    van Engeland, Saskia; Snoeren, Peter R; Huisman, Henkjan; Boetes, Carla; Karssemeijer, Nico

    2006-03-01

    A method is presented for estimation of dense breast tissue volume from mammograms obtained with full-field digital mammography (FFDM). The thickness of dense tissue mapping to a pixel is determined by using a physical model of image acquisition. This model is based on the assumption that the breast is composed of two types of tissue, fat and parenchyma. Effective linear attenuation coefficients of these tissues are derived from empirical data as a function of tube voltage (kVp), anode material, filtration, and compressed breast thickness. By employing these, tissue composition at a given pixel is computed after performing breast thickness compensation, using a reference value for fatty tissue determined by the maximum pixel value in the breast tissue projection. Validation has been performed using 22 FFDM cases acquired with a GE Senographe 2000D by comparing the volume estimates with volumes obtained by semi-automatic segmentation of breast magnetic resonance imaging (MRI) data. The correlation between MRI and mammography volumes was 0.94 on a per image basis and 0.97 on a per patient basis. Using the dense tissue volumes from MRI data as the gold standard, the average relative error of the volume estimates was 13.6%.

  18. Computer-Aided Detection in Digital Mammography: False-Positive Marks and Their Reproducibility in Negative Mammograms

    International Nuclear Information System (INIS)

    Kim, Seung Ja; Moon, Woo Kyung; Cho, Nariya; Chang, Jung Min; Seong, Min Hyun

    2009-01-01

    Background: There are relatively few studies reporting the frequency of false-positive computer-aided detection (CAD) marks and their reproducibility in normal cases. Purpose: To evaluate retrospectively the false-positive mark rate of a CAD system and the reproducibility of false-positive marks in two sets of negative digital mammograms. Material and Methods: Two sets of negative digital mammograms were obtained in 360 women (mean age 57 years, range 30-76 years) with an approximate interval of 1 year (mean time 343.7 days), and a CAD system was applied. False-positive CAD marks and the reproducibility were determined. Results: Of the 360 patients, 252 (70.0%) and 240 (66.7%) patients had 1-7 CAD marks on the initial and second mammograms, respectively. The false-positive CAD mark rate was 1.5 (1.1 for masses and 0.4 for calcifications) and 1.4 (1.0 for masses and 0.4 for calcifications) per examination in the initial and second mammograms, respectively. The reproducibility of the false-positive CAD marks was 12.0% for both mass (81/680) and microcalcification (33/278) marks. Conclusion: False-positive CAD marks were seen in approximately 70% of normal cases. However, the reproducibility was very low. Radiologists must be familiar with the findings of false-positive CAD marks, since they are very common and can increase the recall rate in screening

  19. Three-Class Mammogram Classification Based on Descriptive CNN Features

    Directory of Open Access Journals (Sweden)

    M. Mohsin Jadoon

    2017-01-01

    Full Text Available In this paper, a novel classification technique for large data set of mammograms using a deep learning method is proposed. The proposed model targets a three-class classification study (normal, malignant, and benign cases. In our model we have presented two methods, namely, convolutional neural network-discrete wavelet (CNN-DW and convolutional neural network-curvelet transform (CNN-CT. An augmented data set is generated by using mammogram patches. To enhance the contrast of mammogram images, the data set is filtered by contrast limited adaptive histogram equalization (CLAHE. In the CNN-DW method, enhanced mammogram images are decomposed as its four subbands by means of two-dimensional discrete wavelet transform (2D-DWT, while in the second method discrete curvelet transform (DCT is used. In both methods, dense scale invariant feature (DSIFT for all subbands is extracted. Input data matrix containing these subband features of all the mammogram patches is created that is processed as input to convolutional neural network (CNN. Softmax layer and support vector machine (SVM layer are used to train CNN for classification. Proposed methods have been compared with existing methods in terms of accuracy rate, error rate, and various validation assessment measures. CNN-DW and CNN-CT have achieved accuracy rate of 81.83% and 83.74%, respectively. Simulation results clearly validate the significance and impact of our proposed model as compared to other well-known existing techniques.

  20. Mammogram segmentation using maximal cell strength updation in cellular automata.

    Science.gov (United States)

    Anitha, J; Peter, J Dinesh

    2015-08-01

    Breast cancer is the most frequently diagnosed type of cancer among women. Mammogram is one of the most effective tools for early detection of the breast cancer. Various computer-aided systems have been introduced to detect the breast cancer from mammogram images. In a computer-aided diagnosis system, detection and segmentation of breast masses from the background tissues is an important issue. In this paper, an automatic segmentation method is proposed to identify and segment the suspicious mass regions of mammogram using a modified transition rule named maximal cell strength updation in cellular automata (CA). In coarse-level segmentation, the proposed method performs an adaptive global thresholding based on the histogram peak analysis to obtain the rough region of interest. An automatic seed point selection is proposed using gray-level co-occurrence matrix-based sum average feature in the coarse segmented image. Finally, the method utilizes CA with the identified initial seed point and the modified transition rule to segment the mass region. The proposed approach is evaluated over the dataset of 70 mammograms with mass from mini-MIAS database. Experimental results show that the proposed approach yields promising results to segment the mass region in the mammograms with the sensitivity of 92.25% and accuracy of 93.48%.

  1. Mammogram retrieval through machine learning within BI-RADS standards.

    Science.gov (United States)

    Wei, Chia-Hung; Li, Yue; Huang, Pai Jung

    2011-08-01

    A content-based mammogram retrieval system can support usual comparisons made on images by physicians, answering similarity queries over images stored in the database. The importance of searching for similar mammograms lies in the fact that physicians usually try to recall similar cases by seeking images that are pathologically similar to a given image. This paper presents a content-based mammogram retrieval system, which employs a query example to search for similar mammograms in the database. In this system the mammographic lesions are interpreted based on their medical characteristics specified in the Breast Imaging Reporting and Data System (BI-RADS) standards. A hierarchical similarity measurement scheme based on a distance weighting function is proposed to model user's perception and maximizes the effectiveness of each feature in a mammographic descriptor. A machine learning approach based on support vector machines and user's relevance feedback is also proposed to analyze the user's information need in order to retrieve target images more accurately. Experimental results demonstrate that the proposed machine learning approach with Radial Basis Function (RBF) kernel function achieves the best performance among all tested ones. Furthermore, the results also show that the proposed learning approach can improve retrieval performance when applied to retrieve mammograms with similar mass and calcification lesions, respectively. Copyright © 2011 Elsevier Inc. All rights reserved.

  2. Appointment reminder systems are effective but not optimal: results of a systematic review and evidence synthesis employing realist principles

    Directory of Open Access Journals (Sweden)

    McLean SM

    2016-04-01

    Full Text Available Sionnadh Mairi McLean,1 Andrew Booth,2 Melanie Gee,3 Sarah Salway,2 Mark Cobb,4 Sadiq Bhanbhro,3 Susan A Nancarrow5 1Faculty of Health and Wellbeing, Sheffield Hallam University, Sheffield, UK; 2School of Health and Related Research, University of Sheffield, Sheffield, UK; 3Centre for Health and Social Care Research, Sheffield Hallam University, Sheffield, UK; 4Therapeutics & Palliative Care, Sheffield Teaching Hospitals, Sheffield, UK; 5School of Health and Human Science, Southern Cross University, East Lismore, NSW, Australia Abstract: Missed appointments are an avoidable cost and resource inefficiency which impact upon the health of the patient and treatment outcomes. Health care services are increasingly utilizing reminder systems to manage these negative effects. This study explores the effectiveness of reminder systems for promoting attendance, cancellations, and rescheduling of appointments across all health care settings and for particular patient groups and the contextual factors which indicate that reminders are being employed sub-optimally. We used three inter-related reviews of quantitative and qualitative evidence. Firstly, using pre-existing models and theories, we developed a conceptual framework to inform our understanding of the contexts and mechanisms which influence reminder effectiveness. Secondly, we performed a review following Centre for Reviews and Dissemination guidelines to investigate the effectiveness of different methods of reminding patients to attend health service appointments. Finally, to supplement the effectiveness information, we completed a review informed by realist principles to identify factors likely to influence non-attendance behaviors and the effectiveness of reminders. We found consistent evidence that all types of reminder systems are effective at improving appointment attendance across a range of health care settings and patient populations. Reminder systems may also increase cancellation and

  3. Use of RSS feeds for the implementation of clinical reminder.

    Science.gov (United States)

    Chi, Wen-Chou; Wen, Chia-Hsien; Lin, Chih-Yu; Poon, Sek-Kwong; Huang, Shih-Che

    2012-06-01

    A computer-based reminder system can help physicians get right information and make right decisions in daily clinical work in time. This study presents a RSS-based Clinical Reminding System (RCRS) designed for reminding clinicians to deal with their varied unfinished clinical works. The RCRS was implemented in a hospital to automatically generate messages for every clinician on the basis of clinical information gathered from the hospital information system (HIS) and send them by RSS feed. In order to allow all physicians to participate in the project, the RCRS was integrated with the Computerized Physician Order Entry (COPE) system to provide messages whenever a clinician logs in the HIS; the connection on screen lets the clinician easily make some response. The system can help clinicians focus on patient care without keeping track of the schedule of clinical chores stored in various systems. Two physicians, also directors from Clinical Informatics Research & Development Center (CIRD) who were appointed as project leaders of the RCRS project who went through the entire development process were chosen as interviewees to obtain a preliminary evaluation of the system. The results show the "Information Content" of this system was suggested to be modified, and "Information Accuracy", "Formats", "Ease of use" and "Timeliness" of the system were appropriate to meet the system design purposes.

  4. Computerized classification of mass lesions in digital mammograms

    International Nuclear Information System (INIS)

    Giger, M.L.; Doi, K.; Yin, F.F.; Schmidt, R.A.; Vyborny, C.J.

    1989-01-01

    Subjective classification of masses on mammograms is a difficult task. On average, about 25% of masses referred for surgical biopsy are actually malignant. The authors are developing, as an aid to radiologists, a computerized scheme for the classification of lesions in mammograms to reduce the false-negative and false-positive diagnoses of malignancies. The classification scheme involves the extraction of border information from the mammographic lesion in order to quantify the degree of spiculation, which is related to the possibility of malignancy. Clinical film mammograms are digitized with an optical drum scanner (0.1-mm pixel size) for analysis on a Micro VAX 3500 computer. Border information (fluctuations) is obtained from the difference between the lesion border and its smoothed border. Using the rms variation of the frequency content of these fluctuations, approximately 85% of the cancerous lesions were correctly classified as malignant, while 15% of benign lesions were misclassified, in a preliminary study

  5. An anatomically oriented breast coordinate system for mammogram analysis

    DEFF Research Database (Denmark)

    Brandt, Sami; Karemore, Gopal; Karssemeijer, Nico

    2011-01-01

    and the shape of the breast boundary because these are the most robust features independent of the breast size and shape. On the basis of these landmarks, we have constructed a nonlinear mapping between the parameter frame and the breast region in the mammogram. This mapping makes it possible to identify...... the corresponding positions and orientations among all of the ML or MLO mammograms, which facilitates an implicit use of the registration, i.e., no explicit image warping is needed. We additionally show how the coordinate transform can be used to extract Gaussian derivative features so that the feature positions...... and orientations are registered and extracted without non-linearly deforming the images. We use the proposed breast coordinate transform in a cross-sectional breast cancer risk assessment study of 490 women, in which we attempt to learn breast cancer risk factors from mammograms that were taken prior to when...

  6. Computerized detection of mass lesions in digital mammograms

    International Nuclear Information System (INIS)

    Yin, F.F.; Giger, M.L.; Doi, K.; Metz, C.E.; Vyborny, C.J.; Schmidt, R.A.

    1989-01-01

    Early detection of breast cancer from the periodic screening of asymptomatic women could reduce breast cancer mortality by at least 40%. The authors are developing a computerized scheme for the detection of mass lesions in digital mammograms as an aid to radiologists in such high volume screening programs. Based on left-right architectural symmetry and gray-level histogram analysis, bilateral subtraction of left and right breast images is performed. False-positive detections included in bilateral-difference images are reduced with various images feature-extraction techniques. The database involves clinical film mammograms digitized by a TV camera and analyzed on a Micro-VAX workstation. Among five different bilateral subtraction techniques investigated, a nonlinear approach provided superior lesion enhancement. Feature-extraction techniques reduced substantially the remaining false-positives. Preliminary results, for 32 pairs of clinical mammograms, yielded a true-positive rate of approximately 95% with a false-positive rate of about 2 per image

  7. Automatic detection of anomalies in screening mammograms

    Science.gov (United States)

    2013-01-01

    Background Diagnostic performance in breast screening programs may be influenced by the prior probability of disease. Since breast cancer incidence is roughly half a percent in the general population there is a large probability that the screening exam will be normal. That factor may contribute to false negatives. Screening programs typically exhibit about 83% sensitivity and 91% specificity. This investigation was undertaken to determine if a system could be developed to pre-sort screening-images into normal and suspicious bins based on their likelihood to contain disease. Wavelets were investigated as a method to parse the image data, potentially removing confounding information. The development of a classification system based on features extracted from wavelet transformed mammograms is reported. Methods In the multi-step procedure images were processed using 2D discrete wavelet transforms to create a set of maps at different size scales. Next, statistical features were computed from each map, and a subset of these features was the input for a concerted-effort set of naïve Bayesian classifiers. The classifier network was constructed to calculate the probability that the parent mammography image contained an abnormality. The abnormalities were not identified, nor were they regionalized. The algorithm was tested on two publicly available databases: the Digital Database for Screening Mammography (DDSM) and the Mammographic Images Analysis Society’s database (MIAS). These databases contain radiologist-verified images and feature common abnormalities including: spiculations, masses, geometric deformations and fibroid tissues. Results The classifier-network designs tested achieved sensitivities and specificities sufficient to be potentially useful in a clinical setting. This first series of tests identified networks with 100% sensitivity and up to 79% specificity for abnormalities. This performance significantly exceeds the mean sensitivity reported in literature

  8. Automatic correspondence detection in mammogram and breast tomosynthesis images

    Science.gov (United States)

    Ehrhardt, Jan; Krüger, Julia; Bischof, Arpad; Barkhausen, Jörg; Handels, Heinz

    2012-02-01

    Two-dimensional mammography is the major imaging modality in breast cancer detection. A disadvantage of mammography is the projective nature of this imaging technique. Tomosynthesis is an attractive modality with the potential to combine the high contrast and high resolution of digital mammography with the advantages of 3D imaging. In order to facilitate diagnostics and treatment in the current clinical work-flow, correspondences between tomosynthesis images and previous mammographic exams of the same women have to be determined. In this paper, we propose a method to detect correspondences in 2D mammograms and 3D tomosynthesis images automatically. In general, this 2D/3D correspondence problem is ill-posed, because a point in the 2D mammogram corresponds to a line in the 3D tomosynthesis image. The goal of our method is to detect the "most probable" 3D position in the tomosynthesis images corresponding to a selected point in the 2D mammogram. We present two alternative approaches to solve this 2D/3D correspondence problem: a 2D/3D registration method and a 2D/2D mapping between mammogram and tomosynthesis projection images with a following back projection. The advantages and limitations of both approaches are discussed and the performance of the methods is evaluated qualitatively and quantitatively using a software phantom and clinical breast image data. Although the proposed 2D/3D registration method can compensate for moderate breast deformations caused by different breast compressions, this approach is not suitable for clinical tomosynthesis data due to the limited resolution and blurring effects perpendicular to the direction of projection. The quantitative results show that the proposed 2D/2D mapping method is capable of detecting corresponding positions in mammograms and tomosynthesis images automatically for 61 out of 65 landmarks. The proposed method can facilitate diagnosis, visual inspection and comparison of 2D mammograms and 3D tomosynthesis images for

  9. Study of the Effects of Total Modulation Transfer Function Changes on Observer Performance Using Clinical Mammograms.

    Science.gov (United States)

    Bencomo, Jose Antonio Fagundez

    The main goal of this study was to relate physical changes in image quality measured by Modulation Transfer Function (MTF) to diagnostic accuracy. One Hundred and Fifty Kodak Min-R screen/film combination conventional craniocaudal mammograms obtained with the Pfizer Microfocus Mammographic system were selected from the files of the Department of Radiology, at M.D. Anderson Hospital and Tumor Institute. The mammograms included 88 cases with a variety of benign diagnosis and 62 cases with a variety of malignant biopsy diagnosis. The average age of the patient population was 55 years old. 70 cases presented calcifications with 30 cases having calcifications smaller than 0.5mm. 46 cases presented irregular bordered masses larger than 1 cm. 30 cases presented smooth bordered masses with 20 larger than 1 cm. Four separated copies of the original images were made each having a different change in the MTF using a defocusing technique whereby copies of the original were obtained by light exposure through different thicknesses (spacing) of transparent film base. The mammograms were randomized, and evaluated by three experienced mammographers for the degree of visibility of various anatomical breast structures and pathological lesions (masses and calicifications), subjective image quality, and mammographic interpretation. 3,000 separate evaluations were anayzed by several statistical techniques including Receiver Operating Characteristic curve analysis, McNemar test for differences between proportions and the Landis et al. method of agreement weighted kappa for ordinal categorical data. Results from the statistical analysis show: (1) There were no statistical significant differences in the diagnostic accuracy of the observers when diagnosing from mammograms with the same MTF. (2) There were no statistically significant differences in diagnostic accuracy for each observer when diagnosing from mammograms with the different MTF's used in the study. (3) There statistical

  10. Detection of microcalcifications in television-enhanced nonmagnified screen-film mammograms compared with matching magnification unenhanced mammograms

    International Nuclear Information System (INIS)

    Kimme-Smith, C.; Gormley, L.S.; Gold, R.H.; Bassett, L.W.

    1988-01-01

    The object of this investigation was to determine which imaging method was associated with greater accuracy in the interpretation of breast microcalcifications: 1.5X to 2.0X magnification with a microfocal spot or Damon DETECT-enhanced mammograms. The authors' test series consisted of matched pairs of images of 31 breasts, each containing a cluster of microcalcifications within a biopsy-proved benign (N = 21) or malignant (N =10) lesion. Three experienced mammographers and three senior radiology residents with 2 weeks of training in mammography interpreted the calcifications. On the basis of receiver operating characteristic analysis, the authors conclude that (1) inexperienced mammographers should not use television image enhancement alone to evaluate microcalcifications and (2) television-enhanced mammograms are not a substitute for microfocal spot magnification mammograms

  11. Parameter estimation in stochastic mammogram model by heuristic optimization techniques.

    NARCIS (Netherlands)

    Selvan, S.E.; Xavier, C.C.; Karssemeijer, N.; Sequeira, J.; Cherian, R.A.; Dhala, B.Y.

    2006-01-01

    The appearance of disproportionately large amounts of high-density breast parenchyma in mammograms has been found to be a strong indicator of the risk of developing breast cancer. Hence, the breast density model is popular for risk estimation or for monitoring breast density change in prevention or

  12. Flu Shots, Mammogram, and the Perception of Probabilities

    NARCIS (Netherlands)

    Carman, K.G.; Kooreman, P.

    2010-01-01

    We study individuals’ decisions to decline or accept preventive health care interventions such as flu shots and mammograms. In particular, we analyze the role of perceptions of the effectiveness of the intervention, by eliciting individuals' subjective probabilities of sickness and survival, with

  13. Volumetric breast density estimation from full-field digital mammograms.

    NARCIS (Netherlands)

    Engeland, S. van; Snoeren, P.R.; Huisman, H.J.; Boetes, C.; Karssemeijer, N.

    2006-01-01

    A method is presented for estimation of dense breast tissue volume from mammograms obtained with full-field digital mammography (FFDM). The thickness of dense tissue mapping to a pixel is determined by using a physical model of image acquisition. This model is based on the assumption that the breast

  14. Automatic breast cancer risk assessment from digital mammograms

    DEFF Research Database (Denmark)

    Karemore, Gopal Raghunath; Brandt, Sami; Karssemeijer, N

    Purpose: Textural characteristics of the breast tissue structure on mammogram have been shown to improve breast cancer risk assessment in several large studies. Currently, however, the texture is not used to assess risk in standard clinical procedures or involved in general breast cancer risk ass...

  15. Application of texture analysis method for mammogram density classification

    Science.gov (United States)

    Nithya, R.; Santhi, B.

    2017-07-01

    Mammographic density is considered a major risk factor for developing breast cancer. This paper proposes an automated approach to classify breast tissue types in digital mammogram. The main objective of the proposed Computer-Aided Diagnosis (CAD) system is to investigate various feature extraction methods and classifiers to improve the diagnostic accuracy in mammogram density classification. Texture analysis methods are used to extract the features from the mammogram. Texture features are extracted by using histogram, Gray Level Co-Occurrence Matrix (GLCM), Gray Level Run Length Matrix (GLRLM), Gray Level Difference Matrix (GLDM), Local Binary Pattern (LBP), Entropy, Discrete Wavelet Transform (DWT), Wavelet Packet Transform (WPT), Gabor transform and trace transform. These extracted features are selected using Analysis of Variance (ANOVA). The features selected by ANOVA are fed into the classifiers to characterize the mammogram into two-class (fatty/dense) and three-class (fatty/glandular/dense) breast density classification. This work has been carried out by using the mini-Mammographic Image Analysis Society (MIAS) database. Five classifiers are employed namely, Artificial Neural Network (ANN), Linear Discriminant Analysis (LDA), Naive Bayes (NB), K-Nearest Neighbor (KNN), and Support Vector Machine (SVM). Experimental results show that ANN provides better performance than LDA, NB, KNN and SVM classifiers. The proposed methodology has achieved 97.5% accuracy for three-class and 99.37% for two-class density classification.

  16. Clinical images evaluation of mammograms: a national survey

    International Nuclear Information System (INIS)

    Moon, Woo Kyung; Kim, Tae Jung; Cha, Joo Hee

    2003-01-01

    The goal of this study was to survey the overall quality of mammographic images in Korea. A total of 598 mammographic images collected from 257 hospitals nationwide were reviewed in terms of eight images quality categories, namely positioning, compression, contrast, exposure, sharpness, noise, artifacts, and examination identification, and rated on a five-point scale: (1=severe deficiency, 2=major deficiency, 3=minor deficiency, 4=good, 5=best). Failure was defined as the occurrence of more than four major deficiencies or one severe deficiency (score of 1 or 2). The results were compared among hospitals of varying kinds, and common problems in clinical images quality were identified. Two hundred and seventeen mammographic images (36.3%) failed the evaluation. Poor images were found in descending order of frequency, at The Society for Medical Examination (33/69, 47.8%), non-radiologyclinics (42/88, 47.7%), general hospitals (92/216, 42.6%), radiology clinics (39/102, 38.2%), and university hospitals (11/123, 8.9%) (p<0.01, Chi-square test). Among the 598 images, serious problems which occurred were related to positioning in 23.7% of instances (n=142) (p<0.01, Chi-square test), examination identification in 5.7% (n=34), exposure in 5.4% (n=32), contrast in 4.2% (n=25), sharpness in 2.7% (n=16), compression in 2.5% (n=15), artifacts in 2.5% (n=15), and noise in 0.3% (n=2). This study showed that in Korea, 36.3% of the mammograms examined in this sampling had important image-related defects that might have led to serious errors in patient management. The failure rate was significantly higher in non-radiology clinics and at The Society for Medical Examination than at university hospitals

  17. Effect of JPEG2000 mammogram compression on microcalcifications segmentation

    International Nuclear Information System (INIS)

    Georgiev, V.; Arikidis, N.; Karahaliou, A.; Skiadopoulos, S.; Costaridou, L.

    2012-01-01

    The purpose of this study is to investigate the effect of mammographic image compression on the automated segmentation of individual microcalcifications. The dataset consisted of individual microcalcifications of 105 clusters originating from mammograms of the Digital Database for Screening Mammography. A JPEG2000 wavelet-based compression algorithm was used for compressing mammograms at 7 compression ratios (CRs): 10:1, 20:1, 30:1, 40:1, 50:1, 70:1 and 100:1. A gradient-based active contours segmentation algorithm was employed for segmentation of microcalcifications as depicted on original and compressed mammograms. The performance of the microcalcification segmentation algorithm on original and compressed mammograms was evaluated by means of the area overlap measure (AOM) and distance differentiation metrics (d mean and d max ) by comparing automatically derived microcalcification borders to manually defined ones by an expert radiologist. The AOM monotonically decreased as CR increased, while d mean and d max metrics monotonically increased with CR increase. The performance of the segmentation algorithm on original mammograms was (mean±standard deviation): AOM=0.91±0.08, d mean =0.06±0.05 and d max =0.45±0.20, while on 40:1 compressed images the algorithm's performance was: AOM=0.69±0.15, d mean =0.23±0.13 and d max =0.92±0.39. Mammographic image compression deteriorates the performance of the segmentation algorithm, influencing the quantification of individual microcalcification morphological properties and subsequently affecting computer aided diagnosis of microcalcification clusters. (authors)

  18. Effects of Different Compression Techniques on Diagnostic Accuracies of Breast Masses on Digitized Mammograms

    International Nuclear Information System (INIS)

    Zhigang Liang; Xiangying Du; Jiabin Liu; Yanhui Yang; Dongdong Rong; Xinyu Y ao; Kuncheng Li

    2008-01-01

    Background: The JPEG 2000 compression technique has recently been introduced into the medical imaging field. It is critical to understand the effects of this technique on the detection of breast masses on digitized images by human observers. Purpose: To evaluate whether lossless and lossy techniques affect the diagnostic results of malignant and benign breast masses on digitized mammograms. Material and Methods: A total of 90 screen-film mammograms including craniocaudal and lateral views obtained from 45 patients were selected by two non-observing radiologists. Of these, 22 cases were benign lesions and 23 cases were malignant. The mammographic films were digitized by a laser film digitizer, and compressed to three levels (lossless and lossy 20:1 and 40:1) using the JPEG 2000 wavelet-based image compression algorithm. Four radiologists with 10-12 years' experience in mammography interpreted the original and compressed images. The time interval was 3 weeks for each reading session. A five-point malignancy scale was used, with a score of 1 corresponding to definitely not a malignant mass, a score of 2 referring to not a malignant mass, a score of 3 meaning possibly a malignant mass, a score of 4 being probably a malignant mass, and a score of 5 interpreted as definitely a malignant mass. The radiologists' performance was evaluated using receiver operating characteristic analysis. Results: The average Az values for all radiologists decreased from 0.8933 for the original uncompressed images to 0.8299 for the images compressed at 40:1. This difference was not statistically significant. The detection accuracy of the original images was better than that of the compressed images, and the Az values decreased with increasing compression ratio. Conclusion: Digitized mammograms compressed at 40:1 could be used to substitute original images in the diagnosis of breast cancer

  19. False Negative Mammogram of Breast Cancer : Analysis of Mammographic and Sonographic Findings and Correlation with Clinical Findings

    International Nuclear Information System (INIS)

    Lee, Kil Jun; Lee, Ji Yeon; Han, Sung Nim; Jeong, Seong Ki; Tae, Seok; Shin, Kyoung Ja; Lee, Sang Chun

    1995-01-01

    Recent mammographic equipment have been of good quality and yielded high diagnostic accuracy for the detection of breast cancer. However, negative mammogram does not necessarily rule out breast cancer. Therefore were viewed cause of false negative mammography in confirmed breast cancer to improve diagnostic accuracy and for adequate clinical approach. We reviewed 19 cases of confirmed breast cancer, which showed false negative mammography with positive sonographic findings. Retrospective analysis was done by correlating the patient's age, sonographic finding and mass size, mammographic breast pattern and cause of false negative mammogram, and clinical symptoms. Among the 5 patients below 35 years in age, mass was not visible due to dense breast in 4 and due to small size in 1 case. In 14 patients over 35 years in age, 11 had normal mammographic findings, 4 had dense breast, and 7 had small sized mass. Remaining 3 cases showed asymmetric density in 2 and architecture distortion in 1 case. All showed mass lesion in sonography : ill defined malignant appearance in 14,well defined malignant appearance in 2, and well defined benign in 3 cases. Negative mammogram should be correlated with sonography in case of dense breast, below 35 years in age with palpable mass and under risk for breast cancer

  20. Telephone reminders reduced the non-attendance rate in a gastroenterology outpatient clinic

    DEFF Research Database (Denmark)

    Jeppesen, Maja Haunstrup; Ainsworth, Mark Andrew

    2015-01-01

    INTRODUCTION: Non-attendance is a global health-care problem. The aim of the present study was 1) to investigate if a telephone reminder could reduce the non-attendance rate, 2) to study reasons for non-attendance and 3) to evaluate if a permanent implementation would be economically advantageous......,705). Patients in the following three-month period were reminded by telephone one weekday in advance of their appointment, when possible (intervention group, n = 2,479). Non-attending patients in the intervention group received a questionnaire. Based on the results, a financial cost-benefit analysis was made...

  1. Automated Reminders and Physician Notification to Promote Immunosuppression Adherence Among Kidney Transplant Recipients: A Randomized Trial.

    Science.gov (United States)

    Reese, Peter P; Bloom, Roy D; Trofe-Clark, Jennifer; Mussell, Adam; Leidy, Daniel; Levsky, Simona; Zhu, Jingsan; Yang, Lin; Wang, Wenli; Troxel, Andrea; Feldman, Harold I; Volpp, Kevin

    2017-03-01

    Immunosuppression nonadherence increases the risk for kidney transplant loss after transplantation. Wireless-enabled pill bottles have created the opportunity to monitor medication adherence in real time. Reminders may help patients with poor memory or organization. Provision of adherence data to providers may motivate patients to improve adherence and help providers identify adherence barriers. Randomized controlled trial. Kidney transplant recipients (n=120) at a single center. Participants were provided wireless pill bottles to store tacrolimus and record bottle openings. Participants were randomly assigned 1:1:1 to adherence monitoring with customized reminders (including alarms, texts, telephone calls, and/or e-mails), monitoring with customized reminders plus provider notification (every 2 weeks, providers received notification if adherence decreased to adherence during the last 90 days of the 180-day trial. A secondary outcome was tacrolimus whole-blood concentrations at routine clinical visits. Adherence for the primary outcome was assessed via wireless pill bottle openings. Mean participant age was 50 years; 60% were men, and 40% were black. Mean adherence was 78%, 88%, and 55% in the reminders, reminders-plus-notification, and control arms (Padherence, but these strategies require evaluation in trials powered to detect differences in clinical outcomes. Copyright © 2016 National Kidney Foundation, Inc. Published by Elsevier Inc. All rights reserved.

  2. Monte Carlo Modelling of Mammograms : Development and Validation

    Energy Technology Data Exchange (ETDEWEB)

    Spyrou, G; Panayiotakis, G [Univercity of Patras, School of Medicine, Medical Physics Department, 265 00 Patras (Greece); Bakas, A [Technological Educational Institution of Athens, Department of Radiography, 122 10 Athens (Greece); Tzanakos, G [University of Athens, Department of Physics, Divission of Nuclear and Particle Physics, 157 71 Athens (Greece)

    1999-12-31

    A software package using Monte Carlo methods has been developed for the simulation of x-ray mammography. A simplified geometry of the mammographic apparatus has been considered along with the software phantom of compressed breast. This phantom may contain inhomogeneities of various compositions and sizes at any point. Using this model one can produce simulated mammograms. Results that demonstrate the validity of this simulation are presented. (authors) 16 refs, 4 figs

  3. Monte Carlo Modelling of Mammograms : Development and Validation

    International Nuclear Information System (INIS)

    Spyrou, G.; Panayiotakis, G.; Bakas, A.; Tzanakos, G.

    1998-01-01

    A software package using Monte Carlo methods has been developed for the simulation of x-ray mammography. A simplified geometry of the mammographic apparatus has been considered along with the software phantom of compressed breast. This phantom may contain inhomogeneities of various compositions and sizes at any point. Using this model one can produce simulated mammograms. Results that demonstrate the validity of this simulation are presented. (authors)

  4. Use of prior mammograms in the transition to digital mammography: A performance and cost analysis

    International Nuclear Information System (INIS)

    Taylor-Phillips, S.; Wallis, M.G.; Duncan, A.; Gale, A.G.

    2012-01-01

    Breast screening in Europe is gradually changing from film to digital imaging and reporting of cases. In the transition period prior mammograms (from the preceding screening round) are films thereby potentially causing difficulties in comparison to current digital mammograms. To examine this breast screening performance was measured at a digital mammography workstation with prior mammograms displayed in different formats, and the associated costs calculated. 160 selected difficult cases (41% malignant) were read by eight UK qualified mammography readers in three conditions: with film prior mammograms; with digitised prior mammograms; or without prior mammograms. Lesion location and probability of malignancy were recorded, alongside a decision of whether to recall each case for further tests. JAFROC analysis showed a difference between conditions (p = .006); performance with prior mammograms in either film or digitised formats was superior to that without prior mammograms (p < .05). There was no difference in the performance when the prior mammograms were presented in film or digitised form. The number of benign or normal cases recalled was 26% higher without prior mammograms than with digitised or film prior mammograms (p < .05). This would correspond to an increase in recall rate at the study hospital from 4.3% to 5.5% with no associated increase in cancer detection rate. The cost of this increase was estimated to be £11,581 (€13,666) per 10,000 women screened, which is higher than the cost of digitised (£11,114/€13,115), or film display (£6451/€7612) of the prior mammograms. It is recommended that, where available, prior mammograms are used in the transition to digital breast screening.

  5. Field nonuniformity correction for quantitative analysis of digitized mammograms

    International Nuclear Information System (INIS)

    Pawluczyk, Olga; Yaffe, Martin J.

    2001-01-01

    Several factors, including the heel effect, variation in distance from the x-ray source to points in the image and path obliquity contribute to the signal nonuniformity of mammograms. To best use digitized mammograms for quantitative image analysis, these field non-uniformities must be corrected. An empirically based correction method, which uses a bowl-shaped calibration phantom, has been developed. Due to the annular spherical shape of the phantom, its attenuation is constant over the entire image. Remaining nonuniformities are due only to the heel and inverse square effects as well as the variable path through the beam filter, compression plate and image receptor. In logarithmic space, a normalized image of the phantom can be added to mammograms to correct for these effects. Then, an analytical correction for path obliquity in the breast can be applied to the images. It was found that the correction causes the errors associated with field nonuniformity to be reduced from 14% to 2% for a 4 cm block of material corresponding to a combination of 50% fibroglandular and 50% fatty breast tissue. A repeatability study has been conducted to show that in regions as far as 20 cm away from the chest wall, variations due to imaging conditions and phantom alignment contribute to <2% of overall corrected signal

  6. Quantification and normalization of x-ray mammograms

    International Nuclear Information System (INIS)

    Tromans, Christopher E; Cocker, Mary R; Brady, Michael

    2012-01-01

    The analysis of (x-ray) mammograms remains qualitative, relying on the judgement of clinicians. We present a novel method to compute a quantitative, normalized measure of tissue radiodensity traversed by the primary beam incident on each pixel of a mammogram, a measure we term the standard attenuation rate (SAR). SAR enables: the estimation of breast density which is linked to cancer risk; direct comparison between images; the full potential of computer aided diagnosis to be utilized; and a basis for digital breast tomosynthesis reconstruction. It does this by removing the effects of the imaging conditions under which the mammogram is acquired. First, the x-ray spectrum incident upon the breast is calculated, and from this, the energy exiting the breast is calculated. The contribution of scattered radiation is calculated and subtracted. The SAR measure is the scaling factor that must be applied to the reference material in order to match the primary attenuation of the breast. Specifically, this is the scaled reference material attenuation which when traversed by an identical beam to that traversing the breast, and when subsequently detected, results in the primary component of the pixel intensity observed in the breast image. We present results using two tissue equivalent phantoms, as well as a sensitivity analysis to detector response changes over time and possible errors in compressed thickness measurement. (paper)

  7. Is there a correlation between the presence of a spiculated mass on mammogram and luminal a subtype breast cancer?

    International Nuclear Information System (INIS)

    Liu, Song; Wu, Xiao Dong; Xu, Wen Jian; Lin, Qing; Liu, Xue Jun; Li, Ying

    2016-01-01

    To determine whether the appearance of a spiculated mass on a mammogram is associated with luminal A subtype breast cancer and the factors that may influence the presence or absence of the spiculated mass. Three hundred seventeen (317) patients who underwent image-guided or surgical biopsy between December 2014 and April 2015 were included in the study. Radiologists conducted retrospective assessments of the presence of spiculated masses according to the criteria of Breast Imaging Reporting and Data System. We used combinations of estrogen receptor (ER), progesterone receptor (PR), human epithelial growth factor receptor 2 (HER2), and Ki67 as surrogate markers to identify molecular subtypes of breast cancer. Pearson chi-square test was employed to measure statistical significance of correlations. Furthermore, we built a bi-variate logistic regression model to quantify the relative contribution of the factors that may influence the presence or absence of the spiculated mass. Seventy-one percent (71%) of the spiculated masses were classified as luminal A. Masses classified as luminal A were 10.3 times more likely to be presented as spiculated mass on a mammogram than all other subtypes. Patients with low Ki67 index (< 14%) and HER2 negative were most likely to present with a spiculated mass on their mammograms (p <0.001) than others. The hormone receptor status (ER and PR), pathology grade, overall breast composition, were all associated with the presence of a spiculated mass, but with less weight in contribution than Ki67 and HER2. We observed an association between the luminal A subtype of invasive breast cancer and the presence of a spiculated mass on a mammogram. It is hypothesized that lower Ki67 index and HER2 negativity may be the most significant factors in the presence of a spiculated mass

  8. Is there a correlation between the presence of a spiculated mass on mammogram and luminal a subtype breast cancer?

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Song; Wu, Xiao Dong; Xu, Wen Jian; Lin, Qing; Liu, Xue Jun; Li, Ying [The Affiliated Hospital of Qingdao University, Qingdao (China)

    2016-11-15

    To determine whether the appearance of a spiculated mass on a mammogram is associated with luminal A subtype breast cancer and the factors that may influence the presence or absence of the spiculated mass. Three hundred seventeen (317) patients who underwent image-guided or surgical biopsy between December 2014 and April 2015 were included in the study. Radiologists conducted retrospective assessments of the presence of spiculated masses according to the criteria of Breast Imaging Reporting and Data System. We used combinations of estrogen receptor (ER), progesterone receptor (PR), human epithelial growth factor receptor 2 (HER2), and Ki67 as surrogate markers to identify molecular subtypes of breast cancer. Pearson chi-square test was employed to measure statistical significance of correlations. Furthermore, we built a bi-variate logistic regression model to quantify the relative contribution of the factors that may influence the presence or absence of the spiculated mass. Seventy-one percent (71%) of the spiculated masses were classified as luminal A. Masses classified as luminal A were 10.3 times more likely to be presented as spiculated mass on a mammogram than all other subtypes. Patients with low Ki67 index (< 14%) and HER2 negative were most likely to present with a spiculated mass on their mammograms (p <0.001) than others. The hormone receptor status (ER and PR), pathology grade, overall breast composition, were all associated with the presence of a spiculated mass, but with less weight in contribution than Ki67 and HER2. We observed an association between the luminal A subtype of invasive breast cancer and the presence of a spiculated mass on a mammogram. It is hypothesized that lower Ki67 index and HER2 negativity may be the most significant factors in the presence of a spiculated mass.

  9. Vaccination against seasonal influenza: a reminder

    CERN Multimedia

    Medical Service

    2013-01-01

    At this time every year, the Medical Service suggests that you should get vaccinated against seasonal flu.   We would like to remind you that vaccination is the best method of protecting yourself and others against this contagious illness which can have serious consequences for certain people, especially those suffering from chronic medical conditions (e.g. chronic pulmonary, cardiovascular or kidney disease or diabetes), pregnant women, people suffering from obesity (BMI>30) and those over 65. As the Medical Service does not supply the vaccine, you must purchase it from a pharmacy (without the need for a prescription in France). From the beginning of October you can then bring your vaccine to the Infirmary (Building 57-Ground floor) and get vaccinated without an appointment between 9 a.m. - 12 p.m. and 2 p.m. - 4:30 p.m. For the purposes of health insurance reimbursement, you can get a prescription from the Medical Service either on the day of the injection or beforehand. Reminder: The...

  10. Vaccination against seasonal influenza: a reminder

    CERN Multimedia

    2012-01-01

    At this time every year the Medical Service suggests that you should get vaccinated against seasonal flu.   We would like to remind you that vaccination is the best method of protecting yourself and others against this contagious illness which can have serious consequences for certain people, especially those suffering from chronic medical conditions (e.g. chronic pulmonary, cardiovascular or kidney disease or diabetes), pregnant women, people suffering from obesity (BMI>30) and those over 65. As the Medical Service does not supply the vaccine, you must purchase it from a pharmacy (in France you don't need a prescription). From the beginning of October you can then bring your vaccine to the Infirmary (Building 57-Ground floor) and get vaccinated without an appointment between 9 a.m. and 12 a.m. and 2 p.m. to 4:30 p.m. For the purposes of health insurance reimbursement, you can get a prescription from the Medical Service either on the day of the injection or beforehand. Reminder:...

  11. Vaccination against seasonal influenza: a reminder

    CERN Document Server

    GS Department

    2011-01-01

    At this time every year the Medical Service suggests that you should get vaccinated against seasonal flu. We would like to remind you that vaccination is the best method of protecting yourself and others against this contagious illness which can have serious consequences for certain people, especially those suffering from chronic medical conditions (e.g. chronic pulmonary, cardiovascular or kidney disease or diabetes), pregnant women, people suffering from obesity (BMI>30) and those over 65. As the Medical Service does not supply the vaccine, you must purchase it from a pharmacy (in France without the need for a prescription). From the beginning of October you can then bring your vaccine to the Infirmary (Building 57-Ground floor) and get vaccinated without an appointment between 9 a.m. and 12 a.m. and 2 p.m. to 4:30 p.m. For the purposes of health insurance reimbursement, you can get a prescription from the Medical Service either on the day of the injection or beforehand. Reminder: The Medical Se...

  12. A Prospective Controlled Trial of an Electronic Hand Hygiene Reminder System.

    Science.gov (United States)

    Ellison, Richard T; Barysauskas, Constance M; Rundensteiner, Elke A; Wang, Di; Barton, Bruce

    2015-12-01

    Background.  The use of electronic hand hygiene reminder systems has been proposed as an approach to improve hand hygiene compliance among healthcare workers, although information on efficacy is limited. We prospectively assessed whether hand hygiene activities among healthcare workers could be increased using an electronic hand hygiene monitoring and reminder system. Methods.  A prospective controlled clinical trial was conducted in 2 medical intensive care units (ICUs) at an academic medical center with comparable patient populations, healthcare staff, and physical layout. Hand hygiene activity was monitored concurrently in both ICUs, and the reminder system was installed in the test ICU. The reminder system was tested during 3 administered phases including: room entry/exit chimes, display of real-time hand hygiene activity, and a combination of the 2. Results.  In the test ICU, the mean number of hand hygiene events increased from 1538 per day at baseline to 1911 per day (24% increase) with the use of a combination of room entry/exit chimes, real-time displays of hand hygiene activity, and manager reports (P performance returned to baseline (1473 hand hygiene events per day) during the follow-up phase. There was no significant change in hand hygiene activity in the control ICU during the course of the trial. Conclusions.  In an ICU setting, an electronic hand hygiene reminder system that provided real-time feedback on overall unit-wide hand hygiene performance significantly increased hand hygiene activity.

  13. Anisotropic diffusion tensor applied to temporal mammograms

    DEFF Research Database (Denmark)

    Karemore, Gopal; Brandt, Sami; Sporring, Jon

    2010-01-01

    changes related to  specific  effects  like  Hormonal  Replacement  Therapy  (HRT) and aging. Given effect-grouped patient data, we demonstrated how  anisotropic  diffusion  tensor  and  its  coherence  features computed in an anatomically oriented breast coordinate system followed by statistical learning...

  14. Psychological distress, social withdrawal, and coping following receipt of an abnormal mammogram among different ethnicities: a mediation model.

    Science.gov (United States)

    Molina, Yamile; Beresford, Shirley A A; Espinoza, Noah; Thompson, Beti

    2014-09-01

    To explore ethnic differences in psychological distress and social withdrawal after receiving an abnormal mammogram result and to assess if coping strategies mediate ethnic differences. Descriptive correlational. Two urban mobile mammography units and a rural community hospital in the state of Washington. 41 Latina and 41 non-Latina Caucasian (NLC) women who had received an abnormal mammogram result. Women completed standard sociodemographic questions, Impact of Event Scale-Revised, the social dimension of the Psychological Consequences Questionnaire, and the Brief COPE. Ethnicity, psychological distress, social withdrawal, and coping. Latinas experienced greater psychological distress and social withdrawal compared to NLC counterparts. Denial as a coping strategy mediated ethnic differences in psychological distress. Religious coping mediated ethnic differences in social withdrawal. Larger population-based studies are necessary to understand how ethnic differences in coping strategies can influence psychological outcomes. This is an important finding that warrants additional study among women who are and are not diagnosed with breast cancer following an abnormal mammogram. Nurses may be able to work with Latina patients to diminish denial coping and consequent distress. Nurses may be particularly effective, given cultural values concerning strong interpersonal relationships and respect for authority figures.

  15. Improving Rates of Post-Essure Hysterosalpingography in an Urban Population Using Electronic Tracking Reminders.

    Science.gov (United States)

    Virginia Hu, Yu-Han; Arora, Kavita Shah

    2017-02-01

    To demonstrate the efficacy of electronic reminders for follow-up hysterosalpingography (HSG) after Essure hysteroscopic sterilization in an urban tertiary care hospital obstetrics and gynecology practice. Retrospective cohort study (Canadian Task Force classification II-3). Obstetrics and gynecology practice at a university-affiliated urban tertiary care teaching hospital. Two hundred and fifty patients who underwent Essure hysteroscopic sterilization between June 2011 and July 2014. Implementation of electronic reminders for the office staff. Two hundred and fifty of 259 patients (96.5%) underwent Essure hysteroscopic sterilization and successful placement of coils into bilateral Fallopian tubes. Among these 250 patients, 135 (54%) returned for HSG at 3 months post-Essure as advised at the time of procedure. The use of electronic reminders prompted another 45 patients (18%) to return for HSG, improving the total post-Essure follow-up rate to 72%. Electronic reminders for the office staff of an urban tertiary care hospital's obstetrics and gynecology practice is an effective method for improving the rate of post-Essure HSG. Copyright © 2016 AAGL. Published by Elsevier Inc. All rights reserved.

  16. Enterprise Mobile Tracking and Reminder System: MAE

    Directory of Open Access Journals (Sweden)

    Cheah Huei Yoong

    2012-07-01

    Full Text Available Mobile phones have made significant improvements from providing voice communications to advanced features such as camera, GPS, Wi-Fi, SMS, voice recognition, Internet surfing, and touch screen. This paper presents an enterprise mobile tracking and reminder system (MAE that enables the elderly to have a better elder-care experience. The high-level architecture and major software algorithms especially the tracking in Android phones and SMS functions in server are described. The analysis of data captured and performance study of the server are discussed. In order to show the effectiveness of MAE, a pilot test was carried out with a retirement village in Singapore and the feedback from the elderly was evaluated. Generally, most comments received from the elderly were positive.

  17. Findings more frequent in mammograms (according to BIRADS classification) in patients older than 35 years, conducted during the months of September 2012 to January 2013 in the Hospital San Juan de Dios

    International Nuclear Information System (INIS)

    Araya Steinvorth, Cristina; Mejia Rojas, Howard; Vargas Solis, Sussy

    2013-01-01

    Mammography are performed in the Hospital San Juan de Dios in a period of four months between September 2012 to January 2013 to women over 35 years. This has allowed to know the situation of the Servicio de Radiologia and raise awareness of the importance of having equipment of high and latest technology in the institution such as digital mammography. The advantages of having this equipment have been: low doses of radiation, better visualization dense breast because it has better contrast between tissues, the radiologist has able determine a more secure diagnosis for each patient, has reduced the use of complementary studies as breast ultrasound and other mammographic and has reduced morbidity of patients contributing to the timely diagnosis of breast cancer in early stages [es

  18. Breast Cancer Detection with Gabor Features from Digital Mammograms

    Directory of Open Access Journals (Sweden)

    Yufeng Zheng

    2010-01-01

    Full Text Available A new breast cancer detection algorithm, named the “Gabor Cancer Detection” (GCD algorithm, utilizing Gabor features is proposed. Three major steps are involved in the GCD algorithm, preprocessing, segmentation (generating alarm segments, and classification (reducing false alarms. In preprocessing, a digital mammogram is down-sampled, quantized, denoised and enhanced. Nonlinear diffusion is used for noise suppression. In segmentation, a band-pass filter is formed by rotating a 1-D Gaussian filter (off center in frequency space, termed as “Circular Gaussian Filter” (CGF. A CGF can be uniquely characterized by specifying a central frequency and a frequency band. A mass or calcification is a space-occupying lesion and usually appears as a bright region on a mammogram. The alarm segments (suspicious to be masses/calcifications can be extracted out using a threshold that is adaptively decided upon the histogram analysis of the CGF-filtered mammogram. In classification, a Gabor filter bank is formed with five bands by four orientations (horizontal, vertical, 45 and 135 degree in Fourier frequency domain. For each mammographic image, twenty Gabor-filtered images are produced. A set of edge histogram descriptors (EHD are then extracted from 20 Gabor images for classification. An EHD signature is computed with four orientations of Gabor images along each band and five EHD signatures are then joined together to form an EHD feature vector of 20 dimensions. With the EHD features, the fuzzy C-means clustering technique and k-nearest neighbor (KNN classifier are used to reduce the number of false alarms. The experimental results tested on the DDSM database (University of South Florida show the promises of GCD algorithm in breast cancer detection, which achieved TP (true positive rate = 90% at FPI (false positives per image = 1.21 in mass detection; and TP = 93% at FPI = 1.19 in calcification detection.

  19. Breast composition measurements using retrospective standard mammogram form (SMF)

    International Nuclear Information System (INIS)

    Highnam, R; Pan, X; Warren, R; Jeffreys, M; Smith, G Davey; Brady, M

    2006-01-01

    The standard mammogram form (SMF) representation of an x-ray mammogram is a standardized, quantitative representation of the breast from which the volume of non-fat tissue and breast density can be easily estimated, both of which are of significant interest in determining breast cancer risk. Previous theoretical analysis of SMF had suggested that a complete and substantial set of calibration data (such as mAs and kVp) would be needed to generate realistic breast composition measures and yet there are many interesting trials that have retrospectively collected images with no calibration data. The main contribution of this paper is to revisit our previous theoretical analysis of SMF with respect to errors in the calibration data and to show how and why that theoretical analysis did not match the results from the practical implementations of SMF. In particular, we show how by estimating breast thickness for every image we are, effectively, compensating for any errors in the calibration data. To illustrate our findings, the current implementation of SMF (version 2.2β) was run over 4028 digitized film-screen mammograms taken from six sites over the years 1988-2002 with and without using the known calibration data. Results show that the SMF implementation running without any calibration data at all generates results which display a strong relationship with when running with a complete set of calibration data, and, most importantly, to an expert's visual assessment of breast composition using established techniques. SMF shows considerable promise in being of major use in large epidemiological studies related to breast cancer which require the automated analysis of large numbers of films from many years previously where little or no calibration data is available

  20. A similarity measure method combining location feature for mammogram retrieval.

    Science.gov (United States)

    Wang, Zhiqiong; Xin, Junchang; Huang, Yukun; Li, Chen; Xu, Ling; Li, Yang; Zhang, Hao; Gu, Huizi; Qian, Wei

    2018-05-28

    Breast cancer, the most common malignancy among women, has a high mortality rate in clinical practice. Early detection, diagnosis and treatment can reduce the mortalities of breast cancer greatly. The method of mammogram retrieval can help doctors to find the early breast lesions effectively and determine a reasonable feature set for image similarity measure. This will improve the accuracy effectively for mammogram retrieval. This paper proposes a similarity measure method combining location feature for mammogram retrieval. Firstly, the images are pre-processed, the regions of interest are detected and the lesions are segmented in order to get the center point and radius of the lesions. Then, the method, namely Coherent Point Drift, is used for image registration with the pre-defined standard image. The center point and radius of the lesions after registration are obtained and the standard location feature of the image is constructed. This standard location feature can help figure out the location similarity between the image pair from the query image to each dataset image in the database. Next, the content feature of the image is extracted, including the Histogram of Oriented Gradients, the Edge Direction Histogram, the Local Binary Pattern and the Gray Level Histogram, and the image pair content similarity can be calculated using the Earth Mover's Distance. Finally, the location similarity and content similarity are fused to form the image fusion similarity, and the specified number of the most similar images can be returned according to it. In the experiment, 440 mammograms, which are from Chinese women in Northeast China, are used as the database. When fusing 40% lesion location feature similarity and 60% content feature similarity, the results have obvious advantages. At this time, precision is 0.83, recall is 0.76, comprehensive indicator is 0.79, satisfaction is 96.0%, mean is 4.2 and variance is 17.7. The results show that the precision and recall of this

  1. Nigerian mothers opinion of reminder/recall for immunization

    African Journals Online (AJOL)

    PROF. EZECHUKWU

    2013-06-23

    Jun 23, 2013 ... Abstract Introduction: Reminder/recall interventions have been shown to improve im- munization coverage. The percep- tion of mothers/caregivers may influence the outcome of such interventions. The attitude of. Nigerian mothers to reminders/ recalls using cell phones was evaluated. Methods: This was a ...

  2. Ameliorating mammograms by using novel image processing algorithms

    Science.gov (United States)

    Pillai, A.; Kwartowitz, D.

    2014-03-01

    Mammography is one of the most important tools for the early detection of breast cancer typically through detection of characteristic masses and/or micro calcifications. Digital mammography has become commonplace in recent years. High quality mammogram images are large in size, providing high-resolution data. Estimates of the false negative rate for cancers in mammography are approximately 10%-30%. This may be due to observation error, but more frequently it is because the cancer is hidden by other dense tissue in the breast and even after retrospective review of the mammogram, cannot be seen. In this study, we report on the results of novel image processing algorithms that will enhance the images providing decision support to reading physicians. Techniques such as Butterworth high pass filtering and Gabor filters will be applied to enhance images; followed by segmentation of the region of interest (ROI). Subsequently, the textural features will be extracted from the ROI, which will be used to classify the ROIs as either masses or non-masses. Among the statistical methods most used for the characterization of textures, the co-occurrence matrix makes it possible to determine the frequency of appearance of two pixels separated by a distance, at an angle from the horizontal. This matrix contains a very large amount of information that is complex. Therefore, it is not used directly but through measurements known as indices of texture such as average, variance, energy, contrast, correlation, normalized correlation and entropy.

  3. Computerized detection of masses on mammograms by entropy maximization thresholding

    International Nuclear Information System (INIS)

    Kom, Guillaume; Tiedeu, Alain; Feudjio, Cyrille; Ngundam, J.

    2010-03-01

    In many cases, masses in X-ray mammograms are subtle and their detection can benefit from an automated system serving as a diagnostic aid. It is to this end that the authors propose in this paper, a new computer aided mass detection for breast cancer diagnosis. The first step focuses on wavelet filters enhancement which removes bright background due to dense breast tissues and some film artifacts while preserving features and patterns related to the masses. In the second step, enhanced image is computed by Entropy Maximization Thresholding (EMT) to obtain segmented masses. The efficiency of 98,181% is achieved by analyzing a database of 84 mammograms previously marked by radiologists and digitized at a pixel size of 343μmm x 343μ mm. The segmentation results, in terms of size of detected masses, give a relative error on mass area that is less than 8%. The performance of the proposed method has also been evaluated by means of the receiver operating-characteristics (ROC) analysis. This yielded respectively, an area (Az) of 0.9224 and 0.9295 under the ROC curve whether enhancement step is applied or not. Furthermore, we observe that the EMT yields excellent segmentation results compared to those found in literature. (author)

  4. Mammographer personality traits – elements of the optimal mammogram experience

    Directory of Open Access Journals (Sweden)

    Amanda Louw

    2014-11-01

    Doelstellings: Die doel van hierdie studie was om van die faktore wat pasiënte se persepsies beïnvloed, te ondersoek. Pasiënte se persepsies en voorkeure ten opsigte van mammograwe se persoonlikheidseienskappe word in hierdie artikel bespreek. Metode: In dié beskrywende, verkennende studie is ’n nie-waarskynlikheid-gerieflikheidsteekproef-metode gebruik om data van 274 mammogram-pasiënte in vier kliniese opleidingsentrums in Gauteng met behulp van ’n vraelys in te win. Die respondente moes die belangrikheid van 24 persoonlikheidseienskappe van mammograwe beoordeel. Geldigheid, betroubaarheid, geloofwaardigheid en etiese oorwegings is in ag geneem. Resultate: Van al die vraelyste is 91% ingehandig. Die data is met behulp van beskrywende statistiek en faktoranalise geïnterpreteer, en vier faktore is uit die persoonlikheidskaal geïdentifiseer. Gevolgtrekking: Dit blyk dat pasiënte mammograwe beoordeel volgens die vertroue wat hulle inboesem, die sorg wat hulle verleen, hoe veilig hulle pasiënte laat voel, asook hoe goed hulle kommunikeer. Aangesien die mammograaf-pasiënt-verhouding pasiënte se indrukke van mammogramme sterk beïnvloed, kan hierdie vier faktore as fundamentele elemente van ’n optimale mammogram-ondersoek beskou word.

  5. ANALISA PERBANDINGAN METODE SEGMENTASI CITRA PADA CITRA MAMMOGRAM

    Directory of Open Access Journals (Sweden)

    Toni Arifin

    2016-09-01

    Full Text Available Abstract Cancer is a desaeas with a high prevalence in the world. As many 8,2 million people died of cancer. The prevalence of cancer was happened in woman that is breast cancer. Breast cancer is a malignancy derived from grandular cells, gland duct and supporting the breast tissues. There are many ways of detecting the presence of breast cancer which one is mammography test that aims to examine the human breast using low-dose X-rays. Observation mammography results in the form of mammogram images can be done with image processing, in this way the process of observation is not take a long time and error in the observation can be reduced. One of the process image processing is image segmentation, the step of image segmentation is an important in image analysis there force is needed method in process of image sementation. This observation is aims to analyze comparison of two image segmentation methods of mammogram images that is using Watershed method and Otsu method after that it will see the quality of image by calculating the signal to noise ratio and timing run of each method. The result of this observation is showed that the signal to noise ratio on the Watershed method 7,475 dB and Otsu method 6.197 dB and the conclution is Watershed method is better than Otsu method, whereas if viewed the timing run Watershed method 0,016 seconds is more faster than Otsu method.

  6. Primary breast osteosarcoma mimicking calcified fibroadenoma on screening digital breast tomosynthesis mammogram

    Directory of Open Access Journals (Sweden)

    Debbie Lee Bennett, MD

    2017-12-01

    Full Text Available Primary breast osteosarcoma is a rare malignancy, with mostly case reports in the literature. The appearance of breast osteosarcoma on digital breast tomosynthesis imaging has not yet been described. A 69-year-old woman presents for routine screening mammography and is found to have a calcified mass in her right breast. Pattern of calcification appeared “sunburst” on digital breast tomosynthesis images. This mass was larger than on the previous year's mammogram, at which time it had been interpreted as a benign calcified fibroadenoma. The subsequent workup demonstrated the mass to reflect primary breast osteosarcoma. The patient's workup and treatment are detailed in this case. Primary breast osteosarcoma, although rare, should be included as a diagnostic consideration for breast masses with a sunburst pattern of calcifications, particularly when the mammographic appearance has changed.

  7. Use of mobile phone text message reminders in health care services: a narrative literature review.

    Science.gov (United States)

    Kannisto, Kati Anneli; Koivunen, Marita Hannele; Välimäki, Maritta Anneli

    2014-10-17

    Mobile text messages are a widely recognized communication method in societies, as the global penetration of the technology approaches 100% worldwide. Systematic knowledge is still lacking on how the mobile telephone text messaging (short message service, SMS) has been used in health care services. This study aims to review the literature on the use of mobile phone text message reminders in health care. We conducted a systematic literature review of studies on mobile telephone text message reminders. The data sources used were PubMed (MEDLINE), CINAHL, Proquest Databases/ PsycINFO, EMBASE, Cochrane Library, Scopus, and hand searching since 2003. Studies reporting the use of SMS intended to remind patients in health services were included. Given the heterogeneity in the studies, descriptive characteristics, purpose of the study, response rates, description of the intervention, dose and timing, instruments, outcome measures, and outcome data from the studies were synthesized using a narrative approach. From 911 initial citations, 60 studies were included in the review. The studies reported a variety of use for SMS. Mobile telephone text message reminders were used as the only intervention in 73% (44/60) of the studies, and in 27% (16/60) of the remaining studies, SMS was connected to another comprehensive health intervention system. SMS reminders were sent to different patient groups: patients with HIV/AIDS (15%, 9/60) and diabetes (13%, 8/60) being the most common groups. The response rates of the studies varied from 22-100%. Typically, the text message reminders were sent daily. The time before the specific intervention to be rendered varied from 10 minutes (eg, medication taken) to 2 weeks (eg, scheduled appointment). A wide range of different evaluation methods and outcomes were used to assess the impact of SMS varying from existing databases (eg, attendance rate based on medical records), questionnaires, and physiological measures. About three quarters of the

  8. Use of prior mammograms in the classification of benign and malignant masses

    International Nuclear Information System (INIS)

    Varela, Celia; Karssemeijer, Nico; Hendriks, Jan H.C.L.; Holland, Roland

    2005-01-01

    The purpose of this study was to determine the importance of using prior mammograms for classification of benign and malignant masses. Five radiologists and one resident classified mass lesions in 198 mammograms obtained from a population-based screening program. Cases were interpreted twice, once without and once with comparison of previous mammograms, in a sequential reading order using soft copy image display. The radiologists' performances in classifying benign and malignant masses without and with previous mammograms were evaluated with receiver operating characteristic (ROC) analysis. The statistical significance of the difference in performances was calculated using analysis of variance. The use of prior mammograms improved the classification performance of all participants in the study. The mean area under the ROC curve of the readers increased from 0.763 to 0.796. This difference in performance was statistically significant (P = 0.008)

  9. Should previous mammograms be digitised in the transition to digital mammography?

    International Nuclear Information System (INIS)

    Taylor-Phillips, S.; Gale, A.G.; Wallis, M.G.

    2009-01-01

    Breast screening specificity is improved if previous mammograms are available, which presents a challenge when converting to digital mammography. Two display options were investigated: mounting previous film mammograms on a multiviewer adjacent to the workstation, or digitising them for soft copy display. Eight qualified screen readers were videotaped undertaking routine screen reading for two 45-min sessions in each scenario. Analysis of gross eye and head movements showed that when digitised, previous mammograms were examined a greater number of times per case (p=0.03), due to a combination of being used in 19% more cases (p=0.04) and where used, looked at a greater number of times (28% increase, p=0.04). Digitising previous mammograms reduced both the average time taken per case by 18% (p=0.04) and the participants' perceptions of workload (p < 0.05). Digitising previous analogue mammograms may be advantageous, in particular in increasing their level of use. (orig.)

  10. 21 CFR 200.200 - Prescription drugs; reminder advertisements and reminder labeling to provide price information to...

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Prescription drugs; reminder advertisements and reminder labeling to provide price information to consumers. 200.200 Section 200.200 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL GENERAL Prescription Drug Consumer Price Listing §...

  11. Reminders of Social Connection Can Attenuate Anthropomorphism.

    Science.gov (United States)

    Bartz, Jennifer A; Tchalova, Kristina; Fenerci, Can

    2016-12-01

    It is a fundamental human need to secure and sustain a sense of social belonging. Previous research has shown that individuals who are lonely are more likely than people who are not lonely to attribute humanlike traits (e.g., free will) to nonhuman agents (e.g., an alarm clock that makes people get up by moving away from the sleeper), presumably in an attempt to fulfill unmet needs for belongingness. We directly replicated the association between loneliness and anthropomorphism in a larger sample ( N = 178); furthermore, we showed that reminding people of a close, supportive relationship reduces their tendency to anthropomorphize. This finding provides support for the idea that the need for belonging has causal effects on anthropomorphism. Last, we showed that attachment anxiety-characterized by intense desire for and preoccupation with closeness, fear of abandonment, and hypervigilance to social cues-was a stronger predictor of anthropomorphism than loneliness was. This finding helps clarify the mechanisms underlying anthropomorphism and supports the idea that anthropomorphism is a motivated process reflecting the active search for potential sources of connection.

  12. Role of technetium-99m sestamibi scintimammography and contrast-enhanced magnetic resonance imaging for the evaluation of indeterminate mammograms

    International Nuclear Information System (INIS)

    Tiling, R.; Moser, R.; Meyer, G.; Tatsch, K.; Hahn, K.; Khalkhali, I.; Sommer, H.; Willemsen, F.; Pfluger, T.

    1997-01-01

    This study evaluated and compared technetium-99m sestamibi scintimammography (SMM) and breast magnetic resonance imaging (MRI) results in patients with indeterminate mammograms to determine whether either technique can improve the sensitivity and specificity for the diagnosis of breast carcinoma. From 123 consecutive patients who underwent physical examination, mammography, SMM, and histopathologic confirmation, a subgroup of 82 patients presenting with indeterminate mammograms was studied. Sixty-eight patients underwent contrast-enhanced MRI. SMM results were scored on the basis of the intensity and pattern of sestamibi uptake. MRI images were scored on the basis of signal intensity increase after administration of contrast material as well as the enhancement pattern and speed of gadolinium uptake. The results obtained with the two techniques were compared and related to the final histopathologic diagnoses. Considering indeterminate findings as positive, the sensitivity of SMM was 79% and the specificity, 70%. MRI displayed a sensitivity of 84% and a specificity of 49%. When indeterminate results were considered negative, the sensitivity and specificity of SMM were 62% and 83%, respectively. MRI revealed a sensitivity and specificity of 56% and 79%, respectively. The calculated sensitivities and specificities demonstrate the diagnostic limitations of both SMM and MRI in the evaluation of patients with indeterminate mammographic findings. Due to the higher specificity, SMM may be the preferred modality in the evaluation of selected patients with breast abnormalities. (orig.)

  13. SU-E-I-59: Investigation of the Usefulness of a Standard Deviation and Mammary Gland Density as Indexes for Mammogram Classification.

    Science.gov (United States)

    Takarabe, S; Yabuuchi, H; Morishita, J

    2012-06-01

    To investigate the usefulness of the standard deviation of pixel values in a whole mammary glands region and the percentage of a high- density mammary glands region to a whole mammary glands region as features for classification of mammograms into four categories based on the ACR BI-RADS breast composition. We used 36 digital mediolateral oblique view mammograms (18 patients) approved by our IRB. These images were classified into the four categories of breast compositions by an experienced breast radiologist and the results of the classification were regarded as a gold standard. First, a whole mammary region in a breast was divided into two regions such as a high-density mammary glands region and a low/iso-density mammary glands region by using a threshold value that was obtained from the pixel values corresponding to a pectoral muscle region. Then the percentage of a high-density mammary glands region to a whole mammary glands region was calculated. In addition, as a new method, the standard deviation of pixel values in a whole mammary glands region was calculated as an index based on the intermingling of mammary glands and fats. Finally, all mammograms were classified by using the combination of the percentage of a high-density mammary glands region and the standard deviation of each image. The agreement rates of the classification between our proposed method and gold standard was 86% (31/36). This result signified that our method has the potential to classify mammograms. The combination of the standard deviation of pixel values in a whole mammary glands region and the percentage of a high-density mammary glands region to a whole mammary glands region was available as features to classify mammograms based on the ACR BI- RADS breast composition. © 2012 American Association of Physicists in Medicine.

  14. Dynamic multiple thresholding breast boundary detection algorithm for mammograms

    International Nuclear Information System (INIS)

    Wu, Yi-Ta; Zhou Chuan; Chan, Heang-Ping; Paramagul, Chintana; Hadjiiski, Lubomir M.; Daly, Caroline Plowden; Douglas, Julie A.; Zhang Yiheng; Sahiner, Berkman; Shi Jiazheng; Wei Jun

    2010-01-01

    Purpose: Automated detection of breast boundary is one of the fundamental steps for computer-aided analysis of mammograms. In this study, the authors developed a new dynamic multiple thresholding based breast boundary (MTBB) detection method for digitized mammograms. Methods: A large data set of 716 screen-film mammograms (442 CC view and 274 MLO view) obtained from consecutive cases of an Institutional Review Board approved project were used. An experienced breast radiologist manually traced the breast boundary on each digitized image using a graphical interface to provide a reference standard. The initial breast boundary (MTBB-Initial) was obtained by dynamically adapting the threshold to the gray level range in local regions of the breast periphery. The initial breast boundary was then refined by using gradient information from horizontal and vertical Sobel filtering to obtain the final breast boundary (MTBB-Final). The accuracy of the breast boundary detection algorithm was evaluated by comparison with the reference standard using three performance metrics: The Hausdorff distance (HDist), the average minimum Euclidean distance (AMinDist), and the area overlap measure (AOM). Results: In comparison with the authors' previously developed gradient-based breast boundary (GBB) algorithm, it was found that 68%, 85%, and 94% of images had HDist errors less than 6 pixels (4.8 mm) for GBB, MTBB-Initial, and MTBB-Final, respectively. 89%, 90%, and 96% of images had AMinDist errors less than 1.5 pixels (1.2 mm) for GBB, MTBB-Initial, and MTBB-Final, respectively. 96%, 98%, and 99% of images had AOM values larger than 0.9 for GBB, MTBB-Initial, and MTBB-Final, respectively. The improvement by the MTBB-Final method was statistically significant for all the evaluation measures by the Wilcoxon signed rank test (p<0.0001). Conclusions: The MTBB approach that combined dynamic multiple thresholding and gradient information provided better performance than the breast boundary

  15. Improved Resident Adherence to AAA Screening Guidelines via an Electronic Reminder.

    Science.gov (United States)

    Sypert, David; Van Dyke, Kenneth; Dhillon, Namrata; Elliott, John O; Jordan, Kim

    The 2014 United States Preventive Services Task Force systematic review found abdominal aortic aneurysm (AAA) screening decreased related mortality by close to half. Despite the simplicity of screening, research suggests poor adherence to the recommended AAA screening guidelines. Using the quality improvement plan-study-do-act cycle, we retrospectively established poor adherence to AAA screening and poor documentation of smoking history in our resident clinic. An electronic reminder was prospectively implemented into our electronic medical record (EMR) with the goal of improving screening rates. After 1 year, a retrospective chart review was conducted. Comparisons of the pre- and post-electronic reminder intervention data were made using chi-square tests and odds ratios (OR). The purposeful AAA screening rate improved 27.8% during the intervention, 40.3% (95% confidence interval [CI]: 28.6-52.0%) versus 12.5% (95% CI: 3.1-21.9%), p = .002, suggesting patients were more likely to be screened as a result of the electronic reminder, OR = 4.73 (95% CI: 1.77-12.65). This improvement translates to a large effect size, Cohen's d = 0.86 (95% CI: 0.31-1.40). Electronic reminders are a simple EMR addition that can provide evidence-based education while improving adherence rates with preventive health screening measures.

  16. Assessment of a novel mass detection algorithm in mammograms

    Directory of Open Access Journals (Sweden)

    Ehsan Kozegar

    2013-01-01

    Settings and Design: The proposed mass detector consists of two major steps. In the first step, several suspicious regions are extracted from the mammograms using an adaptive thresholding technique. In the second step, false positives originating by the previous stage are reduced by a machine learning approach. Materials and Methods: All modules of the mass detector were assessed on mini-MIAS database. In addition, the algorithm was tested on INBreast database for more validation. Results: According to FROC analysis, our mass detection algorithm outperforms other competing methods. Conclusions: We should not just insist on sensitivity in the segmentation phase because if we forgot FP rate, and our goal was just higher sensitivity, then the learning algorithm would be biased more toward false positives and the sensitivity would decrease dramatically in the false positive reduction phase. Therefore, we should consider the mass detection problem as a cost sensitive problem because misclassification costs are not the same in this type of problems.

  17. Do Fitness Apps Need Text Reminders? An Experiment Testing Goal-Setting Text Message Reminders to Promote Self-Monitoring.

    Science.gov (United States)

    Liu, Shuang; Willoughby, Jessica F

    2018-01-01

    Fitness tracking apps have the potential to change unhealthy lifestyles, but users' lack of compliance is an issue. The current intervention examined the effectiveness of using goal-setting theory-based text message reminders to promote tracking activities on fitness apps. We conducted a 2-week experiment with pre- and post-tests with young adults (n = 50). Participants were randomly assigned to two groups-a goal-setting text message reminder group and a generic text message reminder group. Participants were asked to use a fitness tracking app to log physical activity and diet for the duration of the study. Participants who received goal-setting reminders logged significantly more physical activities than those who only received generic reminders. Further, participants who received goal-setting reminders liked the messages and showed significantly increased self-efficacy, awareness of personal goals, motivation, and intention to use the app. The study shows that incorporating goal-setting theory-based text message reminders can be useful to boost user compliance with self-monitoring fitness apps by reinforcing users' personal goals and enhancing cognitive factors associated with health behavior change.

  18. Locally adaptive decision in detection of clustered microcalcifications in mammograms

    Science.gov (United States)

    Sainz de Cea, María V.; Nishikawa, Robert M.; Yang, Yongyi

    2018-02-01

    In computer-aided detection or diagnosis of clustered microcalcifications (MCs) in mammograms, the performance often suffers from not only the presence of false positives (FPs) among the detected individual MCs but also large variability in detection accuracy among different cases. To address this issue, we investigate a locally adaptive decision scheme in MC detection by exploiting the noise characteristics in a lesion area. Instead of developing a new MC detector, we propose a decision scheme on how to best decide whether a detected object is an MC or not in the detector output. We formulate the individual MCs as statistical outliers compared to the many noisy detections in a lesion area so as to account for the local image characteristics. To identify the MCs, we first consider a parametric method for outlier detection, the Mahalanobis distance detector, which is based on a multi-dimensional Gaussian distribution on the noisy detections. We also consider a non-parametric method which is based on a stochastic neighbor graph model of the detected objects. We demonstrated the proposed decision approach with two existing MC detectors on a set of 188 full-field digital mammograms (95 cases). The results, evaluated using free response operating characteristic (FROC) analysis, showed a significant improvement in detection accuracy by the proposed outlier decision approach over traditional thresholding (the partial area under the FROC curve increased from 3.95 to 4.25, p-value  FPs at a given sensitivity level. The proposed adaptive decision approach could not only reduce the number of FPs in detected MCs but also improve case-to-case consistency in detection.

  19. Exposure parameters of mammograms with and without mass lesions from a South African breast care centre

    International Nuclear Information System (INIS)

    Acho, Sussan N.; Boonzaier, Willem P. E.; Nel, Ina F.

    2017-01-01

    In South African breast care centres, full-field digital mammography units provide breast imaging services to symptomatic and asymptomatic women simultaneously. This study evaluated the technical exposure parameters of 800 mammograms of which 100 mammograms had obvious mass lesions in the fibro-glandular tissue. The average breast compression force of mammograms with mass lesions in the fibro-glandular tissue was 18.4% less than the average breast compression force of mammograms without mass lesions. The average mean glandular dose (MGD), tube potential (kV p ) and compressed breast thickness (CBT) values were 2.14 mGy, 30.5 kV p and 63.9 mm, respectively, for mammograms with mass lesions, and 1.45 mGy, 29.6 kV p and 56.9 mm, respectively, for mammograms without mass lesions. Overall, the average MGD and mean CBT of mammograms with mass lesion were significantly higher compared to those without mass lesions (p < 0.05), although there was no significant difference in their tube potentials (p > 0.05). (authors)

  20. Effect on sensitivity and specificity of mammography screening with or without comparison of old mammograms

    International Nuclear Information System (INIS)

    Thurfjell, M.G.; Vitak, B.; Azavedo, E.; Svane, G.; Thurfjell, E.

    2000-01-01

    In order to evaluate the effect of old mammograms on the specificity and sensitivity of radiologists in mammography screening, one hundred and fifty sets of screening mammograms were examined by 3 experienced screeners twice: once without and once in comparison with older mammograms. The films came from a population-based screening done during the first half of 1994 and comprised all 35 cancers detected during screening in 1994, 12/24 interval cancers, 14/34 cancers detected in the following screening and 89 normal mammograms. Without old mammograms, the screeners detected an average of 40.3 cancers (range 37-42), with a specificity of 87% (85-88%). With old mammograms, the screeners detected 37.7 cancers (range 34-42) with a specificity of 96% (94-99%). The change in detection rate was not significant. However, the increase in specificity was significant for each screener. Mammography screening with old mammograms available for comparison decreased the false-positive recall rate. The effect on sensitivity, however, was unclear

  1. Computerized image analysis: Texture-field orientation method for pectoral muscle identification on MLO-view mammograms

    International Nuclear Information System (INIS)

    Zhou Chuan; Wei Jun; Chan, Heang-Ping; Paramagul, Chintana; Hadjiiski, Lubomir M.; Sahiner, Berkman; Douglas, Julie A.

    2010-01-01

    Purpose: To develop a new texture-field orientation (TFO) method that combines a priori knowledge, local and global information for the automated identification of pectoral muscle on mammograms. Methods: The authors designed a gradient-based directional kernel (GDK) filter to enhance the linear texture structures, and a gradient-based texture analysis to extract a texture orientation image that represented the dominant texture orientation at each pixel. The texture orientation image was enhanced by a second GDK filter for ridge point extraction. The extracted ridge points were validated and the ridges that were less likely to lie on the pectoral boundary were removed automatically. A shortest-path finding method was used to generate a probability image that represented the likelihood that each remaining ridge point lay on the true pectoral boundary. Finally, the pectoral boundary was tracked by searching for the ridge points with the highest probability lying on the pectoral boundary. A data set of 130 MLO-view digitized film mammograms (DFMs) from 65 patients was used to train the TFO algorithm. An independent data set of 637 MLO-view DFMs from 562 patients was used to evaluate its performance. Another independent data set of 92 MLO-view full field digital mammograms (FFDMs) from 92 patients was used to assess the adaptability of the TFO algorithm to FFDMs. The pectoral boundary detection accuracy of the TFO method was quantified by comparison with an experienced radiologist's manually drawn pectoral boundary using three performance metrics: The percent overlap area (POA), the Hausdorff distance (Hdist), and the average distance (AvgDist). Results: The mean and standard deviation of POA, Hdist, and AvgDist were 95.0±3.6%, 3.45±2.16 mm, and 1.12±0.82 mm, respectively. For the POA measure, 91.5%, 97.3%, and 98.9% of the computer detected pectoral muscles had POA larger than 90%, 85%, and 80%, respectively. For the distance measures, 85.4% and 98.0% of the

  2. SMS text message reminders to improve infant vaccination coverage in Guatemala: A pilot randomized controlled trial.

    Science.gov (United States)

    Domek, Gretchen J; Contreras-Roldan, Ingrid L; O'Leary, Sean T; Bull, Sheana; Furniss, Anna; Kempe, Allison; Asturias, Edwin J

    2016-05-05

    Patient reminder systems are an evidence-based way to improve childhood vaccination rates but are difficult to implement in low- and middle-income countries (LMICs). Short Message Service (SMS) texts may offer a potential low-cost solution, especially in LMICs where mobile phones are becoming more ubiquitous. To determine if an SMS-based vaccination reminder system aimed at improving completion of the infant primary immunization series is feasible and acceptable in Guatemala. A pilot randomized controlled trial was conducted at two public health clinics in Guatemala City. Infants aged 8-14 weeks presenting for the first dose of the primary immunization series were enrolled in March-April 2013. Participants randomized into the intervention received three SMS reminders one week before the second and third dose. A follow-up acceptability survey was administered to both groups. The participation rate was 86.8% (321/370); 8 did not own a cell phone and 12 could not use SMS. 96.9% of intervention parents were sent at least one SMS reminder prior to visit 2 and 96.3% prior to visit 3. Both intervention and usual care participants had high rates of vaccine and visit completion, with a non-statistically significant higher percentage of children in the intervention completing both visit 2 (95.0% vs. 90.1%, p=.12) and visit 3 (84.4% vs. 80.7%, p=.69). More intervention vs. usual care parents agreed that SMS reminders would be helpful for remembering appointments (p<.0001), agreed to being interested in receiving future SMS reminders (p<.0001), and said that they would be willing to pay for future SMS reminders (p=.01). This proof of concept evaluation showed that a new application of SMS technology is feasible to implement in a LMIC with high user satisfaction. Larger studies with modifications in the SMS system are needed to determine effectiveness (Clinical Trial Registry NCT01663636). Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

  3. A Prospective Controlled Trial of an Electronic Hand Hygiene Reminder System

    Science.gov (United States)

    Ellison, Richard T.; Barysauskas, Constance M.; Rundensteiner, Elke A.; Wang, Di; Barton, Bruce

    2015-01-01

    Background. The use of electronic hand hygiene reminder systems has been proposed as an approach to improve hand hygiene compliance among healthcare workers, although information on efficacy is limited. We prospectively assessed whether hand hygiene activities among healthcare workers could be increased using an electronic hand hygiene monitoring and reminder system. Methods. A prospective controlled clinical trial was conducted in 2 medical intensive care units (ICUs) at an academic medical center with comparable patient populations, healthcare staff, and physical layout. Hand hygiene activity was monitored concurrently in both ICUs, and the reminder system was installed in the test ICU. The reminder system was tested during 3 administered phases including: room entry/exit chimes, display of real-time hand hygiene activity, and a combination of the 2. Results. In the test ICU, the mean number of hand hygiene events increased from 1538 per day at baseline to 1911 per day (24% increase) with the use of a combination of room entry/exit chimes, real-time displays of hand hygiene activity, and manager reports (P hand hygiene to room entry/exit events also increased from 26.1% to 36.6% (40% increase, P hand hygiene events per day) during the follow-up phase. There was no significant change in hand hygiene activity in the control ICU during the course of the trial. Conclusions. In an ICU setting, an electronic hand hygiene reminder system that provided real-time feedback on overall unit-wide hand hygiene performance significantly increased hand hygiene activity. PMID:26430698

  4. A Single Sided Edge Marking Method for Detecting Pectoral Muscle in Digital Mammograms

    Directory of Open Access Journals (Sweden)

    G. Toz

    2018-02-01

    Full Text Available In the computer-assisted diagnosis of breast cancer, the removal of pectoral muscle from mammograms is very important. In this study, a new method, called Single-Sided Edge Marking (SSEM technique, is proposed for the identification of the pectoral muscle border from mammograms. 60 mammograms from the INbreast database were used to test the proposed method. The results obtained were compared for False Positive Rate, False Negative Rate, and Sensitivity using the ground truth values pre-determined by radiologists for the same images. Accordingly, it has been shown that the proposed method can detect the pectoral muscle border with an average of 95.6% sensitivity.

  5. Selective reminding of prospective memory in Multiple Sclerosis.

    Science.gov (United States)

    McKeever, Joshua D; Schultheis, Maria T; Sim, Tiffanie; Goykhman, Jessica; Patrick, Kristina; Ehde, Dawn M; Woods, Steven Paul

    2017-04-19

    Multiple sclerosis (MS) is associated with prospective memory (PM) deficits, which may increase the risk of poor functional/health outcomes such as medication non-adherence. This study examined the potential benefits of selective reminding to enhance PM functioning in persons with MS. Twenty-one participants with MS and 22 healthy adults (HA) underwent a neuropsychological battery including a Selective Reminding PM (SRPM) experimental procedure. Participants were randomly assigned to either: (1) a selective reminding condition in which participants learn (to criterion) eight prospective memory tasks in a Selective Reminding format; or (2) a single trial encoding condition (1T). A significant interaction was demonstrated, with MS participants receiving greater benefit than HAs from the SR procedure in terms of PM performance. Across diagnostic groups, participants in the SR conditions (vs. 1T conditions) demonstrated significantly better PM performance. Individuals with MS were impaired relative to HAs in the 1T condition, but performance was statistically comparable in the SR condition. This preliminary study suggests that selective reminding can be used to enhance PM cue detection and retrieval in MS. The extent to which selective reminding of PM is effective in naturalistic settings and for health-related behaviours in MS remains to be determined.

  6. Automated detection of microcalcification clusters in digital mammograms based on wavelet domain hidden Markov tree modeling

    International Nuclear Information System (INIS)

    Regentova, E.; Zhang, L.; Veni, G.; Zheng, J.

    2007-01-01

    A system is designed for detecting microcalcification clusters (MCC) in digital mammograms. The system is intended for computer-aided diagnostic prompting. Further discrimination of MCC as benign or malignant is assumed to be performed by radiologists. Processing of mammograms is based on the statistical modeling by means of wavelet domain hidden markov trees (WHMT). Segmentation is performed by the weighted likelihood evaluation followed by the classification based on spatial filters for a single microcalcification (MC) and a cluster of MC detection. The analysis is carried out on FROC curves for 40 mammograms from the mini-MIAS database and for 100 mammograms with 50 cancerous and 50 benign cases from DDSM database. The designed system is capable to detect 100% of true positive cases in these sets. The rate of false positives is 2.9 per case for mini-MIAS dataset; and 0.01 for the DDSM images. (orig.)

  7. Use of electronic clinical reminders to increase preventive screenings in a primary care setting: blueprint from a successful process in Kodiak, Alaska.

    Science.gov (United States)

    Onders, Robert; Spillane, James; Reilley, Brigg; Leston, Jessica

    2014-01-01

    The Kodiak Area Native Association (KANA) provides primary health care in Kodiak, Alaska and 6 outlying villages. KANA sought to actively improve key preventive screening rates for its patients. KANA adopted an electronic health record in 2008 and deployed national clinical reminders from the Indian Health Service for 5 key preventive screenings: tobacco use, alcohol use, depression, intimate partner violence, and a comprehensive cardiovascular exam. Clinical reminders were deployed in a 5-step process: (a) establish clinical demand, (b) pilot test reminder, (c) expand reminder to all providers, (d) measure outcomes and share results, and (e) delegate clinical reminder follow-up (primarily to nurses). Data from 2007-2011 show screening rates for all 5 measures improved considerably, to levels significantly above the national average for Indian Health Service facilities. Clinical reminders have been a key part of a multistep process to improve screening for depression, tobacco cessation, intimate partner violence, alcohol use, and cardiovascular disease. If deployed correctly, reminders are valuable tools in identifying patients who are overdue for preventive health screenings.

  8. Computer aided monitoring of breast abnormalities in X-ray mammograms

    OpenAIRE

    Selvan, Arul; Saatchi, Reza; Ferris, Christine

    2011-01-01

    X­ray mammography is regarded as the most effective tool for the detection and diagnosis of breast cancer, but the interpretation of mammograms is a difficult and \\ud error­prone task. Computer­aided detection (CADe) systems address the problem that radiologists often miss signs of cancers that are retrospectively visible in mammograms. Furthermore, computer­aided diagnosis (CADx) systems assist the radiologist in the classification of mammographic lesions as benign or malignant[1].\\ud This p...

  9. Mass-Like Fibrocystic Disease of the Breast : Characteristic Findings on Mammogram and Sonogram

    International Nuclear Information System (INIS)

    KIm, Hyeon Hee; Yun, Duk Hee; Hwang, Ho Kyumg; Kim, Jang Min; Kim, Young Sun; Lee, Jung Hee

    1995-01-01

    This study was performed to evaluate the mammographic and sonographic features of mass-like fibrocystic disease of the breast to differentiate from other breast mass. We retrospectively analyzed characteristics mammographic(16 cases) and sonographic findings(39 cases) of histopathologically proven mass-like fibrocystic disease of the breast in 39 patients. Of 16 patients with mammogram, mass-like fibrocystic disease of the breast was round shape in 12 cases, high density in 14 cases.The margin of the mass was well marginated in 8 cases, poorly marginated in 8 cases. The calcification within the mass was not detected in 13 cases. In 39 patients with sonogram, mass-like fibrocystic disease of the breast was mostly ovoid shape in 24 cases, hypoechoic in 23 cases, with homogenous internal echo in 36 cases, well defined in 28 cases, and with equivocal posterior shadowing in 26 cases. The T/AP ratios of the mass was not less than 1.5 in 29 cases. The bilateral edge-shadowing of the mass was not noted in 24 cases. Characteristic findings of the mass-like fibrocystic disease of the breast are round shape, high density, well defined mass on mammograrn and ovoid shape, homogeneous internal echo, well marginated mass on sonogram which were similar to those in other benign lesion. Mass-like fibrocystic disease, which in a frequent cause of breast lumps, should be included in the differential diagnosis of breast mass with benign mammographic and/or sonographic findings

  10. Mass-Like Fibrocystic Disease of the Breast : Characteristic Findings on Mammogram and Sonogram

    Energy Technology Data Exchange (ETDEWEB)

    KIm, Hyeon Hee; Yun, Duk Hee; Hwang, Ho Kyumg; Kim, Jang Min; Kim, Young Sun; Lee, Jung Hee [Kwang Myung Sung Ae Hospital, Gwangmyeong (Korea, Republic of)

    1995-12-15

    This study was performed to evaluate the mammographic and sonographic features of mass-like fibrocystic disease of the breast to differentiate from other breast mass. We retrospectively analyzed characteristics mammographic(16 cases) and sonographic findings(39 cases) of histopathologically proven mass-like fibrocystic disease of the breast in 39 patients. Of 16 patients with mammogram, mass-like fibrocystic disease of the breast was round shape in 12 cases, high density in 14 cases.The margin of the mass was well marginated in 8 cases, poorly marginated in 8 cases. The calcification within the mass was not detected in 13 cases. In 39 patients with sonogram, mass-like fibrocystic disease of the breast was mostly ovoid shape in 24 cases, hypoechoic in 23 cases, with homogenous internal echo in 36 cases, well defined in 28 cases, and with equivocal posterior shadowing in 26 cases. The T/AP ratios of the mass was not less than 1.5 in 29 cases. The bilateral edge-shadowing of the mass was not noted in 24 cases. Characteristic findings of the mass-like fibrocystic disease of the breast are round shape, high density, well defined mass on mammograrn and ovoid shape, homogeneous internal echo, well marginated mass on sonogram which were similar to those in other benign lesion. Mass-like fibrocystic disease, which in a frequent cause of breast lumps, should be included in the differential diagnosis of breast mass with benign mammographic and/or sonographic findings

  11. Parent opinions about use of text messaging for immunization reminders.

    Science.gov (United States)

    Ahlers-Schmidt, Carolyn Rose; Chesser, Amy K; Paschal, Angelia M; Hart, Traci A; Williams, Katherine S; Yaghmai, Beryl; Shah-Haque, Sapna

    2012-06-06

    Adherence to childhood immunization schedules is a function of various factors. Given the increased use of technology as a strategy to increase immunization coverage, it is important to investigate how parents perceive different forms of communication, including traditional means and text-message reminders. To examine current forms of communication about immunization information, parents' satisfaction levels with these communication modes, perceived barriers and benefits to using text messaging, and the ideal content of text messages for immunization reminders. Structured interviews were developed and approved by two Institutional Review Boards. A convenience sample of 50 parents was recruited from two local pediatric clinics. The study included a demographics questionnaire, the shortened form of the Test of Functional Health Literacy for Adults (S-TOFHLA), questions regarding benefits and barriers of text communication from immunization providers, and preferred content for immunization reminders. Content analyses were performed on responses to barriers, benefits, and preferred content (all Cohen's kappas > 0.70). Respondents were mostly female (45/50, 90%), white non-Hispanic (31/50, 62%), between 20-41 years (mean = 29, SD 5), with one or two children (range 1-9). Nearly all (48/50, 96%) had an S-TOFHLA score in the "adequate" range. All parents (50/50, 100%) engaged in face-to-face contact with their child's physician at appointments, 74% (37/50) had contact via telephone, and none of the parents (0/50, 0%) used email or text messages. Most parents were satisfied with the face-to-face (48/50, 96%) and telephone (28/50, 75%) communication. Forty-nine of the 50 participants (98%) were interested in receiving immunization reminders by text message, and all parents (50/50, 100%) were willing to receive general appointment reminders by text message. Parents made 200 comments regarding text-message reminders. Benefits accounted for 63.5% of comments (127/200). The

  12. Resolution effects on the morphology of calcifications in digital mammograms

    Energy Technology Data Exchange (ETDEWEB)

    Kallergi, Maria; He, Li; Gavrielides, Marios; Heine, John; Clarke, Laurence P [Department of Radiology, College of Medicine, and H. Lee Moffitt Cancer Center and Research Institute at the University of South Florida, 12901 Bruce B. Downs Blvd., Box 17, Tampa, FL 33612 (United States)

    1999-12-31

    The development of computer assisted diagnosis (CAD) techniques and direct digital mammography systems have generated significant interest in the issue of the effect of image resolution on the detection and classification (benign vs malignant) of mammographic abnormalities. CAD in particular seems to heavily depend on image resolution, either due to the inherent algorithm design and optimization, which is almost always dependent, or due to the differences in image content at the various resolutions. This twofold dependence makes it even more difficult to answer the question of what is the minimum resolution required for successful detection and/or classification of a specific mammographic abnormality, such as calcifications. One may begin by evaluating the losses in the mammograms as the films are digitized with different pixel sizes and depths. In this paper we attempted to measure these losses for the case of calcifications at four different spatial resolutions through a simulation model and a classification scheme that is based only on morphological features. The results showed that a 60 {mu}m pixel size and 12 bits per pixel should at least be used if the morphology and distribution of the calcifications are essential components in the CAD algorithm design. These conclusions were tested with the use of a wavelet-based algorithm for the segmentation of simulated mammographic calcifications at various resolutions. The evaluation of the segmentation through shape analysis and classification supported the initial conclusion. (authors) 14 refs., 1 tabs.

  13. Evaluation of hybrids algorithms for mass detection in digitalized mammograms

    International Nuclear Information System (INIS)

    Cordero, Jose; Garzon Reyes, Johnson

    2011-01-01

    The breast cancer remains being a significant public health problem, the early detection of the lesions can increase the success possibilities of the medical treatments. The mammography is an image modality effective to early diagnosis of abnormalities, where the medical image is obtained of the mammary gland with X-rays of low radiation, this allows detect a tumor or circumscribed mass between two to three years before that it was clinically palpable, and is the only method that until now achieved reducing the mortality by breast cancer. In this paper three hybrids algorithms for circumscribed mass detection on digitalized mammograms are evaluated. In the first stage correspond to a review of the enhancement and segmentation techniques used in the processing of the mammographic images. After a shape filtering was applied to the resulting regions. By mean of a Bayesian filter the survivors regions were processed, where the characteristics vector for the classifier was constructed with few measurements. Later, the implemented algorithms were evaluated by ROC curves, where 40 images were taken for the test, 20 normal images and 20 images with circumscribed lesions. Finally, the advantages and disadvantages in the correct detection of a lesion of every algorithm are discussed.

  14. A Probabilistic Approach for Breast Boundary Extraction in Mammograms

    Directory of Open Access Journals (Sweden)

    Hamed Habibi Aghdam

    2013-01-01

    Full Text Available The extraction of the breast boundary is crucial to perform further analysis of mammogram. Methods to extract the breast boundary can be classified into two categories: methods based on image processing techniques and those based on models. The former use image transformation techniques such as thresholding, morphological operations, and region growing. In the second category, the boundary is extracted using more advanced techniques, such as the active contour model. The problem with thresholding methods is that it is a hard to automatically find the optimal threshold value by using histogram information. On the other hand, active contour models require defining a starting point close to the actual boundary to be able to successfully extract the boundary. In this paper, we propose a probabilistic approach to address the aforementioned problems. In our approach we use local binary patterns to describe the texture around each pixel. In addition, the smoothness of the boundary is handled by using a new probability model. Experimental results show that the proposed method reaches 38% and 50% improvement with respect to the results obtained by the active contour model and threshold-based methods respectively, and it increases the stability of the boundary extraction process up to 86%.

  15. Quantifying the effect of colorization enhancement on mammogram images

    Science.gov (United States)

    Wojnicki, Paul J.; Uyeda, Elizabeth; Micheli-Tzanakou, Evangelia

    2002-04-01

    Current methods of radiological displays provide only grayscale images of mammograms. The limitation of the image space to grayscale provides only luminance differences and textures as cues for object recognition within the image. However, color can be an important and significant cue in the detection of shapes and objects. Increasing detection ability allows the radiologist to interpret the images in more detail, improving object recognition and diagnostic accuracy. Color detection experiments using our stimulus system, have demonstrated that an observer can only detect an average of 140 levels of grayscale. An optimally colorized image can allow a user to distinguish 250 - 1000 different levels, hence increasing potential image feature detection by 2-7 times. By implementing a colorization map, which follows the luminance map of the original grayscale images, the luminance profile is preserved and color is isolated as the enhancement mechanism. The effect of this enhancement mechanism on the shape, frequency composition and statistical characteristics of the Visual Evoked Potential (VEP) are analyzed and presented. Thus, the effectiveness of the image colorization is measured quantitatively using the Visual Evoked Potential (VEP).

  16. Search for lesions in mammograms: Statistical characterization of observer responses

    International Nuclear Information System (INIS)

    Bochud, Francois O.; Abbey, Craig K.; Eckstein, Miguel P.

    2004-01-01

    We investigate human performance for visually detecting simulated microcalcifications and tumors embedded in x-ray mammograms as a function of signal contrast and the number of possible signal locations. Our results show that performance degradation with an increasing number of locations is well approximated by signal detection theory (SDT) with the usual Gaussian assumption. However, more stringent statistical analysis finds a departure from Gaussian assumptions for the detection of microcalcifications. We investigated whether these departures from the SDT Gaussian model could be accounted for by an increase in human internal response correlations arising from the image-pixel correlations present in 1/f spectrum backgrounds and/or observer internal response distributions that departed from the Gaussian assumption. Results were consistent with a departure from the Gaussian response distributions and suggested that the human observer internal responses were more compact than the Gaussian distribution. Finally, we conducted a free search experiment where the signal could appear anywhere within the image. Results show that human performance in a multiple-alternative forced-choice experiment can be used to predict performance in the clinically realistic free search experiment when the investigator takes into account the search area and the observers' inherent spatial imprecision to localize the targets

  17. Multi-task transfer learning deep convolutional neural network: application to computer-aided diagnosis of breast cancer on mammograms

    Science.gov (United States)

    Samala, Ravi K.; Chan, Heang-Ping; Hadjiiski, Lubomir M.; Helvie, Mark A.; Cha, Kenny H.; Richter, Caleb D.

    2017-12-01

    Transfer learning in deep convolutional neural networks (DCNNs) is an important step in its application to medical imaging tasks. We propose a multi-task transfer learning DCNN with the aim of translating the ‘knowledge’ learned from non-medical images to medical diagnostic tasks through supervised training and increasing the generalization capabilities of DCNNs by simultaneously learning auxiliary tasks. We studied this approach in an important application: classification of malignant and benign breast masses. With Institutional Review Board (IRB) approval, digitized screen-film mammograms (SFMs) and digital mammograms (DMs) were collected from our patient files and additional SFMs were obtained from the Digital Database for Screening Mammography. The data set consisted of 2242 views with 2454 masses (1057 malignant, 1397 benign). In single-task transfer learning, the DCNN was trained and tested on SFMs. In multi-task transfer learning, SFMs and DMs were used to train the DCNN, which was then tested on SFMs. N-fold cross-validation with the training set was used for training and parameter optimization. On the independent test set, the multi-task transfer learning DCNN was found to have significantly (p  =  0.007) higher performance compared to the single-task transfer learning DCNN. This study demonstrates that multi-task transfer learning may be an effective approach for training DCNN in medical imaging applications when training samples from a single modality are limited.

  18. Diagnostic abilities of three CAD methods for assessing microcalcifications in mammograms and an aspect of equivocal cases decisions by radiologists

    International Nuclear Information System (INIS)

    Hung, W.T.; Nguyen, H.T.; Thornton, B.S.; Rickard, M.T.; Blinowska, A.

    2003-01-01

    Radiologists use an 'Overall impression' rating to assess a suspicious region on a mammogram. The value ranges from 1 to 5. They will definitely send a patient for biopsy if the rating is 4 or 5. They will send the patient for core biopsy when a rating of 3 (indeterminate) is given. We have developed three methods to aid diagnosis of cases with microcalcifications. The first two methods, namely, Bayesian and multiple logistic regression (with a special 'cutting score' technique), utilise six parameter ratings which minimise subjectivity in characterising the microcalcifications. The third method uses three parameters (age of patient, uniformity of size of microcalcification and their distribution) in a multiple stepwise regression. For both training set and test set, all three methods are as good as the two radiologists in terms of percentages of correct classification. Therefore, all three proposed methods potentially can be used as second readers. Copyright (2003) Australasian College of Physical Scientists and Engineers in Medicine

  19. Reminder cues modulate the renewal effect in human predictive learning

    Directory of Open Access Journals (Sweden)

    Javier Bustamante

    2016-12-01

    Full Text Available Associative learning refers to our ability to learn about regularities in our environment. When a stimulus is repeatedly followed by a specific outcome, we learn to expect the outcome in the presence of the stimulus. We are also able to modify established expectations in the face of disconfirming information (the stimulus is no longer followed by the outcome. Both the change of environmental regularities and the related processes of adaptation are referred to as extinction. However, extinction does not erase the initially acquired expectations. For instance, following successful extinction, the initially learned expectations can recover when there is a context change – a phenomenon called the renewal effect, which is considered as a model for relapse after exposure therapy. Renewal was found to be modulated by reminder cues of acquisition and extinction. However, the mechanisms underlying the effectiveness of reminder cues are not well understood. The aim of the present study was to investigate the impact of reminder cues on renewal in the field of human predictive learning. Experiment I demonstrated that renewal in human predictive learning is modulated by cues related to acquisition or extinction. Initially, participants received pairings of a stimulus and an outcome in one context. These stimulus-outcome pairings were preceded by presentations of a reminder cue (acquisition cue. Then, participants received extinction in a different context in which presentations of the stimulus were no longer followed by the outcome. These extinction trials were preceded by a second reminder cue (extinction cue. During a final phase conducted in a third context, participants showed stronger expectations of the outcome in the presence of the stimulus when testing was accompanied by the acquisition cue compared to the extinction cue. Experiment II tested an explanation of the reminder cue effect in terms of simple cue-outcome associations. Therefore

  20. Real-time alerts and reminders using information systems.

    Science.gov (United States)

    Wanderer, Jonathan P; Sandberg, Warren S; Ehrenfeld, Jesse M

    2011-09-01

    Adoption of information systems throughout the hospital environment has enabled the development of real-time physiologic alerts and clinician reminder systems. These clinical tools can be made available through the deployment of anesthesia information management systems (AIMS). Creating usable alert systems requires understanding of technical considerations. Various successful implementations are reviewed, encompassing cost reduction, improved revenue capture, timely antibiotic administration, and postoperative nausea and vomiting prophylaxis. Challenges to the widespread use of real-time alerts and reminders include AIMS adoption rates and the difficulty in choosing appropriate areas and approaches for information systems support. Copyright © 2011 Elsevier Inc. All rights reserved.

  1. Avoidable surgical consultations in women with a positive screening mammogram: Experience from a southern region of the Dutch breast screening programme

    International Nuclear Information System (INIS)

    Schreutelkamp, J.L.; Kwee, R.M.; Booij, M. de; Adriaensen, M.E.A.P.M.

    2014-01-01

    Introduction: According to current Dutch guidelines, all women with a positive screening mammogram are referred for a full hospital assessment, which includes surgical consultation and radiological assessment. Surgical consultation may be unnecessary for many patients. Our objective was to determine how often surgical consultations can be avoided by radiological pre-assessment. Materials and methods: All women with a positive screening mammogram, referred to our radiology department between 2002 and 2007, were included (n = 1014). Percentage of women that was downstaged to BI-RADS category 1 or 2 by radiological pre-assessment was calculated. Negative predictive value (NPV) for malignancy was estimated from the in-hospital follow-up, which was available up to September 2012. Results: 423 of 1014 women (42%) were downstaged to BI-RADS category 1 or 2 by radiological pre-assessment. During follow-up, 8 of these 423 women (2%) developed a malignancy in the same breast. At least 6 of these malignancies were located at a different location as the original screening findings which led to the initial referral. The estimated NPV for malignancy was 99.5% (95%CI, 98.3–99.9). Conclusion: By referring women with a positive screening mammogram to the radiology department for pre-assessment, a surgical consultation was avoided in 42%, with an estimated NPV of 99.5% for malignancy

  2. Design and implementation of a children vaccination reminder system based on short message service

    Directory of Open Access Journals (Sweden)

    Marjan Ghazisaeedi

    2016-09-01

    Full Text Available Background: Most problems related to quality of care and patient safety are related to human negligence. One of the causes of these problems is forgetting to do something. This problem can be avoided with information technology in many cases. Some forgotten are very important. Among these is failure to comply with vaccination schedule by parents that can result in inappropriate outcomes. In this study, we developed and evaluated a SMS reminder system for regular and timely vaccination of children. Methods: In this developmental-applied research, firstly, a child vaccination reminder system was designed and implemented to help parents reduce the forgetfulness. This system based on the child's vaccination history and the date of birth, offer time and type of future vaccines. Then the parents of 27 children, that their vaccination was between 22 June and 21 August 2015, referred to Children's Medical Center, were sent text messages by using this system. We evaluated the accuracy of the system logic by using some scenarios. In addition, we evaluated parents' satisfaction with the system using a questionnaire. Results: In all cases but one, the system proposed the type and date of future children vaccines correctly. All the parents who have received text messages had good perception and satisfaction on the majority of questions (total mean score of 4.15 out of 5. Most parents (4.92 out of 5 stated that using the system to remind their visit for child immunization was helpful and willing to offer the system to their friends and other families. Conclusion: Using the short message system is beneficial for parents to remind their children’s vaccination time and increases their satisfaction. So, it can be considered as an important and essential tool in providing healthcare services. SMS is an easy, cheap and effective way to improve the quality of care services.

  3. Modeling sequential context effects in diagnostic interpretation of screening mammograms.

    Science.gov (United States)

    Alamudun, Folami; Paulus, Paige; Yoon, Hong-Jun; Tourassi, Georgia

    2018-07-01

    Prior research has shown that physicians' medical decisions can be influenced by sequential context, particularly in cases where successive stimuli exhibit similar characteristics when analyzing medical images. This type of systematic error is known to psychophysicists as sequential context effect as it indicates that judgments are influenced by features of and decisions about the preceding case in the sequence of examined cases, rather than being based solely on the peculiarities unique to the present case. We determine if radiologists experience some form of context bias, using screening mammography as the use case. To this end, we explore correlations between previous perceptual behavior and diagnostic decisions and current decisions. We hypothesize that a radiologist's visual search pattern and diagnostic decisions in previous cases are predictive of the radiologist's current diagnostic decisions. To test our hypothesis, we tasked 10 radiologists of varied experience to conduct blind reviews of 100 four-view screening mammograms. Eye-tracking data and diagnostic decisions were collected from each radiologist under conditions mimicking clinical practice. Perceptual behavior was quantified using the fractal dimension of gaze scanpath, which was computed using the Minkowski-Bouligand box-counting method. To test the effect of previous behavior and decisions, we conducted a multifactor fixed-effects ANOVA. Further, to examine the predictive value of previous perceptual behavior and decisions, we trained and evaluated a predictive model for radiologists' current diagnostic decisions. ANOVA tests showed that previous visual behavior, characterized by fractal analysis, previous diagnostic decisions, and image characteristics of previous cases are significant predictors of current diagnostic decisions. Additionally, predictive modeling of diagnostic decisions showed an overall improvement in prediction error when the model is trained on additional information about

  4. Computerized image analysis: estimation of breast density on mammograms

    Science.gov (United States)

    Zhou, Chuan; Chan, Heang-Ping; Petrick, Nicholas; Sahiner, Berkman; Helvie, Mark A.; Roubidoux, Marilyn A.; Hadjiiski, Lubomir M.; Goodsitt, Mitchell M.

    2000-06-01

    An automated image analysis tool is being developed for estimation of mammographic breast density, which may be useful for risk estimation or for monitoring breast density change in a prevention or intervention program. A mammogram is digitized using a laser scanner and the resolution is reduced to a pixel size of 0.8 mm X 0.8 mm. Breast density analysis is performed in three stages. First, the breast region is segmented from the surrounding background by an automated breast boundary-tracking algorithm. Second, an adaptive dynamic range compression technique is applied to the breast image to reduce the range of the gray level distribution in the low frequency background and to enhance the differences in the characteristic features of the gray level histogram for breasts of different densities. Third, rule-based classification is used to classify the breast images into several classes according to the characteristic features of their gray level histogram. For each image, a gray level threshold is automatically determined to segment the dense tissue from the breast region. The area of segmented dense tissue as a percentage of the breast area is then estimated. In this preliminary study, we analyzed the interobserver variation of breast density estimation by two experienced radiologists using BI-RADS lexicon. The radiologists' visually estimated percent breast densities were compared with the computer's calculation. The results demonstrate the feasibility of estimating mammographic breast density using computer vision techniques and its potential to improve the accuracy and reproducibility in comparison with the subjective visual assessment by radiologists.

  5. Impact of health portal enrollment with email reminders on adherence to clinic appointments: a pilot study.

    Science.gov (United States)

    Horvath, Monica; Levy, Janet; L'Engle, Pete; Carlson, Boyd; Ahmad, Asif; Ferranti, Jeffrey

    2011-05-26

    Internet portal technologies that provide access to portions of electronic health records have the potential to revolutionize patients' involvement in their care. However, relatively few descriptions of the demographic characteristics of portal enrollees or of the effects of portal technology on quality outcomes exist. This study examined data from patients who attended one of seven Duke Medicine clinics and who were offered the option of enrolling in and using the Duke Medicine HealthView portal (HVP). The HVP allows patients to manage details of their appointment scheduling and provides automated email appointment reminders in addition to the telephone and mail reminders that all patients receive. Our objective was to test whether portal enrollment with an email reminder functionality is significantly related to decreases in rates of appointment "no-shows," which are known to impair clinic operational efficiency. Appointment activity during a 1-year period was examined for all patients attending one of seven Duke Medicine clinics. Patients were categorized as portal enrollees or as nonusers either by their status at time of appointment or at the end of the 1-year period. Demographic characteristics and no-show rates among these groups were compared. A binomial logistic regression model was constructed to measure the adjusted impact of HVP enrollment on no-show rates, given confounding factors. To demonstrate the effect of HVP use over time, monthly no-show rates were calculated for patient appointment keeping and contrasted between preportal and postportal deployment periods. Across seven clinics, 58,942 patients, 15.7% (9239/58,942) of whom were portal enrollees, scheduled 198,199 appointments with an overall no-show rate of 9.9% (19,668/198,199). We found that HVP enrollees were significantly more likely to be female, white, and privately insured compared with nonusers. Bivariate no-show rate differences between portal enrollment groups varied widely according

  6. Relationship between arterial vascular calcifications seen on screening mammograms and biochemical markers of endothelial injury

    Energy Technology Data Exchange (ETDEWEB)

    Pidal, Diego [Unidad de Investigacion del, Hospital de Jove, Gijon (Spain)], E-mail: dpidal@hotmail.com; Sanchez Vidal, M Teresa [Servicio de Medicina Interna, Hospital de Jove (Spain)], E-mail: medicinainterna@hospitaldejove.com; Rodriguez, Juan Carlos [Unidad de Investigacion del, Hospital de Jove, Gijon (Spain); Servicio de Cirugia General, Hospital de Jove (Spain); Instituto Universitario de Oncologia del Principado de Asturias, Oviedo (Spain)], E-mail: investigacion@hospitaldejove.com; Corte, M Daniela [Unidad de Investigacion del, Hospital de Jove, Gijon (Spain); Instituto Universitario de Oncologia del Principado de Asturias, Oviedo (Spain)], E-mail: mdanielac@hotmail.com; Pravia, Paz [Servicio de Radiodiagnostico, Hospital de Jove (Spain)], E-mail: radiologia@hospitaldejove.com; Guinea, Oscar [Servicio de Radiodiagnostico, Hospital de Jove (Spain)], E-mail: oscarfguinea@seram.org; Pidal, Ivan [Unidad de Investigacion del, Hospital de Jove, Gijon (Spain)], E-mail: ivanpida@hotmail.com; Bongera, Miguel [Unidad de Investigacion del, Hospital de Jove, Gijon (Spain)], E-mail: mbchoppy@hotmail.com; Escribano, Damaso [Servicio de Medicina Interna, Hospital de Jove (Spain)], E-mail: medicinainterna@hospitaldejove.com; Gonzalez, Luis O. [Unidad de Investigacion del, Hospital de Jove, Gijon (Spain)], E-mail: lovidiog@telefonica.net; Diez, M Cruz [Servicio de Cirugia General, Hospital de Jove (Spain)], E-mail: cirugiageneral@hospitaldejove.com; Venta, Rafael [Servicio de Analisis Clinicos, Hospital de San Agustin, Aviles (Spain); Departamento de Bioquimica y Biologia Molecular, Universidad de Oviedo (Spain)], E-mail: rafael.venta@sespa.princast.es; Vizoso, Francisco J. [Unidad de Investigacion del, Hospital de Jove, Gijon (Spain); Servicio de Cirugia General, Hospital de Jove (Spain); Instituto Universitario de Oncologia del Principado de Asturias, Oviedo (Spain)], E-mail: fjvizoso@telefonica.net

    2009-01-15

    To assess whether breast arterial calcifications (BAC) are associated with altered serum markers of cardiovascular risk, mammograms and records from 1759 women (age range: 45-65 years) screened for breast cancer were revised. One hundred and forty seven (8.36%) women showed BAC. A total of 136 women with BAC and controls (mean age: 57 and 55 years, respectively) accepted entering the study. There were no significant differences in serum levels of urea, glucose, uric acid, creatinine, total cholesterol, HDL-C, LDL-C, folic acid, vitamin B{sub 12}, TSH or cysteine, between both groups of patients. However, women with BAC showed higher serum levels of triglycerides (p = 0.006), homocysteine (p = 0.002) and hs-CRP (p = 0.003) than women without BAC. Likewise, we found a significantly higher percentage of cases with an elevated LDL-C/HDL-C ratio (coronary risk index >2) amongst women with BAC than in women without BAC (56.7 and 38.2%, respectively; p = 0.04). Our results indicate that the finding of BAC identify women showing altered serum markers of cardiovascular risk.

  7. Relationship between arterial vascular calcifications seen on screening mammograms and biochemical markers of endothelial injury

    International Nuclear Information System (INIS)

    Pidal, Diego; Sanchez Vidal, M Teresa; Rodriguez, Juan Carlos; Corte, M Daniela; Pravia, Paz; Guinea, Oscar; Pidal, Ivan; Bongera, Miguel; Escribano, Damaso; Gonzalez, Luis O.; Diez, M Cruz; Venta, Rafael; Vizoso, Francisco J.

    2009-01-01

    To assess whether breast arterial calcifications (BAC) are associated with altered serum markers of cardiovascular risk, mammograms and records from 1759 women (age range: 45-65 years) screened for breast cancer were revised. One hundred and forty seven (8.36%) women showed BAC. A total of 136 women with BAC and controls (mean age: 57 and 55 years, respectively) accepted entering the study. There were no significant differences in serum levels of urea, glucose, uric acid, creatinine, total cholesterol, HDL-C, LDL-C, folic acid, vitamin B 12 , TSH or cysteine, between both groups of patients. However, women with BAC showed higher serum levels of triglycerides (p = 0.006), homocysteine (p = 0.002) and hs-CRP (p = 0.003) than women without BAC. Likewise, we found a significantly higher percentage of cases with an elevated LDL-C/HDL-C ratio (coronary risk index >2) amongst women with BAC than in women without BAC (56.7 and 38.2%, respectively; p = 0.04). Our results indicate that the finding of BAC identify women showing altered serum markers of cardiovascular risk

  8. DETECTION OF MICROCALCIFICATION IN DIGITAL MAMMOGRAMS USING ONE DIMENSIONAL WAVELET TRANSFORM

    Directory of Open Access Journals (Sweden)

    T. Balakumaran

    2010-11-01

    Full Text Available Mammography is the most efficient method for breast cancer early detection. Clusters of microcalcifications are the early sign of breast cancer and their detection is the key to improve prognosis of breast cancer. Microcalcifications appear in mammogram image as tiny localized granular points, which is often difficult to detect by naked eye because of their small size. Automatic and accurately detection of microcalcifications has received much more attention from radiologists and physician. An efficient method for automatic detection of clustered microcalcifications in digitized mammograms is the use of Computer Aided Diagnosis (CAD systems. This paper presents a one dimensional wavelet-based multiscale products scheme for microcalcification detection in mammogram images. The detection of microcalcifications were achieved by decomposing the each line of mammograms by 1D wavelet transform into different frequency sub-bands, suppressing the low-frequency subband, and finally reconstructing the mammogram from the subbands containing only significant high frequencies features. The significant features are obtained by multiscale products. Preliminary results indicate that the proposed scheme is better in suppressing the background and detecting the microcalcification clusters than any other wavelet decomposition methods.

  9. Improved Screening Mammogram Workflow by Maximizing PACS Streamlining Capabilities in an Academic Breast Center.

    Science.gov (United States)

    Pham, Ramya; Forsberg, Daniel; Plecha, Donna

    2017-04-01

    The aim of this study was to perform an operational improvement project targeted at the breast imaging reading workflow of mammography examinations at an academic medical center with its associated breast centers and satellite sites. Through careful analysis of the current workflow, two major issues were identified: stockpiling of paperwork and multiple worklists. Both issues were considered to cause significant delays to the start of interpreting screening mammograms. Four workflow changes were suggested (scanning of paperwork, worklist consolidation, use of chat functionality, and tracking of case distribution among trainees) and implemented in July 2015. Timestamp data was collected 2 months before (May-Jun) and after (Aug-Sep) the implemented changes. Generalized linear models were used to analyze the data. The results showed significant improvements for the interpretation of screening mammograms. The average time elapsed for time to open a case reduced from 70 to 28 min (60 % decrease, p workflow for diagnostic mammograms at large unaltered even with increased volume of mammography examinations (31 % increase of 4344 examinations for May-Jun to 5678 examinations for Aug-Sep). In conclusion, targeted efforts to improve the breast imaging reading workflow for screening mammograms in a teaching environment provided significant performance improvements without affecting the workflow of diagnostic mammograms.

  10. Early detection of breast cancer mass lesions by mammogram segmentation images based on texture features

    International Nuclear Information System (INIS)

    Mahmood, F.H.

    2012-01-01

    Mammography is at present one of the available method for early detection of masses or abnormalities which is related to breast cancer.The calcifications. The challenge lies in early and accurate detection to overcome the development of breast cancer that affects more and more women throughout the world. Breast cancer is diagnosed at advanced stages with the help of the digital mammogram images. Masses appear in a mammogram as fine, granular clusters, which are often difficult to identify in a raw mammogram. The incidence of breast cancer in women has increased significantly in recent years. This paper proposes a computer aided diagnostic system for the extraction of features like mass lesions in mammograms for early detection of breast cancer. The proposed technique is based on a four-step procedure: (a) the preprocessing of the image is done, (b) regions of interest (ROI) specification, (c) supervised segmentation method includes two to stages performed using the minimum distance (M D) criterion, and (d) feature extraction based on Gray level Co-occurrence matrices GLC M for the identification of mass lesions. The method suggested for the detection of mass lesions from mammogram image segmentation and analysis was tested over several images taken from A L-llwiya Hospital in Baghdad, Iraq.The proposed technique shows better results.

  11. How supervisors' reminders relate to subordinates' absorption and creativity

    NARCIS (Netherlands)

    Gevers, J.M.P.; Demerouti, E.

    2013-01-01

    Purpose – This study aims to examine supervisors' temporal reminders and subordinates' pacing style as they relate to employees' absorption in work tasks, and subsequently creativity. Design/methodology/approach – The study involved a weekly diary study among 32 employees of an IT-development

  12. Sistem Reminder Donor Darah dengan Memanfaatkan Teknologi Location Based Service

    Directory of Open Access Journals (Sweden)

    Ismail Abdus Shobar

    2016-11-01

    Full Text Available Donor darah merupakan kegiatan kemanusiaan yang bertujuan untuk membantu anggota masyarakat yang membutuhkan darah. Kegiatan donor darah diselenggarakan dan dikelola oleh Palang Merah Indonesia. Menurut catatan Palang Merah Indonesia, secara keseluruhan kebutuhan kantung darah yang tidak terpenuhi melebihi satu juta kantung darah. Untuk itu dibutuhkan peningkatan produksi kantung darah. Salah satu solusi yang dapat dilakukan adalah perancangan suatu sistem informasi geografis (GIS yang memudahkan pendonor untuk mendonorkan darahnya kembali dengan reminder donor darah dan membantu PMI mendapatkan kantung darah. Makalah ini membahas perancangan sistem reminder donor darah dengan menggunakan teknologi location based service. Kemudian untuk menguji sistem, dibuatkan sebuah prototype dengan hasil pengujian sistem menunjukkan bahwa sistem reminder donor darah dapat memudahkan pendonor dalam mendonorkan darahnya kembali sehingga memberikan motivasi bagi pendonor untuk lebih giat dalam mendonorkan darahnya. Sistem ini berpotensi meningkatkan produktivitas PMI dalam mengumpulkan kantong darah sehingga pemenuhan kebutuhan kantung darah masyarakat dapat meningkat yang pada akhirnya dapat menyelamatkan lebih banyak nyawa manusia khususnya di Indonesia. Kata kunci: donor darah, reminder, GIS, location based service.

  13. Computer aided system for segmentation and visualization of microcalcifications in digital mammograms

    International Nuclear Information System (INIS)

    Reljin, B.; Reljin, I.; Milosevic, Z.; Stojic, T.

    2009-01-01

    Two methods for segmentation and visualization of microcalcifications in digital or digitized mammograms are described. First method is based on modern mathematical morphology, while the second one uses the multifractal approach. In the first method, by using an appropriate combination of some morphological operations, high local contrast enhancement, followed by significant suppression of background tissue, irrespective of its radiology density, is obtained. By iterative procedure, this method highly emphasizes only small bright details, possible microcalcifications. In a multifractal approach, from initial mammogram image, a corresponding multifractal 'images' are created, from which a radiologist has a freedom to change the level of segmentation. An appropriate user friendly computer aided visualization (CAV) system with embedded two methods is realized. The interactive approach enables the physician to control the level and the quality of segmentation. Suggested methods were tested through mammograms from MIAS database as a gold standard, and from clinical praxis, using digitized films and digital images from full field digital mammograph. (authors)

  14. Mammogram synthesis using a 3D simulation. I. Breast tissue model and image acquisition simulation

    International Nuclear Information System (INIS)

    Bakic, Predrag R.; Albert, Michael; Brzakovic, Dragana; Maidment, Andrew D. A.

    2002-01-01

    A method is proposed for generating synthetic mammograms based upon simulations of breast tissue and the mammographic imaging process. A computer breast model has been designed with a realistic distribution of large and medium scale tissue structures. Parameters controlling the size and placement of simulated structures (adipose compartments and ducts) provide a method for consistently modeling images of the same simulated breast with modified position or acquisition parameters. The mammographic imaging process is simulated using a compression model and a model of the x-ray image acquisition process. The compression model estimates breast deformation using tissue elasticity parameters found in the literature and clinical force values. The synthetic mammograms were generated by a mammogram acquisition model using a monoenergetic parallel beam approximation applied to the synthetically compressed breast phantom

  15. Global detection approach for clustered microcalcifications in mammograms using a deep learning network.

    Science.gov (United States)

    Wang, Juan; Nishikawa, Robert M; Yang, Yongyi

    2017-04-01

    In computerized detection of clustered microcalcifications (MCs) from mammograms, the traditional approach is to apply a pattern detector to locate the presence of individual MCs, which are subsequently grouped into clusters. Such an approach is often susceptible to the occurrence of false positives (FPs) caused by local image patterns that resemble MCs. We investigate the feasibility of a direct detection approach to determining whether an image region contains clustered MCs or not. Toward this goal, we develop a deep convolutional neural network (CNN) as the classifier model to which the input consists of a large image window ([Formula: see text] in size). The multiple layers in the CNN classifier are trained to automatically extract image features relevant to MCs at different spatial scales. In the experiments, we demonstrated this approach on a dataset consisting of both screen-film mammograms and full-field digital mammograms. We evaluated the detection performance both on classifying image regions of clustered MCs using a receiver operating characteristic (ROC) analysis and on detecting clustered MCs from full mammograms by a free-response receiver operating characteristic analysis. For comparison, we also considered a recently developed MC detector with FP suppression. In classifying image regions of clustered MCs, the CNN classifier achieved 0.971 in the area under the ROC curve, compared to 0.944 for the MC detector. In detecting clustered MCs from full mammograms, at 90% sensitivity, the CNN classifier obtained an FP rate of 0.69 clusters/image, compared to 1.17 clusters/image by the MC detector. These results indicate that using global image features can be more effective in discriminating clustered MCs from FPs caused by various sources, such as linear structures, thereby providing a more accurate detection of clustered MCs on mammograms.

  16. Rapid point-of-care breath test for biomarkers of breast cancer and abnormal mammograms.

    Directory of Open Access Journals (Sweden)

    Michael Phillips

    Full Text Available BACKGROUND: Previous studies have reported volatile organic compounds (VOCs in breath as biomarkers of breast cancer and abnormal mammograms, apparently resulting from increased oxidative stress and cytochrome p450 induction. We evaluated a six-minute point-of-care breath test for VOC biomarkers in women screened for breast cancer at centers in the USA and the Netherlands. METHODS: 244 women had a screening mammogram (93/37 normal/abnormal or a breast biopsy (cancer/no cancer 35/79. A mobile point-of-care system collected and concentrated breath and air VOCs for analysis with gas chromatography and surface acoustic wave detection. Chromatograms were segmented into a time series of alveolar gradients (breath minus room air. Segmental alveolar gradients were ranked as candidate biomarkers by C-statistic value (area under curve [AUC] of receiver operating characteristic [ROC] curve. Multivariate predictive algorithms were constructed employing significant biomarkers identified with multiple Monte Carlo simulations and cross validated with a leave-one-out (LOO procedure. RESULTS: Performance of breath biomarker algorithms was determined in three groups: breast cancer on biopsy versus normal screening mammograms (81.8% sensitivity, 70.0% specificity, accuracy 79% (73% on LOO [C-statistic value], negative predictive value 99.9%; normal versus abnormal screening mammograms (86.5% sensitivity, 66.7% specificity, accuracy 83%, 62% on LOO; and cancer versus no cancer on breast biopsy (75.8% sensitivity, 74.0% specificity, accuracy 78%, 67% on LOO. CONCLUSIONS: A pilot study of a six-minute point-of-care breath test for volatile biomarkers accurately identified women with breast cancer and with abnormal mammograms. Breath testing could potentially reduce the number of needless mammograms without loss of diagnostic sensitivity.

  17. Reducing drug–herb interaction risk with a computerized reminder system

    Science.gov (United States)

    Lin, Sheng-Shing; Tsai, Chiu-Lin; Tu, Ching-Yeh; Hsieh, Ching-Liang

    2015-01-01

    Background Traditional Chinese medicine (TCM) and Western medicine are both popular in Taiwan. Approximately 14.1% of Taiwanese residents use Western drugs and Chinese herbs concurrently; therefore, drug–herb interaction is critical to patient safety. This paper presents a new procedure for reducing the risk of drug interactions. Methods Hospital computer systems are modified to ensure that drug–herb interactions are automatically detected when a TCM practitioner is writing a prescription. A pop-up reminder appears, warning of interactions, and the practitioner may adjust doses, delete herbs, or leave the prescription unchanged. A pharmacist will receive interaction information through the system and provide health education to the patient. Results During the 2011–2013 study period, 256 patients received 891 herbal prescriptions with potential drug–herb interactions. Three of the 50 patients who concurrently used ginseng and antidiabetic drugs manifested hypoglycemia (fasting blood sugar level ≤70 mg/dL). Conclusion Drug–herb interactions can cause adverse reactions. A computerized reminder system can enable TCM practitioners to reduce the risk of drug–herb interactions. In addition, health education for patients is crucial in avoiding adverse reaction by the interactions. PMID:25733840

  18. Volumetric Mammogram Assessment: A Helpful Tool in the Treatment of Breast Asymmetries.

    Science.gov (United States)

    Zimman, Oscar A; Butto, Carlos D; Rostagno, Román; Rostagno, Camila

    2017-12-01

    The surgical approach to breast asymmetry depends on several factors, including the surgeon's experience, the anatomy of the patient, and several methods that may help to choose a technique and define the size of the implant or the amount of breast tissue to be excised. The aim of this study is to assist in evaluation of breast volumes with the Quantra™ software application, intended for use with Hologic™ digital mammography systems. Twenty-eight women were studied with full-field digital mammography (FFDM) with the Quantra™ software application, for use with Hologic™ digital mammography systems preoperatively. The case diagnoses were as follows: breast hypertrophy, ptosis, hypoplasia, and reconstruction, and the surgeries included breast reduction, mastopexy, mastopexy and breast reduction, mastoplasty and breast augmentation, breast augmentation, and immediate or delayed breast reconstruction. Patients were evaluated from 6 to 18 months after surgery. Volumetric mammogram studies help to decide the amount of tissue to be excised, the size of the implants, and the combination of both. The results of this study were evaluated by surgeons and patients and found to be highly satisfactory. The use of full-field digital mammography with adequate software should be considered as another tool to assist in making decisions regarding the correction of breast asymmetries. Level of Evidence IV This journal requires that authors assign a level of evidence to each article. For a full description of these Evidence-Based Medicine ratings, please refer to the Table of Contents or the online Instructions to Authors www.springer.com/00266 .

  19. The effect of reminders in a web-based intervention study

    DEFF Research Database (Denmark)

    Svensson, M.; Svensson, T.; Hansen, A. W.

    2012-01-01

    Knowledge on effective strategies to encourage participation in epidemiological web-based research is scant. We studied the effects of reminders on overall participation. 3,876 employees were e-mailed a baseline web-based lifestyle questionnaire. Nine months later, a follow-up questionnaire...... was sent. To encourage study participation, 4-5 and 11 e-mail reminders were sent at baseline and follow-up, respectively. Additional reminders (media articles, flyers, SMS etc) were also administered. Reminders (e-mails + additional) were given in low (a parts per thousand currency sign6 reminders......). About 29 % responded before any e-mail reminder, following 26 and 45 % after 1 respective a parts per thousand yen 2 e-mail reminders. Participant characteristics were not related to when the participants responded. The 4-5 e-mail reminders increased total response rate by 15 %, the eleven by 21...

  20. MEDication reminder APPs to improve medication adherence in Coronary Heart Disease (MedApp-CHD) Study: a randomised controlled trial protocol.

    Science.gov (United States)

    Santo, Karla; Chow, Clara K; Thiagalingam, Aravinda; Rogers, Kris; Chalmers, John; Redfern, Julie

    2017-10-08

    The growing number of smartphone health applications available in the app stores makes these apps a promising tool to help reduce the global problem of non-adherence to long-term medications. However, to date, there is limited evidence that available medication reminder apps are effective. This study aims to determine the impact of medication reminder apps on adherence to cardiovascular medication when compared with usual care for people with coronary heart disease (CHD) and to determine whether an advanced app compared with a basic app is associated with higher adherence. Randomised controlled trial with follow-up at 3 months to evaluate the feasibility and effectiveness of medication reminder apps on medication adherence compared with usual care. An estimated sample size of 156 patients with CHD will be randomised to one of three groups (usual care group, basic medication reminder app group and advanced medication reminder app group). The usual care group will receive standard care for CHD with no access to a medication reminder app. The basic medication reminder app group will have access to a medication reminder app with a basic feature of providing simple daily reminders with no interactivity. The advanced medication reminder app group will have access to a medication reminder app with additional interactive and customisable features. The primary outcome is medication adherence measured by the eight-item Morisky Medication Adherence Scale at 3 months. Secondary outcomes include clinical measurements of blood pressure and cholesterol levels, and medication knowledge. A process evaluation will also be performed to assess the feasibility of the intervention by evaluating the acceptability, utility and engagement with the apps. Ethical approval has been obtained from the Western Sydney Local Health Network Human Research Ethics Committee (AU/RED/HREC/1/WMEAD/3). Study findings will be disseminated via usual scientific forums. ACTRN12616000661471; Pre-results.

  1. Image quality of a wet laser printer versus a paper printer for full-field digital mammograms.

    Science.gov (United States)

    Schueller, Gerd; Kaindl, Elisabeth; Matzek, Wolfgang K; Semturs, Friedrich; Schueller-Weidekamm, Claudia; Helbich, Thomas H

    2006-01-01

    The purpose of our study was to compare the image quality of a wet laser printer with that of a paper printer for full-field digital mammography (FFDM). For both a wet laser printer and a paper printer connected to an FFDM system, image quality parameters were evaluated using a standardized printer test image (luminance density, dynamic range). The detectability of standardized objects on a phantom was also evaluated. Furthermore, 640 mammograms of 80 patients with different breast tissue composition patterns were imaged with both printers. Subjective image quality parameters (brightness, contrast, and detection of details of anatomic structures-that is, skin, subcutis, musculature, glandular tissue, and fat), the detectability of breast lesions (mass, calcifications), and the diagnostic performance according to the BI-RADS classification were evaluated. Both the luminance density and the dynamic range were superior for the wet laser printer. More standardized objects were visible on the phantom imaged with the wet laser printer than with the paper printer (13/16 vs 11/16). Each subjective image quality parameter of the mammograms from the wet laser printer was rated superior to those of the paper printer. Significantly more breast lesions were detected on the wet laser printer images than on the paper printer images (masses, 13 vs 10; calcifications, 65 vs 48; p printer images, BI-RADS 4 and 5 categories were underestimated for 10 (43.5%) of 23 patients. For FFDM, images obtained from a wet laser printer show superior objective and subjective image quality compared with a paper printer. As a consequence, the paper printer should not be used for FFDM.

  2. Comparison Between Digital and Synthetic 2D Mammograms in Breast Density Interpretation.

    Science.gov (United States)

    Alshafeiy, Taghreed I; Wadih, Antoine; Nicholson, Brandi T; Rochman, Carrie M; Peppard, Heather R; Patrie, James T; Harvey, Jennifer A

    2017-07-01

    The purpose of this study was to compare assessments of breast density on synthetic 2D images as compared with digital 2D mammograms. This retrospective study included consecutive women undergoing screening with digital 2D mammography and tomosynthesis during May 2015 with a negative or benign outcome. In separate reading sessions, three radiologists with 5-25 years of clinical experience and 1 year of experience with synthetic 2D mammography read digital 2D and synthetic 2D images and assigned breast density categories according to the 5th edition of BI-RADS. Inter- and intrareader agreement was assessed for each BI-RADS density assessment and combined dense and nondense categories using percent agreement and Cohen kappa coefficient for consensus and all reads. A total of 309 patients met study inclusion criteria. Agreement between consensus BI-RADS density categories assigned for digital and synthetic 2D mammography was 80.3% (95% CI, 75.4-84.5%) with κ = 0.73 (95% CI, 0.66-0.79). For combined dense and nondense categories, agreement reached 91.9% (95% CI, 88.2-94.7%). For consensus readings, similar numbers of patients were shifted between nondense and dense categories (11 and 14, respectively) with the synthetic 2D compared with digital 2D mammography. Interreader differences were apparent; assignment to dense categories was greater with digital 2D mammography for reader 1 (odds ratio [OR], 1.26; p = 0.002), the same for reader 2 (OR, 0.91; p = 0.262), and greater with synthetic 2D mammography for reader 3 (OR, 0.86; p = 0.033). Overall, synthetic 2D mammography is comparable with digital 2D mammography in assessment of breast density, though there is some variability by reader. Practices can readily adopt synthetic 2D mammography without concern that it will affect density assessment and subsequent recommendations for supplemental screening.

  3. Inhaler Reminders Significantly Improve Asthma Patients' Use of Controller Medications

    Science.gov (United States)

    ... Conditions Drug Guide Conditions Dictionary Just for Kids Library School Tools Videos Virtual Allergist Education & Training Careers in ... Support the AAAAI Foundation Donate Utility navigation Español Journals Annual Meeting Member Login / My Membership Search navigation ...

  4. Forgetting, reminding, and remembering: the retrieval of lost spatial memory.

    Directory of Open Access Journals (Sweden)

    Livia de Hoz

    2004-08-01

    Full Text Available Retrograde amnesia can occur after brain damage because this disrupts sites of storage, interrupts memory consolidation, or interferes with memory retrieval. While the retrieval failure account has been considered in several animal studies, recent work has focused mainly on memory consolidation, and the neural mechanisms responsible for reactivating memory from stored traces remain poorly understood. We now describe a new retrieval phenomenon in which rats' memory for a spatial location in a watermaze was first weakened by partial lesions of the hippocampus to a level at which it could not be detected. The animals were then reminded by the provision of incomplete and potentially misleading information-an escape platform in a novel location. Paradoxically, both incorrect and correct place information reactivated dormant memory traces equally, such that the previously trained spatial memory was now expressed. It was also established that the reminding procedure could not itself generate new learning in either the original environment, or in a new training situation. The key finding is the development of a protocol that definitively distinguishes reminding from new place learning and thereby reveals that a failure of memory during watermaze testing can arise, at least in part, from a disruption of memory retrieval.

  5. An abnormal screening mammogram causes more anxiety than a palpable lump in benign breast disease

    NARCIS (Netherlands)

    Keyzer-Dekker, C. M. G.; van Esch, L.; de Vries, J.; Ernst, Marloes; Nieuwenhuijzen, G. A. P.; Roukema, J. A.; van der Steeg, A. F. W.

    Being recalled for further diagnostic procedures after an abnormal screening mammogram (ASM) can evoke a high state anxiety with lowered quality of life (QoL). We examined whether these adverse psychological consequences are found in all women with benign breast disease (BBD) or are particular to

  6. Noise equalization for detection of microcalcification clusters in direct digital mammogram images.

    NARCIS (Netherlands)

    McLoughlin, K.J.; Bones, P.J.; Karssemeijer, N.

    2004-01-01

    Equalizing image noise is shown to be an important step in the automatic detection of microcalcifications in digital mammography. This study extends a well established film-screen noise equalization scheme developed by Veldkamp et al. for application to full-field digital mammogram (FFDM) images. A

  7. New Embedded Denotes Fuzzy C-Mean Application for Breast Cancer Density Segmentation in Digital Mammograms

    Science.gov (United States)

    Othman, Khairulnizam; Ahmad, Afandi

    2016-11-01

    In this research we explore the application of normalize denoted new techniques in advance fast c-mean in to the problem of finding the segment of different breast tissue regions in mammograms. The goal of the segmentation algorithm is to see if new denotes fuzzy c- mean algorithm could separate different densities for the different breast patterns. The new density segmentation is applied with multi-selection of seeds label to provide the hard constraint, whereas the seeds labels are selected based on user defined. New denotes fuzzy c- mean have been explored on images of various imaging modalities but not on huge format digital mammograms just yet. Therefore, this project is mainly focused on using normalize denoted new techniques employed in fuzzy c-mean to perform segmentation to increase visibility of different breast densities in mammography images. Segmentation of the mammogram into different mammographic densities is useful for risk assessment and quantitative evaluation of density changes. Our proposed methodology for the segmentation of mammograms on the basis of their region into different densities based categories has been tested on MIAS database and Trueta Database.

  8. Mapping 3D breast lesions from full-field digital mammograms using subject-specific finite element models

    Science.gov (United States)

    García, E.; Oliver, A.; Diaz, O.; Diez, Y.; Gubern-Mérida, A.; Martí, R.; Martí, J.

    2017-03-01

    Patient-specific finite element (FE) models of the breast have received increasing attention due to the potential capability of fusing images from different modalities. During the Magnetic Resonance Imaging (MRI) to X-ray mammography registration procedure, the FE model is compressed mimicking the mammographic acquisition. Subsequently, suspicious lesions in the MRI volume can be projected into the 2D mammographic space. However, most registration algorithms do not provide the reverse information, avoiding to obtain the 3D geometrical information from the lesions localized in the mammograms. In this work we introduce a fast method to localize the 3D position of the lesion within the MRI, using both cranio-caudal (CC) and medio-lateral oblique (MLO) mammographic projections, indexing the tetrahedral elements of the biomechanical model by means of an uniform grid. For each marked lesion in the Full-Field Digital Mammogram (FFDM), the X-ray path from source to the marker is calculated. Barycentric coordinates are computed in the tetrahedrons traversed by the ray. The list of elements and coordinates allows to localize two curves within the MRI and the closest point between both curves is taken as the 3D position of the lesion. The registration errors obtained in the mammographic space are 9.89 +/- 3.72 mm in CC- and 8.04 +/- 4.68 mm in MLO-projection and the error in the 3D MRI space is equal to 10.29 +/- 3.99 mm. Regarding the uniform grid, it is computed spending between 0.1 and 0.7 seconds. The average time spent to compute the 3D location of a lesion is about 8 ms.

  9. Computer-aided classification of breast masses using contrast-enhanced digital mammograms

    Science.gov (United States)

    Danala, Gopichandh; Aghaei, Faranak; Heidari, Morteza; Wu, Teresa; Patel, Bhavika; Zheng, Bin

    2018-02-01

    By taking advantages of both mammography and breast MRI, contrast-enhanced digital mammography (CEDM) has emerged as a new promising imaging modality to improve efficacy of breast cancer screening and diagnosis. The primary objective of study is to develop and evaluate a new computer-aided detection and diagnosis (CAD) scheme of CEDM images to classify between malignant and benign breast masses. A CEDM dataset consisting of 111 patients (33 benign and 78 malignant) was retrospectively assembled. Each case includes two types of images namely, low-energy (LE) and dual-energy subtracted (DES) images. First, CAD scheme applied a hybrid segmentation method to automatically segment masses depicting on LE and DES images separately. Optimal segmentation results from DES images were also mapped to LE images and vice versa. Next, a set of 109 quantitative image features related to mass shape and density heterogeneity was initially computed. Last, four multilayer perceptron-based machine learning classifiers integrated with correlationbased feature subset evaluator and leave-one-case-out cross-validation method was built to classify mass regions depicting on LE and DES images, respectively. Initially, when CAD scheme was applied to original segmentation of DES and LE images, the areas under ROC curves were 0.7585+/-0.0526 and 0.7534+/-0.0470, respectively. After optimal segmentation mapping from DES to LE images, AUC value of CAD scheme significantly increased to 0.8477+/-0.0376 (pbreast tissue on lesions, segmentation accuracy was significantly improved as compared to regular mammograms, the study demonstrated that computer-aided classification of breast masses using CEDM images yielded higher performance.

  10. Cancer on a mammogram is not memorable: readers remember their recalls and not cancers

    International Nuclear Information System (INIS)

    Pitman, Alexander G.; Kok, Phebe; Zentner, Lucila

    2012-01-01

    To determine if presence of cancer on a mammogram makes that mammogram more memorable. A total of 100 mammograms (25 cancers) were grouped into 5 sets of 20 cases. Set pairs were presented in five reads to eight radiologist readers. Readers were asked to 'clear' or 'call back' cases, and at post-baseline reads to indicate whether each case was 'new' or 'old ' (remembered from prior read). Two sets were presented only at baseline, to calculate each reader's false recollection rate. For cases presented more than once ('old' cases, 100 presentations) readers could have 'correct memory' or 'memory loss'. Memory performance was defined as odds ratio of correct memory to memory loss. Multivariate logistic data regression analysis identified predictors of memory performance from: reader, set, time since last read, presence of cancer, and whether the case was called back at the last read. Memory performance differed markedly between readers and reader identity was a highly significant predictor of memory performance. Presence of cancer was not a significant predictor of memory performance (odds ratio 0.77, 95% CI: 0.49–1.21). Whether the case was called back at the last read was a highly significant predictor (odds ratio 4.22, 95% CI: 2.70–6.61) for the model incorporating reader variability, and also the model without reader variability (odds ratio 2.67, 95% CI: 1.74–4.08). The only statistically significant predictor of radiologist memory for a mammogram was whether the radiologist 'called it back' at a prior reading round. Presence of cancer on a mammogram did not make it memorable.

  11. Influenza vaccine text message reminders for urban, low-income pregnant women: a randomized controlled trial.

    Science.gov (United States)

    Stockwell, Melissa S; Westhoff, Carolyn; Kharbanda, Elyse Olshen; Vargas, Celibell Y; Camargo, Stewin; Vawdrey, David K; Castaño, Paula M

    2014-02-01

    We evaluated the impact of influenza vaccine text message reminders in a low-income obstetric population. We conducted a randomized controlled trial that enrolled 1187 obstetric patients from 5 community-based clinics in New York City. The intervention group received 5 weekly text messages regarding influenza vaccination starting mid-September 2011 and 2 text message appointment reminders. Both groups received standard automated telephone appointment reminders. The prespecified endpoints were receipt of either pre- or postpartum influenza vaccination calculated cumulatively at the end of each month (September-December 2011). After adjusting for gestational age and number of clinic visits, women who received the intervention were 30% more likely to be vaccinated as of December 2011 (adjusted odds ratio [AOR] = 1.30; 95% confidence interval [CI] = 1.003, 1.69 end of September: AOR = 1.34; 95% CI = 0.98, 1.85; October: AOR = 1.35; 95% CI = 1.05, 1.75; November: AOR = 1.27; 95% CI = 0.98, 1.65). The subgroup of women early in the third trimester at randomization showed the greatest intervention effect (December 31: 61.9% intervention vs 49.0% control; AOR = 1.88; 95% CI = 1.12, 3.15). In this low-income obstetric population, text messaging was associated with increased influenza vaccination, especially in those who received messages early in their third trimester.

  12. Design of an Electronic Reminder System for Supporting the Integerity of Nursing Records.

    Science.gov (United States)

    Chen, Chien-Min; Hou, I-Ching; Chen, Hsiao-Ping; Weng, Yung-Ching

    2016-01-01

    The integrity of electronic nursing records (ENRs) stands for the quality of medical records. But patients' conditions are varied (e.g. not every patient had wound or need fall prevention), to achieve the integrity of ENRs depends much on clinical nurses' attention. Our study site, an one 2,300-bed hospital in northern Taiwan, there are a total of 20 ENRs including nursing assessments, nursing care plan, discharge planning etc. implemented in the whole hospital before 2014. It become important to help clinical nurses to decrease their human recall burden to complete these records. Thus, the purpose of this study was to design an ENRs reminder system (NRS) to facilitate nursing recording process. The research team consisted of an ENR engineer, a clinical head nurse and a nursing informatics specialist began to investigate NRS through three phases (e.g. information requirements; design and implementation). In early 2014, a qualitative research method was used to identify NRS information requirements through both groups (e.g. clinical nurses and their head nurses) focus interviews. According to the their requirements, one prototype was created by the nursing informatics specialist. Then the engineer used Microsoft Visual Studio 2012, C#, and Oracle to designed a web-based NRS (Figure 1). Then the integrity reminder system which including a total of twelve electronic nursing records was designed and the preliminary accuracy validation of the system was 100%. NRS could be used to support nursing recording process and prepared for implementing in the following phase.

  13. A longitudinal study of psychological distress and exposure to trauma reminders after terrorism.

    Science.gov (United States)

    Glad, Kristin A; Hafstad, Gertrud S; Jensen, Tine K; Dyb, Grete

    2017-08-01

    The aim of this study was threefold: (1) to examine the type and frequency of trauma reminders reported by survivors 2.5 years after a terrorist attack; (2) to examine whether frequency of exposure to trauma reminders is associated with psychological distress and level of functioning; and (3) to compare the worst trauma reminders reported by the same survivors at 2 different time points. Participants were 261 survivors (52.1% male; Mage = 22.1 years, SD = 4.76) of the 2011 massacre on Utøya Island, Norway, who were interviewed face-to-face 14-15 and 30-32 months postterror. Participants were asked how often they had experienced various trauma reminders in the past month, which reminder was the worst, and how distressing it was. Current posttraumatic reactions were measured using the University of California at Los Angeles PTSD Reaction Index and an 8-item version of the Hopkins Symptom Checklist-25. Auditory reminders were most frequently encountered and the most distressing. Frequency of exposure to trauma reminders was positively correlated with symptoms of posttraumatic stress disorder (PTSD), anxiety, and depression, as well as negatively correlated with level of functioning, over time. Almost 20% of the survivors reported being very distressed by their worst reminder 2.5 years postterror. Less than half reported the same worst reminder at both time points. Trauma reminders, especially auditory reminders, are prevalent and distressing for years after a terrorist attack. Exposure to reminders may be important not only in the development and maintenance of PTSD but also in a broader conceptualization of posttraumatic reactions and functioning. Which reminder survivors appraise as the worst may fluctuate over time. It is important to help survivors identify and cope with reminders. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  14. Supporting adherence to antiretroviral therapy with mobile phone reminders: results from a cohort in South India.

    Directory of Open Access Journals (Sweden)

    Rashmi Rodrigues

    Full Text Available BACKGROUND: Adherence is central to the success of antiretroviral therapy. Supporting adherence has gained importance in HIV care in many national treatment programs. The ubiquity of mobile phones, even in resource-constrained settings, has provided an opportunity to utilize an inexpensive, contextually feasible technology for adherence support in HIV in these settings. We aimed to assess the influence of mobile phone reminders on adherence to antiretroviral therapy in South India. Participant experiences with the intervention were also studied. This is the first report of such an intervention for antiretroviral adherence from India, a country with over 800 million mobile connections. METHODS: STUDY DESIGN: Quasi-experimental cohort study involving 150 HIV-infected individuals from Bangalore, India, who were on antiretroviral therapy between April and July 2010. The intervention: All participants received two types of adherence reminders on their mobile phones, (i an automated interactive voice response (IVR call and (ii A non-interactive neutral picture short messaging service (SMS, once a week for 6 months. Adherence measured by pill count, was assessed at study recruitment and at months one, three, six, nine and twelve. Participant experiences were assessed at the end of the intervention period. RESULTS: The mean age of the participants was 38 years, 27% were female and 90% urban. Overall, 3,895 IVRs and 3,073 SMSs were sent to the participants over 6 months. Complete case analysis revealed that the proportion of participants with optimal adherence increased from 85% to 91% patients during the intervention period, an effect that was maintained 6 months after the intervention was discontinued (p = 0.016. Both, IVR calls and SMS reminders were considered non-intrusive and not a threat to privacy. A significantly higher proportion agreed that the IVR was helpful compared to the SMS (p<0.001. CONCLUSION: Mobile phone reminders may improve

  15. Text messaging reminders for influenza vaccine in primary care: protocol for a cluster randomised controlled trial (TXT4FLUJAB).

    Science.gov (United States)

    Herrett, Emily; van Staa, Tjeerd; Free, Caroline; Smeeth, Liam

    2014-05-02

    The UK government recommends that at least 75% of people aged under 64 with certain conditions receive an annual influenza vaccination. Primary care practices often fall short of this target and strategies to increase vaccine uptake are required. Text messaging reminders are already used in 30% of practices to remind patients about vaccination, but there has been no trial addressing their effectiveness in increasing influenza vaccine uptake in the UK. The aims of the study are (1) to develop the methodology for conducting cluster randomised trials of text messaging interventions utilising routine electronic health records and (2) to assess the effectiveness of using a text messaging influenza vaccine reminder in achieving an increase in influenza vaccine uptake in patients aged 18-64 with chronic conditions, compared with standard care. This cluster randomised trial will recruit general practices across three settings in English primary care (Clinical Practice Research Datalink, ResearchOne and London iPLATO text messaging software users) and randomise them to either standard care or a text messaging campaign to eligible patients. Flu vaccine uptake will be ascertained using routinely collected, anonymised electronic patient records. This protocol outlines the proposed study design and analysis methods. This study will determine the effectiveness of text messaging vaccine reminders in primary care in increasing influenza vaccine uptake, and will strengthen the methodology for using electronic health records in cluster randomised trials of text messaging interventions. This trial was approved by the Surrey Borders Ethics Committee (13/LO/0872). The trial results will be disseminated at national conferences and published in a peer-reviewed medical journal. The results will also be distributed to the Primary Care Research Network and to all participating general practices. This study is registered at controlled-trials.com ISRCTN48840025, July 2013.

  16. The Free and Cued Selective Reminding Test: Pictures vs. Words

    OpenAIRE

    Pettit, Annabel

    2013-01-01

    The present study tested a group of young (18-25) and old (>60) healthy adults to examine whether a pictorial superiority effect influences performance in the free and cued selective reminding test (FCSRT). 81 participants were recruited and performed the ACE-R, TOPF and FCSRT. Stimulus items for the FCSRT consisted of either 16 line drawings (in the picture form) or 16 written words (in the word form). The design was completely-between subjects and the form of test was fully counterbalanced...

  17. REMINDER : deadline for submission of reimbursements claims to UNIQA

    CERN Multimedia

    HR Department

    2011-01-01

    We would like to remind you of the resolution which took effect from 1 June 2010 changing the deadline for submitting a claim from 24 months to 12 months from the invoice date (as opposed to from the time of treatment). As a transitional measure, it is still possible to submit invoices issued prior to 1 June 2010 as long as they do not date back to more than two years (from the invoice date) at the time of submission. The deadline for transitional claims is 31 May 2011. You are advised to check any outstanding submissions that you have since, as from 1 June 2011, no transitional claims will be accepted.  

  18. Low energy mammogram obtained in contrast-enhanced digital mammography (CEDM) is comparable to routine full-field digital mammography (FFDM)

    Energy Technology Data Exchange (ETDEWEB)

    Francescone, Mark A., E-mail: maf2184@columbia.edu [Columbia University Medical Center, ColumbiaDoctors Midtown, 51 West 51st Street, Suite 300, New York, NY 10019 (United States); Jochelson, Maxine S., E-mail: jochelsm@mskcc.org [Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Dershaw, D. David, E-mail: dershawd@mskcc.org [Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Sung, Janice S., E-mail: sungj@mskcc.org [Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Hughes, Mary C., E-mail: hughesm@mskcc.org [Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Zheng, Junting, E-mail: zhengj@mskcc.org [Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Moskowitz, Chaya, E-mail: moskowc1@mskcc.org [Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Morris, Elizabeth A., E-mail: morrise@mskcc.org [Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States)

    2014-08-15

    Purpose: Contrast enhanced digital mammography (CEDM) uses low energy and high energy exposures to produce a subtracted contrast image. It is currently performed with a standard full-field digital mammogram (FFDM). The purpose is to determine if the low energy image performed after intravenous iodine injection can replace the standard FFDM. Methods: And Materials: In an IRB approved HIPAA compatible study, low-energy CEDM images of 170 breasts in 88 women (ages 26–75; mean 50.3) undergoing evaluation for elevated risk or newly diagnosed breast cancer were compared to standard digital mammograms performed within 6 months. Technical parameters including posterior nipple line (PNL) distance, compression thickness, and compression force on the MLO projection were compared. Mammographic findings were compared qualitatively and quantitatively. Mixed linear regression using generalized estimating equation (GEE) method was performed. Intraclass correlation coefficients (ICC) with 95% confidence interval (95%CI) were estimated to assess agreement. Results: No statistical difference was found in the technical parameters compression thickness, PNL distance, compression force (p-values: 0.767, 0.947, 0.089). No difference was found in the measured size of mammographic findings (p-values 0.982–0.988). Grouped calcifications had a mean size/extent of 2.1 cm (SD 0.6) in the low-energy contrast images, and a mean size/extent of 2.2 cm (SD 0.6) in the standard digital mammogram images. Masses had a mean size of 1.8 cm (SD 0.2) in both groups. Calcifications were equally visible on both CEDM and FFDM. Conclusion: Low energy CEDM images are equivalent to standard FFDM despite the presence of intravenous iodinated contrast. Low energy CEDM images may be used for interpretation in place of the FFDM, thereby reducing patient dose.

  19. Low energy mammogram obtained in contrast-enhanced digital mammography (CEDM) is comparable to routine full-field digital mammography (FFDM)

    International Nuclear Information System (INIS)

    Francescone, Mark A.; Jochelson, Maxine S.; Dershaw, D. David; Sung, Janice S.; Hughes, Mary C.; Zheng, Junting; Moskowitz, Chaya; Morris, Elizabeth A.

    2014-01-01

    Purpose: Contrast enhanced digital mammography (CEDM) uses low energy and high energy exposures to produce a subtracted contrast image. It is currently performed with a standard full-field digital mammogram (FFDM). The purpose is to determine if the low energy image performed after intravenous iodine injection can replace the standard FFDM. Methods: And Materials: In an IRB approved HIPAA compatible study, low-energy CEDM images of 170 breasts in 88 women (ages 26–75; mean 50.3) undergoing evaluation for elevated risk or newly diagnosed breast cancer were compared to standard digital mammograms performed within 6 months. Technical parameters including posterior nipple line (PNL) distance, compression thickness, and compression force on the MLO projection were compared. Mammographic findings were compared qualitatively and quantitatively. Mixed linear regression using generalized estimating equation (GEE) method was performed. Intraclass correlation coefficients (ICC) with 95% confidence interval (95%CI) were estimated to assess agreement. Results: No statistical difference was found in the technical parameters compression thickness, PNL distance, compression force (p-values: 0.767, 0.947, 0.089). No difference was found in the measured size of mammographic findings (p-values 0.982–0.988). Grouped calcifications had a mean size/extent of 2.1 cm (SD 0.6) in the low-energy contrast images, and a mean size/extent of 2.2 cm (SD 0.6) in the standard digital mammogram images. Masses had a mean size of 1.8 cm (SD 0.2) in both groups. Calcifications were equally visible on both CEDM and FFDM. Conclusion: Low energy CEDM images are equivalent to standard FFDM despite the presence of intravenous iodinated contrast. Low energy CEDM images may be used for interpretation in place of the FFDM, thereby reducing patient dose

  20. Analysis and comparison of breast density according to age on mammogram between Korean and Western women

    International Nuclear Information System (INIS)

    Kim, Seung Hyung; Kim, Mi Hye; Oh, Ki Keun

    2000-01-01

    To compare changes in breast parenchymal density among diverse age groups in asymptomatic Korean women with those of Western women, and to evaluate the effect of different patterns of breast parenchymal density on the sensitivity of screening mammography in Korean women. We analyzed the distribution of breast parenchymal density among diverse age groups in 823 asymptomatic Korean women aged 30-64 who underwent screening mammography between January and December 1998. On the basis of ACR BI-RADS breast composition, four density patterns were designated: patterns 1 and 2 related to fatty mammograms, and patterns 3 and 4 to dense mammograms. We compared the results with those for western women. In Korean women, the frequency of dense mammogram was 88.1% (30-34 years old), 91.1% (35-39), 78.3% (40-44), 61.1% (45-49), 30.1% (50-54), 21.1% (55-59), and 7.0% (60-64). Korean women in their 40s thus showed a higher frequency of dense mammograms, but this frequency decreased abruptly between the ages of 40 and 54. In Western women, however, there was little difference between 40 and 54-year-olds: the figures were 47.2% (40-44 years), 44.8% (45-49), and 44.4% (50-54). Because the frequency of their dense mammograms shows little change between Western women in their forties and in their fifties, it is clear that between these two age groups, mammographic sensitivity is only slightly different. Because the frequency of dense mammograms is much greater among Korean women in their forties than among Western women of the same age, and among korean women this frequency decreases abruptly, it appears, however, that the mammographic sensitivity of korean women is less among those in their forties than among those in their fifties. It is therefore thought that mammography combined with ultrasonography may increase screening sensitivity among Korean women under 50, who have a relatively higher incidence of breast cancer in the younger age groups than do Western women. (author)

  1. Reducing drug–herb interaction risk with a computerized reminder system

    Directory of Open Access Journals (Sweden)

    Lin SS

    2015-02-01

    Full Text Available Sheng-Shing Lin,1,2 Chiu-Lin Tsai,3 Ching-Yeh Tu,3 Ching-Liang Hsieh2,4,5 1Graduate Institute of Chinese Medicine, College of Chinese Medicine, China Medical University, 2Department of Chinese Medicine, China Medical University Hospital, 3Division of Chinese Medicine, Department of Pharmacy, China Medical University Hospital, 4Graduate Institute of Integrated Medicine, College of Chinese Medicine, China Medical University, 5Research Center for Chinese Medicine and Acupuncture, China Medical University, Taichung, Taiwan Background: Traditional Chinese medicine (TCM and Western medicine are both popular in Taiwan. Approximately 14.1% of Taiwanese residents use Western drugs and Chinese herbs concurrently; therefore, drug–herb interaction is critical to patient safety. This paper presents a new procedure for reducing the risk of drug interactions.Methods: Hospital computer systems are modified to ensure that drug–herb interactions are automatically detected when a TCM practitioner is writing a prescription. A pop-up reminder appears, warning of interactions, and the practitioner may adjust doses, delete herbs, or leave the prescription unchanged. A pharmacist will receive interaction information through the system and provide health education to the patient.Results: During the 2011–2013 study period, 256 patients received 891 herbal prescriptions with potential drug–herb interactions. Three of the 50 patients who concurrently used ginseng and antidiabetic drugs manifested hypoglycemia (fasting blood sugar level ≤70 mg/dL.Conclusion: Drug–herb interactions can cause adverse reactions. A computerized reminder system can enable TCM practitioners to reduce the risk of drug–herb interactions. In addition, health education for patients is crucial in avoiding adverse reaction by the interactions. Keywords: Traditional Chinese medicine, Western medicine, adverse reaction

  2. A randomized trial of the effect of centralized reminder/recall on immunizations and preventive care visits for adolescents.

    Science.gov (United States)

    Szilagyi, Peter G; Albertin, Christina; Humiston, Sharon G; Rand, Cynthia M; Schaffer, Stanley; Brill, Howard; Stankaitis, Joseph; Yoo, Byung-Kwang; Blumkin, Aaron; Stokley, Shannon

    2013-01-01

    To assess the impact of a managed care-based patient reminder/recall system on immunization rates and preventive care visits among low-income adolescents. We conducted a randomized controlled trial between December 2009 and December 2010 that assigned adolescents aged 11-17 years to one of three groups: mailed letter, telephone reminders, or control. Publicly insured youths (n = 4115) were identified in 37 participating primary care practices. The main outcome measures were immunization rates for routine vaccines (meningococcus, pertussis, HPV) and preventive visit rates at study end. Intervention and control groups were similar at baseline for demographics, immunization rates, and preventive visits. Among adolescents who were behind at the start, immunization rates at study end increased by 21% for mailed (P immunizations and preventive visits, with modest costs and modest impact. Copyright © 2013 Academic Pediatric Association. Published by Elsevier Inc. All rights reserved.

  3. A combined approach for the enhancement and segmentation of mammograms using modified fuzzy C-means method in wavelet domain

    OpenAIRE

    Srivastava, Subodh; Sharma, Neeraj; Singh, S. K.; Srivastava, R.

    2014-01-01

    In this paper, a combined approach for enhancement and segmentation of mammograms is proposed. In preprocessing stage, a contrast limited adaptive histogram equalization (CLAHE) method is applied to obtain the better contrast mammograms. After this, the proposed combined methods are applied. In the first step of the proposed approach, a two dimensional (2D) discrete wavelet transform (DWT) is applied to all the input images. In the second step, a proposed nonlinear complex diffusion based uns...

  4. Detection of masses in mammograms by analysis of gradient vector convergence using sector filter

    International Nuclear Information System (INIS)

    Fakhari, Y.; Karimian, A.; Mohammadbeigi, M.

    2012-01-01

    Although mammography is the main diagnostic method for breast cancer, but the interpretation of mammograms is a difficult task and depends on the experience and skill of the radiologists. Computer Aided Detection (CADe) systems have been proposed to help radiologist in interpretation of mammograms. In this paper a novel filter called Sector filter is proposed to detect masses. This filter works based on the analysis of convergence of gradient vectors toward the center of filter. Using this filter, rounded convex regions, which are more likely to be pertained to a mass, could be detected in a gray scale image. After applying this filter on the images with two scales and their linear combination suspicious points were selected by a specific process. After implementation of the proposed method, promising results were achieved. The performance of the proposed method in this research was competitive or in some cases even better than that of other suggested methods in the literature. (authors)

  5. Detecting microcalcifications in mammograms by using SVM method for the diagnostics of breast cancer

    Science.gov (United States)

    Wan, Baikun; Wang, Ruiping; Qi, Hongzhi; Cao, Xuchen

    2005-01-01

    Support vector machine (SVM) is a new statistical learning method. Compared with the classical machine learning methods, SVM learning discipline is to minimize the structural risk instead of the empirical risk of the classical methods, and it gives better generative performance. Because SVM algorithm is a convex quadratic optimization problem, the local optimal solution is certainly the global optimal one. In this paper a SVM algorithm is applied to detect the micro-calcifications (MCCs) in mammograms for the diagnostics of breast cancer that has not been reported yet. It had been tested with 10 mammograms and the results show that the algorithm can achieve a higher true positive in comparison with artificial neural network (ANN) based on the empirical risk minimization, and is valuable for further study and application in the clinical engineering.

  6. Bayesian Maximum Entropy Based Algorithm for Digital X-ray Mammogram Processing

    Directory of Open Access Journals (Sweden)

    Radu Mutihac

    2009-06-01

    Full Text Available Basics of Bayesian statistics in inverse problems using the maximum entropy principle are summarized in connection with the restoration of positive, additive images from various types of data like X-ray digital mammograms. An efficient iterative algorithm for image restoration from large data sets based on the conjugate gradient method and Lagrange multipliers in nonlinear optimization of a specific potential function was developed. The point spread function of the imaging system was determined by numerical simulations of inhomogeneous breast-like tissue with microcalcification inclusions of various opacities. The processed digital and digitized mammograms resulted superior in comparison with their raw counterparts in terms of contrast, resolution, noise, and visibility of details.

  7. Automated electronic reminders to facilitate primary cardiovascular disease prevention: randomised controlled trial

    Science.gov (United States)

    Holt, Tim A; Thorogood, Margaret; Griffiths, Frances; Munday, Stephen; Friede, Tim; Stables, David

    2010-01-01

    Background Primary care databases contain cardiovascular disease risk factor data, but practical tools are required to improve identification of at-risk patients. Aim To test the effects of a system of electronic reminders (the ‘e-Nudge’) on cardiovascular events and the adequacy of data for cardiovascular risk estimation. Design of study Randomised controlled trial. Setting Nineteen general practices in the West Midlands, UK. Method The e-Nudge identifies four groups of patients aged over 50 years on the basis of estimated cardiovascular risk and adequacy of risk factor data in general practice computers. Screen messages highlight individuals at raised risk and prompt users to complete risk profiles where necessary. The proportion of the study population in the four groups was measured, as well as the rate of cardiovascular events in each arm after 2 years. Results Over 38 000 patients' electronic records were randomised. The intervention led to an increase in the proportion of patients with sufficient data who were identifiably at risk, with a difference of 1.94% compared to the control group (95% confidence interval [CI] = 1.38 to 2.50, P<0.001). A corresponding reduction occurred in the proportion potentially at risk but requiring further data for a risk estimation (difference = –3.68%, 95% CI = –4.53 to –2.84, P<0.001). No significant difference was observed in the incidence of cardiovascular events (rate ratio = 0.96, 95% CI = 0.85 to 1.10, P = 0.59). Conclusion Automated electronic reminders using routinely collected primary care data can improve the adequacy of cardiovascular risk factor information during everyday practice and increase the visibility of the at-risk population. PMID:20353659

  8. Reminder Objects in the Connected Home of the Future and Beyond

    Directory of Open Access Journals (Sweden)

    Martina Uhlig

    2017-12-01

    Full Text Available This paper presents best practices on how to design reminder objects. Reminder objects are digitally augmented everyday objects that break down and communicate complex information via sensory input and output. In the first section of this paper, we introduce reminder objects—what they are and how they work. We then describe our understanding of computing and the interaction between humans and technology, in detail, in the second section. We then present our vision on how reminder objects can enrich the user’s experience by combining different objects. We then use the three following sections to showcase corresponding examples of our work in the previously described field. Next, three scenarios—people with dementia living an independent life at home, checking the weather, and navigating the city—will illustrate our understanding of reminder objects. The paper then concludes with a discussion of the presented work and an outlook regarding the future of reminder objects.

  9. Clinical Image Evaluation of Film Mammograms in Korea: Comparison with the ACR Standard

    International Nuclear Information System (INIS)

    Gwak, Yeon Joo; Kim, Hye Jung; Kwak, Jin Young; Son, Eun Ju; Ko, Kyung Hee; Lee, Jin Hwa; Lim, Hyo Soon; Lee, You Jin; Park, Ji Won; Shin, Kyung Min; Jang, Yun-Jin

    2013-01-01

    The goal of this study is to compare the overall quality of film mammograms taken according to the Korean standards with the American College of Radiology (ACR) standard for clinical image evaluation and to identify means of improving mammography quality in Korea. Four hundred and sixty eight sets of film mammograms were evaluated with respect to the Korean and ACR standards for clinical image evaluation. The pass and failure rates of mammograms were compared by medical facility types. Average scores in each category of the two standards were evaluated. Receiver operating characteristic curve analysis was used to identify an optimal Korean standard pass mark by taking the ACR standard as the reference standard. 93.6% (438/468) of mammograms passed the Korean standard, whereas only 80.1% (375/468) passed the ACR standard (p < 0.001). Non-radiologic private clinics had the lowest pass rate (88.1%: Korean standard, 71.8%: ACR standard) and the lowest total score (76.0) by the Korean standard. Average scores of positioning were lowest (19.3/29 by the Korean standard and 3.7/5 by the ACR standard). A cutoff score of 77.0 for the Korean standard was found to correspond to a pass level when the ACR standard was applied. We suggest that tighter regulations, such as, raising the Korean pass mark, subtracting more for severe deficiencies, or considering a very low scores in even a single category as failure, are needed to improve the quality of mammography in Korea

  10. Association between mammogram density and background parenchymal enhancement of breast MRI

    Science.gov (United States)

    Aghaei, Faranak; Danala, Gopichandh; Wang, Yunzhi; Zarafshani, Ali; Qian, Wei; Liu, Hong; Zheng, Bin

    2018-02-01

    Breast density has been widely considered as an important risk factor for breast cancer. The purpose of this study is to examine the association between mammogram density results and background parenchymal enhancement (BPE) of breast MRI. A dataset involving breast MR images was acquired from 65 high-risk women. Based on mammography density (BIRADS) results, the dataset was divided into two groups of low and high breast density cases. The Low-Density group has 15 cases with mammographic density (BIRADS 1 and 2), while the High-density group includes 50 cases, which were rated by radiologists as mammographic density BIRADS 3 and 4. A computer-aided detection (CAD) scheme was applied to segment and register breast regions depicted on sequential images of breast MRI scans. CAD scheme computed 20 global BPE features from the entire two breast regions, separately from the left and right breast region, as well as from the bilateral difference between left and right breast regions. An image feature selection method namely, CFS method, was applied to remove the most redundant features and select optimal features from the initial feature pool. Then, a logistic regression classifier was built using the optimal features to predict the mammogram density from the BPE features. Using a leave-one-case-out validation method, the classifier yields the accuracy of 82% and area under ROC curve, AUC=0.81+/-0.09. Also, the box-plot based analysis shows a negative association between mammogram density results and BPE features in the MRI images. This study demonstrated a negative association between mammogram density and BPE of breast MRI images.

  11. Segmentation of the Breast Region in Digital Mammograms and Detection of Masses

    OpenAIRE

    Armen Sahakyan; Hakop Sarukhanyan

    2012-01-01

    The mammography is the most effective procedure for an early diagnosis of the breast cancer. Finding an accurate and efficient breast region segmentation technique still remains a challenging problem in digital mammography. In this paper we explore an automated technique for mammogram segmentation. The proposed algorithm uses morphological preprocessing algorithm in order to: remove digitization noises and separate background region from the breast profile region for further edge detection an...

  12. Computerized detection of masses on mammograms: A comparative study of two algorithms

    International Nuclear Information System (INIS)

    Tiedeu, A.; Kom, G.; Kom, M.

    2007-02-01

    In this paper, we implement and carry out the comparison of two methods of computer-aided-detection of masses on mammograms. The two algorithms basically consist of 3 steps each: segmentation, binarization and noise suppression but using different techniques for each step. A database of 60 images was used to compare the performance of the two algorithms in terms of general detection efficiency, conservation of size and shape of detected masses. (author)

  13. Predicting adolescent posttraumatic stress in the aftermath of war: differential effects of coping strategies across trauma reminder, loss reminder, and family conflict domains.

    Science.gov (United States)

    Howell, Kathryn H; Kaplow, Julie B; Layne, Christopher M; Benson, Molly A; Compas, Bruce E; Katalinski, Ranka; Pasalic, Hafiza; Bosankic, Nina; Pynoos, Robert

    2015-01-01

    The vast majority of youth who lived through the Bosnian war were exposed to multiple traumatic events, including interpersonal violence, community destruction, and the loss of a loved one. This study examined factors that predict post-war psychological adjustment, specifically posttraumatic stress, in Bosnian adolescents. Regression analyses evaluated theorized differential relations between three types of post-war stressors - exposure to trauma reminders, loss reminders, and intrafamilial conflict - specific coping strategies, and posttraumatic stress symptom dimensions. We examined 555 Bosnian adolescents, aged 15-19 years, to predict their long-term posttraumatic stress reactions in the aftermath of war. Findings indicated that post-war exposure to trauma reminders, loss reminders, and family conflict, as well as engagement and disengagement coping strategies, predicted posttraumatic stress symptoms. Secondary control engagement coping responses to all three types of post-war stressors were inversely associated with posttraumatic stress symptoms, whereas primary control engagement coping responses to family conflict were inversely associated with hyperarousal symptoms. Disengagement responses to trauma reminders and family conflict were positively associated with re-experiencing symptoms. These findings shed light on ways in which trauma reminders, loss reminders, and family conflict may intersect with coping responses to influence adolescent postwar adjustment.

  14. [Usefulness of the 10 pictures reminding test for memory assessment for the diagnosis of Alzheimer's disease, mild cognitive impairment and anxiety/depression].

    Science.gov (United States)

    Federico, D; Thomas-Anterion, C; Borg, C; Foyatier Michel, N; Dirson, S; Laurent, B

    2008-10-01

    Episodic memory is often considered to be essential in the neuropsychological examination of elderly people consulting in the memory clinics. Therefore, the performance of three different episodic memory tests were compared in Alzheimer's disease (AD), mild cognitive impairment (MCI) and anxiety/depression. Seventy-six patients with AD, 46 with MCI, and 36 with anxiety/depression performed three memory tests: (1) three-words immediate and delayed recall of the MMSE test; (2) 10-pictures reminding test; (3) 16-items free and cued reminding test. Patients with AD and MCI differed from the depressed/anxious participants on all subcomponents of the memory tests. Only the three-words immediate and delayed recall in the MMSE test as well as the immediate recall (encoding) of the free and cued reminding test (16-items) did not differ between AD and MCI. Significant correlations were also evidenced between the free and cued recall of the 10 pictures and the score of the 16-items for all patients. Scores of total and free recalls distinguished the three group of patients; also, a trend was observed for the free recall between the patients with AD and MCI. The three-words immediate and delayed recall of the MMSE test is linked with hippocampic dysfunction. Also, the present study suggests that the 10-pictures reminding test, is a simple and reliable test for investigating memory, in addition to other evaluation tests. Finally, further studies would be necessary to assess the sensitivity and specificity of the tests.

  15. Ethnic differences in social support after initial receipt of an abnormal mammogram.

    Science.gov (United States)

    Molina, Yamile; Hohl, Sarah D; Nguyen, Michelle; Hempstead, Bridgette H; Weatherby, Shauna Rae; Dunbar, Claire; Beresford, Shirley A A; Ceballos, Rachel M

    2016-10-01

    We examine access to and type of social support after initial receipt of an abnormal mammogram across non-Latina White (NLW), African American, and Latina women. This cross-sectional study used a mixed method design, with quantitative and qualitative measures. Women were recruited through 2 community advocates and 3 breast-health-related care organizations. With regard to access, African American women were less likely to access social support relative to NLW counterparts. Similar nonsignificant differences were found for Latinas. Women did not discuss results with family and friends to avoid burdening social networks and negative reactions. Networks' geographic constraints and medical mistrust influenced Latina and African American women's decisions to discuss results. With regard to type of social support, women reported emotional support across ethnicity. Latina and African American women reported more instrumental support, whereas NLW women reported more informational support in the context of their well-being. There are shared and culturally unique aspects of women's experiences with social support after initially receiving an abnormal mammogram. Latina and African American women may particularly benefit from informational support from health care professionals. Communitywide efforts to mitigate mistrust and encourage active communication about cancer may improve ethnic disparities in emotional well-being and diagnostic resolution during initial receipt of an abnormal mammogram. (PsycINFO Database Record (c) 2016 APA, all rights reserved).

  16. Quantitative assessment of breast density from digitized mammograms into Tabar's patterns

    Energy Technology Data Exchange (ETDEWEB)

    Jamal, N [Medical Technology Division, Malaysian Institute for Nuclear Technology Research (MINT) 43000 Kajang (Malaysia); Ng, K-H [Department of Radiology, University of Malaya, 50603 Kuala Lumpur (Malaysia); Looi, L-M [Department of Pathology, University of Malaya, 50603 Kuala Lumpur (Malaysia); McLean, D [Medical Physics Department, Westmead Hospital, Sydney, NSW 2145 (Australia); Zulfiqar, A [Department of Radiology, Hospital Universiti Kebangsaan Malaysia, 56000 Malaysia, Kuala Lumpur, Malaysia (Malaysia); Tan, S-P [Department of Radiology, Hospital Universiti Kebangsaan Malaysia, 56000 Malaysia, Kuala Lumpur, Malaysia (Malaysia); Liew, W-F [Department of Radiology, Hospital Universiti Kebangsaan Malaysia, 56000 Malaysia, Kuala Lumpur, Malaysia (Malaysia); Shantini, A [Department of Radiology, Kuala Lumpur Hospital, 50586 Kuala Lumpur (Malaysia); Ranganathan, S [Department of Radiology, University of Malaya, 50603 Kuala Lumpur (Malaysia)

    2006-11-21

    We describe a semi-automated technique for the quantitative assessment of breast density from digitized mammograms in comparison with patterns suggested by Tabar. It was developed using the MATLAB-based graphical user interface applications. It is based on an interactive thresholding method, after a short automated method that shows the fibroglandular tissue area, breast area and breast density each time new thresholds are placed on the image. The breast density is taken as a percentage of the fibroglandular tissue to the breast tissue areas. It was tested in four different ways, namely by examining: (i) correlation of the quantitative assessment results with subjective classification, (ii) classification performance using the quantitative assessment technique, (iii) interobserver agreement and (iv) intraobserver agreement. The results of the quantitative assessment correlated well (r{sup 2} = 0.92) with the subjective Tabar patterns classified by the radiologist (correctly classified 83% of digitized mammograms). The average kappa coefficient for the agreement between the readers was 0.63. This indicated moderate agreement between the three observers in classifying breast density using the quantitative assessment technique. The kappa coefficient of 0.75 for intraobserver agreement reflected good agreement between two sets of readings. The technique may be useful as a supplement to the radiologist's assessment in classifying mammograms into Tabar's pattern associated with breast cancer risk.

  17. Quantitative assessment of breast density from digitized mammograms into Tabar's patterns

    International Nuclear Information System (INIS)

    Jamal, N; Ng, K-H; Looi, L-M; McLean, D; Zulfiqar, A; Tan, S-P; Liew, W-F; Shantini, A; Ranganathan, S

    2006-01-01

    We describe a semi-automated technique for the quantitative assessment of breast density from digitized mammograms in comparison with patterns suggested by Tabar. It was developed using the MATLAB-based graphical user interface applications. It is based on an interactive thresholding method, after a short automated method that shows the fibroglandular tissue area, breast area and breast density each time new thresholds are placed on the image. The breast density is taken as a percentage of the fibroglandular tissue to the breast tissue areas. It was tested in four different ways, namely by examining: (i) correlation of the quantitative assessment results with subjective classification, (ii) classification performance using the quantitative assessment technique, (iii) interobserver agreement and (iv) intraobserver agreement. The results of the quantitative assessment correlated well (r 2 = 0.92) with the subjective Tabar patterns classified by the radiologist (correctly classified 83% of digitized mammograms). The average kappa coefficient for the agreement between the readers was 0.63. This indicated moderate agreement between the three observers in classifying breast density using the quantitative assessment technique. The kappa coefficient of 0.75 for intraobserver agreement reflected good agreement between two sets of readings. The technique may be useful as a supplement to the radiologist's assessment in classifying mammograms into Tabar's pattern associated with breast cancer risk

  18. Using x-ray mammograms to assist in microwave breast image interpretation.

    Science.gov (United States)

    Curtis, Charlotte; Frayne, Richard; Fear, Elise

    2012-01-01

    Current clinical breast imaging modalities include ultrasound, magnetic resonance (MR) imaging, and the ubiquitous X-ray mammography. Microwave imaging, which takes advantage of differing electromagnetic properties to obtain image contrast, shows potential as a complementary imaging technique. As an emerging modality, interpretation of 3D microwave images poses a significant challenge. MR images are often used to assist in this task, and X-ray mammograms are readily available. However, X-ray mammograms provide 2D images of a breast under compression, resulting in significant geometric distortion. This paper presents a method to estimate the 3D shape of the breast and locations of regions of interest from standard clinical mammograms. The technique was developed using MR images as the reference 3D shape with the future intention of using microwave images. Twelve breast shapes were estimated and compared to ground truth MR images, resulting in a skin surface estimation accurate to within an average Euclidean distance of 10 mm. The 3D locations of regions of interest were estimated to be within the same clinical area of the breast as corresponding regions seen on MR imaging. These results encourage investigation into the use of mammography as a source of information to assist with microwave image interpretation as well as validation of microwave imaging techniques.

  19. Using X-Ray Mammograms to Assist in Microwave Breast Image Interpretation

    Directory of Open Access Journals (Sweden)

    Charlotte Curtis

    2012-01-01

    Full Text Available Current clinical breast imaging modalities include ultrasound, magnetic resonance (MR imaging, and the ubiquitous X-ray mammography. Microwave imaging, which takes advantage of differing electromagnetic properties to obtain image contrast, shows potential as a complementary imaging technique. As an emerging modality, interpretation of 3D microwave images poses a significant challenge. MR images are often used to assist in this task, and X-ray mammograms are readily available. However, X-ray mammograms provide 2D images of a breast under compression, resulting in significant geometric distortion. This paper presents a method to estimate the 3D shape of the breast and locations of regions of interest from standard clinical mammograms. The technique was developed using MR images as the reference 3D shape with the future intention of using microwave images. Twelve breast shapes were estimated and compared to ground truth MR images, resulting in a skin surface estimation accurate to within an average Euclidean distance of 10 mm. The 3D locations of regions of interest were estimated to be within the same clinical area of the breast as corresponding regions seen on MR imaging. These results encourage investigation into the use of mammography as a source of information to assist with microwave image interpretation as well as validation of microwave imaging techniques.

  20. Reading screening mammograms – Attitudes among radiologists and radiographers about skill mix

    International Nuclear Information System (INIS)

    Johansen, Lena Westphal; Brodersen, John

    2011-01-01

    Introduction: Because of shortage of personnel for the Danish mammography screening programme, the aim of this study was to investigate the attitudes of radiologists and radiographers towards a future implementation of radiographers reading screening mammograms. Materials and methods: Seven combined phenomenological and hermeneutical interviews with radiographers and radiologists were performed. Stratified selection was used for sampling of informants. The interviews were analysed against theory about quality, organization and profession. Results: Quality related possibilities: radiographers do routinely measure the performance quality, radiographers obtain sufficient reading qualifications, and skill mix improves quality. Quality related obstacles: radiologists do not routinely measure performance quality. Organization related possibilities: shortage of radiologists, positive attitudes of managers, and improved working relations. Organization related obstacles: shortage of radiographers and negative attitudes of managers. Professional related possibilities: positive experience with skill mix. Professional related obstacles: worries about negative consequences for the training of radiologists, and resistance against handing over tasks to another profession. Conclusion: Attitudes towards radiographers reading screening mammograms are attached to either quality-, organisational or professional perspectives. Radiographers are capable of learning to read mammograms at sufficient performance level but routine measurement of performance quality is essential. Resistance against skill mix may be caused by an emotionally conditioned fear of losing demarcations. The main motive for skill mix is improvement of the utilization of resources. No evidence was found regarding the organisational and financial consequences of skill mix. Despite of this all radiologists and radiographers experienced with skill mix were strong advocates for reading radiographers.

  1. Computer-aided diagnosis scheme for histological classification of clustered microcalcifications on magnification mammograms

    International Nuclear Information System (INIS)

    Nakayama, Ryohei; Uchiyama, Yoshikazu; Watanabe, Ryoji; Katsuragawa, Shigehiko; Namba, Kiyoshi; Doi, Kunio

    2004-01-01

    The histological classification of clustered microcalcifications on mammograms can be difficult, and thus often require biopsy or follow-up. Our purpose in this study was to develop a computer-aided diagnosis schemefor identifying the histological classification of clustered microcalcifications on magnification mammograms in order to assist the radiologists' interpretation as a 'second opinion'. Our database consisted of 58 magnification mammograms, which included 35 malignant clustered microcalcifications (9 invasive carcinomas, 12 noninvasive carcinomas of the comedo type, and 14 noninvasive carcinomas of the noncomedo type) and 23 benign clustered microcalcifications (17 mastopathies and 6 fibroadenomas). The histological classifications of all clustered microcalcifications were proved by pathologic diagnosis. The clustered microcalcifications were first segmented by use of a novel filter bank and a thresholding technique. Five objective features on clustered microcalcifications were determined by taking into account subjective features that experienced the radiologists commonly use to identify possible histological classifications. The Bayes decision rule with five objective features was employed for distinguishing between five histological classifications. The classification accuracies for distinguishing between three malignant histological classifications were 77.8% (7/9) for invasive carcinoma, 75.0% (9/12) for noninvasive carcinoma of the comedo type, and 92.9% (13/14) for noninvasive carcinoma of the noncomedo type. The classification accuracies for distinguishing between two benign histological classifications were 94.1% (16/17) for mastopathy, and 100.0% (6/6) for fibroadenoma. This computerized method would be useful in assisting radiologists in their assessments of clustered microcalcifications

  2. Revisiting the effect of reminders on infants' media memories: does the encoding format matter?

    Science.gov (United States)

    Barr, Rachel; Brito, Natalie; Simcock, Gabrielle

    2013-11-01

    With the present research, the authors examined whether reminders could maintain 18-month-olds' memories generated from picture books and videos. Infants (N = 98) were shown a series of target actions in a picture book or on video. Either 24 hr or 2 weeks prior to a 4-week deferred imitation test, they were exposed to a reminder, a partial presentation of the original media demonstration. After both reminder delays, groups that received a video demonstration and a video reminder (video/video) performed significantly better than did the video-reminder-only control group (x/video), but groups that received a picture-book demonstration and a picture-book reminder (book/book) did not perform better than did the picture-book-reminder-only control (x/book). Additionally, if reminders did not veridically match the conditions of encoding (e.g., video demonstration and a book reminder, video/book or vice versa), infants also failed to perform better than controls. Theoretical implications for the understanding of long-term memory processing during early childhood and practical implications for early multimedia usage are discussed.

  3. Joint two-view information for computerized detection of microcalcifications on mammograms

    International Nuclear Information System (INIS)

    Sahiner, Berkman; Chan, H.-P.; Hadjiiski, Lubomir M.; Helvie, Mark A.; Paramagul, Chinatana; Ge Jun; Wei Jun; Zhou Chuan

    2006-01-01

    We are developing new techniques to improve the accuracy of computerized microcalcification detection by using the joint two-view information on craniocaudal (CC) and mediolateral-oblique (MLO) views. After cluster candidates were detected using a single-view detection technique, candidates on CC and MLO views were paired using their radial distances from the nipple. Candidate pairs were classified with a similarity classifier that used the joint information from both views. Each cluster candidate was also characterized by its single-view features. The outputs of the similarity classifier and the single-view classifier were fused and the cluster candidate was classified as a true microcalcification cluster or a false-positive (FP) using the fused two-view information. A data set of 116 pairs of mammograms containing microcalcification clusters and 203 pairs of normal images from the University of South Florida (USF) public database was used for training the two-view detection algorithm. The trained method was tested on an independent test set of 167 pairs of mammograms, which contained 71 normal pairs and 96 pairs with microcalcification clusters collected at the University of Michigan (UM). The similarity classifier had a very low FP rate for the test set at low and medium levels of sensitivity. However, the highest mammogram-based sensitivity that could be reached by the similarity classifier was 69%. The single-view classifier had a higher FP rate compared to the similarity classifier, but it could reach a maximum mammogram-based sensitivity of 93%. The fusion method combined the scores of these two classifiers so that the number of FPs was substantially reduced at relatively low and medium sensitivities, and a relatively high maximum sensitivity was maintained. For the malignant microcalcification clusters, at a mammogram-based sensitivity of 80%, the FP rates were 0.18 and 0.35 with the two-view fusion and single-view detection methods, respectively. When the

  4. Early Model of Traffic Sign Reminder Based on Neural Network

    Directory of Open Access Journals (Sweden)

    Budi Rahmani

    2012-12-01

    Full Text Available Recognizing the traffic signs installed on the streets is one of the requirements of driving on the road. Laxity in driving may result in traffic accident. This paper describes a real-time reminder model, by utilizing a camera that can be installed in a car to capture image of traffic signs, and is processed and later to inform the driver. The extracting feature harnessing the morphological elements (strel is used in this paper. Artificial Neural Networks is used to train the system and to produce a final decision. The result shows that the accuracy in detecting and recognizing the ten types of traffic signs in real-time is 80%.

  5. Do subtle reminders of money change people's political views?

    Science.gov (United States)

    Rohrer, Doug; Pashler, Harold; Harris, Christine R

    2015-08-01

    A number of researchers have reported studies showing that subtle reminders of money can alter behaviors and beliefs that are seemingly unrelated to money. In 1 set of studies published in this journal, Caruso, Vohs, Baxter, and Waytz (2013) found that incidental exposures to money led subjects to indicate greater support for inequality, socioeconomic differences, group-based discrimination, and free market economies. We conducted high-powered replication attempts of these 4 money priming effects and found no evidence of priming (weighted Cohen's d = 0.03). We later learned that Caruso et al. also found several null effects in their line of research that were not reported in the original article. In addition, the money priming effect observed in the first study of Caruso et al. was included in the Many Labs Replication Project (Klein et al., 2014), and only 1 of the 36 labs was able to find the effect. (c) 2015 APA, all rights reserved).

  6. Rudimentary functions:Important reminders of history and relationship

    Directory of Open Access Journals (Sweden)

    Natalia Y. Collings

    2018-03-01

    Full Text Available Background. When Vygotsky suggested the term rudimentary functions for psychological phenomena, he drew a parallel with organismic rudiments that existed and continue to exist in a number of biological species. These rudiments used to play an important role in the life of an organism and allow us to study that life in the process of its development. Vygotsky originally gave three explicit examples of psychological rudimentary functions: 1 attributing an important decision to the result of a solitaire card game, 2 tying a knot in a handkerchief in order to remember and do something later, and 3 counting on one’s fingers. Objective. The purpose of this article is to offer a contemporary overview and paths for development of L.S. Vygotsky’s notion of rudimentary function. Design. This paper, in the genre of a theoretical article, drew on existing research and theoretical literature to advance a theory. I analyzed Vygotsky’s original example of a solitaire game and similar actions (for example, flipping a coin, arguing that these actions represent key events mediating choice and exercising human will over affect. I then focused on three more psychological functions that fit Vygotsky’s definition of rudiments: 1 photographic memory and déjà vu as instances of historically primitive eidetic memory, 2 talking to oneself aloud as a rudiment of a key event forming the self-regulatory mechanism of inner speech in childhood, and 3 fantasizing, which could remind us of our young age, when imagination readily created what was lacking in external world. Results. This analysis allowed me to vividly illustrate the historical and relational focus of Vygotsky’s theories. Conclusions. Rudimentary functions, often perceived as mysterious, in their simplicity can be powerful reminders that historically primitive functions do not disappear, but enter complex relationships with other psychological functions, and that many relationships are possible within

  7. Impact of late-to-refill reminder calls on medication adherence in the Medicare Part D population: evaluation of a randomized controlled study

    Directory of Open Access Journals (Sweden)

    Taitel MS

    2017-02-01

    Full Text Available Michael S Taitel, Ying Mu, Angshuman Gooptu, Youbei Lou Health Analytics, Research & Reporting, Walgreen Co., Deerfield, IL, USA Objectives: This study evaluates a nationwide pharmacy chain’s late-to-refill (LTR reminder program that entails local pharmacists placing reminder calls to Medicare Part D patients. Methods: We conducted a randomized controlled study among 735,218 patients who exhibited nonadherent behavior by not refilling a maintenance medication 3 days from an expected refill date. Patients were randomly assigned to an intervention group who received LTR reminder calls or to a control group. We used Walgreens pharmaceutical claims data from 2015 to estimate the impact of LTR calls on short-term and annual adherence. Results: The initial refill rate within the first 14 days of the expected refill date significantly increased in the intervention group by 22.8% (6.09 percentage points compared to the control group (P<0.001. The proportion of days covered (PDC in the intervention group increased significantly by 1.5% (0.856 percentage points relative to the control group (P<0.001 over 365 days. Patients in the intervention group were significantly more adherent (PDC ≥80% by 3% (0.97 percentage points compared to the control group (P<0.001. Over a 270-day follow-up period, persistence significantly increased by 2.15 days in the intervention group (P<0.001. Conclusion: Results from this study suggest that LTR reminder calls increased adherence for Medicare Part D patients who are late in refilling their medications and therefore have the potential to reduce their risk for hospitalization and health care costs. Additionally, the intervention increased the number of patients with PDC ≥80% by ~3%, positively impacting Medicare Part D plan quality rating. Keywords: reminder system, tailored intervention, Medicare Part D, adherence, persistence

  8. The Free and Cued Selective Reminding Test: evidence of psychometric adequacy

    Directory of Open Access Journals (Sweden)

    KATJA OCEPEK-WELIKSON

    2009-09-01

    Full Text Available These analyses examine the psychometric properties of the Free and Cued Selective Reminding Test with Immediate Recall (FCSRT-IR. FCSRT-IR is a measure of memory under conditions that control attention and cognitive processing in order to obtain an assessment of memory unconfounded by normal agerelated changes in cognition. FCSRT-IR performance has been associated with preclinical and early dementia in several longitudinal epidemiological studies. Factor and item response theory analyses were applied to FCSRT-IR data from patients at a geriatric primary care center who had independently established clinical diagnoses. The results provide supporting evidence for the psychometric adequacy of the FCSR-IR in terms of reliability, essential (sufficient unidimensionality, information across the continuum of memory disability/ability, and classification accuracy. The psychometric adequacy of the FCSRT-IR adds further validity to its use as a case finding strategy for dementia.

  9. Annual Screening Mammogram and its Relation to Breast Density

    Directory of Open Access Journals (Sweden)

    Sabek EAS

    2017-11-01

    Full Text Available Background: Current national screening programs totally depend on mammographic evaluation. After increased incidence of breast cancer in women under the age of 35, mammography sensitivity in now a question. Several factors added to decrease sensitivity of mammography, such as increased density in older age groups and increased aggressiveness of tumour biology. All these factors will change the reliability of the screening program. The study is a retrospective study conducted at Ain Shams University. Method: 138 patients diagnosed with cancer breast underwent both mammography and sonography to determine percentage of patient with more than one focus, age and density distribution breast cancer in the affected patient and accuracy of both mammography and US. Results: By studying this population, we found that around 61,44% have areas of density ranging from dense breast, heterogenous density or scattered density. These areas of density render the mammography a less sensitive tool as its sensitivity fall to 34.09%, while that of US was 77.27%. Conclusion: As breast cancer is prevalent in younger population, also with increased density in older population who are relatively insensitive to mammography, we recommended the use of Automated Breast Ultrasound (ABUS in the national screening program.

  10. Revisiting the Effect of Reminders on Infants' Media Memories: Does the Encoding Format Matter?

    Science.gov (United States)

    Barr, Rachel; Brito, Natalie; Simcock, Gabrielle

    2013-01-01

    With the present research, the authors examined whether reminders could maintain 18-month-olds' memories generated from picture books and videos. Infants (N = 98) were shown a series of target actions in a picture book or on video. Either 24 hr or 2 weeks prior to a 4-week deferred imitation test, they were exposed to a reminder, a partial…

  11. On the Value of Nonremovable Reminders for Behavior Modification: An Application to Nail-Biting (Onychophagia)

    Science.gov (United States)

    Koritzky, Gilly; Yechiam, Eldad

    2011-01-01

    The authors examined the effectiveness of a novel behavior modification method for dysfunctional and impulsive habits, based on nonremovable reminders (NrRs). NrRs were implemented by having participants wear nonremovable wristbands designated to constantly remind them of their resolution to quit the targeted habit (nail-biting). Participants were…

  12. Design of a randomized trial to evaluate the influence of mobile phone reminders on adherence to first line antiretroviral treatment in South India - the HIVIND study protocol

    Directory of Open Access Journals (Sweden)

    Kumarasamy Nagalingeswaran

    2010-03-01

    Full Text Available Abstract Background Poor adherence to antiretroviral treatment has been a public health challenge associated with the treatment of HIV. Although different adherence-supporting interventions have been reported, their long term feasibility in low income settings remains uncertain. Thus, there is a need to explore sustainable contextual adherence aids in such settings, and to test these using rigorous scientific designs. The current ubiquity of mobile phones in many resource-constrained settings, make it a contextually appropriate and relatively low cost means of supporting adherence. In India, mobile phones have wide usage and acceptability and are potentially feasible tools for enhancing adherence to medications. This paper presents the study protocol for a trial, to evaluate the influence of mobile phone reminders on adherence to first-line antiretroviral treatment in South India. Methods/Design 600 treatment naïve patients eligible for first-line treatment as per the national antiretroviral treatment guidelines will be recruited into the trial at two clinics in South India. Patients will be randomized into control and intervention arms. The control arm will receive the standard of care; the intervention arm will receive the standard of care plus mobile phone reminders. Each reminder will take the form of an automated call and a picture message. Reminders will be delivered once a week, at a time chosen by the patient. Patients will be followed up for 24 months or till the primary outcome i.e. virological failure, is reached, whichever is earlier. Self-reported adherence is a secondary outcome. Analysis is by intention-to-treat. A cost-effectiveness study of the intervention will also be carried out. Discussion Stepping up telecommunications technology in resource-limited healthcare settings is a priority of the World Health Organization. The trial will evaluate if the use of mobile phone reminders can influence adherence to first

  13. Design of a randomized trial to evaluate the influence of mobile phone reminders on adherence to first line antiretroviral treatment in South India--the HIVIND study protocol.

    Science.gov (United States)

    De Costa, Ayesha; Shet, Anita; Kumarasamy, Nagalingeswaran; Ashorn, Per; Eriksson, Bo; Bogg, Lennart; Diwan, Vinod K

    2010-03-26

    Poor adherence to antiretroviral treatment has been a public health challenge associated with the treatment of HIV. Although different adherence-supporting interventions have been reported, their long term feasibility in low income settings remains uncertain. Thus, there is a need to explore sustainable contextual adherence aids in such settings, and to test these using rigorous scientific designs. The current ubiquity of mobile phones in many resource-constrained settings, make it a contextually appropriate and relatively low cost means of supporting adherence. In India, mobile phones have wide usage and acceptability and are potentially feasible tools for enhancing adherence to medications. This paper presents the study protocol for a trial, to evaluate the influence of mobile phone reminders on adherence to first-line antiretroviral treatment in South India. 600 treatment naïve patients eligible for first-line treatment as per the national antiretroviral treatment guidelines will be recruited into the trial at two clinics in South India. Patients will be randomized into control and intervention arms. The control arm will receive the standard of care; the intervention arm will receive the standard of care plus mobile phone reminders. Each reminder will take the form of an automated call and a picture message. Reminders will be delivered once a week, at a time chosen by the patient. Patients will be followed up for 24 months or till the primary outcome i.e. virological failure, is reached, whichever is earlier. Self-reported adherence is a secondary outcome. Analysis is by intention-to-treat. A cost-effectiveness study of the intervention will also be carried out. Stepping up telecommunications technology in resource-limited healthcare settings is a priority of the World Health Organization. The trial will evaluate if the use of mobile phone reminders can influence adherence to first-line antiretrovirals in an Indian context.

  14. SMS text pre-notification and delivery of reminder e-mails to increase response rates to postal questionnaires in the SUSPEND trial: a factorial design, randomised controlled trial.

    Science.gov (United States)

    Starr, Kathryn; McPherson, Gladys; Forrest, Mark; Cotton, Seonaidh C

    2015-07-08

    Patient-reported outcomes are vital in informing randomised controlled trials (RCTs) and health-care interventions and policies from the patient's perspective. However, participant non-response may introduce bias and can affect the generalisability of the trial. This study evaluates two interventions aimed at increasing response rates to postal questionnaires within a large, UK-wide RCT: pre-notification via short messenger service (SMS) text prior to sending the initial mailing of trial questionnaires versus no pre-notification; for non-responders to the initial mailing of the questionnaires, an e-mail reminder (containing a hyperlink to complete the questionnaire online) versus a postal reminder. This study is a 2 × 2 partial factorial design RCT nested within an RCT of medical expulsive therapy for ureteric stone disease. Participants who supplied a mobile telephone number were randomly assigned to receive an SMS text pre-notification of questionnaire delivery or no pre-notification. Those who supplied an e-mail address were randomly assigned to receive a questionnaire reminder by e-mail or post. Participants could be randomly assigned to the pre-notification comparison or the reminder comparison or both. The primary outcome measure was response rate at each questionnaire time point. Four hundred eighteen participants were randomly assigned to the SMS pre-notification comparison (80% were male, and the mean age was 41 years with a standard deviation (SD) of 11.1). The intervention had no effect on response rate at either questionnaire time point. In subgroup analyses, SMS pre-notification increased response rates in women but only at the first questionnaire time point. One hundred nineteen participants were randomly assigned to the reminder comparison (80% were male, and the mean age was 42 years with an SD of 12.1). There was no difference in response rate in those who received an e-mail reminder compared with those who received a postal reminder. SMS text pre

  15. Validation of a method for measuring the volumetric breast density from digital mammograms

    International Nuclear Information System (INIS)

    Alonzo-Proulx, O; Shen, S Z; Yaffe, M J; Packard, N; Boone, J M; Al-Mayah, A; Brock, K K

    2010-01-01

    The purpose of this study was to evaluate the performance of an algorithm used to measure the volumetric breast density (VBD) from digital mammograms. The algorithm is based on the calibration of the detector signal versus the thickness and composition of breast-equivalent phantoms. The baseline error in the density from the algorithm was found to be 1.25 ± 2.3% VBD units (PVBD) when tested against a set of calibration phantoms, of thicknesses 3-8 cm, with compositions equivalent to fibroglandular content (breast density) between 0% and 100% and under x-ray beams between 26 kVp and 32 kVp with a Rh/Rh anode/filter. The algorithm was also tested against images from a dedicated breast computed tomography (CT) scanner acquired on 26 volunteers. The CT images were segmented into regions representing adipose, fibroglandular and skin tissues, and then deformed using a finite-element algorithm to simulate the effects of compression in mammography. The mean volume, VBD and thickness of the compressed breast for these deformed images were respectively 558 cm 3 , 23.6% and 62 mm. The displaced CT images were then used to generate simulated digital mammograms, considering the effects of the polychromatic x-ray spectrum, the primary and scattered energy transmitted through the breast, the anti-scatter grid and the detector efficiency. The simulated mammograms were analyzed with the VBD algorithm and compared with the deformed CT volumes. With the Rh/Rh anode filter, the root mean square difference between the VBD from CT and from the algorithm was 2.6 PVBD, and a linear regression between the two gave a slope of 0.992 with an intercept of -1.4 PVBD and a correlation with R 2 = 0.963. The results with the Mo/Mo and Mo/Rh anode/filter were similar.

  16. Validation of a method for measuring the volumetric breast density from digital mammograms

    Energy Technology Data Exchange (ETDEWEB)

    Alonzo-Proulx, O; Shen, S Z; Yaffe, M J [Sunnybrook Health Sciences Centre, University of Toronto, Toronto, Ontario M4N 3M5 (Canada); Packard, N; Boone, J M [UC Davis Medical Center, University of California-Davis, Sacramento, CA 95817 (United States); Al-Mayah, A; Brock, K K, E-mail: oliviera@sri.utoronto.c [University Health Network, University of Toronto, Toronto, Ontario M5G 2M9 (Canada)

    2010-06-07

    The purpose of this study was to evaluate the performance of an algorithm used to measure the volumetric breast density (VBD) from digital mammograms. The algorithm is based on the calibration of the detector signal versus the thickness and composition of breast-equivalent phantoms. The baseline error in the density from the algorithm was found to be 1.25 {+-} 2.3% VBD units (PVBD) when tested against a set of calibration phantoms, of thicknesses 3-8 cm, with compositions equivalent to fibroglandular content (breast density) between 0% and 100% and under x-ray beams between 26 kVp and 32 kVp with a Rh/Rh anode/filter. The algorithm was also tested against images from a dedicated breast computed tomography (CT) scanner acquired on 26 volunteers. The CT images were segmented into regions representing adipose, fibroglandular and skin tissues, and then deformed using a finite-element algorithm to simulate the effects of compression in mammography. The mean volume, VBD and thickness of the compressed breast for these deformed images were respectively 558 cm{sup 3}, 23.6% and 62 mm. The displaced CT images were then used to generate simulated digital mammograms, considering the effects of the polychromatic x-ray spectrum, the primary and scattered energy transmitted through the breast, the anti-scatter grid and the detector efficiency. The simulated mammograms were analyzed with the VBD algorithm and compared with the deformed CT volumes. With the Rh/Rh anode filter, the root mean square difference between the VBD from CT and from the algorithm was 2.6 PVBD, and a linear regression between the two gave a slope of 0.992 with an intercept of -1.4 PVBD and a correlation with R{sup 2} = 0.963. The results with the Mo/Mo and Mo/Rh anode/filter were similar.

  17. Mobile Versus Fixed Facility: Latinas' Attitudes and Preferences for Obtaining a Mammogram.

    Science.gov (United States)

    Scheel, John R; Tillack, Allison A; Mercer, Lauren; Coronado, Gloria D; Beresford, Shirley A A; Molina, Yamile; Thompson, Beti

    2018-01-01

    Mobile mammographic services have been proposed as a way to reduce Latinas' disproportionate late-stage presentation compared with white women by increasing their access to mammography. The aims of this study were to assess why Latinas may not use mobile mammographic services and to explore their preferences after using these services. Using a mixed-methods approach, a secondary analysis was conducted of baseline survey data (n = 538) from a randomized controlled trial to improve screening mammography rates among Latinas in Washington. Descriptive statistics and bivariate regression were used to characterize mammography location preferences and to test for associations with sociodemographic indices, health care access, and perceived breast cancer risk and beliefs. On the basis of these findings, a qualitative study (n = 18) was used to explore changes in perceptions after using mobile mammographic services. More Latinas preferred obtaining a mammogram at a fixed facility (52.3% [n = 276]) compared with having no preference (46.3% [n = 249]) and preferring mobile mammographic services (1.7% [n = 9]). Concerns about privacy and comfort (15.6% [n = 84]) and about general quality (10.6% [n = 57]) were common reasons for preferring a fixed facility. Those with no history of mammography preferred a fixed facility (P mobile mammographic services after obtaining a mammogram. Although most Latinas preferred obtaining a mammogram at a fixed facility, positive experiences with mobile mammography services changed their attitudes toward them. These findings highlight the need to include community education when using mobile mammographic service to increase screening mammography rates in underserved communities. Copyright © 2017 American College of Radiology. Published by Elsevier Inc. All rights reserved.

  18. Studies on computer-aided diagnosis systems for chest radiographs and mammograms (in Japanese)

    International Nuclear Information System (INIS)

    Hara, Takeshi

    2001-01-01

    This thesis describes computer-aided diagnosis (CAD) systems for chest radiographs and mammograms. Preprocessing and imaging processing methods for each CAD system include dynamic range compression and region segmentation technique. A new pattern recognition technique combines genetic algorithms with template matching methods to detect lung nodules. A genetic algorithm was employed to select the optimal shape of simulated nodular shadows to be compared with real lesions on digitized chest images. Detection performance was evaluated using 332 chest radiographs from the database of the Japanese Society of Radiological Technology. Our average true-positive rate was 72.8% with an average of 11 false-positive findings per image. A new detection method using high resolution digital images with 0.05 mm sampling is also proposed for the mammogram CAD system to detect very small microcalcifications. An automated classification method uses feature extraction based on fractal dimension analysis of masses. Using over 200 cases to evaluate the detection of mammographic masses and calcifications, the detection rate of masses and microcalcifications were 87% and 96% with 1.5 and 1.8 false-positive findings, respectively. The classification performance on benign vs malignant lesions, the Az values that were defined by the areas under the ROC curves derived from classification schemes of masses and microcalcifications were 0.84 and 0.89. To demonstrate the practicality of these CAD systems in a computer-network environment, we propose to use the mammogram CAD system via the Internet and WWW. A common gateway interface and server-client approach for the CAD system via the Internet will permit display of the CAD results on ordinary computers

  19. Reading screening mammograms - Attitudes among radiologists and radiographers about skill mix

    DEFF Research Database (Denmark)

    Johansen, Lena Westphal; Brodersen, John

    2011-01-01

    INTRODUCTION: Because of shortage of personnel for the Danish mammography screening programme, the aim of this study was to investigate the attitudes of radiologists and radiographers towards a future implementation of radiographers reading screening mammograms. MATERIALS AND METHODS: Seven...... of managers, and improved working relations. Organization related obstacles: shortage of radiographers and negative attitudes of managers. Professional related possibilities: positive experience with skill mix. Professional related obstacles: worries about negative consequences for the training...... and financial consequences of skill mix. Despite of this all radiologists and radiographers experienced with skill mix were strong advocates for reading radiographers....

  20. Reminder: Bike safety – e-learning module still available!

    CERN Multimedia

    HSE Unit

    2014-01-01

    The “Safe bike riding” e-learning module offered by the Safety Training Section of the HSE Unit is designed for anyone who uses a bike on the CERN site.   The course, which takes around 10 minutes to complete, can be accessed via the SIR application. It presents safety information, such as the road traffic rules, and practical advice, such as the appropriate safety equipment to wear and to have fitted to your bike. Regarding the rules, we would like to remind you that CERN's Safety Code A7 applies to cyclists as well as motorists.  The training module was created by the accident prevention service of the HSE Unit after it was noticed that the number of occupational accidents involving cyclists had been constantly increasing since 2008, with a rise from about 20 in 2009 to about 50 in 2013. Since its launch in September 2013, the course has been taken by more than 670 people. It can be completed at any time, in either English or French. The Safety T...

  1. REMINDER - FRENCH CARDS - NEW PROCEDURE FOR INITIAL APPLICATION

    CERN Multimedia

    Human Resources Division

    2002-01-01

    The Human Resources Division would like to remind members of personnel that they are obliged to submit an application form for a French card as soon as they have a permanent address in either Switzerland or in France and they are actually living there. Following the rationalization of our administrative procedures, as of October 1st, 2002, the initial application procedure for a French card will now be as follows: The member of personnel should complete an application form. If necessary, an application form must also be completed for family members. These forms must then be transferred via e-mail to the appropriate Divisional Administrative Officer (DAO) who will forward them to the Cards Service. In parallel, the member of personnel should submit the necessary supporting documents to the Cards Service. Users are requested to apply for a French card through the Users' Office. The application form (Word format only), the procedural details, the necessary supporting documents as well as the conditions of issue ...

  2. Reminder: Alcohol abuse, road traffic and safety on the site

    CERN Multimedia

    HSE Unit

    2011-01-01

    You are reminded that: - the legal blood alcohol limit in force under the Host States’ traffic regulations (0.5 g per 1000 ml of blood) also applies on the CERN site; - the consumption of alcohol is forbidden during working hours and is only tolerated in the restaurants at certain times, unless an exception is granted for special events (Operational Circular No. 8); - failure to observe these rules may result in disciplinary action by the Organization, independently of any sanctions that may be applicable pursuant to the road traffic regulations of the Host State concerned. Furthermore, the Reception and Access Control Service, the site guards and the Fire Brigade have been instructed to stop any driver in an obvious state of intoxication and to ask him/her to abandon the vehicle on the spot. In case of disagreement, they may also suggest that he/she submits to a voluntary blood alcohol level test at the CERN Medical Service or Fire Brigade. They will also stop and question any obviously intoxicate...

  3. Comparison of Two-dimensional Synthesized Mammograms versus Original Digital Mammograms Alone and in Combination with Tomosynthesis Images

    Science.gov (United States)

    Guo, Ben; Catullo, Victor J.; Chough, Denise M.; Kelly, Amy E.; Lu, Amy H.; Rathfon, Grace Y.; Lee Spangler, Marion; Sumkin, Jules H.; Wallace, Luisa P.; Bandos, Andriy I.

    2014-01-01

    Purpose To assess interpretation performance and radiation dose when two-dimensional synthesized mammography (SM) images versus standard full-field digital mammography (FFDM) images are used alone or in combination with digital breast tomosynthesis images. Materials and Methods A fully crossed, mode-balanced multicase (n = 123), multireader (n = 8), retrospective observer performance study was performed by using deidentified images acquired between 2008 and 2011 with institutional review board approved, HIPAA-compliant protocols, during which each patient signed informed consent. The cohort included 36 cases of biopsy-proven cancer, 35 cases of biopsy-proven benign lesions, and 52 normal or benign cases (Breast Imaging Reporting and Data System [BI-RADS] score of 1 or 2) with negative 1-year follow-up results. Accuracy of sequentially reported probability of malignancy ratings and seven-category forced BI-RADS ratings was evaluated by using areas under the receiver operating characteristic curve (AUCs) in the random-reader analysis. Results Probability of malignancy–based mean AUCs for SM and FFDM images alone was 0.894 and 0.889, respectively (difference, −0.005; 95% confidence interval [CI]: −0.062, 0.054; P = .85). Mean AUC for SM with tomosynthesis and FFDM with tomosynthesis was 0.916 and 0.939, respectively (difference, 0.023; 95% CI: −0.011, 0.057; P = .19). In terms of the reader-specific AUCs, five readers performed better with SM alone versus FFDM alone, and all eight readers performed better with combined FFDM and tomosynthesis (absolute differences from 0.003 to 0.052). Similar results were obtained by using a nonparametric analysis of forced BI-RADS ratings. Conclusion SM alone or in combination with tomosynthesis is comparable in performance to FFDM alone or in combination with tomosynthesis and may eliminate the need for FFDM as part of a routine clinical study. © RSNA, 2014 PMID:24475859

  4. Emotional contrast or compensation? How support reminders influence the pain of acute peer disapproval in preadolescents.

    Science.gov (United States)

    Thomaes, Sander; Sedikides, Constantine; Reijntjes, Albert; Brummelman, Eddie; Bushman, Brad J

    2015-10-01

    When children experience habitual peer difficulties, adults often remind them that many people care about them. How do such reminders of support impact children's emotional responses to acute experiences of peer disapproval? Intuitively, support reminders would exert compensatory effects attenuating the emotional impact of acute disapproval. Theory suggests, however, that support reminders might also lead to contrast effects magnifying the emotional impact of acute disapproval, especially among socially vulnerable children. These opposing perspectives were pitted against each other. In 2 experiments, children (aged 9-13, M(age) = 11.5) were randomly assigned to reflect on their relationships with either supportive others (support condition) or mere acquaintances (control condition). Children experienced acute peer disapproval immediately after (Experiment 1) or before (Experiment 2) the manipulated support reminder. Among children who experienced higher levels of peer difficulties in their daily life, the support reminder increased externalized emotional reactivity and decreased internalized emotional recovery following disapproval. Thus, consistent with emotional contrast theory, support reminders magnified the disapproval-based emotional responses of socially vulnerable children. (c) 2015 APA, all rights reserved).

  5. Vitamin D intake, month the mammogram was taken and mammographic density in Norwegian women aged 50-69.

    Directory of Open Access Journals (Sweden)

    Merete Ellingjord-Dale

    Full Text Available The role of vitamin D in breast cancer etiology is unclear. There is some, but inconsistent, evidence that vitamin D is associated with both breast cancer risk and mammographic density (MD. We evaluated the associations of MD with month the mammogram was taken, and with vitamin D intake, in a population of women from Norway--a country with limited sunlight exposure for a large part of the year.3114 women aged 50-69, who participated in the Norwegian Breast Cancer Screening Program (NBCSP in 2004 or 2006/07, completed risk factor and food frequency (FFQ questionnaires. Dietary and total (dietary plus supplements vitamin D, calcium and energy intakes were estimated by the FFQ. Month when the mammogram was taken was recorded on the mammogram. Percent MD was assessed using a computer assisted method (Madena, University of Southern California after digitization of the films. Linear regression models were used to investigate percent MD associations with month the mammogram was taken, and vitamin D and calcium intakes, adjusting for age, body mass index (BMI, study year, estrogen and progestin therapy (EPT, education, parity, calcium intakes and energy intakes.There was no statistical significant association between the month the mammogram was taken and percent MD. Overall, there was no association between percent MD and quartiles of total or dietary vitamin D intakes, or of calcium intake. However, analysis restricted to women aged <55 years revealed a suggestive inverse association between total vitamin D intake and percent MD (p for trend = 0.03.Overall, we found no strong evidence that month the mammogram was taken was associated with percent MD. We found no inverse association between vitamin D intake and percent MD overall, but observed a suggestive inverse association between dietary vitamin D and MD for women less than 55 years old.

  6. Detection of architectural distortion in prior screening mammograms using Gabor filters, phase portraits, fractal dimension, and texture analysis

    International Nuclear Information System (INIS)

    Rangayyan, Rangaraj M.; Prajna, Shormistha; Ayres, Fabio J.; Desautels, J.E.L.

    2008-01-01

    Mammography is a widely used screening tool for the early detection of breast cancer. One of the commonly missed signs of breast cancer is architectural distortion. The purpose of this study is to explore the application of fractal analysis and texture measures for the detection of architectural distortion in screening mammograms taken prior to the detection of breast cancer. A method based on Gabor filters and phase portrait analysis was used to detect initial candidates for sites of architectural distortion. A total of 386 regions of interest (ROIs) were automatically obtained from 14 ''prior mammograms'', including 21 ROIs related to architectural distortion. From the corresponding set of 14 ''detection mammograms'', 398 ROIs were obtained, including 18 related to breast cancer. For each ROI, the fractal dimension and Haralick's texture features were computed. The fractal dimension of the ROIs was calculated using the circular average power spectrum technique. The average fractal dimension of the normal (false-positive) ROIs was significantly higher than that of the ROIs with architectural distortion (p = 0.006). For the ''prior mammograms'', the best receiver operating characteristics (ROC) performance achieved, in terms of the area under the ROC curve, was 0.80 with a Bayesian classifier using four features including fractal dimension, entropy, sum entropy, and inverse difference moment. Analysis of the performance of the methods with free-response receiver operating characteristics indicated a sensitivity of 0.79 at 8.4 false positives per image in the detection of sites of architectural distortion in the ''prior mammograms''. Fractal dimension offers a promising way to detect the presence of architectural distortion in prior mammograms. (orig.)

  7. Can Australian radiographers assess screening mammograms accurately? First stage results from a four year prospective study

    International Nuclear Information System (INIS)

    Moran, S.; Warren-Forward, H.

    2016-01-01

    Introduction: Globally, the role of the radiographer is changing; some countries have developed advanced roles with specific scopes of practice. Other countries, like Australia, are in the process of this change. The aim of this research is to assess the diagnostic outcomes reported by the radiographers and compare them to those reported by current screen readers. Method: Six experienced radiographers were invited to participate in a prospective study conducted between 2010 and 2011. They were required to read 2000 mammograms each. Their results were compared with those of the radiologists. Statistical analysis of the results included overall cancer detection rates, recall rates, levels of agreement, kappa, sensitivity, specificity, accuracy, positive predictive value and negative predictive value. Results: A total of 9348 women were included in the study. The percentage of cancers detected by the radiographers ranged from 53% to 100% of the cancers detected by the radiologists. Radiologist recall rate ranged between 3.4% and 5.5% and the radiographers' range was 2.9%–9.8%. Level of agreement of the radiographers with the radiologists ranged from 90 to 96%. Conclusion: The potential for accuracy in screen reading by Australian radiographers is supported by the results of this study. Implementation of formal training is likely to result in an increase in the diagnostic accuracy of radiographers. - Highlights: • Radiographers prospectively read 2000 screening mammograms each. • These results support potential for accuracy in screen reading by radiographers. • Will advanced practice be introduced within BreastScreen Australia?.

  8. Multiplexed wavelet transform technique for detection of microcalcification in digitized mammograms.

    Science.gov (United States)

    Mini, M G; Devassia, V P; Thomas, Tessamma

    2004-12-01

    Wavelet transform (WT) is a potential tool for the detection of microcalcifications, an early sign of breast cancer. This article describes the implementation and evaluates the performance of two novel WT-based schemes for the automatic detection of clustered microcalcifications in digitized mammograms. Employing a one-dimensional WT technique that utilizes the pseudo-periodicity property of image sequences, the proposed algorithms achieve high detection efficiency and low processing memory requirements. The detection is achieved from the parent-child relationship between the zero-crossings [Marr-Hildreth (M-H) detector] /local extrema (Canny detector) of the WT coefficients at different levels of decomposition. The detected pixels are weighted before the inverse transform is computed, and they are segmented by simple global gray level thresholding. Both detectors produce 95% detection sensitivity, even though there are more false positives for the M-H detector. The M-H detector preserves the shape information and provides better detection sensitivity for mammograms containing widely distributed calcifications.

  9. ELM BASED CAD SYSTEM TO CLASSIFY MAMMOGRAMS BY THE COMBINATION OF CLBP AND CONTOURLET

    Directory of Open Access Journals (Sweden)

    S Venkatalakshmi

    2017-05-01

    Full Text Available Breast cancer is a serious life threat to the womanhood, worldwide. Mammography is the promising screening tool, which can show the abnormality being detected. However, the physicians find it difficult to detect the affected regions, as the size of microcalcifications is very small. Hence it would be better, if a CAD system can accompany the physician in detecting the malicious regions. Taking this as a challenge, this paper presents a CAD system for mammogram classification which is proven to be accurate and reliable. The entire work is decomposed into four different stages and the outcome of a phase is passed as the input of the following phase. Initially, the mammogram is pre-processed by adaptive median filter and the segmentation is done by GHFCM. The features are extracted by combining the texture feature descriptors Completed Local Binary Pattern (CLBP and contourlet to frame the feature sets. In the training phase, Extreme Learning Machine (ELM is trained with the feature sets. During the testing phase, the ELM can classify between normal, malignant and benign type of cancer. The performance of the proposed approach is analysed by varying the classifier, feature extractors and parameters of the feature extractor. From the experimental analysis, it is evident that the proposed work outperforms the analogous techniques in terms of accuracy, sensitivity and specificity.

  10. Similarity estimation for reference image retrieval in mammograms using convolutional neural network

    Science.gov (United States)

    Muramatsu, Chisako; Higuchi, Shunichi; Morita, Takako; Oiwa, Mikinao; Fujita, Hiroshi

    2018-02-01

    Periodic breast cancer screening with mammography is considered effective in decreasing breast cancer mortality. For screening programs to be successful, an intelligent image analytic system may support radiologists' efficient image interpretation. In our previous studies, we have investigated image retrieval schemes for diagnostic references of breast lesions on mammograms and ultrasound images. Using a machine learning method, reliable similarity measures that agree with radiologists' similarity were determined and relevant images could be retrieved. However, our previous method includes a feature extraction step, in which hand crafted features were determined based on manual outlines of the masses. Obtaining the manual outlines of masses is not practical in clinical practice and such data would be operator-dependent. In this study, we investigated a similarity estimation scheme using a convolutional neural network (CNN) to skip such procedure and to determine data-driven similarity scores. By using CNN as feature extractor, in which extracted features were employed in determination of similarity measures with a conventional 3-layered neural network, the determined similarity measures were correlated well with the subjective ratings and the precision of retrieving diagnostically relevant images was comparable with that of the conventional method using handcrafted features. By using CNN for determination of similarity measure directly, the result was also comparable. By optimizing the network parameters, results may be further improved. The proposed method has a potential usefulness in determination of similarity measure without precise lesion outlines for retrieval of similar mass images on mammograms.

  11. Regions of micro-calcifications clusters detection based on new features from imbalance data in mammograms

    Science.gov (United States)

    Wang, Keju; Dong, Min; Yang, Zhen; Guo, Yanan; Ma, Yide

    2017-02-01

    Breast cancer is the most common cancer among women. Micro-calcification cluster on X-ray mammogram is one of the most important abnormalities, and it is effective for early cancer detection. Surrounding Region Dependence Method (SRDM), a statistical texture analysis method is applied for detecting Regions of Interest (ROIs) containing microcalcifications. Inspired by the SRDM, we present a method that extract gray and other features which are effective to predict the positive and negative regions of micro-calcifications clusters in mammogram. By constructing a set of artificial images only containing micro-calcifications, we locate the suspicious pixels of calcifications of a SRDM matrix in original image map. Features are extracted based on these pixels for imbalance date and then the repeated random subsampling method and Random Forest (RF) classifier are used for classification. True Positive (TP) rate and False Positive (FP) can reflect how the result will be. The TP rate is 90% and FP rate is 88.8% when the threshold q is 10. We draw the Receiver Operating Characteristic (ROC) curve and the Area Under the ROC Curve (AUC) value reaches 0.9224. The experiment indicates that our method is effective. A novel regions of micro-calcifications clusters detection method is developed, which is based on new features for imbalance data in mammography, and it can be considered to help improving the accuracy of computer aided diagnosis breast cancer.

  12. Digitized mammograms

    International Nuclear Information System (INIS)

    Bruneton, J.N.; Balu-Maestro, C.; Rogopoulos, A.; Chauvel, C.; Geoffray, A.

    1988-01-01

    Two observers conducted a blind evaluation of 100 mammography files, including 47 malignant cases. Films were read both before and after image digitization at 50 μm and 100 μm with the FilmDRSII. Digitization permitted better analysis of the normal anatomic structures and moderately improved diagnostic sensitivity. Searches for microcalcifications before and after digitization at 100 μm and 50 μm showed better analysis of anatomic structures after digitization (especially for solitary microcalcifications). The diagnostic benefit, with discovery of clustered microcalcifications, was more limited (one case at 100 μm, nine cases at 50 μm). Recognition of microcalcifications was clearly improved in dense breasts, which can benefit from reinterpretation after digitization at 50 μm rather 100μm

  13. 4D co-registration of X-ray and MR-mammograms: initial clinical results and potential incremental diagnostic value.

    Science.gov (United States)

    Dietzel, Matthias; Hopp, Torsten; Ruiter, Nicole V; Kaiser, Clemens G; Kaiser, Werner A; Baltzer, Pascal A

    2015-01-01

    4D co-registration of X-ray- and MR-mammograms (XM and MM) is a new method of image fusion. The present study aims to evaluate its clinical feasibility, radiological accuracy, and potential clinical value. XM and MM of 25 patients were co-registered. Results were evaluated by a blinded reader. Precision of the 4D co-registration was "very good" (mean-score [ms]=7), and lesions were "easier to delineate" (ms=5). In 88.8%, "relevant additional diagnostic information" was present, accounting for a more "confident diagnosis" in 76% (ms=5). 4D co-registration is feasible, accurate, and of potential clinical value. Copyright © 2015 Elsevier Inc. All rights reserved.

  14. The effectiveness of computer reminders versus postal reminders for improving quality assessment for point-of-care testing in primary care

    DEFF Research Database (Denmark)

    Siersma, Volkert; Kousgaard, Marius Brostrøm; Reventlow, Susanne

    2015-01-01

    Rationale, aims and objectives: This study aimed to evaluate the relative effectiveness of electronic and postal reminders for increasing adherence to the quality assurance programme for the international normalized ratio (INR) point-of-care testing (POCT) device inprimary care. Methods: All 213...... family practices that use the Elective Laboratory of the Capital Region, Denmark, and regularly conduct INR POCT were randomly allocated into two similarly sized groups. During the 4-month intervention, these practices were sent either computer reminders (ComRem) or computer generated postal reminders...... (Postal) if they did not perform a split test to check the quality of their INR POCT for each calendar month. The adherence of the practices was tracked during the subsequent 8 months subdivided into two 4-month periods both without intervention. Outcomes were measures of split test procedure adherence...

  15. Diagnostic omission errors in acute paediatric practice: impact of a reminder system on decision-making

    Directory of Open Access Journals (Sweden)

    Fisher Helen

    2006-11-01

    Full Text Available Abstract Background Diagnostic error is a significant problem in specialities characterised by diagnostic uncertainty such as primary care, emergency medicine and paediatrics. Despite wide-spread availability, computerised aids have not been shown to significantly improve diagnostic decision-making in a real world environment, mainly due to the need for prolonged system consultation. In this study performed in the clinical environment, we used a Web-based diagnostic reminder system that provided rapid advice with free text data entry to examine its impact on clinicians' decisions in an acute paediatric setting during assessments characterised by diagnostic uncertainty. Methods Junior doctors working over a 5-month period at four paediatric ambulatory units consulted the Web-based diagnostic aid when they felt the need for diagnostic assistance. Subjects recorded their clinical decisions for patients (differential diagnosis, test-ordering and treatment before and after system consultation. An expert panel of four paediatric consultants independently suggested clinically significant decisions indicating an appropriate and 'safe' assessment. The primary outcome measure was change in the proportion of 'unsafe' workups by subjects during patient assessment. A more sensitive evaluation of impact was performed using specific validated quality scores. Adverse effects of consultation on decision-making, as well as the additional time spent on system use were examined. Results Subjects attempted to access the diagnostic aid on 595 occasions during the study period (8.6% of all medical assessments; subjects examined diagnostic advice only in 177 episodes (30%. Senior House Officers at hospitals with greater number of available computer workstations in the clinical area were most likely to consult the system, especially out of working hours. Diagnostic workups construed as 'unsafe' occurred in 47/104 cases (45.2%; this reduced to 32.7% following system

  16. Use of automated reminder letters to improve diabetes management in primary care: outcomes of a quality improvement initiative.

    Science.gov (United States)

    Berryman, Sally H; Sick, Brian T; Wang, Qi; Swan, Paul J; Weber-Main, Anne Marie

    2013-01-01

    Effective management of patients with diabetes mellitus (DM) can be time-consuming and costly. One patient-centred quality improvement strategy is to generate reminder letters to prompt patient action(s), but this strategy's effect on DM outcomes is uncertain. To determine whether using the electronic medical record to automatically generate reminder letters for patients not meeting recommended DM targets is associated with improvement in practice level quality metrics for DM management. Over 15 months, letters were sent monthly to all patients with DM in a large, urban, primary care teaching practice whose records for haemoglobin A1c (HbA1c), low-density lipoprotein (LDL) or blood pressure (BP) indicated non-compliance with recommended levels and testing intervals. Logistic regression was used to analyse cross-sectional, practice-level differences in the proportion of patients meeting DM quality metrics (HbA1c < 7%, LDL < 100 mg/dl and BP < 130/80 mmHg; rates of checking each value within the last 12 months; and a composite of these five measures) across four time points: six months before the intervention, start of the intervention, end of the 15-month intervention period and six months after the intervention. The number of letters sent per month ranged from 284 to 392, representing 28-38% of all patients with DM. At the end of the intervention, patients' odds of being at goal were higher than before the intervention began for LDL < 100 mg/dl, and for HbA1c and LDL tested once within the last 12 months (or 1.24, P = 0.005; or 1.35, P = 0.03; or 1.48, P < 0.001, respectively). Post intervention, declines were seen in LDL checked within the last 12 months (or 0.76, P = 0.003) and in the composite endpoint (or 0.78, P = 0.005). The automated patient-reminder letter intervention was associated with modest improvements in several, but not all DM measures. This approach may be an effective tool for improving quality of care for patients with DM.

  17. Persuasive texts for prompting action: Agency assignment in HPV vaccination reminders.

    Science.gov (United States)

    McGlone, Matthew S; Stephens, Keri K; Rodriguez, Serena A; Fernandez, Maria E

    2017-08-03

    Vaccination reminders must both inform and persuade, and text messages designed for this purpose must do so in 160 characters or less. We tested a strategy for improving the impact of HPV vaccination text message reminders through strategic wording. In an experiment conducted in community settings, 167 Spanish-speaking Latina mothers reviewed text message reminders that assigned the cause or "agency" for HPV transmission to their daughters or the virus, and assigned protection agency to the mothers or the vaccine. Reminder messages framing transmission as an action of the virus prompted mothers to perceive the threat as more severe than messages describing their daughters as the cause. Assigning transmission agency to the virus also held a persuasive advantage in boosting mothers' intentions to seek vaccination, particularly when the message cast mothers as agents of protection rather than the vaccine. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Effectiveness of Ford's belt reminder system in increasing seat belt use

    OpenAIRE

    Williams, A; Wells, J; Farmer, C

    2002-01-01

    Objectives: The study investigated the effectiveness in increasing seat belt use of Ford's belt reminder system, a supplementary system that provides intermittent flashing lights and chimes for five minutes if drivers are not belted.

  19. 78 FR 65427 - Pipeline Safety: Reminder of Requirements for Liquefied Petroleum Gas and Utility Liquefied...

    Science.gov (United States)

    2013-10-31

    ... DEPARTMENT OF TRANSPORTATION Pipeline and Hazardous Materials Safety Administration [Docket No. PHMSA-2013-0097] Pipeline Safety: Reminder of Requirements for Liquefied Petroleum Gas and Utility Liquefied Petroleum Gas Pipeline Systems AGENCY: Pipeline and Hazardous Materials Safety Administration...

  20. Contextual reminders fail to trigger memory reconsolidation in aged rats and aged humans.

    Science.gov (United States)

    Jones, Bethany J; Pest, Stacey M; Vargas, Iliana M; Glisky, Elizabeth L; Fellous, Jean-Marc

    2015-04-01

    There is strong evidence that hippocampal memory returns to a labile state upon reactivation, initiating a reconsolidation process that restabilizes it and allows for its updating. Normal aging is associated with deficits in episodic memory processes. However, the effects of aging on memory reconsolidation and its neural substrate remain largely unknown, and an animal model is lacking. In this study we investigated the effects of aging on context-dependent reconsolidation using an episodic set-learning task in humans and an analogous set-learning spatial task in rats. In both tasks, young and older subjects learned a set of objects (humans) or feeder locations (rats; Set 1) in Context A on Day 1. On Day 2, a different set (Set 2) was learned in either Context A (Reminder condition) or Context B (No Reminder condition). On Day 3, subjects were instructed (humans) or cued (rats) to recall Set 1. Young rats and humans in the Reminder condition falsely recalled significantly more items from Set 2 than those in the No Reminder condition, suggesting that the reminder context triggered a reactivation of Set 1 on Day 2 and allowed the integration of Set 2 items into Set 1. In both species, older subjects displayed a different pattern of results than young subjects. In aged rats, there was no difference between conditions in the level of falsely recalled Set 2 items (intrusions). Older humans in the No Reminder condition made significantly more intrusions than those in the Reminder condition. Follow-up control experiments in aged rats suggested that intrusions in older animals reflected general interference, independent of context manipulations. We conclude that contextual reminders are not sufficient to trigger memory updating in aged rats or aged humans, unlike in younger individuals. Future studies using this animal model should further our understanding of the role of the hippocampus in memory maintenance and updating during normal aging. Copyright © 2015 Elsevier Inc

  1. Automated registration of diagnostic to prediagnostic x-ray mammograms: Evaluation and comparison to radiologists' accuracy

    International Nuclear Information System (INIS)

    Pinto Pereira, Snehal M.; Hipwell, John H.; McCormack, Valerie A.; Tanner, Christine; Moss, Sue M.; Wilkinson, Louise S.; Khoo, Lisanne A. L.; Pagliari, Catriona; Skippage, Pippa L.; Kliger, Carole J.; Hawkes, David J.; Santos Silva, Isabel M. dos

    2010-01-01

    Purpose: To compare and evaluate intensity-based registration methods for computation of serial x-ray mammogram correspondence. Methods: X-ray mammograms were simulated from MRIs of 20 women using finite element methods for modeling breast compressions and employing a MRI/x-ray appearance change model. The parameter configurations of three registration methods, affine, fluid, and free-form deformation (FFD), were optimized for registering x-ray mammograms on these simulated images. Five mammography film readers independently identified landmarks (tumor, nipple, and usually two other normal features) on pairs of diagnostic and corresponding prediagnostic digitized images from 52 breast cancer cases. Landmarks were independently reidentified by each reader. Target registration errors were calculated to compare the three registration methods using the reader landmarks as a gold standard. Data were analyzed using multilevel methods. Results: Between-reader variability varied with landmark (p<0.01) and screen (p=0.03), with between-reader mean distance (mm) in point location on the diagnostic/prediagnostic images of 2.50 (95% CI 1.95, 3.15)/2.84 (2.24, 3.55) for nipples and 4.26 (3.43, 5.24)/4.76 (3.85, 5.84) for tumors. Registration accuracy was sensitive to the type of landmark and the amount of breast density. For dense breasts (≥40%), the affine and fluid methods outperformed FFD. For breasts with lower density, the affine registration surpassed both fluid and FFD. Mean accuracy (mm) of the affine registration varied between 3.16 (95% CI 2.56, 3.90) for nipple points in breasts with density 20%-39% and 5.73 (4.80, 6.84) for tumor points in breasts with density <20%. Conclusions: Affine registration accuracy was comparable to that between independent film readers. More advanced two-dimensional nonrigid registration algorithms were incapable of increasing the accuracy of image alignment when compared to affine registration.

  2. Computer aided detection of clusters of microcalcifications on full field digital mammograms

    International Nuclear Information System (INIS)

    Ge Jun; Sahiner, Berkman; Hadjiiski, Lubomir M.; Chan, H.-P.; Wei Jun; Helvie, Mark A.; Zhou Chuan

    2006-01-01

    We are developing a computer-aided detection (CAD) system to identify microcalcification clusters (MCCs) automatically on full field digital mammograms (FFDMs). The CAD system includes six stages: preprocessing; image enhancement; segmentation of microcalcification candidates; false positive (FP) reduction for individual microcalcifications; regional clustering; and FP reduction for clustered microcalcifications. At the stage of FP reduction for individual microcalcifications, a truncated sum-of-squares error function was used to improve the efficiency and robustness of the training of an artificial neural network in our CAD system for FFDMs. At the stage of FP reduction for clustered microcalcifications, morphological features and features derived from the artificial neural network outputs were extracted from each cluster. Stepwise linear discriminant analysis (LDA) was used to select the features. An LDA classifier was then used to differentiate clustered microcalcifications from FPs. A data set of 96 cases with 192 images was collected at the University of Michigan. This data set contained 96 MCCs, of which 28 clusters were proven by biopsy to be malignant and 68 were proven to be benign. The data set was separated into two independent data sets for training and testing of the CAD system in a cross-validation scheme. When one data set was used to train and validate the convolution neural network (CNN) in our CAD system, the other data set was used to evaluate the detection performance. With the use of a truncated error metric, the training of CNN could be accelerated and the classification performance was improved. The CNN in combination with an LDA classifier could substantially reduce FPs with a small tradeoff in sensitivity. By using the free-response receiver operating characteristic methodology, it was found that our CAD system can achieve a cluster-based sensitivity of 70, 80, and 90 % at 0.21, 0.61, and 1.49 FPs/image, respectively. For case

  3. Simultaneous detection and classification of breast masses in digital mammograms via a deep learning YOLO-based CAD system.

    Science.gov (United States)

    Al-Masni, Mohammed A; Al-Antari, Mugahed A; Park, Jeong-Min; Gi, Geon; Kim, Tae-Yeon; Rivera, Patricio; Valarezo, Edwin; Choi, Mun-Taek; Han, Seung-Moo; Kim, Tae-Seong

    2018-04-01

    Automatic detection and classification of the masses in mammograms are still a big challenge and play a crucial role to assist radiologists for accurate diagnosis. In this paper, we propose a novel Computer-Aided Diagnosis (CAD) system based on one of the regional deep learning techniques, a ROI-based Convolutional Neural Network (CNN) which is called You Only Look Once (YOLO). Although most previous studies only deal with classification of masses, our proposed YOLO-based CAD system can handle detection and classification simultaneously in one framework. The proposed CAD system contains four main stages: preprocessing of mammograms, feature extraction utilizing deep convolutional networks, mass detection with confidence, and finally mass classification using Fully Connected Neural Networks (FC-NNs). In this study, we utilized original 600 mammograms from Digital Database for Screening Mammography (DDSM) and their augmented mammograms of 2,400 with the information of the masses and their types in training and testing our CAD. The trained YOLO-based CAD system detects the masses and then classifies their types into benign or malignant. Our results with five-fold cross validation tests show that the proposed CAD system detects the mass location with an overall accuracy of 99.7%. The system also distinguishes between benign and malignant lesions with an overall accuracy of 97%. Our proposed system even works on some challenging breast cancer cases where the masses exist over the pectoral muscles or dense regions. Copyright © 2018 Elsevier B.V. All rights reserved.

  4. Impact of second reminder invitation on uptake of screening and cancer detection in BreastCheck.

    LENUS (Irish Health Repository)

    Fleming, P

    2012-01-01

    This research aims to quantify the impact of reminder invitations on uptake and cancer detection in Ireland. Examination of BreastCheck\\'s clinical database (2000-2010) to determine number of women screened following first invitation and after reminder; comparison by age group and screening phase with outcomes of recall rate, cancer detection and true positive rates. Of 819,182 first invitations sent 448,974 (54.8%) women attended. 245,157 (66.2%) women attended after reminder invitations, increasing uptake by 29.9% to 694,131 (84.7%) and cancers detected by 1,550 (35%). Women awaiting a reminder were less likely recalled for assessment 9,555 (3.9%) than respondents to first invitation 2,887 (4.04%) (p=0.004). Younger, mainly initial women were more likely recalled for assessment after first invitation. There was no difference between cohorts for cancer detection rate or true positive rate. Reminders increased uptake, supporting international evidence. For programme efficiency attendance at first invitation is optimal. For maximum programme effectiveness attendance must be encouraged with reminders.

  5. Online guideline assist in intensive care medicine--is the login-authentication a sufficient trigger for reminders?

    Science.gov (United States)

    Röhrig, Rainer; Meister, Markus; Michel-Backofen, Achim; Sedlmayr, Martin; Uphus, Dirk; Katzer, Christian; Rose, Thomas

    2006-01-01

    Rising cost pressure due to the implementation of the DRG-System and quality assurance lead to an increased use of therapy standards and standard operating procedures (SOPs) in intensive care medicine. The intention of the German Scientific Society supported project "OLGA" (Online Guideline Assist) is to develop a prototype of a knowledge based system supporting physicians of an intensive care unit in recognizing the indication for and selecting a specific guideline or SOP. While the response of the prototype on user entries can be displayed as a signal on the used workstation itself, the location and time for a reminder of scheduled or missed procedures or reactions to imported information is a difficult issue. One possible approach to this task is the display of non acknowledged reminders or recommendations while logging on to a system. The objective of this study is to analyse user behaviour of the physicians working on the surgical intensive care unit to decide whether the login authentication is a sufficient trigger for clinical reminding. The surgical intensive care unit examined in this study comprises 14 beds. Medical care is provided by physicians working in shifts 24 hours a day, 7 days a week, with two anaesthetists at a time and an additional senior consultant during daytime. The entire documentation (examinations, medication, orders, care) is performed using the patient data management system ICUData. The authentication process of the physicians was logged and analysed. Throughout the observation period from December 13th 2005 to January 11th 2006 3563 physician logins were counted in total. The mean span between logins was in 11.3 minutes (SD 14.4), the median 7 minutes. The 75% centile was 14 minutes, the 95% centile 38 min. Intervals greater than 60 minutes occurred in 75%, and greater than 90 minutes in 25% of the days. It seems reasonable that reminders sent during authentication are able to enforce workflow compliance. It is possible to send

  6. Double versus single reading of mammograms in a breast cancer screening programme: a cost-consequence analysis.

    Science.gov (United States)

    Posso, Margarita C; Puig, Teresa; Quintana, Ma Jesus; Solà-Roca, Judit; Bonfill, Xavier

    2016-09-01

    To assess the costs and health-related outcomes of double versus single reading of digital mammograms in a breast cancer screening programme. Based on data from 57,157 digital screening mammograms from women aged 50-69 years, we compared costs, false-positive results, positive predictive value and cancer detection rate using four reading strategies: double reading with and without consensus and arbitration, and single reading with first reader only and second reader only. Four highly trained radiologists read the mammograms. Double reading with consensus and arbitration was 15 % (Euro 334,341) more expensive than single reading with first reader only. False-positive results were more frequent at double reading with consensus and arbitration than at single reading with first reader only (4.5 % and 4.2 %, respectively; p cancer detection rate were similar for both reading strategies (4.6 and 4.2 per 1000 screens; p = 0.283). Our results suggest that changing to single reading of mammograms could produce savings in breast cancer screening. Single reading could reduce the frequency of false-positive results without changing the cancer detection rate. These results are not conclusive and cannot be generalized to other contexts with less trained radiologists. • Double reading of digital mammograms is more expensive than single reading. • Compared to single reading, double reading yields a higher proportion of false-positive results. • The cancer detection rate was similar for double and single readings. • Single reading may be a cost-effective strategy in breast cancer screening programmes.

  7. Block-based wavelet transform coding of mammograms with region-adaptive quantization

    Science.gov (United States)

    Moon, Nam Su; Song, Jun S.; Kwon, Musik; Kim, JongHyo; Lee, ChoongWoong

    1998-06-01

    To achieve both high compression ratio and information preserving, it is an efficient way to combine segmentation and lossy compression scheme. Microcalcification in mammogram is one of the most significant sign of early stage of breast cancer. Therefore in coding, detection and segmentation of microcalcification enable us to preserve it well by allocating more bits to it than to other regions. Segmentation of microcalcification is performed both in spatial domain and in wavelet transform domain. Peak error controllable quantization step, which is off-line designed, is suitable for medical image compression. For region-adaptive quantization, block- based wavelet transform coding is adopted and different peak- error-constrained quantizers are applied to blocks according to the segmentation result. In view of preservation of microcalcification, the proposed coding scheme shows better performance than JPEG.

  8. Case base classification on digital mammograms: improving the performance of case base classifier

    Science.gov (United States)

    Raman, Valliappan; Then, H. H.; Sumari, Putra; Venkatesa Mohan, N.

    2011-10-01

    Breast cancer continues to be a significant public health problem in the world. Early detection is the key for improving breast cancer prognosis. The aim of the research presented here is in twofold. First stage of research involves machine learning techniques, which segments and extracts features from the mass of digital mammograms. Second level is on problem solving approach which includes classification of mass by performance based case base classifier. In this paper we build a case-based Classifier in order to diagnose mammographic images. We explain different methods and behaviors that have been added to the classifier to improve the performance of the classifier. Currently the initial Performance base Classifier with Bagging is proposed in the paper and it's been implemented and it shows an improvement in specificity and sensitivity.

  9. Abnormality detection of mammograms by discriminative dictionary learning on DSIFT descriptors.

    Science.gov (United States)

    Tavakoli, Nasrin; Karimi, Maryam; Nejati, Mansour; Karimi, Nader; Reza Soroushmehr, S M; Samavi, Shadrokh; Najarian, Kayvan

    2017-07-01

    Detection and classification of breast lesions using mammographic images are one of the most difficult studies in medical image processing. A number of learning and non-learning methods have been proposed for detecting and classifying these lesions. However, the accuracy of the detection/classification still needs improvement. In this paper we propose a powerful classification method based on sparse learning to diagnose breast cancer in mammograms. For this purpose, a supervised discriminative dictionary learning approach is applied on dense scale invariant feature transform (DSIFT) features. A linear classifier is also simultaneously learned with the dictionary which can effectively classify the sparse representations. Our experimental results show the superior performance of our method compared to existing approaches.

  10. A new approach to develop computer-aided detection schemes of digital mammograms

    Science.gov (United States)

    Tan, Maxine; Qian, Wei; Pu, Jiantao; Liu, Hong; Zheng, Bin

    2015-06-01

    The purpose of this study is to develop a new global mammographic image feature analysis based computer-aided detection (CAD) scheme and evaluate its performance in detecting positive screening mammography examinations. A dataset that includes images acquired from 1896 full-field digital mammography (FFDM) screening examinations was used in this study. Among them, 812 cases were positive for cancer and 1084 were negative or benign. After segmenting the breast area, a computerized scheme was applied to compute 92 global mammographic tissue density based features on each of four mammograms of the craniocaudal (CC) and mediolateral oblique (MLO) views. After adding three existing popular risk factors (woman’s age, subjectively rated mammographic density, and family breast cancer history) into the initial feature pool, we applied a sequential forward floating selection feature selection algorithm to select relevant features from the bilateral CC and MLO view images separately. The selected CC and MLO view image features were used to train two artificial neural networks (ANNs). The results were then fused by a third ANN to build a two-stage classifier to predict the likelihood of the FFDM screening examination being positive. CAD performance was tested using a ten-fold cross-validation method. The computed area under the receiver operating characteristic curve was AUC = 0.779   ±   0.025 and the odds ratio monotonically increased from 1 to 31.55 as CAD-generated detection scores increased. The study demonstrated that this new global image feature based CAD scheme had a relatively higher discriminatory power to cue the FFDM examinations with high risk of being positive, which may provide a new CAD-cueing method to assist radiologists in reading and interpreting screening mammograms.

  11. Hough transform for clustered microcalcifications detection in full-field digital mammograms

    Science.gov (United States)

    Fanizzi, A.; Basile, T. M. A.; Losurdo, L.; Amoroso, N.; Bellotti, R.; Bottigli, U.; Dentamaro, R.; Didonna, V.; Fausto, A.; Massafra, R.; Moschetta, M.; Tamborra, P.; Tangaro, S.; La Forgia, D.

    2017-09-01

    Many screening programs use mammography as principal diagnostic tool for detecting breast cancer at a very early stage. Despite the efficacy of the mammograms in highlighting breast diseases, the detection of some lesions is still doubtless for radiologists. In particular, the extremely minute and elongated salt-like particles of microcalcifications are sometimes no larger than 0.1 mm and represent approximately half of all cancer detected by means of mammograms. Hence the need for automatic tools able to support radiologists in their work. Here, we propose a computer assisted diagnostic tool to support radiologists in identifying microcalcifications in full (native) digital mammographic images. The proposed CAD system consists of a pre-processing step, that improves contrast and reduces noise by applying Sobel edge detection algorithm and Gaussian filter, followed by a microcalcification detection step performed by exploiting the circular Hough transform. The procedure performance was tested on 200 images coming from the Breast Cancer Digital Repository (BCDR), a publicly available database. The automatically detected clusters of microcalcifications were evaluated by skilled radiologists which asses the validity of the correctly identified regions of interest as well as the system error in case of missed clustered microcalcifications. The system performance was evaluated in terms of Sensitivity and False Positives per images (FPi) rate resulting comparable to the state-of-art approaches. The proposed model was able to accurately predict the microcalcification clusters obtaining performances (sensibility = 91.78% and FPi rate = 3.99) which favorably compare to other state-of-the-art approaches.

  12. Barriers to the use of reminder/recall interventions for immunizations: a systematic review

    Directory of Open Access Journals (Sweden)

    Pereira Jennifer A

    2012-12-01

    Full Text Available Abstract Background Although many studies have demonstrated the benefits of reminder/recall (RR measures to address patient under-immunization and improve immunization coverage, they are not widely implemented by healthcare providers. We identified providers’ perceived barriers to their use from existing literature. Methods We conducted a systematic review of relevant articles published in English between January 1990 and July 2011 that examined the perceptions of healthcare providers regarding barriers to tracking patient immunization history and implementing RR interventions. We searched MEDLINE, PubMed, EMBASE, Cumulative Index to Nursing and Allied Health Literature, Academic Search Premier, and PsychINFO. Additional strategies included hand-searching the references of pertinent articles and related reviews, and searching keywords in Google Scholar and Google. Results Ten articles were included; all described populations in the United States, and examined perceptions of family physicians, pediatricians, and other immunization staff. All articles were of moderate-high methodological quality; the majority (n=7 employed survey methodology. The most frequently described barriers involved the perceived human and financial resources associated with implementing an RR intervention, as well as low confidence in the accuracy of patient immunization records, given the lack of data sharing between multiple immunization providers. Changes to staff workflow, lack of appropriate electronic patient-tracking functionalities, and uncertainty regarding the success of RR interventions were also viewed as barriers to their adoption. Conclusions Although transitioning to electronic immunization records and registries should facilitate the implementation of RR interventions, numerous perceived barriers must still be overcome before the full benefits of these methods can be realized.

  13. BRBN-T validation: adaptation of the Selective Reminding Test and Word List Generation

    Directory of Open Access Journals (Sweden)

    Mariana Rigueiro Neves

    2015-10-01

    Full Text Available Objective This study aims to present the Selective Reminding Test(SRT and Word List Generation (WLG adaptation to the Portuguese population, within the validation of the Brief Repeatable Battery of Neuropsychological Tests (BRBN-Tfor multiple sclerosis (MS patients.Method 66 healthy participants (54.5% female recruited from the community volunteered to participate in this study.Results A combination of procedures from Classical Test Theory (CTT and Item Response Theory (ITR were applied to item analysis and selection. For each SRT list, 12 words were selected and 3 letters were chosen for WLG to constitute the final versions of these tests for the Portuguese population.Conclusion The combination of CTT and ITR maximized the decision making process in the adaptation of the SRT and WLG to a different culture and language (Portuguese. The relevance of this study lies on the production of reliable standardized neuropsychological tests, so that they can be used to facilitate a more rigorous monitoring of the evolution of MS, as well as any therapeutic effects and cognitive rehabilitation.

  14. "There's no billing code for empathy" - Animated comics remind medical students of empathy: a qualitative study.

    Science.gov (United States)

    Tsao, Pamela; Yu, Catherine H

    2016-08-12

    Physician empathy is associated with improved diabetes outcomes. However, empathy declines throughout medical school training. This study seeks to describe how comics on diabetes affect learning processes for empathy in medical students. All first- or second-year students at a Canadian medical school were invited to provide written reflections on two comics regarding diabetes and participate in a focus group. Responses were analyzed qualitatively for emergent themes. Students completed the Jefferson Scale of Physician Empathy (JSPE) at baseline, after the comic, and after the focus group. Linear mixed model statistical analyses were performed. Thirteen first-year and 12 second-year students participated. Qualitative analysis revealed four themes: 1) Empathy decline and its barriers; 2) Impact of the comic and focus group on knowledge, attitudes and skills; 3) Role of the comic in the curriculum as a reminder tool of the importance of empathy; 4) Comics as an effective medium. Baseline mean JSPE scores were 116.4 (SD 10.5) and trended up to 117.2 (SD 12.5) and 119.6 (SD 15.2) after viewing the comics and participating in the focus groups, respectively (p = 0.08). Animated comics on diabetes are novel methods of reminding students about empathy by highlighting the patient perspective.

  15. SMS-reminder for vaccination in Africa: research from published, unpublished and grey literature.

    Science.gov (United States)

    Manakongtreecheep, Kasidet

    2017-01-01

    Immunization for children against vaccine-preventable diseases is one of the most important health intervention method in the world, both in terms of its health impact and cost-effectiveness. Through EPI and various other programs such as the Decades of Vaccines, immunization has been improving the health of children around the world. However, this progress falls short of global immunization targets of the Global Vaccine Action Plan (GVAP). Furthermore, the African region still lags behind in immunization, and suffers from a high proportion of vaccine preventable diseases as a result. Reminders and recall for vaccination have been shown to improve health care-seeking behaviours, and have been recommended for application in routine and supplemental measles immunization activities. With mobile phones becoming more accessible in Africa, SMS vaccine reminder system has been proposed as a convenient and easily scalable way to inform caregivers of the disease and the importance of immunization, to address any concerns related to immunization safety, and to remind them of vaccination schedules and campaigns. There have been 6 published articles and 1 unpublished article on the effect of SMS reminder system for immunization in Africa. The studies done has shown that SMS vaccination reminder has led to improvements in vaccination uptakes in various metrics, whether is through the increase in vaccination coverage, decrease in dropout rates, increase in completion rate, or decrease in delay for vaccination.

  16. Redesign of a computerized clinical reminder for colorectal cancer screening: a human-computer interaction evaluation

    Directory of Open Access Journals (Sweden)

    Saleem Jason J

    2011-11-01

    Full Text Available Abstract Background Based on barriers to the use of computerized clinical decision support (CDS learned in an earlier field study, we prototyped design enhancements to the Veterans Health Administration's (VHA's colorectal cancer (CRC screening clinical reminder to compare against the VHA's current CRC reminder. Methods In a controlled simulation experiment, 12 primary care providers (PCPs used prototypes of the current and redesigned CRC screening reminder in a within-subject comparison. Quantitative measurements were based on a usability survey, workload assessment instrument, and workflow integration survey. We also collected qualitative data on both designs. Results Design enhancements to the VHA's existing CRC screening clinical reminder positively impacted aspects of usability and workflow integration but not workload. The qualitative analysis revealed broad support across participants for the design enhancements with specific suggestions for improving the reminder further. Conclusions This study demonstrates the value of a human-computer interaction evaluation in informing the redesign of information tools to foster uptake, integration into workflow, and use in clinical practice.

  17. Intralenticular foreign body: a D-Day reminder.

    Science.gov (United States)

    Dhawahir-Scala, Felipe E; Kamal, A

    2005-12-01

    Intralenticular foreign bodies are not uncommon after penetrating eye injuries. This is an observational case report where a patient was found to have an embedded lenticular foreign body for more than 60 years. Following such a long period of time the patient has not experienced any significant cataract formation or compromised ocular function due to the foreign body.

  18. Anticipating divine protection? Reminders of god can increase nonmoral risk taking.

    Science.gov (United States)

    Kupor, Daniella M; Laurin, Kristin; Levav, Jonathan

    2015-04-01

    Religiosity and participation in religious activities have been linked with decreased risky behavior. In the current research, we hypothesized that exposure to the concept of God can actually increase people's willingness to engage in certain types of risks. Across seven studies, reminders of God increased risk taking in nonmoral domains. This effect was mediated by the perceived danger of a risky option and emerged more strongly among individuals who perceive God as a reliable source of safety and protection than among those who do not. Moreover, in an eighth study, when participants were first reminded of God and then took a risk that produced negative consequences (i.e., when divine protection failed to materialize), participants reported feeling more negatively toward God than did participants in the same situation who were not first reminded of God. This research contributes to an understanding of the divergent effects that distinct components of religion can exert on behavior. © The Author(s) 2015.

  19. A randomized trial found online questionnaires supplemented by postal reminders generated a cost-effective and generalizable sample but don't forget the reminders.

    Science.gov (United States)

    Loban, Amanda; Mandefield, Laura; Hind, Daniel; Bradburn, Mike

    2017-12-01

    The objective of this study was to compare the response rates, data completeness, and representativeness of survey data produced by online and postal surveys. A randomized trial nested within a cohort study in Yorkshire, United Kingdom. Participants were randomized to receive either an electronic (online) survey questionnaire with paper reminder (N = 2,982) or paper questionnaire with electronic reminder (N = 2,855). Response rates were similar for electronic contact and postal contacts (50.9% vs. 49.7%, difference = 1.2%, 95% confidence interval: -1.3% to 3.8%). The characteristics of those responding to the two groups were similar. Participants nevertheless demonstrated an overwhelming preference for postal questionnaires, with the majority responding by post in both groups. Online survey questionnaire systems need to be supplemented with a postal reminder to achieve acceptable uptake, but doing so provides a similar response rate and case mix when compared to postal questionnaires alone. For large surveys, online survey systems may be cost saving. Copyright © 2017 Elsevier Inc. All rights reserved.

  20. Resting-state functional connectivity between amygdala and the ventromedial prefrontal cortex following fear reminder predicts fear extinction

    Science.gov (United States)

    Feng, Pan; Zheng, Yong

    2016-01-01

    Investigations of fear conditioning have elucidated the neural mechanisms of fear acquisition, consolidation and extinction, but it is not clear how the neural activation following fear reminder influence the following extinction. To address this question, we measured human brain activity following fear reminder using resting-state functional magnetic resonance imaging, and investigated whether the extinction effect can be predicted by resting-state functional connectivity (RSFC). Behaviorally, we found no significant differences of fear ratings between the reminder group and the no reminder group at the fear acquisition and extinction stages, but spontaneous recovery during re-extinction stage appeared only in the no reminder group. Imaging data showed that functional connectivity between ventromedial prefrontal cortex (vmPFC) and amygdala in the reminder group was greater than that in the no reminder group after fear memory reactivation. More importantly, the functional connectivity between amygdala and vmPFC of the reminder group after fear memory reactivation was positively correlated with extinction effect. These results suggest RSFC between amygdala and the vmPFC following fear reminder can predict fear extinction, which provide important insight into the neural mechanisms of fear memory after fear memory reactivation. PMID:27013104

  1. Characteristics of Quoit filter, a digital filter developed for the extraction of circumscribed shadows, and its applications to mammograms

    International Nuclear Information System (INIS)

    Isobe, Yoshiaki; Ohkubo, Natsumi; Yamamoto, Shinji; Toriwaki, Jun-ichiro; Kobatake, Hidefumi.

    1993-01-01

    This paper presents a newly developed filter called Quoit filter, which detects circumscribed shadows (concentric circular isolated image), like typical cancer regions. This Quoit filter is based on the mathematical morphology and is found to have interesting facts as follows. (1) Output of this filter can be analytically expressible when an input image is assumed to be a concentric circular model (output is expectable for typical inputs). (2) This filter has an ability to reconstruct original isolated models mentioned in (1) selectively, when this filter is applied sequentially twice. This filter was tested on the detection of cancer regions in X-ray mammograms, and for 12 cancer mammograms, this filter achieved a true-positive cancer detection rate of 100 %. (author)

  2. Development of a Computer-aided Diagnosis System for Early Detection of Masses Using Retrospectively Detected Cancers on Prior Mammograms

    Science.gov (United States)

    2009-06-01

    des ign a c lassifier f or t he differentiation of the abnormal from the normal structures . In this project, we have also investigated the...were trained: one with the current m ammograms and the other with the prior mammograms. A feed- forward backpropagation artificial neural network...Sahin er, B., Helvie, M. A., Petri ck, N., Roubidou x, M. A., Wi lson, T. E., Adler, D. D., Pa ramagul, C., Ne wman, J . S . a nd G opal , S. S

  3. Volumetric quantification of the effect of aging and hormone replacement therapy on breast composition from digital mammograms

    International Nuclear Information System (INIS)

    Hammann-Kloss, J.S.; Bick, U.; Fallenberg, E.; Engelken, F.

    2014-01-01

    Objective: To assess the physiological changes in breast composition with aging using volumetric breast composition measurement from digital mammograms and to assess the effect of hormone replacement therapy (HRT). Methods: A total of 764 consecutive mammograms of 208 non-HRT using women and 508 mammograms of 134 HRT-using women were analyzed using a volumetric breast composition assessment software (Quantra™, Hologic Inc.). Fibroglandular tissue volume (FTV), breast volume (BV), and percent density (PD) were measured. For statistical analysis, women were divided into a premenopausal (<46 years), a perimenopausal (46–55 years), and a postmenopausal (>55 years) age group. More detailed graphical analysis was performed using smaller age brackets. Women using HRT were compared to age-matched controls not using HRT. Results: Women in the postmenopausal age group had a significantly lower FTV and PD and a significantly higher BV than women in the premenopausal age group (FTV: 77 vs. 120 cm 3 , respectively; PD: 16% vs. 28%, respectively; BV 478 vs. 406 cm 3 , respectively; p < 0.01 for all). Median FTV was nearly stable in consecutive mammograms in the premenopausal and postmenopausal age groups, but declined at a rate of 3.9% per year in the perimenopausal period. Median PD was constant in the premenopausal and postmenopausal age groups and declined at a rate of 0.57% per year in the perimenopausal age group. BV continuously increased with age. Women using HRT throughout the study had a 5% higher PD than women not using HRT (22% vs. 17%, respectively; p < 0.001). Conclusions: Accurate knowledge of normal changes in breast composition are of particular interest nowadays due to the importance of breast density for breast cancer risk evaluation. FTV and PD change significantly during the perimenopausal period but remain relatively constant before and thereafter. Median total breast volume consistently increases with age and further contributes to changes in breast

  4. Evaluation of a novel educational strategy, including inhaler-based reminder labels, to improve asthma inhaler technique.

    Science.gov (United States)

    Basheti, Iman A; Armour, Carol L; Bosnic-Anticevich, Sinthia Z; Reddel, Helen K

    2008-07-01

    To evaluate the feasibility, acceptability and effectiveness of a brief intervention about inhaler technique, delivered by community pharmacists to asthma patients. Thirty-one pharmacists received brief workshop education (Active: n=16, CONTROL: n=15). Active Group pharmacists were trained to assess and teach dry powder inhaler technique, using patient-centered educational tools including novel Inhaler Technique Labels. Interventions were delivered to patients at four visits over 6 months. At baseline, patients (Active: 53, CONTROL: 44) demonstrated poor inhaler technique (mean+/-S.D. score out of 9, 5.7+/-1.6). At 6 months, improvement in inhaler technique score was significantly greater in Active cf. CONTROL patients (2.8+/-1.6 cf. 0.9+/-1.4, p<0.001), and asthma severity was significantly improved (p=0.015). Qualitative responses from patients and pharmacists indicated a high level of satisfaction with the intervention and educational tools, both for their effectiveness and for their impact on the patient-pharmacist relationship. A simple feasible intervention in community pharmacies, incorporating daily reminders via Inhaler Technique Labels on inhalers, can lead to improvement in inhaler technique and asthma outcomes. Brief training modules and simple educational tools, such as Inhaler Technique Labels, can provide a low-cost and sustainable way of changing patient behavior in asthma, using community pharmacists as educators.

  5. Automatic classification for mammogram backgrounds based on bi-rads complexity definition and on a multi content analysis framework

    Science.gov (United States)

    Wu, Jie; Besnehard, Quentin; Marchessoux, Cédric

    2011-03-01

    Clinical studies for the validation of new medical imaging devices require hundreds of images. An important step in creating and tuning the study protocol is the classification of images into "difficult" and "easy" cases. This consists of classifying the image based on features like the complexity of the background, the visibility of the disease (lesions). Therefore, an automatic medical background classification tool for mammograms would help for such clinical studies. This classification tool is based on a multi-content analysis framework (MCA) which was firstly developed to recognize image content of computer screen shots. With the implementation of new texture features and a defined breast density scale, the MCA framework is able to automatically classify digital mammograms with a satisfying accuracy. BI-RADS (Breast Imaging Reporting Data System) density scale is used for grouping the mammograms, which standardizes the mammography reporting terminology and assessment and recommendation categories. Selected features are input into a decision tree classification scheme in MCA framework, which is the so called "weak classifier" (any classifier with a global error rate below 50%). With the AdaBoost iteration algorithm, these "weak classifiers" are combined into a "strong classifier" (a classifier with a low global error rate) for classifying one category. The results of classification for one "strong classifier" show the good accuracy with the high true positive rates. For the four categories the results are: TP=90.38%, TN=67.88%, FP=32.12% and FN =9.62%.

  6. A novel featureless approach to mass detection in digital mammograms based on support vector machines

    Energy Technology Data Exchange (ETDEWEB)

    Campanini, Renato [Department of Physics, University of Bologna, and INFN, Bologna (Italy); Dongiovanni, Danilo [Department of Physics, University of Bologna, and INFN, Bologna (Italy); Iampieri, Emiro [Department of Physics, University of Bologna, and INFN, Bologna (Italy); Lanconelli, Nico [Department of Physics, University of Bologna, and INFN, Bologna (Italy); Masotti, Matteo [Department of Physics, University of Bologna, and INFN, Bologna (Italy); Palermo, Giuseppe [Department of Physics, University of Bologna, and INFN, Bologna (Italy); Riccardi, Alessandro [Department of Physics, University of Bologna, and INFN, Bologna (Italy); Roffilli, Matteo [Department of Computer Science, University of Bologna, Bologna (Italy)

    2004-03-21

    In this work, we present a novel approach to mass detection in digital mammograms. The great variability of the appearance of masses is the main obstacle to building a mass detection method. It is indeed demanding to characterize all the varieties of masses with a reduced set of features. Hence, in our approach we have chosen not to extract any feature, for the detection of the region of interest; in contrast, we exploit all the information available on the image. A multiresolution overcomplete wavelet representation is performed, in order to codify the image with redundancy of information. The vectors of the very-large space obtained are then provided to a first support vector machine (SVM) classifier. The detection task is considered here as a two-class pattern recognition problem: crops are classified as suspect or not, by using this SVM classifier. False candidates are eliminated with a second cascaded SVM. To further reduce the number of false positives, an ensemble of experts is applied: the final suspect regions are achieved by using a voting strategy. The sensitivity of the presented system is nearly 80% with a false-positive rate of 1.1 marks per image, estimated on images coming from the USF DDSM database.

  7. Evaluating radiographers' diagnostic accuracy in screen-reading mammograms: what constitutes a quality study?

    International Nuclear Information System (INIS)

    Debono, Josephine C; Poulos, Ann E

    2015-01-01

    The aim of this study was to first evaluate the quality of studies investigating the diagnostic accuracy of radiographers as mammogram screen-readers and then to develop an adapted tool for determining the quality of screen-reading studies. A literature search was used to identify relevant studies and a quality evaluation tool constructed by combining the criteria for quality of Whiting, Rutjes, Dinnes et al. and Brealey and Westwood. This constructed tool was then applied to the studies and subsequently adapted specifically for use in evaluating quality in studies investigating diagnostic accuracy of screen-readers. Eleven studies were identified and the constructed tool applied to evaluate quality. This evaluation resulted in the identification of quality issues with the studies such as potential for bias, applicability of results, study conduct, reporting of the study and observer characteristics. An assessment of the applicability and relevance of the tool for this area of research resulted in adaptations to the criteria and the development of a tool specifically for evaluating diagnostic accuracy in screen-reading. This tool, with further refinement and rigorous validation can make a significant contribution to promoting well-designed studies in this important area of research and practice

  8. Iso-precision scaling of digitized mammograms to facilitate image analysis

    International Nuclear Information System (INIS)

    Karssmeijer, N.; van Erning, L.

    1991-01-01

    This paper reports on a 12 bit CCD camera equipped with a linear sensor of 4096 photodiodes which is used to digitize conventional mammographic films. An iso-precision conversion of the pixel values is preformed to transform the image data to a scale on which the image noise is equal at each level. For this purpose film noise and digitization noise have been determined as a function of optical density and pixel size. It appears that only at high optical densities digitization noise is comparable to or larger than film noise. The quantization error caused by compression of images recorded with 12 bits per pixel to 8 bit images by an iso-precision conversion has been calculated as a function of the number of quantization levels. For mammograms digitized in a 4096 2 matrix the additional error caused by such a scale transform is only about 1.5 percent. An iso-precision scale transform can be advantageous when automated procedures for quantitative image analysis are developed. Especially when detection of signals in noise is aimed at, a constant noise level over the whole pixel value range is very convenient. This is demonstrated by applying local thresholding to detect small microcalcifications. Results are compared to those obtained by using logarithmic or linearized scales

  9. Study on Compression Induced Contrast in X-ray Mammograms Using Breast Mimicking Phantoms

    Directory of Open Access Journals (Sweden)

    A. B. M. Aowlad Hossain

    2015-09-01

    Full Text Available X-ray mammography is commonly used to scan cancer or tumors in breast using low dose x-rays. But mammograms suffer from low contrast problem. The breast is compressed in mammography to reduce x-ray scattering effects. As tumors are stiffer than normal tissues, they undergo smaller deformation under compression. Therefore, image intensity at tumor region may change less than the background tissues. In this study, we try to find out compression induced contrast from multiple mammographic images of tumorous breast phantoms taken with different compressions. This is an extended work of our previous simulation study with experiment and more analysis. We have used FEM models for synthetic phantom and constructed a phantom using agar and n-propanol for simulation and experiment. The x-ray images of deformed phantoms have been obtained under three compression steps and a non-rigid registration technique has been applied to register these images. It is noticeably observed that the image intensity changes at tumor are less than those at surrounding which induce a detectable contrast. Addition of this compression induced contrast to the simulated and experimental images has improved their original contrast by a factor of about 1.4

  10. An automatic system to discriminate malignant from benign massive lesions on mammograms

    International Nuclear Information System (INIS)

    Retico, A.; Delogu, P.; Fantacci, M.E.; Kasae, P.

    2006-01-01

    Mammography is widely recognized as the most reliable technique for early detection of breast cancers. Automated or semi-automated computerized classification schemes can be very useful in assisting radiologists with a second opinion about the visual diagnosis of breast lesions, thus leading to a reduction in the number of unnecessary biopsies. We present a computer-aided diagnosis (CADi) system for the characterization of massive lesions in mammograms, whose aim is to distinguish malignant from benign masses. The CADi system we realized is based on a three-stage algorithm: (a) a segmentation technique extracts the contours of the massive lesion from the image; (b) 16 features based on size and shape of the lesion are computed; (c) a neural classifier merges the features into an estimated likelihood of malignancy. A data set of 226 massive lesions (109 malignant and 117 benign) has been used in this study. The system performances have been evaluated in terms of the receiver-operating characteristic (ROC) analysis, obtaining A z =0.80+/-0.04 as the estimated area under the ROC curve

  11. An SVM classifier to separate false signals from microcalcifications in digital mammograms

    Energy Technology Data Exchange (ETDEWEB)

    Bazzani, Armando; Bollini, Dante; Brancaccio, Rosa; Campanini, Renato; Riccardi, Alessandro; Romani, Davide [Department of Physics, University of Bologna (Italy); INFN, Bologna (Italy); Lanconelli, Nico [Department of Physics, University of Bologna, and INFN, Bologna (Italy). E-mail: nico.lanconelli@bo.infn.it; Bevilacqua, Alessandro [Department of Electronics, Computer Science and Systems, University of Bologna, and INFN, Bologna (Italy)

    2001-06-01

    In this paper we investigate the feasibility of using an SVM (support vector machine) classifier in our automatic system for the detection of clustered microcalcifications in digital mammograms. SVM is a technique for pattern recognition which relies on the statistical learning theory. It minimizes a function of two terms: the number of misclassified vectors of the training set and a term regarding the generalization classifier capability. We compare the SVM classifier with an MLP (multi-layer perceptron) in the false-positive reduction phase of our detection scheme: a detected signal is considered either microcalcification or false signal, according to the value of a set of its features. The SVM classifier gets slightly better results than the MLP one (Az value of 0.963 against 0.958) in the presence of a high number of training data; the improvement becomes much more evident (Az value of 0.952 against 0.918) in training sets of reduced size. Finally, the setting of the SVM classifier is much easier than the MLP one. (author)

  12. Three-dimensional reconstruction of clustered microcalcifications from two digitized mammograms

    Science.gov (United States)

    Stotzka, Rainer; Mueller, Tim O.; Epper, Wolfgang; Gemmeke, Hartmut

    1998-06-01

    X-ray mammography is one of the most significant diagnosis methods in early detection of breast cancer. Usually two X- ray images from different angles are taken from each mamma to make even overlapping structures visible. X-ray mammography has a very high spatial resolution and can show microcalcifications of 50 - 200 micron in size. Clusters of microcalcifications are one of the most important and often the only indicator for malignant tumors. These calcifications are in some cases extremely difficult to detect. Computer assisted diagnosis of digitized mammograms may improve detection and interpretation of microcalcifications and cause more reliable diagnostic findings. We build a low-cost mammography workstation to detect and classify clusters of microcalcifications and tissue densities automatically. New in this approach is the estimation of the 3D formation of segmented microcalcifications and its visualization which will put additional diagnostic information at the radiologists disposal. The real problem using only two or three projections for reconstruction is the big loss of volume information. Therefore the arrangement of a cluster is estimated using only the positions of segmented microcalcifications. The arrangement of microcalcifications is visualized to the physician by rotating.

  13. A deep learning approach for the analysis of masses in mammograms with minimal user intervention.

    Science.gov (United States)

    Dhungel, Neeraj; Carneiro, Gustavo; Bradley, Andrew P

    2017-04-01

    We present an integrated methodology for detecting, segmenting and classifying breast masses from mammograms with minimal user intervention. This is a long standing problem due to low signal-to-noise ratio in the visualisation of breast masses, combined with their large variability in terms of shape, size, appearance and location. We break the problem down into three stages: mass detection, mass segmentation, and mass classification. For the detection, we propose a cascade of deep learning methods to select hypotheses that are refined based on Bayesian optimisation. For the segmentation, we propose the use of deep structured output learning that is subsequently refined by a level set method. Finally, for the classification, we propose the use of a deep learning classifier, which is pre-trained with a regression to hand-crafted feature values and fine-tuned based on the annotations of the breast mass classification dataset. We test our proposed system on the publicly available INbreast dataset and compare the results with the current state-of-the-art methodologies. This evaluation shows that our system detects 90% of masses at 1 false positive per image, has a segmentation accuracy of around 0.85 (Dice index) on the correctly detected masses, and overall classifies masses as malignant or benign with sensitivity (Se) of 0.98 and specificity (Sp) of 0.7. Copyright © 2017 Elsevier B.V. All rights reserved.

  14. Application of support vector machines to breast cancer screening using mammogram and history data

    Science.gov (United States)

    Land, Walker H., Jr.; Akanda, Anab; Lo, Joseph Y.; Anderson, Francis; Bryden, Margaret

    2002-05-01

    Support Vector Machines (SVMs) are a new and radically different type of classifiers and learning machines that use a hypothesis space of linear functions in a high dimensional feature space. This relatively new paradigm, based on Statistical Learning Theory (SLT) and Structural Risk Minimization (SRM), has many advantages when compared to traditional neural networks, which are based on Empirical Risk Minimization (ERM). Unlike neural networks, SVM training always finds a global minimum. Furthermore, SVMs have inherent ability to solve pattern classification without incorporating any problem-domain knowledge. In this study, the SVM was employed as a pattern classifier, operating on mammography data used for breast cancer detection. The main focus was to formulate the best learning machine configurations for optimum specificity and positive predictive value at very high sensitivities. Using a mammogram database of 500 biopsy-proven samples, the best performing SVM, on average, was able to achieve (under statistical 5-fold cross-validation) a specificity of 45.0% and a positive predictive value (PPV) of 50.1% at 100% sensitivity. At 97% sensitivity, a specificity of 55.8% and a PPV of 55.2% were obtained.

  15. Women with physical disability and the mammogram: An observational study to identify barriers and facilitators

    International Nuclear Information System (INIS)

    Poulos, Ann; Balandin, Susan; Llewellyn, Gwynnyth; McCarthy, Louella; Dark, Leigha

    2011-01-01

    Purpose: To identify barriers and facilitators experienced by women with physical disability having a mammogram. Method: Direct observation of the mammography procedure for women with a range of physical disability at screening facilities of BreastScreen NSW Australia. Results: A volunteer sample of 13 women with varying degrees of physical disability participated in the study. The outcomes suggested that many barriers for women with physical disability can be ameliorated by environmental adaptations and guidelines for both radiographers and women. Some women however cannot be screened successfully, or can be screened only with a level of trauma and/or pain which militates against their continuation within the screening program. This study has identified physical limitations which preclude a successful outcome, those which increase the discomfort/pain of the procedure and aspects of the procedure which can be improved to minimise the experience of discomfort/pain. Conclusion: From the outcomes of the study the development of a decision tool is indicated as a method of providing information for women with physical disability and their doctors as to the likelihood of a successful outcome to participation in mammography screening.

  16. Women with physical disability and the mammogram: An observational study to identify barriers and facilitators

    Energy Technology Data Exchange (ETDEWEB)

    Poulos, Ann, E-mail: ann.poulos@sydney.edu.a [University of Sydney, Faculty of Health Sciences, Discipline of Medical Radiation Sciences, PO Box 170, Lidcombe, NSW 1825 (Australia); Balandin, Susan [University of Sydney, Faculty of Health Sciences, Discipline of Speech Pathology, PO Box 170, Lidcombe, NSW 1825 (Australia); Avdeling for helse- og sosialfag, Hogskolen i Molde, Postboks 2110, 6402 Molde (Norway); Llewellyn, Gwynnyth; McCarthy, Louella [University of Sydney, Faculty of Health Sciences, Discipline of Occupational Therapy, PO Box 170, Lidcombe, NSW 1825 (Australia); Dark, Leigha [University of Sydney, Faculty of Health Sciences, Discipline of Speech Pathology, PO Box 170, Lidcombe, NSW 1825 (Australia)

    2011-02-15

    Purpose: To identify barriers and facilitators experienced by women with physical disability having a mammogram. Method: Direct observation of the mammography procedure for women with a range of physical disability at screening facilities of BreastScreen NSW Australia. Results: A volunteer sample of 13 women with varying degrees of physical disability participated in the study. The outcomes suggested that many barriers for women with physical disability can be ameliorated by environmental adaptations and guidelines for both radiographers and women. Some women however cannot be screened successfully, or can be screened only with a level of trauma and/or pain which militates against their continuation within the screening program. This study has identified physical limitations which preclude a successful outcome, those which increase the discomfort/pain of the procedure and aspects of the procedure which can be improved to minimise the experience of discomfort/pain. Conclusion: From the outcomes of the study the development of a decision tool is indicated as a method of providing information for women with physical disability and their doctors as to the likelihood of a successful outcome to participation in mammography screening.

  17. CASE REPORT CASE Assessing cervical stability: a reminder

    African Journals Online (AJOL)

    modality for excluding instability,2 as the following case illustrates. The patient, an underground mine worker, sustained an injury to his neck in a rock fall accident. Cervical spine radiographs and a CT scan demonstrate bilateral fractures which have resulted in disruption of the bony ring of C2. This constitutes a hangman's ...

  18. Augmenting short cheap talk scripts with a repeated opt-out reminder in choice experiment surveys

    DEFF Research Database (Denmark)

    Ladenburg, Jacob; Olsen, Søren Bøye

    to choose the opt-out alternative if they find the experimentally designed alternatives too expensive. In an empirical Choice Experiment survey we find the Opt-Out Reminder to significantly reduce total WTP and to some extent also marginal WTP beyond the capability of the Cheap Talk applied without the Opt...

  19. Temporal Lobe Epilepsy and the Selective Reminding Test: The Conventional 30-Minute Delay Suffices

    Science.gov (United States)

    Bell, Brian D.; Fine, Jason; Dow, Christian; Seidenberg, Michael; Hermann, Bruce P.

    2005-01-01

    Conventional memory assessment may fail to identify memory dysfunction characterized by intact recall for a relatively brief period but rapid forgetting thereafter. This study assessed learning and retention after 30-min and 24-hr delays on auditory and visual selective reminding tests (SRTs) in right (n=20) and left (n=22) temporal lobe epilepsy…

  20. Assessing the long-term effect of educational reminder messages on primary care radiology referrals

    International Nuclear Information System (INIS)

    Ramsay, C.R.; Eccles, M.; Grimshaw, J.M.; Steen, N.

    2003-01-01

    AIM: To investigate whether the effect of educational reminder messages for knee and lumbar spine radiographs varied over a 12 month period. MATERIALS AND METHODS: In a previous randomized, controlled trial, educational reminder messages attached to x-ray reports were shown to be effective in reducing the number of radiograph requests by general practitioners for knee and lumbar spine radiographs. In this study, all radiology departments from the previous trial were asked for monthly referral records for the 12 month intervention period for knee and lumbar spine radiographs for each general practice. Poisson regression was used to test for a change over time in the number of referrals between control and intervention practices. RESULTS: Data were obtained for 66% of the general practices in the main trial. The number of referrals for both knee and lumbar spine radiographs remained consistently and statistically significantly lower in the educational reminder messages group compared with the control group (relative risk=0.65 and 0.64, respectively). There was no evidence that this difference increased or decreased throughout the 12 month period. CONCLUSIONS: The effect of educational reminder messages was produced as soon as the intervention was delivered and maintained throughout the intervention period. There was no evidence of the effect of the intervention wearing off

  1. Can a Repeated Opt-Out Reminder mitigate hypothetical bias in discrete choice experiments?

    DEFF Research Database (Denmark)

    Alemu, Mohammed Hussen; Olsen, Søren Bøye

    2018-01-01

    In this paper, we test whether a Repeated Opt-Out Reminder (ROOR) can mitigate hypothetical bias in stated discrete choice experiments (DCE). The data originate from a field experiment concerning consumer preferences for a novel food product made from cricket flour. Utilising a between...

  2. Incentive Matters!--The Benefit of Reminding Students about Their Academic Standing in Introductory Economics Courses

    Science.gov (United States)

    Chen, Qihui; Okediji, Tade O.

    2014-01-01

    In this article, the authors illustrate how incentives can improve student performance in introductory economics courses. They implemented a policy experiment in a large introductory economics class in which they reminded students who scored below an announced cutoff score on the midterm exam about the risk of failing the course. The authors…

  3. Interaction matters? : exploring interactive music as a reminder to break sedentary office time

    NARCIS (Netherlands)

    Ren, X.; Lu, Y.; Visser, V.J.J.; Le, P.D.Huy; van den Burg, R.

    2017-01-01

    This paper presents a within-subject field test (n=24) with Flow platform, a smart cushion that uses interactive music to motivate office workers to break excessive sedentary time. In this study, we compared continuous music and interactive music as reminders to inform sedentary time by every

  4. The hidden costs of nudging: Experimental evidence from reminders in fundraising

    DEFF Research Database (Denmark)

    Damgaard, Mette Trier; Gravert, Christina

    We document the hidden costs of a popular nudge and show how these costs distort policy making when neglected. In a field experiment with a charity, we find reminders increasing intended behavior (donations), but also increasing avoidance behavior (unsubscriptions from the mailing list). We develop...

  5. "Necesita una vacuna": what Spanish-speakers want in text-message immunization reminders.

    Science.gov (United States)

    Ahlers-Schmidt, Carolyn R; Chesser, Amy; Brannon, Jennifer; Lopez, Venessa; Shah-Haque, Sapna; Williams, Katherine; Hart, Traci

    2013-08-01

    Appointment reminders help parents deal with complex immunization schedules. Preferred content of text-message reminders has been identified for English-speakers. Spanish-speaking parents of children under three years old were recruited to develop Spanish text-message immunization reminders. Structured interviews included questions about demographic characteristics, use of technology, and willingness to receive text reminders. Each participant was assigned to one user-centered design (UCD) test: card sort, needs analysis or comprehension testing. Respondents (N=54) were female (70%) and averaged 27 years of age (SD=7). A card sort of 20 immunization-related statements resulted in identification of seven pieces of critical information, which were compiled into eight example texts. These texts were ranked in the needs assessment and the top two were assessed for comprehension. All participants were able to understand the content and describe intention to act. Utilizing UCD testing, Spanish-speakers identified short, specific text content that differed from preferred content of English-speaking parents.

  6. Using Human Factors Techniques to Design Text Message Reminders for Childhood Immunization

    Science.gov (United States)

    Ahlers-Schmidt, Carolyn R.; Hart, Traci; Chesser, Amy; Williams, Katherine S.; Yaghmai, Beryl; Shah-Haque, Sapna; Wittler, Robert R.

    2012-01-01

    This study engaged parents to develop concise, informative, and comprehensible text messages for an immunization reminder system using Human Factors techniques. Fifty parents completed a structured interview including demographics, technology questions, willingness to receive texts from their child's doctor, and health literacy. Each participant…

  7. On the importance of looking back: the role of recursive remindings in recency judgments and cued recall.

    Science.gov (United States)

    Jacoby, Larry L; Wahlheim, Christopher N

    2013-07-01

    Suppose that you were asked which of two movies you had most recently seen. The results of the experiments reported here suggest that your answer would be more accurate if, when viewing the later movie, you were reminded of the earlier one. In the present experiments, we investigated the role of remindings in recency judgments and cued-recall performance. We did this by presenting a list composed of two instances from each of several different categories and later asking participants to select (Exp. 1) or to recall (Exp. 2) the more recently presented instance. Reminding was manipulated by varying instructions to look back over memory of earlier instances during the presentation of later instances. As compared to a control condition, cued-recall performance revealed facilitation effects when remindings occurred and were later recollected, but interference effects in their absence. The effects of reminding on recency judgments paralleled those on cued recall of more recently presented instances. We interpret these results as showing that reminding produces a recursive representation that embeds memory for an earlier-presented category instance into that of a later-presented one and, thereby, preserves their temporal order. Large individual differences in the probabilities of remindings and of their later recollection were observed. The widespread importance of recursive reminding for theory and for applied purposes is discussed.

  8. The Role of Reminding in the Effects of Spaced Repetitions on Cued Recall: Sufficient but Not Necessary

    Science.gov (United States)

    Wahlheim, Christopher N.; Maddox, Geoffrey B.; Jacoby, Larry L.

    2014-01-01

    Three experiments examined the role of study-phase retrieval (reminding) in the effects of spaced repetitions on cued recall. Remindings were brought under task control to evaluate their effects. Participants studied 2 lists of word pairs containing 3 item types: single items that appeared once in List 2, within-list repetitions that appeared…

  9. Sex-specific impairment of spatial memory in rats following a reminder of predator stress.

    Science.gov (United States)

    Burke, Hanna M; Robinson, Cristina M; Wentz, Bethany; McKay, Jerel; Dexter, Kyle W; Pisansky, Julia M; Talbot, Jeffery N; Zoladz, Phillip R

    2013-07-01

    It has been suggested that cognitive impairments exhibited by people with post-traumatic stress disorder (PTSD) result from intrusive, flashback memories transiently interfering with ongoing cognitive processing. Researchers have further speculated that females are more susceptible to developing PTSD because they form stronger traumatic memories than males, hence females may be more sensitive to the negative effects of intrusive memories on cognition. We have examined how the reminder of a naturalistic stress experience would affect rat spatial memory and if sex was a contributing factor to such effects. Male and female Sprague-Dawley rats were exposed, without contact, to an adult female cat for 30 min. Five weeks later, the rats were trained to locate a hidden platform in the radial-arm water maze and given a single long-term memory test trial 24 h later. Before long-term memory testing, the rats were given a 30-min reminder of the cat exposure experienced 5 weeks earlier. The results indicated that the stress reminder impaired spatial memory in the female rats only. Control manipulations revealed that this effect was not attributable to the original cat exposure adversely impacting learning that occurred 5 weeks later, or to merely exposing rats to a novel environment or predator-related cues immediately before testing. These findings provide evidence that the reminder of a naturalistic stressful experience can impair cognitive processing in rats; moreover, since female rats were more susceptible to the memory-impairing effects of the stress reminder, the findings could lend insight into the existing sex differences in susceptibility to PTSD.

  10. Implementation Intention and Reminder Effects on Behavior Change in a Mobile Health System: A Predictive Cognitive Model.

    Science.gov (United States)

    Pirolli, Peter; Mohan, Shiwali; Venkatakrishnan, Anusha; Nelson, Les; Silva, Michael; Springer, Aaron

    2017-11-30

    Implementation intentions are mental representations of simple plans to translate goal intentions into behavior under specific conditions. Studies show implementation intentions can produce moderate to large improvements in behavioral goal achievement. Human associative memory mechanisms have been implicated in the processes by which implementation intentions produce effects. On the basis of the adaptive control of thought-rational (ACT-R) theory of cognition, we hypothesized that the strength of implementation intention effect could be manipulated in predictable ways using reminders delivered by a mobile health (mHealth) app. The aim of this experiment was to manipulate the effects of implementation intentions on daily behavioral goal success in ways predicted by the ACT-R theory concerning mHealth reminder scheduling. An incomplete factorial design was used in this mHealth study. All participants were asked to choose a healthy behavior goal associated with eat slowly, walking, or eating more vegetables and were asked to set implementation intentions. N=64 adult participants were in the study for 28 days. Participants were stratified by self-efficacy and assigned to one of two reminder conditions: reminders-presented versus reminders-absent. Self-efficacy and reminder conditions were crossed. Nested within the reminders-presented condition was a crossing of frequency of reminders sent (high, low) by distribution of reminders sent (distributed, massed). Participants in the low frequency condition got 7 reminders over 28 days; those in the high frequency condition were sent 14. Participants in the distributed conditions were sent reminders at uniform intervals. Participants in the massed distribution conditions were sent reminders in clusters. There was a significant overall effect of reminders on achieving a daily behavioral goal (coefficient=2.018, standard error [SE]=0.572, odds ratio [OR]=7.52, 95% CI 0.9037-3.2594, Pbehavioral goals. Computational cognitive

  11. The effect of using the health smart card vs. CPOE reminder system on the prescribing practices of non-obstetric physicians during outpatient visits for pregnant women in Taiwan.

    Science.gov (United States)

    Long, An-Jim; Chang, Polun

    2012-09-01

    There is an evidence that pregnant women have been prescribed a significant number of improper medications that could lead to potential damage for a developing fetus due to discontinuity of care. The safety of pregnant women raises public concern and there is a need to identify ways to prevent potential adverse events to the pregnant woman. This study used a health smart card with a clinical reminder system to keep continuous records of general outpatient visits of pregnant women to protect them from potential adverse events caused by improper prescription. The health smart card, issued to all 23 million citizens in Taiwan, was used to work with a Computerized Physician Order Entry (CPOE) implemented at a 700-bed teaching medical center in Taipei to provide the outpatient information of pregnant women. FDA pregnancy risk classification was used to categorize the risk of pregnant women. The log file, combined with the physicians' and patients' profiles, were statistically examined using the Mantel-Haenszel technique to evaluate the impact of system in changing physician's prescription behavior. A total of 441 patients ranged in age from 15 to 50 years with 1114 prescriptions involved in FDA pregnancy risk classification C, D, and X during the study period. 144 reminders (13.1%) were accepted by physicians for further assessment and 100 (69.4%) of them were modified. Non-obstetric physicians in non-emergency setting were more intended to accept reminders (27.8%, 4.9 folds than obstetricians). Reminders triggered on patients in second trimester (15.5%) were accepted by all physicians more than third trimester (OR 1.52, psmart card armed with CPOE reminder system and well-defined criteria had the potential to decrease harmful medication prescribed to pregnant patients. The results show better conformance for non-obstetric physicians (26%) and when physicians accepted the alerts they are more likely to went back and review their orders (69%). In sum, reminder criteria

  12. Computer-aided detection system applied to full-field digital mammograms

    International Nuclear Information System (INIS)

    Vega Bolivar, Alfonso; Sanchez Gomez, Sonia; Merino, Paula; Alonso-Bartolome, Pilar; Ortega Garcia, Estrella; Munoz Cacho, Pedro; Hoffmeister, Jeffrey W.

    2010-01-01

    Background: Although mammography remains the mainstay for breast cancer screening, it is an imperfect examination with a sensitivity of 75-92% for breast cancer. Computer-aided detection (CAD) has been developed to improve mammographic detection of breast cancer. Purpose: To retrospectively estimate CAD sensitivity and false-positive rate with full-field digital mammograms (FFDMs). Material and Methods: CAD was used to evaluate 151 cases of ductal carcinoma in situ (DCIS) (n=48) and invasive breast cancer (n=103) detected with FFDM. Retrospectively, CAD sensitivity was estimated based on breast density, mammographic presentation, histopathology type, and lesion size. CAD false-positive rate was estimated with screening FFDMs from 200 women. Results: CAD detected 93% (141/151) of cancer cases: 97% (28/29) in fatty breasts, 94% (81/86) in breasts containing scattered fibroglandular densities, 90% (28/31) in heterogeneously dense breasts, and 80% (4/5) in extremely dense breasts. CAD detected 98% (54/55) of cancers manifesting as calcifications, 89% (74/83) as masses, and 100% (13/13) as mixed masses and calcifications. CAD detected 92% (73/79) of invasive ductal carcinomas, 89% (8/9) of invasive lobular carcinomas, 93% (14/15) of other invasive carcinomas, and 96% (46/48) of DCIS. CAD sensitivity for cancers 1-10 mm was 87% (47/54); 11-20 mm, 99% (70/71); 21-30 mm, 86% (12/14); and larger than 30 mm, 100% (12/12). The CAD false-positive rate was 2.5 marks per case. Conclusion: CAD with FFDM showed a high sensitivity in identifying cancers manifesting as calcifications or masses. CAD sensitivity was maintained in small lesions (1-20 mm) and invasive lobular carcinomas, which have lower mammographic sensitivity

  13. Human observer detection experiments with mammograms and power-law noise

    International Nuclear Information System (INIS)

    Burgess, Arthur E.; Jacobson, Francine L.; Judy, Philip F.

    2001-01-01

    We determined contrast thresholds for lesion detection as a function of lesion size in both mammograms and filtered noise backgrounds with the same average power spectrum, P(f )=B/f 3 . Experiments were done using hybrid images with digital images of tumors added to digitized normal backgrounds, displayed on a monochrome monitor. Four tumors were extracted from digitized specimen radiographs. The lesion sizes were varied by digital rescaling to cover the range from 0.5 to 16 mm. Amplitudes were varied to determine the value required for 92% correct detection in two-alternative forced-choice (2AFC) and 90% for search experiments. Three observers participated, two physicists and a radiologist. The 2AFC mammographic results demonstrated a novel contrast-detail (CD) diagram with threshold amplitudes that increased steadily (with slope of 0.3) with increasing size for lesions larger than 1 mm. The slopes for prewhitening model observers were about 0.4. Human efficiency relative to these models was as high as 90%. The CD diagram slopes for the 2AFC experiments with filtered noise were 0.44 for humans and 0.5 for models. Human efficiency relative to the ideal observer was about 40%. The difference in efficiencies for the two types of backgrounds indicates that breast structure cannot be considered to be pure random noise for 2AFC experiments. Instead, 2AFC human detection with mammographic backgrounds is limited by a combination of noise and deterministic masking effects. The search experiments also gave thresholds that increased with lesion size. However, there was no difference in human results for mammographic and filtered noise backgrounds, suggesting that breast structure can be considered to be pure random noise for this task. Our conclusion is that, in spite of the fact that mammographic backgrounds have nonstationary statistics, models based on statistical decision theory can still be applied successfully to estimate human performance

  14. Computer-aided detection system applied to full-field digital mammograms

    Energy Technology Data Exchange (ETDEWEB)

    Vega Bolivar, Alfonso; Sanchez Gomez, Sonia; Merino, Paula; Alonso-Bartolome, Pilar; Ortega Garcia, Estrella (Dept. of Radiology, Univ. Marques of Valdecilla Hospital, Santander (Spain)), e-mail: avegab@telefonica.net; Munoz Cacho, Pedro (Dept. of Statistics, Univ. Marques of Valdecilla Hospital, Santander (Spain)); Hoffmeister, Jeffrey W. (iCAD, Inc., Nashua, NH (United States))

    2010-12-15

    Background: Although mammography remains the mainstay for breast cancer screening, it is an imperfect examination with a sensitivity of 75-92% for breast cancer. Computer-aided detection (CAD) has been developed to improve mammographic detection of breast cancer. Purpose: To retrospectively estimate CAD sensitivity and false-positive rate with full-field digital mammograms (FFDMs). Material and Methods: CAD was used to evaluate 151 cases of ductal carcinoma in situ (DCIS) (n=48) and invasive breast cancer (n=103) detected with FFDM. Retrospectively, CAD sensitivity was estimated based on breast density, mammographic presentation, histopathology type, and lesion size. CAD false-positive rate was estimated with screening FFDMs from 200 women. Results: CAD detected 93% (141/151) of cancer cases: 97% (28/29) in fatty breasts, 94% (81/86) in breasts containing scattered fibroglandular densities, 90% (28/31) in heterogeneously dense breasts, and 80% (4/5) in extremely dense breasts. CAD detected 98% (54/55) of cancers manifesting as calcifications, 89% (74/83) as masses, and 100% (13/13) as mixed masses and calcifications. CAD detected 92% (73/79) of invasive ductal carcinomas, 89% (8/9) of invasive lobular carcinomas, 93% (14/15) of other invasive carcinomas, and 96% (46/48) of DCIS. CAD sensitivity for cancers 1-10 mm was 87% (47/54); 11-20 mm, 99% (70/71); 21-30 mm, 86% (12/14); and larger than 30 mm, 100% (12/12). The CAD false-positive rate was 2.5 marks per case. Conclusion: CAD with FFDM showed a high sensitivity in identifying cancers manifesting as calcifications or masses. CAD sensitivity was maintained in small lesions (1-20 mm) and invasive lobular carcinomas, which have lower mammographic sensitivity

  15. IMPORTANT REMINDER - In a Medical Emergency Call 74444

    CERN Multimedia

    2005-01-01

    What happened? A CERN employee, complaining of pains that might indicate a serious heart problem, went to building 57 for medical assistance1). He went to the first floor and found the reception desk temporarily unoccupied. He then went to the CERN Fire Station. The firemen and the CERN medical team took care of him and requested helicopter transport to the Geneva cantonal hospital, where he responded well to medical treatment. What do we learn from this event? Although in this case the patient is doing well, precious time was lost. In the event of serious and acute illness, you must call the CERN internal number 74444 and avoid going in person, even accompanied by someone else. This number is available for all types of emergency. The firemen can provide professional assistance at all times as required: first aid on the spot, ambulance transport and medical assistance as necessary. The CERN Fire Station is located in building 65, on ‘Route Einstein', the first road on your right when you enter CERN Ent...

  16. Effect of novel inhaler technique reminder labels on the retention of inhaler technique skills in asthma: a single-blind randomized controlled trial.

    Science.gov (United States)

    Basheti, Iman A; Obeidat, Nathir M; Reddel, Helen K

    2017-02-09

    Inhaler technique can be corrected with training, but skills drop off quickly without repeated training. The aim of our study was to explore the effect of novel inhaler technique labels on the retention of correct inhaler technique. In this single-blind randomized parallel-group active-controlled study, clinical pharmacists enrolled asthma patients using controller medication by Accuhaler [Diskus] or Turbuhaler. Inhaler technique was assessed using published checklists (score 0-9). Symptom control was assessed by asthma control test. Patients were randomized into active (ACCa; THa) and control (ACCc; THc) groups. All patients received a "Show-and-Tell" inhaler technique counseling service. Active patients also received inhaler labels highlighting their initial errors. Baseline data were available for 95 patients, 68% females, mean age 44.9 (SD 15.2) years. Mean inhaler scores were ACCa:5.3 ± 1.0; THa:4.7 ± 0.9, ACCc:5.5 ± 1.1; THc:4.2 ± 1.0. Asthma was poorly controlled (mean ACT scores ACCa:13.9 ± 4.3; THa:12.1 ± 3.9; ACCc:12.7 ± 3.3; THc:14.3 ± 3.7). After training, all patients had correct technique (score 9/9). After 3 months, there was significantly less decline in inhaler technique scores for active than control groups (mean difference: Accuhaler -1.04 (95% confidence interval -1.92, -0.16, P = 0.022); Turbuhaler -1.61 (-2.63, -0.59, P = 0.003). Symptom control improved significantly, with no significant difference between active and control patients, but active patients used less reliever medication (active 2.19 (SD 1.78) vs. control 3.42 (1.83) puffs/day, P = 0.002). After inhaler training, novel inhaler technique labels improve retention of correct inhaler technique skills with dry powder inhalers. Inhaler technique labels represent a simple, scalable intervention that has the potential to extend the benefit of inhaler training on asthma outcomes. REMINDER LABELS IMPROVE INHALER TECHNIQUE: Personalized

  17. A novel image toggle tool for comparison of serial mammograms: automatic density normalization and alignment-development of the tool and initial experience.

    Science.gov (United States)

    Honda, Satoshi; Tsunoda, Hiroko; Fukuda, Wataru; Saida, Yukihisa

    2014-12-01

    The purpose is to develop a new image toggle tool with automatic density normalization (ADN) and automatic alignment (AA) for comparing serial digital mammograms (DMGs). We developed an ADN and AA process to compare the images of serial DMGs. In image density normalization, a linear interpolation was applied by taking two points of high- and low-brightness areas. The alignment was calculated by determining the point of the greatest correlation while shifting the alignment between the current and prior images. These processes were performed on a PC with a 3.20-GHz Xeon processor and 8 GB of main memory. We selected 12 suspected breast cancer patients who had undergone screening DMGs in the past. Automatic processing was retrospectively performed on these images. Two radiologists subjectively evaluated them. The process of the developed algorithm took approximately 1 s per image. In our preliminary experience, two images could not be aligned approximately. When they were aligned, image toggling allowed detection of differences between examinations easily. We developed a new tool to facilitate comparative reading of DMGs on a mammography viewing system. Using this tool for toggling comparisons might improve the interpretation efficiency of serial DMGs.

  18. Translating the 2-dimensional mammogram into a 3-dimensional breast: Identifying factors that influence the movement of pre-operatively placed wire.

    Science.gov (United States)

    Park, Ko Un; Nathanson, David

    2017-08-01

    Pre-operative measurements from the skin to a wire-localized breast lesion can differ from operating room measurements. This study was designed to measure the discrepancies and study factors that may contribute to wire movement. Prospective data were collected on patients who underwent wire localization lumpectomy. Clip and hook location, breast size, density, and direction of wire placement were the main focus of the analysis. Wire movement was more likely with longer distance from skin to hook or clip, larger breast size (especially if "fatty"), longer time between wire placement and surgery start time, and medial wire placement in larger breast. Age, body mass index, presence of mass, malignant diagnosis, tumor grade, and clip distance to the chest wall were not associated with wire movement. A longer distance from skin to hook correlated with larger specimen volume. Translation of the lesion location from a 2-dimensional mammogram into 3-dimensional breasts is sometimes discrepant because of movement of the localizing wire. Breast size, distance of skin to clip or hook, and wire exit site in larger breasts have a significant impact on wire movement. This information may guide the surgeon's skin incision and extent of excision. © 2017 Wiley Periodicals, Inc.

  19. Benefits of the quality assured double and arbitration reading of mammograms in the early diagnosis of breast cancer in symptomatic women

    International Nuclear Information System (INIS)

    Waldmann, Annika; Katalinic, Alexander; Kapsimalakou, Smaragda; Grande-Nagel, Isabell; Barkhausen, Joerg; Vogt, Florian M.; Stoeckelhuber, Beate M.; Fischer, Dorothea

    2012-01-01

    To address the benefits of double and arbitration reading regarding tumour detection rates, percentage of in situ tumours, and number (of patients) needed to send for expert reading (number needed to treat; NNT) for one additional tumour finding. QuaMaDi is a quality assured breast cancer diagnosis programme; with two-view mammography (craniocaudal, mediolateral oblique) and, in case of breast density ACR 3 or 4, routine ultrasound imaging; and with independent double reading of all images. A consecutive sample of symptomatic women, i.e. women at risk for breast cancer, women aged 70 and above, and/or women with preceding BI-RADS III findings, was analysed. 28,558 mammograms were performed (mean age of women: 57.3 [standard deviation: 12.3] years). Discordant findings were present in 3,837 double readings and were sent for arbitration reading. After histopathological assessment, 52 carcinomas were found (thereof 32% in situ). These carcinomas accounted for 1.8 tumours per 1,000 examinations in the total cohort and increased the tumour detection rate up to 16.4/1,000. The NNT in discordant cases was 74. Double and arbitration reading appears to be a useful tool to ensure the quality of early detection of breast lesions in symptomatic women during indication-based, standardised mammography. circle Quality assured breast cancer diagnosis is feasible outside organised screening structures. (orig.)

  20. Nonconformities in real-world fatal crashes--electronic stability control and seat belt reminders.

    Science.gov (United States)

    Lie, Anders

    2012-01-01

    Many new safety systems are entering the market. Vision Zero is a safety strategy aiming at the elimination of fatalities and impairing injuries by the use of a holistic model for safe traffic to develop a safe system. The aim of this article is to analyze fatalities in modern cars with respect to the Vision Zero model with special respect to electronic stability control (ESC) systems and modern seat belt reminders (SBRs). The model is used to identify and understand cases where cars with ESC systems lost control and where occupants were unbelted in a seat with seat belt reminders under normal driving conditions. The model for safe traffic was used to analyze in-depth studies of fatal crashes with respect to seat belt use and loss of control. Vehicles from 2003 and later in crashes from January 2004 to mid-2010 were analyzed. The data were analyzed case by case. Cars that were equipped with ESC systems and lost control and occupants not using the seat belt in a seat with a seat belt reminder were considered as nonconformities. A total of 138 fatal crashes involving 152 fatally injured occupants were analyzed. Cars with ESC systems had fewer loss-of-control-relevant cases than cars without ESC systems. Thirteen percent of the ESC-equipped vehicles had loss-of-control-relevant crashes and 36 percent of the cars without ESC systems had loss-of-control-relevant crashes. The analysis indicates that only one car of the 9 equipped with ESC that lost control did it on a road surface with relevant friction when driving within the speed restriction of the road. In seats with seat belt reminders that are in accordance with the European New Car Assessment Programme's (Euro NCAP) protocol, 93 percent of the occupants were using a seat belt. In seats without reminders this number was 74 percent. This study shows that ESC systems result in a very significant reduction in fatal crashes, especially under normal driving conditions. Under extreme driving conditions such as speeding

  1. Area and volumetric density estimation in processed full-field digital mammograms for risk assessment of breast cancer.

    Directory of Open Access Journals (Sweden)

    Abbas Cheddad

    Full Text Available INTRODUCTION: Mammographic density, the white radiolucent part of a mammogram, is a marker of breast cancer risk and mammographic sensitivity. There are several means of measuring mammographic density, among which are area-based and volumetric-based approaches. Current volumetric methods use only unprocessed, raw mammograms, which is a problematic restriction since such raw mammograms are normally not stored. We describe fully automated methods for measuring both area and volumetric mammographic density from processed images. METHODS: The data set used in this study comprises raw and processed images of the same view from 1462 women. We developed two algorithms for processed images, an automated area-based approach (CASAM-Area and a volumetric-based approach (CASAM-Vol. The latter method was based on training a random forest prediction model with image statistical features as predictors, against a volumetric measure, Volpara, for corresponding raw images. We contrast the three methods, CASAM-Area, CASAM-Vol and Volpara directly and in terms of association with breast cancer risk and a known genetic variant for mammographic density and breast cancer, rs10995190 in the gene ZNF365. Associations with breast cancer risk were evaluated using images from 47 breast cancer cases and 1011 control subjects. The genetic association analysis was based on 1011 control subjects. RESULTS: All three measures of mammographic density were associated with breast cancer risk and rs10995190 (p0.10 for risk, p>0.03 for rs10995190. CONCLUSIONS: Our results show that it is possible to obtain reliable automated measures of volumetric and area mammographic density from processed digital images. Area and volumetric measures of density on processed digital images performed similar in terms of risk and genetic association.

  2. Automated registration of diagnostic to prediagnostic x-ray mammograms: Evaluation and comparison to radiologists' accuracy

    Energy Technology Data Exchange (ETDEWEB)

    Pinto Pereira, Snehal M.; Hipwell, John H.; McCormack, Valerie A.; Tanner, Christine; Moss, Sue M.; Wilkinson, Louise S.; Khoo, Lisanne A. L.; Pagliari, Catriona; Skippage, Pippa L.; Kliger, Carole J.; Hawkes, David J.; Santos Silva, Isabel M. dos [Cancer Research UK Epidemiology and Genetics Group, London School of Hygiene and Tropical Medicine, Keppel Street, London WC1E 7HT (United Kingdom); Centre for Medical Image Computing, University College London, London WC1E 6BT (United Kingdom); Lifestyle and Cancer Group, International Agency for Research on Cancer, 150 cours Albert Thomas, Lyon 69008 (France); Centre for Medical Image Computing, University College London, London WC1E 6BT (United Kingdom); Cancer Screening Evaluation Unit, Institute of Cancer Research, Surrey SM2 5NG (United Kingdom); St. George' s Healthcare NHS Trust and South West London Breast Screening Service, London SW17 0QT (United Kingdom); Centre for Medical Image Computing, University College London, London WC1E 6BT (United Kingdom); Cancer Research UK Epidemiology and Genetics Group, London School of Hygiene and Tropical Medicine, Keppel Street, London WC1E 7HT (United Kingdom)

    2010-09-15

    Purpose: To compare and evaluate intensity-based registration methods for computation of serial x-ray mammogram correspondence. Methods: X-ray mammograms were simulated from MRIs of 20 women using finite element methods for modeling breast compressions and employing a MRI/x-ray appearance change model. The parameter configurations of three registration methods, affine, fluid, and free-form deformation (FFD), were optimized for registering x-ray mammograms on these simulated images. Five mammography film readers independently identified landmarks (tumor, nipple, and usually two other normal features) on pairs of diagnostic and corresponding prediagnostic digitized images from 52 breast cancer cases. Landmarks were independently reidentified by each reader. Target registration errors were calculated to compare the three registration methods using the reader landmarks as a gold standard. Data were analyzed using multilevel methods. Results: Between-reader variability varied with landmark (p<0.01) and screen (p=0.03), with between-reader mean distance (mm) in point location on the diagnostic/prediagnostic images of 2.50 (95% CI 1.95, 3.15)/2.84 (2.24, 3.55) for nipples and 4.26 (3.43, 5.24)/4.76 (3.85, 5.84) for tumors. Registration accuracy was sensitive to the type of landmark and the amount of breast density. For dense breasts ({>=}40%), the affine and fluid methods outperformed FFD. For breasts with lower density, the affine registration surpassed both fluid and FFD. Mean accuracy (mm) of the affine registration varied between 3.16 (95% CI 2.56, 3.90) for nipple points in breasts with density 20%-39% and 5.73 (4.80, 6.84) for tumor points in breasts with density <20%. Conclusions: Affine registration accuracy was comparable to that between independent film readers. More advanced two-dimensional nonrigid registration algorithms were incapable of increasing the accuracy of image alignment when compared to affine registration.

  3. Sleep Tips for Sjogren's Patients

    Science.gov (United States)

    ... Sjögren’s Patients.” Dr. Fisher reminds patients that adequate sleep is especially important for those with Sjögren’s syndrome, saying that sleep deprivation exacerbates daytime fatigue and can affect the ...

  4. Diagnostic accuracy of commercial system for computer-assisted detection (CADx) as an adjunct to interpretation of mammograms

    International Nuclear Information System (INIS)

    Menna, Sabatino; Di Virgilio, Maria Rosaria; Burke, Paolo; Frigerio, Alfonso; Boglione, Elisa; Ciccarelli, Grazia; Di Filippo, Sabato; Garretti, Licia

    2005-01-01

    Purpose. To evaluate the diagnostic accuracy of the commercial computer-aided detection CADx system for the reading of mammograms. Materials and methods. The study assessed the Second Look system developed and marketed by CADx Medical Systems, Montreal, Canada. The diagnostic sensitivity was evaluated by means of a retrospective study on 98 consecutive cancers detected at screening by double independent reading. The specificity and the positive predictive value (PPV) for cancer of the CADx system were prospectively evaluated on a second group of 560 consecutive mammograms of asymptomatic women not included in screening program. The radiologist who was present during the test assessed the abnormal mammographic findings by one or more of the following diagnostic procedures: physical examination, additional mammographic detail views with or without magnification,ultrasonography, ultrasound- or mammography guided fine needle aspiration cytology, and core-biopsy. The exams first underwent conventional reading and then a second reading carried out with the aid of the CADx system. Results.The overall diagnostic sensitivity of the CADx system on the 98 screening cancers was 81.6%; in particular it was 89.3% for calcifications, 83.9% for masses and only 37.5% for architectural distortion. The CADx markings for each mammography were 4.7 on average. Identification of invasive carcinoma was independent from tumour size. In the second group of 560 mammograms, the CADx system marked all cases identified as positive by conventional reading and confirmed by biopsy (7/7), but did not permit the detection of any additional cancer. The CADx markings per exam were 4.2 on average, the specificity was 13.7% and the PPV was 0.55% versus 13.7% recall rate of conventional reading. CADx reading led to a 1.96% (11/560) increase of the women necessitating further diagnostic investigation. Conclusions. The results of our study show that the diagnostic sensitivity of the CADx system is lower

  5. The symbolic power of money: reminders of money alter social distress and physical pain.

    Science.gov (United States)

    Zhou, Xinyue; Vohs, Kathleen D; Baumeister, Roy F

    2009-06-01

    People often get what they want from the social system, and that process is aided by social popularity or by having money. Money can thus possibly substitute for social acceptance in conferring the ability to obtain benefits from the social system. Moreover, past work has suggested that responses to physical pain and social distress share common underlying mechanisms. Six studies tested relationships among reminders of money, social exclusion, and physical pain. Interpersonal rejection and physical pain caused desire for money to increase. Handling money (compared with handling paper) reduced distress over social exclusion and diminished the physical pain of immersion in hot water. Being reminded of having spent money, however, intensified both social distress and physical pain.

  6. The effect of requesting a reason for non-adherence to a guideline in a long running automated reminder system for PONV prophylaxis

    NARCIS (Netherlands)

    Kooij, Fabian O.; Klok, Toni; Preckel, Benedikt; Hollmann, Markus W.; Kal, Jasper E.

    2017-01-01

    Automated reminders are employed frequently to improve guideline adherence, but limitations of automated reminders are becoming more apparent. We studied the reasons for non-adherence in the setting of automated reminders to test the hypothesis that a separate request for a reason in itself may

  7. Working Memory Load and Reminder Effect on Event-Based Prospective Memory of High- and Low-Achieving Students in Math

    Science.gov (United States)

    Chen, Youzhen; Lian, Rong; Yang, Lixian; Liu, Jianrong; Meng, Yingfang

    2017-01-01

    The effects of working memory (WM) demand and reminders on an event-based prospective memory (PM) task were compared between students with low and high achievement in math. WM load (1- and 2-back tasks) was manipulated as a within-subject factor and reminder (with or without reminder) as a between-subject factor. Results showed that high-achieving…

  8. Differential activation of amygdala, dorsal and ventral hippocampus following an exposure to a reminder ofunderwater trauma

    Directory of Open Access Journals (Sweden)

    Gilad eRitov

    2014-01-01

    Full Text Available Recollection of emotional memories is attributed in part to the activation of the amygdala and the hippocampus. Recent hypothesis suggest a pivotal role for the ventral hippocampus in traumatic stress processing and emotional memory retrieval. Persistent re-experiencing and intrusive recollections are core symptoms in acute and posttraumatic stress disorders (ASD; PTSD. Such intrusive recollections are often triggered by reminders associated with the trauma.We examined the impact of exposure to a trauma reminder (under water trauma on the activation of the basolateral amygdala (BLA, dorsal and ventral hippocampus. Rats were exposed to underwater trauma and 24 hours later were re-exposed to the context of the trauma. Phosphorylation of the extracellular signal-regulated kinase (ERK was used as a marker for level of activation of these regions. Significant increase in ERK activation was found in the ventral hippocampus and BLA. Such pattern of activation was not found in animals exposed only to the trauma or in animals exposed only to the trauma reminder. Additionally, the dissociative pattern of activation of the ventral hippocampus sub-regions positively correlated with the activation of the BLA.Our findings suggest a specific pattern of neural activation during recollection of a trauma reminder, with a unique contribution of the ventral hippocampus. Measured 24 hrs after the exposure to the traumatic experience, the current findings relate to relatively early stages of traumatic memory consolidation. Understanding the neural mechanisms underlying these initial stages may contribute to developing intervention strategies that could reduce the risk of eventually developing PTSD.

  9. Effect of a printed reminder in the waiting room to turn off mobile phones during consultation: a before and after study

    Directory of Open Access Journals (Sweden)

    de Aguiar Sylvia

    2009-03-01

    Full Text Available Abstract Background Telephone interruptions during consultations are one cause of work-related stress amongst general practitioners. Many health care centers recommend that patients turn off any mobile phones to avoid interruptions to the discussion with the physicians. Methods The purpose of this before and after study was to determine whether a printed reminder for turning off the mobile phone in the waiting room is helpful in decreasing the number of interruptions during consultation. A visual phone off sign utilizing the International "No" symbol of a diagonal line through a circle, along with a "please turn off your phone during consultation" reminder was used in the waiting room in the "after" period. Results A significant difference was found in the proportion of patients receiving or making a call during the consultation (8.8% vs. 13.5%, RR = 0.66; 95%CI 0.46–0.94; p = 0.021 and in the total number of calls (10.4% vs. 17.3%, RR = 0.60; 95%CI 0.44–0.83, p = 0.003 between the exposed and the non-exposed groups. However, no significant differences were found in the total time or the median time spent talking during consultation. The duration of the calls had median times of 20.5 seconds and 22.3 seconds in the exposed and the non-exposed groups respectively. Women from both groups who received a call during consultation answered significantly more when compared to men (70% vs. 52%; p = 0.05; Conclusion Our findings suggest that a printed reminder in the waiting room is helpful in decreasing the number of interruptions by mobile phone during consultation in our settings. The study provides the basis for further quantitative and qualitative research on this topic

  10. Email Reminders Increase the Frequency That Pet Owners Update Their Microchip Information

    Directory of Open Access Journals (Sweden)

    Katie Goodwin

    2018-01-01

    Full Text Available Stray animals with incorrect microchip details are less likely to be reclaimed, and unclaimed strays are at increased risk of euthanasia. A retrospective cohort study was performed using 394,747 cats and 904,909 dogs registered with Australia’s largest microchip database to describe animal characteristics, determine whether annual email reminders increased the frequency that owners updated their information, and to compare frequencies of microchip information updates according to pet and owner characteristics. More than twice as many dogs (70% than cats (30% were registered on the database; the most numerous pure-breeds were Ragdoll cats and Staffordshire Bull Terrier dogs, and the number of registered animals per capita varied by Australian state or territory. Owners were more likely (p < 0.001 to update their details soon after they were sent a reminder email, compared to immediately before that email, and there were significant (p < 0.001 differences in the frequency of owner updates by state or territory of residence, animal species, animal age, and socioeconomic index of the owner’s postcode. This research demonstrates that email reminders increase the probability of owners updating their details on the microchip database, and this could reduce the percentages of stray animals that are unclaimed and subsequently euthanized.

  11. Improving mass candidate detection in mammograms via feature maxima propagation and local feature selection.

    Science.gov (United States)

    Melendez, Jaime; Sánchez, Clara I; van Ginneken, Bram; Karssemeijer, Nico

    2014-08-01

    Mass candidate detection is a crucial component of multistep computer-aided detection (CAD) systems. It is usually performed by combining several local features by means of a classifier. When these features are processed on a per-image-location basis (e.g., for each pixel), mismatching problems may arise while constructing feature vectors for classification, which is especially true when the behavior expected from the evaluated features is a peaked response due to the presence of a mass. In this study, two of these problems, consisting of maxima misalignment and differences of maxima spread, are identified and two solutions are proposed. The first proposed method, feature maxima propagation, reproduces feature maxima through their neighboring locations. The second method, local feature selection, combines different subsets of features for different feature vectors associated with image locations. Both methods are applied independently and together. The proposed methods are included in a mammogram-based CAD system intended for mass detection in screening. Experiments are carried out with a database of 382 digital cases. Sensitivity is assessed at two sets of operating points. The first one is the interval of 3.5-15 false positives per image (FPs/image), which is typical for mass candidate detection. The second one is 1 FP/image, which allows to estimate the quality of the mass candidate detector's output for use in subsequent steps of the CAD system. The best results are obtained when the proposed methods are applied together. In that case, the mean sensitivity in the interval of 3.5-15 FPs/image significantly increases from 0.926 to 0.958 (p < 0.0002). At the lower rate of 1 FP/image, the mean sensitivity improves from 0.628 to 0.734 (p < 0.0002). Given the improved detection performance, the authors believe that the strategies proposed in this paper can render mass candidate detection approaches based on image location classification more robust to feature

  12. Reminder: GSM

    CERN Document Server

    2003-01-01

    1- Your present GSM subscription (SIM card) will no longer be valid as from the 5th January 2004. 2- Short numbers 16xxxx (where xxxx are your current last 4 digits) will remain valid. 3- Your new number from outside will then be +4176 487xxxx. 4- From the 20th December to the 4th January 2004 (CERN's official holiday) your GSM will be unusable underground. Nota bene: Due to the high costs involved calls from outside will not be automatically diverted to a "combox" indicating that your number has changed. It is therefore up to you to inform your correspondents of your GSM number change. For further information on the GSM Migration see the CERN home page: http://cern.ch/

  13. Can Australian radiographers assess screening mammograms accurately? Biennial follow-up from a four year prospective study and lesion analysis

    International Nuclear Information System (INIS)

    Moran, S.; Warren-Forward, H.

    2016-01-01

    Introduction: Globally, the role of the radiographer is changing; some countries have developed advanced roles with specific scopes of practice. Other countries, like Australia, are in the process of this change. This paper demonstrates the abilities of Australian radiographers in mammogram screen reading, highlighting some of their specific difficulties with different lesion types. Method: Six experienced radiographers participated in a prospective study, screen reading 2000 mammograms each between 2010 and 2011. This paper looks at the results of those same women at biennial re-screen. Analysis of the results included validation of normal results by negative follow-up screens and new cancers at biennial review; there is also analysis on the types of lesions detected and missed. Results: After biennial review, three cancers in 2013/2014 had been marked as abnormal by one radiographer two years prior, which increased her sensitivity from 64% to 85%. Sensitivity for the radiologists decreased from the assumed 100% to 95%. Radiographers appeared to be skilled in detection of calcifications and architectural distortions but had difficulty with non-specific densities. Conclusion: This study demonstrates the potential for Australian radiographers to enhance the accuracy of screen reading programs. - Highlights: • Radiographers have the potential to increase breast cancer detection rates. • Radiographers appear to be skilled at detecting calcifications. • Lesions commonly overlooked by radiographers could be targeted for training.

  14. iPixel: a visual content-based and semantic search engine for retrieving digitized mammograms by using collective intelligence.

    Science.gov (United States)

    Alor-Hernández, Giner; Pérez-Gallardo, Yuliana; Posada-Gómez, Rubén; Cortes-Robles, Guillermo; Rodríguez-González, Alejandro; Aguilar-Laserre, Alberto A

    2012-09-01

    Nowadays, traditional search engines such as Google, Yahoo and Bing facilitate the retrieval of information in the format of images, but the results are not always useful for the users. This is mainly due to two problems: (1) the semantic keywords are not taken into consideration and (2) it is not always possible to establish a query using the image features. This issue has been covered in different domains in order to develop content-based image retrieval (CBIR) systems. The expert community has focussed their attention on the healthcare domain, where a lot of visual information for medical analysis is available. This paper provides a solution called iPixel Visual Search Engine, which involves semantics and content issues in order to search for digitized mammograms. iPixel offers the possibility of retrieving mammogram features using collective intelligence and implementing a CBIR algorithm. Our proposal compares not only features with similar semantic meaning, but also visual features. In this sense, the comparisons are made in different ways: by the number of regions per image, by maximum and minimum size of regions per image and by average intensity level of each region. iPixel Visual Search Engine supports the medical community in differential diagnoses related to the diseases of the breast. The iPixel Visual Search Engine has been validated by experts in the healthcare domain, such as radiologists, in addition to experts in digital image analysis.

  15. Genetic Fuzzy System (GFS based wavelet co-occurrence feature selection in mammogram classification for breast cancer diagnosis

    Directory of Open Access Journals (Sweden)

    Meenakshi M. Pawar

    2016-09-01

    Full Text Available Breast cancer is significant health problem diagnosed mostly in women worldwide. Therefore, early detection of breast cancer is performed with the help of digital mammography, which can reduce mortality rate. This paper presents wrapper based feature selection approach for wavelet co-occurrence feature (WCF using Genetic Fuzzy System (GFS in mammogram classification problem. The performance of GFS algorithm is explained using mini-MIAS database. WCF features are obtained from detail wavelet coefficients at each level of decomposition of mammogram image. At first level of decomposition, 18 features are applied to GFS algorithm, which selects 5 features with an average classification success rate of 39.64%. Subsequently, at second level it selects 9 features from 36 features and the classification success rate is improved to 56.75%. For third level, 16 features are selected from 54 features and average success rate is improved to 64.98%. Lastly, at fourth level 72 features are applied to GFS, which selects 16 features and thereby increasing average success rate to 89.47%. Hence, GFS algorithm is the effective way of obtaining optimal set of feature in breast cancer diagnosis.

  16. Reduction of false positives in the detection of architectural distortion in mammograms by using a geometrically constrained phase portrait model

    International Nuclear Information System (INIS)

    Ayres, Fabio J.; Rangayyan, Rangaraj M.

    2007-01-01

    Objective One of the commonly missed signs of breast cancer is architectural distortion. We have developed techniques for the detection of architectural distortion in mammograms, based on the analysis of oriented texture through the application of Gabor filters and a linear phase portrait model. In this paper, we propose constraining the shape of the general phase portrait model as a means to reduce the false-positive rate in the detection of architectural distortion. Material and methods The methods were tested with one set of 19 cases of architectural distortion and 41 normal mammograms, and with another set of 37 cases of architectural distortion. Results Sensitivity rates of 84% with 4.5 false positives per image and 81% with 10 false positives per image were obtained for the two sets of images. Conclusion The adoption of a constrained phase portrait model with a symmetric matrix and the incorporation of its condition number in the analysis resulted in a reduction in the false-positive rate in the detection of architectural distortion. The proposed techniques, dedicated for the detection and localization of architectural distortion, should lead to efficient detection of early signs of breast cancer. (orig.)

  17. Mammogram classification scheme using 2D-discrete wavelet and local binary pattern for detection of breast cancer

    Science.gov (United States)

    Adi Putra, Januar

    2018-04-01

    In this paper, we propose a new mammogram classification scheme to classify the breast tissues as normal or abnormal. Feature matrix is generated using Local Binary Pattern to all the detailed coefficients from 2D-DWT of the region of interest (ROI) of a mammogram. Feature selection is done by selecting the relevant features that affect the classification. Feature selection is used to reduce the dimensionality of data and features that are not relevant, in this paper the F-test and Ttest will be performed to the results of the feature extraction dataset to reduce and select the relevant feature. The best features are used in a Neural Network classifier for classification. In this research we use MIAS and DDSM database. In addition to the suggested scheme, the competent schemes are also simulated for comparative analysis. It is observed that the proposed scheme has a better say with respect to accuracy, specificity and sensitivity. Based on experiments, the performance of the proposed scheme can produce high accuracy that is 92.71%, while the lowest accuracy obtained is 77.08%.

  18. Development, equivalence study, and normative data of version B of the Spanish-language Free and Cued Selective Reminding Test.

    Science.gov (United States)

    Grau-Guinea, L; Pérez-Enríquez, C; García-Escobar, G; Arrondo-Elizarán, C; Pereira-Cutiño, B; Florido-Santiago, M; Piqué-Candini, J; Planas, A; Paez, M; Peña-Casanova, J; Sánchez-Benavides, G

    2018-05-08

    The Free and Cued Selective Reminding Test (FCSRT) is widely used for the assessment of verbal episodic memory, mainly in patients with Alzheimer disease. A Spanish version of the FCSRT and normative data were developed within the NEURONORMA project. Availability of alternative, equivalent versions is useful for following patients up in clinical settings. This study aimed to develop an alternative version of the original FCSRT (version B) and to study its equivalence to the original Spanish test (version A), and its performance in a sample of healthy individuals, in order to develop reference data. We evaluated 232 healthy participants of the NEURONORMA-Plus project, aged between 18 and 90. Thirty-three participants were assessed with both versions using a counterbalanced design. High intra-class correlation coefficients (between 0.8 and 0.9) were observed in the equivalence study. While no significant differences in performance were observed in total recall scores, free recall scores were significantly lower for version B. These preliminary results suggest that the newly developed FCSRT version B is equivalent to version A in the main variables tested. Further studies are necessary to ensure interchangeability between versions. We provide normative data for the new version. Copyright © 2018 Sociedad Española de Neurología. Publicado por Elsevier España, S.L.U. All rights reserved.

  19. Implementing a reward and reminder underage drinking prevention program in convenience stores near Southern California American Indian reservations.

    Science.gov (United States)

    Moore, Roland S; Roberts, Jennifer; McGaffigan, Richard; Calac, Daniel; Grube, Joel W; Gilder, David A; Ehlers, Cindy L

    2012-09-01

    Underage drinking is associated with a number of social and public health consequences. Preventing access to alcohol is one approach to reducing underage drinking. This study assesses the efficacy of a culturally tailored "reward and reminder" program aimed at reducing convenience store alcohol sales to youth living on or near nine American Indian reservations. First, tribal council proclamations were sought to support underage drinking prevention, including reward and reminder efforts. Then, decoys (volunteers over 21 years of age but judged to look younger) attempted to purchase alcohol without identification. Clerks who asked for identification were given "rewards" (gift cards and congratulatory letters), whereas clerks who did not were given "reminders" of the law regarding sales to minors. Following an initial baseline of 12 purchase attempts, three repeated reward and reminder visits were made to 13 convenience stores selling alcohol within 10 miles of the reservations (n = 51 total attempts). Five of nine tribal councils passed resolutions in support of the program. The baseline sales rate without requesting ID was 33%. Similarly, 38% of stores in the first reward and reminder visit round failed to request identification. However, in the following two reward and reminder rounds, 0% of the stores failed to request identification. These results indicate that environmental community-level underage drinking prevention strategies to reduce alcohol sales near rural reservations are feasible and can be effective. Environmental prevention strategies within reservation communities support integrated supply and demand reduction models for reducing underage drinking.

  20. Characteristics of mobile phone access and usage in rural and urban Guatemala: assessing feasibility of text message reminders to increase childhood immunizations.

    Science.gov (United States)

    Domek, Gretchen J; Contreras-Roldan, Ingrid L; Asturias, Edwin J; Bronsert, Michael; Bolaños Ventura, Guillermo Antonio; O'Leary, Sean T; Kempe, Allison; Bull, Sheana

    2018-01-01

    Despite efforts to promote vaccination in low- and middle-income countries (LMICs), over 20 million infants remain under-immunized and at risk for unnecessary morbidity and mortality. Mobile health technologies, such as Short Message Service (SMS) texts, have tremendous and untapped potential for disease management. Patient reminder systems are an important mechanism for improving childhood vaccination coverage and can be easily adapted to SMS platforms. However, current research lacks an understanding of the barriers and facilitators to mHealth program design, implementation, and scale in LMICs. We analyzed survey data collected March-November 2016 at the enrollment visit from a randomized controlled trial conducted at public health clinics in urban and rural Guatemala. Participants included eligible infants 6 weeks to 6 months of age receiving the first dose of the primary immunization series. At least one parent needed to own a mobile phone and be capable of deciphering SMS. Chi-square or Fisher's exact and Student's t-test were used to assess significance levels in demographic differences to describe factors that contribute to the feasibility of using an SMS-based vaccination reminder system. Of 1,088 families approached for enrollment, 871 were eligible and 720 (82.7%) participated with equal numbers of urban and rural children enrolled; 54 parents did not own a mobile phone with SMS capability and three parents could not use SMS. There was no significant difference between urban and rural maternal mobile phone ownership (94.4% vs. 93.3%, P=0.53), but more urban fathers owned mobile phones (72.8% vs. 47.1%, Pphones (93.9% vs. 61.1%, Pphones present in the home (Pphone access, usage, and preferences for voice and text communication across rural and urban populations of an LMIC that can be used to inform future mHealth interventions. Our findings suggest that offering a combination of more traditional communication methods with newer, modern technologies may be

  1. The effect of daily small text message reminders for medicine compliance amongst young people connected with the outpatient department for child and adolescent psychiatry

    DEFF Research Database (Denmark)

    Bjørnholt, Karsten; Christiansen, Erik; Attermann Stokholm, Kristine

    2016-01-01

    after 6 months. Aim: In this study we investigated whether text message reminders could improve medicine compliance amongst vulnerable young people with psychiatric disorders who were being treated in the outpatient department for child and adolescent psychiatry and who either are under or were......Background: Many patients with psychiatric illnesses have difficulty maintaining medication over time. Many take their medicine irregularly and studies show that it is the most vulnerable patients who have the greatest problems adhering to treatment. Often only 50% are still under medical treatment...... to commence medicinal treatment. Methods: This study was conducted as a randomized controlled trial including all non-acute referrals to an outpatient department for adolescent psychiatry within a group aged 15-20 years starting medical treatment. The patients were followed until the end of their treatment...

  2. Using email reminders to engage physicians in an Internet-based CME intervention

    Directory of Open Access Journals (Sweden)

    Wall Terry

    2004-09-01

    Full Text Available Abstract Background Engaging practicing physicians in educational strategies that reinforce guideline adoption and improve the quality of healthcare may be difficult. Push technologies such as email offer new opportunities to engage physicians in online educational reinforcing strategies. The objectives are to investigate 1 the effectiveness of email announcements in engaging recruited community-based primary care physicians in an online guideline reinforcement strategy designed to promote Chlamydia screening, 2 the characteristics of physicians who respond to email announcements, as well as 3 how quickly and when they respond to email announcements. Methods Over a 45-week period, 445 recruited physicians received up to 33 email contacts announcing and reminding them of an online women's health guideline reinforcing CME activity. Participation was defined as physician log-on at least once to the website. Data were analyzed to determine participation, to compare characteristics of participants with recruited physicians who did not participate, and to determine at what point and when participants logged on. Results Of 445 recruited physicians with accurate email addresses, 47.2% logged on and completed at least one module. There were no significant differences by age, race, or specialty between participants and non-participants. Female physicians, US medical graduates and MDs had higher participation rates than male physicians, international medical graduates and DOs. Physicians with higher baseline screening rates were significantly more likely to log on to the course. The first 10 emails were the most effective in engaging community-based physicians to complete the intervention. Physicians were more likely to log on in the afternoon and evening and on Monday or Thursday. Conclusions Email course reminders may enhance recruitment of physicians to interventions designed to reinforce guideline adoption; physicians' response to email reminders may

  3. Staging of breast cancer and the advanced applications of digital mammogram: what the physician needs to know?

    Science.gov (United States)

    Helal, Maha H; Mansour, Sahar M; Zaglol, Mai; Salaleldin, Lamia A; Nada, Omniya M; Haggag, Marwa A

    2017-03-01

    To study the role of advanced applications of digital mammogram, whether contrast-enhanced spectral mammography (CESM) or digital breast tomosynthesis (DBT), in the "T" staging of histologically proven breast cancer before planning for treatment management. In this prospective analysis, we evaluated 98 proved malignant breast masses regarding their size, multiplicity and the presence of associated clusters of microcalcifications. Evaluation methods included digital mammography (DM), 3D tomosynthesis and CESM. Traditional DM was first performed then in a period of 10-14-day interval; breast tomosynthesis and contrast-based mammography were performed for the involved breast only. Views at tomosynthesis were acquired in a "step-and-shoot" tube motion mode to produce multiple (11-15), low-dose images and in contrast-enhanced study, low-energy (22-33 kVp) and high-energy (44-49 kVp) exposures were taken after the i.v. injection of the contrast agent. Operative data were the gold standard reference. Breast tomosynthesis showed the highest accuracy in size assessment (n = 69, 70.4%) than contrast-enhanced (n = 49, 50%) and regular mammography (n = 59, 60.2%). Contrast-enhanced mammography presented the least performance in assessing calcifications, yet it was most sensitive in the detection of multiplicity (92.3%), followed by tomosynthesis (77%) and regular mammography (53.8%). The combined analysis of the three modalities provided an accuracy of 74% in the "T" staging of breast cancer. The combined application of tomosynthesis and contrast-enhanced digital mammogram enhanced the performance of the traditional DM and presented an informative method in the staging of breast cancer. Advances in knowledge: Staging and management planning of breast cancer can divert according to tumour size, multiplicity and the presence of microcalcifications. DBT shows sharp outlines of the tumour with no overlap tissue and spots microcalcifications. Contrast

  4. Automatic and consistent registration framework for temporal pairs of mammograms in application to breast cancer risk assessment due to hormone replacement therapy (HRT)

    DEFF Research Database (Denmark)

    Karemore, Gopal Raghunath; Carreras, I. Arganda; Nielsen, Mads

    2009-01-01

     Purpose: Mammographic density is a strong risk factor for breast cancer. However, whether changes in mammographic density due to HRT are associated with risk remains unclear. The aim of this study is to provide a framework for accurate interval change analysis in temporal pairs of mammograms of ...

  5. Attitudes of women in their forties toward the 2009 USPSTF mammogram guidelines: a randomized trial on the effects of media exposure.

    Science.gov (United States)

    Davidson, AuTumn S; Liao, Xun; Magee, B Dale

    2011-07-01

    The objective of the study was to assess women's attitudes toward 2009 US Preventive Services Task Force mammography screening guideline changes and evaluate the role of media in shaping opinions. Two hundred forty-nine women, aged 39-49 years, presenting for annual examinations randomized to read 1 of 2 articles, and survey completion comprised the design of the study. Eighty-eight percent overestimated the lifetime breast cancer (BrCa) risk. Eighty-nine percent want yearly mammograms in their 40s. Eighty-six percent felt the changes were unsafe, and even if the changes were doctor recommended, 84% would not delay screening until age 50 years. Those with a friend/relative with BrCa were more likely to want annual mammography in their forties (92% vs 77%, P = .001), and feel changes unsafe (91% vs 69%, P ≤ .0001). Participants with previous false-positive mammograms were less likely to accept doctor-recommended screening delay until age 50 years (8% vs 21%, P = .01). Women overestimate BrCa risk. Skepticism of new mammogram guidelines exists, and is increased by exposure to negative media. Those with prior false-positive mammograms are less likely to accept changes. Copyright © 2011 Mosby, Inc. All rights reserved.

  6. Reminder from SC/ME to those in charge of first-aid boxes

    CERN Document Server

    2006-01-01

    The Medical Service wishes to remind all those responsible for first-aid boxes that: all the medication and materials in the boxes must be checked at least once a month to make sure that they are always ready for use when needed; they must notify the Medical Service when their CERN contract comes to an end and designate someone to replace them. NB. The medication and materials supplied are for OCCASIONAL USE only and must not be used to treat personal medical conditions on a regular basis. For further information please contact the Infirmary (Building 57 R.004 - Tel 73802).

  7. The relative efficacy of telephone and email reminders to elicit blood donation.

    Science.gov (United States)

    Germain, M; Godin, G

    2016-04-01

    The aim of the study was to test the relative efficacy of telephone and email reminders to trigger blood donation. A sample of 3454 donors was randomized to one of three conditions: phone only (n = 1176), email only (n = 1091) and phone + email (n = 1187). There was a higher proportion of donors who registered to give blood in the phone + email condition (18·45%) compared to the other two conditions (phone: 15·73%, P email: 13·20%; P email conditions did not differ significantly (P = 0·16), suggesting equivalent efficacy. © 2015 International Society of Blood Transfusion.

  8. A combined approach for the enhancement and segmentation of mammograms using modified fuzzy C-means method in wavelet domain.

    Science.gov (United States)

    Srivastava, Subodh; Sharma, Neeraj; Singh, S K; Srivastava, R

    2014-07-01

    In this paper, a combined approach for enhancement and segmentation of mammograms is proposed. In preprocessing stage, a contrast limited adaptive histogram equalization (CLAHE) method is applied to obtain the better contrast mammograms. After this, the proposed combined methods are applied. In the first step of the proposed approach, a two dimensional (2D) discrete wavelet transform (DWT) is applied to all the input images. In the second step, a proposed nonlinear complex diffusion based unsharp masking and crispening method is applied on the approximation coefficients of the wavelet transformed images to further highlight the abnormalities such as micro-calcifications, tumours, etc., to reduce the false positives (FPs). Thirdly, a modified fuzzy c-means (FCM) segmentation method is applied on the output of the second step. In the modified FCM method, the mutual information is proposed as a similarity measure in place of conventional Euclidian distance based dissimilarity measure for FCM segmentation. Finally, the inverse 2D-DWT is applied. The efficacy of the proposed unsharp masking and crispening method for image enhancement is evaluated in terms of signal-to-noise ratio (SNR) and that of the proposed segmentation method is evaluated in terms of random index (RI), global consistency error (GCE), and variation of information (VoI). The performance of the proposed segmentation approach is compared with the other commonly used segmentation approaches such as Otsu's thresholding, texture based, k-means, and FCM clustering as well as thresholding. From the obtained results, it is observed that the proposed segmentation approach performs better and takes lesser processing time in comparison to the standard FCM and other segmentation methods in consideration.

  9. A systematic review of electronic multi-compartment medication devices with reminder systems for improving adherence to self-administered medications.

    Science.gov (United States)

    Paterson, Mary; Kinnear, Moira; Bond, Christine; McKinstry, Brian

    2017-06-01

    Many patients experience difficulties adhering to medication regimes. For people who forget or get confused about medication, there are products to help them such as multi-compartment medication devices (MMDs). Some of these, known as electronic MMDs (eMMDs), use audible and/or visual signals to prompt the patient when to take medication, dispense medications, give instructions to the patient, and contact a caregiver (mobile Internet or text to a carer) as needed. To systematically review the literature on the use of eMMDs, to determine what evidence for their effectiveness is available. A comprehensive literature search of 10 databases, plus an Internet search and hand searching was conducted, using the MeSH terms reminder systems/patient compliance/medication adherence. There were no date restrictions. Inclusion criteria were patients in any community setting, in any country and with no restrictions of age, gender, ethnicity or medical condition, using an eMMD. Peer-reviewed quantitative or qualitative studies of any design were included. Of 805 abstracts identified and 99 full text papers retrieved, six met the inclusion criteria. Five of the studies reported adherence to medication regimes; one reported design factors to improve adherence. Adherence varied by the context of the reminders, the target group and usability of the devices. The studies were small scale and only one was a well conducted randomised controlled trial. Overall methodological quality of the studies was poor. Although positive effects on adherence were reported further, rigorously conducted, studies are needed to inform the use of eMMDs. © 2016 Royal Pharmaceutical Society.

  10. Effect of Mobile Phone Text Message Reminders on Routine Immunization Uptake in Pakistan: Randomized Controlled Trial.

    Science.gov (United States)

    Kazi, Abdul Momin; Ali, Murtaza; Zubair, Khurram; Kalimuddin, Hussain; Kazi, Abdul Nafey; Iqbal, Saleem Perwaiz; Collet, Jean-Paul; Ali, Syed Asad

    2018-03-07

    Improved routine immunization (RI) coverage is recommended as the priority public health strategy to decrease vaccine-preventable diseases and eradicate polio in Pakistan and worldwide. The objective of this study was to ascertain whether customized, automated, one-way text messaging (short message service, SMS) reminders delivered to caregivers via mobile phones when a child is due for an RI visit can improve vaccination uptake and timelines in Pakistan. This was a randomized controlled trial, conducted in an urban squatter settlement area of Karachi, Pakistan. Infants less than 2 weeks of age with at least one family member who had a valid mobile phone connection and was comfortable receiving and reading SMS text messages were included. Participants were randomized to the intervention (standard care + one-way SMS reminder) or control (standard care) groups. The primary outcome was to compare the proportion of children immunized up to date at 18 weeks of age. Vaccine given at 6, 10, and 14 weeks schedule includes DPT-Hep-B-Hib vaccine (ie, diphtheria, pertussis, and tetanus; hepatitis B; and Haemophilus influenza type b) and oral poliovirus vaccine (OPV). Data were analyzed using chi-square tests of independence and tested for both per protocol (PP) and intention-to-treat (ITT) analyses. Out of those approached, 84.3% (300/356) of the participants were eligible for enrollment and 94.1% (318/338) of the participants had a working mobile phone. Only children in the PP analyses, who received an SMS reminder for vaccine uptake at 6 weeks visit, showed a statistically significant difference (96.0%, 86/90 vs 86.4%, 102/118; P=.03).The immunization coverage was consistently higher in the intervention group according to ITT analyses at the 6 weeks scheduled visit (76.0% vs 71.3%, P=.36). The 10 weeks scheduled visit (58.7% vs 52.7%, P=.30) and the 14 weeks scheduled visit (31.3% vs 26.0%, P=.31), however, were not statistically significant. Automated simple one-way SMS

  11. Health care professionals' beliefs about using wiki-based reminders to promote best practices in trauma care.

    Science.gov (United States)

    Archambault, Patrick Michel; Bilodeau, Andrea; Gagnon, Marie-Pierre; Aubin, Karine; Lavoie, André; Lapointe, Jean; Poitras, Julien; Croteau, Sylvain; Pham-Dinh, Martin; Légaré, France

    2012-04-19

    Wikis are knowledge translation tools that could help health professionals implement best practices in acute care. Little is known about the factors influencing professionals' use of wikis. To identify and compare the beliefs of emergency physicians (EPs) and allied health professionals (AHPs) about using a wiki-based reminder that promotes evidence-based care for traumatic brain injuries. Drawing on the theory of planned behavior, we conducted semistructured interviews to elicit EPs' and AHPs' beliefs about using a wiki-based reminder. Previous studies suggested a sample of 25 EPs and 25 AHPs. We purposefully selected participants from three trauma centers in Quebec, Canada, to obtain a representative sample. Using univariate analyses, we assessed whether our participants' gender, age, and level of experience were similar to those of all eligible individuals. Participants viewed a video showing a clinician using a wiki-based reminder, and we interviewed participants about their behavioral, control, and normative beliefs-that is, what they saw as advantages, disadvantages, barriers, and facilitators to their use of a reminder, and how they felt important referents would perceive their use of a reminder. Two reviewers independently analyzed the content of the interview transcripts. We considered the 75% most frequently mentioned beliefs as salient. We retained some less frequently mentioned beliefs as well. Of 66 eligible EPs and 444 eligible AHPs, we invited 55 EPs and 39 AHPs to participate, and 25 EPs and 25 AHPs (15 nurses, 7 respiratory therapists, and 3 pharmacists) accepted. Participating AHPs had more experience than eligible AHPs (mean 14 vs 11 years; P = .04). We noted no other significant differences. Among EPs, the most frequently reported advantage of using a wiki-based reminder was that it refreshes the memory (n = 14); among AHPs, it was that it provides rapid access to protocols (n = 16). Only 2 EPs mentioned a disadvantage (the wiki added stress

  12. The effect of electronic reminders on risk management among diabetic patients in low resourced settings

    NARCIS (Netherlands)

    Adjei, D. N.; Agyemang, C.; Dasah, J. B.; Kuranchie, P.; Amoah, A. G. B.

    2015-01-01

    Information technology has potential to improve health care delivery particularly among individuals with chronic diseases such as diabetes in low and middle-income countries (LMIC). Research on the usefulness of information technology to manage persons living with chronic diseases is scarce in LMIC.

  13. Differential Left Hippocampal Activation during Retrieval with Different Types of Reminders: An fMRI Study of the Reconsolidation Process

    Science.gov (United States)

    De Pino, Gabriela; Fernández, Rodrigo Sebastián; Villarreal, Mirta Fabiana; Pedreira, María Eugenia

    2016-01-01

    Consolidated memories return to a labile state after the presentation of cues (reminders) associated with acquisition, followed by a period of stabilization (reconsolidation). However not all cues are equally effective in initiating the process, unpredictable cues triggered it, predictable cues do not. We hypothesize that the different effects observed by the different reminder types on memory labilization-reconsolidation depend on a differential neural involvement during reminder presentation. To test it, we developed a declarative task and compared the efficacy of three reminder types in triggering the process in humans (Experiment 1). Finally, we compared the brain activation patterns between the different conditions using functional magnetic resonance imaging (fMRI) (Experiment 2). We confirmed that the unpredictable reminder is the most effective in initiating the labilization-reconsolidation process. Furthermore, only under this condition there was differential left hippocampal activation during its presentation. We suggest that the left hippocampus is detecting the incongruence between actual and past events and allows the memory to be updated. PMID:26991776

  14. Distinct effects of reminding mortality and physical pain on the default-mode activity and activity underlying self-reflection.

    Science.gov (United States)

    Shi, Zhenhao; Han, Shihui

    2018-06-01

    Behavioral research suggests that reminding both mortality and negative affect influences self-related thoughts. Using functional magnetic resonance imaging (MRI), we tested the hypothesis that reminders of mortality and physical pain decrease brain activity underlying self-related thoughts. Three groups of adults underwent priming procedures during which they answered questions pertaining to mortality, physical pain, or leisure time, respectively. Before and after priming, participants performed personality trait judgments on oneself or a celebrity, identified the font of words, or passively viewed a fixation. The default-mode activity and neural activity underlying self-reflection were identified by contrasting viewing a fixation vs. font judgment and trait judgments on oneself vs. a celebrity, respectively. The analyses of the pre-priming functional MRI (fMRI) data identified the default-mode activity in the posterior cingulate cortex (PCC), ventral medial prefrontal cortex (MPFC), and parahippocampal gyrus, and the activity underlying instructed self-reflection in both the ventral and dorsal regions of the MPFC. The analyses of the post-priming fMRI data revealed that, relative to leisure time priming, reminding mortality significantly reduced the default-mode PCC activity, and reminding physical pain significantly decreased the dorsal MPFC activity during instructed self-reflection. Our findings suggest distinct neural underpinnings of the effect of reminding morality and aversive emotion on default-mode and instructed self-reflection.

  15. Differential Left Hippocampal Activation during Retrieval with Different Types of Reminders: An fMRI Study of the Reconsolidation Process.

    Directory of Open Access Journals (Sweden)

    Cecilia Forcato

    Full Text Available Consolidated memories return to a labile state after the presentation of cues (reminders associated with acquisition, followed by a period of stabilization (reconsolidation. However not all cues are equally effective in initiating the process, unpredictable cues triggered it, predictable cues do not. We hypothesize that the different effects observed by the different reminder types on memory labilization-reconsolidation depend on a differential neural involvement during reminder presentation. To test it, we developed a declarative task and compared the efficacy of three reminder types in triggering the process in humans (Experiment 1. Finally, we compared the brain activation patterns between the different conditions using functional magnetic resonance imaging (fMRI (Experiment 2. We confirmed that the unpredictable reminder is the most effective in initiating the labilization-reconsolidation process. Furthermore, only under this condition there was differential left hippocampal activation during its presentation. We suggest that the left hippocampus is detecting the incongruence between actual and past events and allows the memory to be updated.

  16. The effect of verbal reminders on memory reactivation in 2-, 3-, and 4-year-old children.

    Science.gov (United States)

    Imuta, Kana; Scarf, Damian; Hayne, Harlene

    2013-06-01

    For adults, verbal reminders provide a powerful key to unlock our memories. For example, a simple question, such as "Do you remember your wedding day?" can reactivate rich memories of the past, allowing us to recall experiences that may have occurred days, weeks, and even decades earlier. The ability to use another person's language to access our memory of a prior experience is considered to be one of the hallmarks in human memory development, but surprisingly, little is known about the ontogeny of this fundamental ability. Prior research has shown that by 4 years of age, children can use a simple verbal reminder (e.g., "Do you remember coming here before?") to reactivate an otherwise inaccessible memory of a unique visual stimulus. Given that language comprehension precedes production, it has been hypothesized that the ability to use verbal reminders may emerge well before 4 years of age. In the present experiment, we tested this hypothesis by examining whether a verbal reminder reactivated memory in 2-, 3-, and 4-year-old children who were tested using the visual-paired comparison (VPC) paradigm. Our findings showed that the ability to exploit a simple verbal reminder emerges by at least 2 years of age. PsycINFO Database Record (c) 2013 APA, all rights reserved

  17. Factors associated with non-attendance, opportunistic attendance and reminded attendance to cervical screening in an organized screening program: a cross-sectional study of 12,058 Norwegian women

    Directory of Open Access Journals (Sweden)

    Eriksen Tormod

    2011-04-01

    likelihood of attendance in an organized screening program was higher among women who were aware of cervical screening, which suggests a potential for a higher attendance rate through improving the public knowledge of screening. Further, the lower awareness among opportunistic than reminded attendees suggests that physicians may inform their patients better when smears are taken at the physician's initiative.

  18. The impact of text message reminders on adherence to antimalarial treatment in northern Ghana: a randomized trial.

    Directory of Open Access Journals (Sweden)

    Julia R G Raifman

    Full Text Available BACKGROUND: Low rates of adherence to artemisinin-based combination therapy (ACT regimens increase the risk of treatment failure and may lead to drug resistance, threatening the sustainability of current anti-malarial efforts. We assessed the impact of text message reminders on adherence to ACT regimens. METHODS: Health workers at hospitals, clinics, pharmacies, and other stationary ACT distributors in Tamale, Ghana provided flyers advertising free mobile health information to individuals receiving malaria treatment. The messaging system automatically randomized self-enrolled individuals to the control group or the treatment group with equal probability; those in the treatment group were further randomly assigned to receive a simple text message reminder or the simple reminder plus an additional statement about adherence in 12-hour intervals. The main outcome was self-reported adherence based on follow-up interviews occurring three days after treatment initiation. We estimated the impact of the messages on treatment completion using logistic regression. RESULTS: 1140 individuals enrolled in both the study and the text reminder system. Among individuals in the control group, 61.5% took the full course of treatment. The simple text message reminders increased the odds of adherence (adjusted OR 1.45, 95% CI [1.03 to 2.04], p-value 0.028. Receiving an additional message did not result in a significant change in adherence (adjusted OR 0.77, 95% CI [0.50 to 1.20], p-value 0.252. CONCLUSION: The results of this study suggest that a simple text message reminder can increase adherence to antimalarial treatment and that additional information included in messages does not have a significant impact on completion of ACT treatment. Further research is needed to develop the most effective text message content and frequency. TRIAL REGISTRATION: ClinicalTrials.gov NCT01722734.

  19. The impact of text message reminders on adherence to antimalarial treatment in northern Ghana: a randomized trial.

    Science.gov (United States)

    Raifman, Julia R G; Lanthorn, Heather E; Rokicki, Slawa; Fink, Günther

    2014-01-01

    Low rates of adherence to artemisinin-based combination therapy (ACT) regimens increase the risk of treatment failure and may lead to drug resistance, threatening the sustainability of current anti-malarial efforts. We assessed the impact of text message reminders on adherence to ACT regimens. Health workers at hospitals, clinics, pharmacies, and other stationary ACT distributors in Tamale, Ghana provided flyers advertising free mobile health information to individuals receiving malaria treatment. The messaging system automatically randomized self-enrolled individuals to the control group or the treatment group with equal probability; those in the treatment group were further randomly assigned to receive a simple text message reminder or the simple reminder plus an additional statement about adherence in 12-hour intervals. The main outcome was self-reported adherence based on follow-up interviews occurring three days after treatment initiation. We estimated the impact of the messages on treatment completion using logistic regression. 1140 individuals enrolled in both the study and the text reminder system. Among individuals in the control group, 61.5% took the full course of treatment. The simple text message reminders increased the odds of adherence (adjusted OR 1.45, 95% CI [1.03 to 2.04], p-value 0.028). Receiving an additional message did not result in a significant change in adherence (adjusted OR 0.77, 95% CI [0.50 to 1.20], p-value 0.252). The results of this study suggest that a simple text message reminder can increase adherence to antimalarial treatment and that additional information included in messages does not have a significant impact on completion of ACT treatment. Further research is needed to develop the most effective text message content and frequency. ClinicalTrials.gov NCT01722734.

  20. Why love has wings and sex has not: how reminders of love and sex influence creative and analytic thinking.

    Science.gov (United States)

    Förster, Jens; Epstude, Kai; Ozelsel, Amina

    2009-11-01

    This article examines cognitive links between romantic love and creativity and between sexual desire and analytic thought based on construal level theory. It suggests that when in love, people typically focus on a long-term perspective, which should enhance holistic thinking and thereby creative thought, whereas when experiencing sexual encounters, they focus on the present and on concrete details enhancing analytic thinking. Because people automatically activate these processing styles when in love or when they experience sex, subtle or even unconscious reminders of love versus sex should suffice to change processing modes. Two studies explicitly or subtly reminded participants of situations of love or sex and found support for this hypothesis.

  1. Effects of viewing ordered pictorial reminders on long-term memory in the first year of life.

    Science.gov (United States)

    Carver, Leslie J

    2011-11-01

    Previous research has shown that reminders can be effective for extending and enhancing a variety of kinds of memory in infants. We investigated the effects of viewing pictorial representations of actions that were included in imitation events used to measure long-term memory in young infants. Infants who saw the pictures of actions displayed in the order in which they comprised events showed evidence of memory for the events. Infants who saw the actions presented randomly did not. These results suggest that pictures presented during the consolidation and storage phase of memory formation can be effective reminders of events for young infants.

  2. Effect of questionnaire length, personalisation and reminder type on response rate to a complex postal survey: randomised controlled trial

    Science.gov (United States)

    2011-01-01

    Background Minimising participant non-response in postal surveys helps to maximise the generalisability of the inferences made from the data collected. The aim of this study was to examine the effect of questionnaire length, personalisation and reminder type on postal survey response rate and quality and to compare the cost-effectiveness of the alternative survey strategies. Methods In a pilot study for a population study of travel behaviour, physical activity and the environment, 1000 participants sampled from the UK edited electoral register were randomly allocated using a 2 × 2 factorial design to receive one of four survey packs: a personally addressed long (24 page) questionnaire pack, a personally addressed short (15 page) questionnaire pack, a non-personally addressed long questionnaire pack or a non-personally addressed short questionnaire pack. Those who did not return a questionnaire were stratified by initial randomisation group and further randomised to receive either a full reminder pack or a reminder postcard. The effects of the survey design factors on response were examined using multivariate logistic regression. Results An overall response rate of 17% was achieved. Participants who received the short version of the questionnaire were more likely to respond (OR = 1.48, 95% CI 1.06 to 2.07). In those participants who received a reminder, personalisation of the survey pack and reminder also increased the odds of response (OR = 1.44, 95% CI 1.01 to 1.95). Item non-response was relatively low, but was significantly higher in the long questionnaire than the short (9.8% vs 5.8%; p = .04). The cost per additional usable questionnaire returned of issuing the reminder packs was £23.1 compared with £11.3 for the reminder postcards. Conclusions In contrast to some previous studies of shorter questionnaires, this trial found that shortening a relatively lengthy questionnaire significantly increased the response. Researchers should consider the trade off

  3. Reminder of the conditions of use for CERN’s picnic areas

    CERN Multimedia

    2014-01-01

    With summer on the way, we would like to remind you of some basic rules for the use of CERN’s picnic areas. Two picnic areas are available for the organisation of CERN events: • the Meyrin barbecue area in the clubs area (9405-R-000); • the Prévessin barbecue area located near to Building 972 (9401-R-000). These areas can be reserved through Indico: • 9405-R-000; • 9401-R-000. For all events taking place at weekends or on public holidays, a list of participants must be sent to the Fire Brigade (Fire.Brigade@cern.ch) and the Access Control Service (Access.Surveillance@cern.ch) for safety reasons. A request form has been created for this purpose (available here). The same services must be informed of events organised on weekdays, but a list of participants is not required in this case. For more information, click here.

  4. A painful reminder: the role of level and salience of attitude importance in cognitive dissonance.

    Science.gov (United States)

    Starzyk, Katherine B; Fabrigar, Leandre R; Soryal, Ashley S; Fanning, Jessie J

    2009-01-01

    In his seminal book, L. Festinger (1957) emphasized the role of attitude importance in cognitive dissonance. This study (N = 308) explored whether people's use of dissonance reduction strategies differs as a function of level of attitude importance and whether the personal importance of an attitude is salient. Results showed that level and salience of attitude importance interacted to affect high-choice (HC) participants' tendency to use attitude change and trivialization to reduce dissonance. When HC participants were not reminded of the personal importance of their attitude (i.e., it was not salient), they changed their attitudes equally irrespective of attitude importance, but engaged in greater trivialization with increasing levels of importance. In contrast, when attitude importance was salient, HC participants changed their attitudes less with increasing attitude importance and showed no evidence of trivializing under any level of importance.

  5. Reminder by SC/ME to those in charge of first-aid boxes

    CERN Multimedia

    2006-01-01

    The Medical Service wishes to remind all those in charge of first-aid boxes that: the contents of the boxes must be checked at least once a month to ensure that all the medication and materials are available for immediate use at all times and that none of the medication has exceeded its expiry date. in the event of termination of their contract with CERN, they must inform the Medical Service accordingly, indicating the name of their designated successor. NB: The medication and materials provided in the boxes are for occasional use only and must not be used for the regular treatment of personal medical conditions. Those requiring such regular treatment should contact the Infirmary in Building 57 R.004 - Tel. 73802

  6. Reminder by SC/ME to those in charge of first-aid boxes

    CERN Multimedia

    2006-01-01

    The Medical Service wishes to remind all those in charge of first-aid boxes that: the contents of the boxes must be checked at least once a month to ensure that all the medication and materials are available for immediate use at all times and that none of the medication has exceeded its expiry date; in the event of termination of their contract with CERN, they must inform the Medical Service accordingly, indicating the name of their designated successor. NB: The medication and materials provided in the boxes are for OCCASIONAL USE ONLY and must not be used for the regular treatment of personal medical conditions. Those requiring such regular treatment should contact the Infirmary in Building 57 R.004 - Tel. 73802

  7. The Moderating Role of Executive Functioning in Older Adults' Responses to a Reminder of Mortality

    Science.gov (United States)

    Maxfield, Molly; Pyszczynski, Tom; Greenberg, Jeff; Pepin, Renee; Davis, Hasker P.

    2011-01-01

    In previous research, older adults responded to mortality salience (MS) with increased tolerance, whereas younger persons responded with increased punitiveness. One possible explanation for this is that many older adults adapt to challenges of later life, such as the prospect of mortality, by becoming more flexible. Recent studies suggest that positively-oriented adaptation is more likely for older adults with high levels of executive functioning. We thus hypothesized that the better an older adult's executive functioning, the more likely MS would result in increased tolerance. Older and younger adults were randomly assigned to MS or control conditions, and then evaluated moral transgressors. As in previous research, younger adults were more punitive following reminders of mortality; executive functioning did not affect their responses. Among older adults, high functioning individuals responded to MS with increased tolerance rather than intolerance, whereas those low in functioning became more punitive. PMID:21728445

  8. Procedure for the classification of professional accidents of members of the personnel – REMINDER

    CERN Multimedia

    HR Department

    2011-01-01

    HR Department would like to remind members of the personnel that, according to the procedure for an accident deemed to be occupational and according to paragraph 29 of Administrative Circular No. 14 (Rev.2), they are requested to complete an accident declaration form (HS 50) within ten working days after the accident has occurred*). Once this deadline has passed, HR Department will be unable to proceed with the classification of the accident and, consequently, medical expenses that may arise linked to this accident will be reimbursed under the non-occupational scheme. In addition, any request for the classification of occupational accidents must be accompanied by a medical certificate detailing the bodily injuries resulting from the accident in question.   _______________ *) Or within three months of its occurrence if the victim or his beneficiaries are materially unable to meet this deadline.

  9. Provider Preferences and Experiences With a Countywide Centralized Collaborative Reminder/Recall for Childhood Immunizations.

    Science.gov (United States)

    Saville, Alison W; Gurfinkel, Dennis; Sevick, Carter; Beaty, Brenda; Dickinson, L Miriam; Kempe, Allison

    2016-01-01

    To assess among providers in 7 Colorado counties where a collaborative centralized reminder/recall (CC-R/R) using the Colorado Immunization Information System (CIIS) was performed: 1) preferences about CC-R/R conducted by the public health department (PHD); 2) preferences for future CC-R/R for different vaccines with and without practice names; and 3) experiences with including their name on CC-R/R notices. A mailed survey was sent to all primary care sites where CC-R/R had been previously conducted. Respondents self-identified as the "the person in charge of immunization policy within the practice." Overall response rate was 69.9% (160 of 229). Twenty-one were removed because they did not provide immunizations to children. Among respondents, 65.0% were from family medicine and 26.3% from pediatric practices; 32.1% physicians or midlevel providers; 34.3% nurses or medical assistants; and 33.6% office managers. Taking into account all issues, 57.6% were "okay" with either the PHD or their practice conducting recall; 27.3% preferred the PHD; and 14.4% preferred their practice conduct R/R. Fifty-six percent of active CIIS practices (n = 95) included their practice's name on CC-R/R notices. Interest in future CC-R/R for different ages and vaccines was strongly related to whether reminders included the practice name: 77.8% for routine immunizations in 4- to 6-year-olds; 74.8% for immunizations for 0- to 3-year-olds; 73.3% for vaccines administered to adolescents; and 59.7% for influenza (P < .001). Most practices are accepting of the PHD centrally conducting R/R, but most prefer collaboration that includes their name. Given the success and support of this method, it should be more widely adopted. Copyright © 2016 Academic Pediatric Association. Published by Elsevier Inc. All rights reserved.

  10. Investigation of psychophysical similarity measures for selection of similar images in the diagnosis of clustered microcalcifications on mammograms

    Energy Technology Data Exchange (ETDEWEB)

    Muramatsu, Chisako; Li Qiang; Schmidt, Robert; Shiraishi, Junji; Doi, Kunio [Department of Radiology, University of Chicago, 5841 South Maryland Avenue, Chicago, Illinois 60637 (United States) and Department of Intelligent Image Information, Gifu University, 1-1 Yanagido, Gifu (Japan); Department of Radiology, Duke Advanced Imaging Labs, Duke University, 2424 Erwin Road, Suite 302, Durham, North Carolina 27705 (United States); Department of Radiology, University of Chicago, 5841 South Maryland Avenue, Chicago, Illinois 60637 (United States)

    2008-12-15

    The presentation of images with lesions of known pathology that are similar to an unknown lesion may be helpful to radiologists in the diagnosis of challenging cases for improving the diagnostic accuracy and also for reducing variation among different radiologists. The authors have been developing a computerized scheme for automatically selecting similar images with clustered microcalcifications on mammograms from a large database. For similar images to be useful, they must be similar from the point of view of the diagnosing radiologists. In order to select such images, subjective similarity ratings were obtained for a number of pairs of clustered microcalcifications by breast radiologists for establishment of a ''gold standard'' of image similarity, and the gold standard was employed for determination and evaluation of the selection of similar images. The images used in this study were obtained from the Digital Database for Screening Mammography developed by the University of South Florida. The subjective similarity ratings for 300 pairs of images with clustered microcalcifications were determined by ten breast radiologists. The authors determined a number of image features which represent the characteristics of clustered microcalcifications that radiologists would use in their diagnosis. For determination of objective similarity measures, an artificial neural network (ANN) was employed. The ANN was trained with the average subjective similarity ratings as teacher and selected image features as input data. The ANN was trained to learn the relationship between the image features and the radiologists' similarity ratings; therefore, once the training was completed, the ANN was able to determine the similarity, called a psychophysical similarity measure, which was expected to be close to radiologists' impressions, for an unknown pair of clustered microcalcifications. By use of a leave-one-out test method, the best combination of features

  11. Investigation of psychophysical similarity measures for selection of similar images in the diagnosis of clustered microcalcifications on mammograms

    International Nuclear Information System (INIS)

    Muramatsu, Chisako; Li Qiang; Schmidt, Robert; Shiraishi, Junji; Doi, Kunio

    2008-01-01

    The presentation of images with lesions of known pathology that are similar to an unknown lesion may be helpful to radiologists in the diagnosis of challenging cases for improving the diagnostic accuracy and also for reducing variation among different radiologists. The authors have been developing a computerized scheme for automatically selecting similar images with clustered microcalcifications on mammograms from a large database. For similar images to be useful, they must be similar from the point of view of the diagnosing radiologists. In order to select such images, subjective similarity ratings were obtained for a number of pairs of clustered microcalcifications by breast radiologists for establishment of a ''gold standard'' of image similarity, and the gold standard was employed for determination and evaluation of the selection of similar images. The images used in this study were obtained from the Digital Database for Screening Mammography developed by the University of South Florida. The subjective similarity ratings for 300 pairs of images with clustered microcalcifications were determined by ten breast radiologists. The authors determined a number of image features which represent the characteristics of clustered microcalcifications that radiologists would use in their diagnosis. For determination of objective similarity measures, an artificial neural network (ANN) was employed. The ANN was trained with the average subjective similarity ratings as teacher and selected image features as input data. The ANN was trained to learn the relationship between the image features and the radiologists' similarity ratings; therefore, once the training was completed, the ANN was able to determine the similarity, called a psychophysical similarity measure, which was expected to be close to radiologists' impressions, for an unknown pair of clustered microcalcifications. By use of a leave-one-out test method, the best combination of features was selected. The correlation

  12. A method to test the reproducibility and to improve performance of computer-aided detection schemes for digitized mammograms

    International Nuclear Information System (INIS)

    Zheng Bin; Gur, David; Good, Walter F.; Hardesty, Lara A.

    2004-01-01

    The purpose of this study is to develop a new method for assessment of the reproducibility of computer-aided detection (CAD) schemes for digitized mammograms and to evaluate the possibility of using the implemented approach for improving CAD performance. Two thousand digitized mammograms (representing 500 cases) with 300 depicted verified masses were selected in the study. Series of images were generated for each digitized image by resampling after a series of slight image rotations. A CAD scheme developed in our laboratory was applied to all images to detect suspicious mass regions. We evaluated the reproducibility of the scheme using the detection sensitivity and false-positive rates for the original and resampled images. We also explored the possibility of improving CAD performance using three methods of combining results from the original and resampled images, including simple grouping, averaging output scores, and averaging output scores after grouping. The CAD scheme generated a detection score (from 0 to 1) for each identified suspicious region. A region with a detection score >0.5 was considered as positive. The CAD scheme detected 238 masses (79.3% case-based sensitivity) and identified 1093 false-positive regions (average 0.55 per image) in the original image dataset. In eleven repeated tests using original and ten sets of rotated and resampled images, the scheme detected a maximum of 271 masses and identified as many as 2359 false-positive regions. Two hundred and eighteen masses (80.4%) and 618 false-positive regions (26.2%) were detected in all 11 sets of images. Combining detection results improved reproducibility and the overall CAD performance. In the range of an average false-positive detection rate between 0.5 and 1 per image, the sensitivity of the scheme could be increased approximately 5% after averaging the scores of the regions detected in at least four images. At low false-positive rate (e.g., ≤average 0.3 per image), the grouping method

  13. Quantitative comparison of clustered microcalcifications in for-presentation and for-processing mammograms in full-field digital mammography.

    Science.gov (United States)

    Wang, Juan; Nishikawa, Robert M; Yang, Yongyi

    2017-07-01

    Mammograms acquired with full-field digital mammography (FFDM) systems are provided in both "for-processing'' and "for-presentation'' image formats. For-presentation images are traditionally intended for visual assessment by the radiologists. In this study, we investigate the feasibility of using for-presentation images in computerized analysis and diagnosis of microcalcification (MC) lesions. We make use of a set of 188 matched mammogram image pairs of MC lesions from 95 cases (biopsy proven), in which both for-presentation and for-processing images are provided for each lesion. We then analyze and characterize the MC lesions from for-presentation images and compare them with their counterparts in for-processing images. Specifically, we consider three important aspects in computer-aided diagnosis (CAD) of MC lesions. First, we quantify each MC lesion with a set of 10 image features of clustered MCs and 12 textural features of the lesion area. Second, we assess the detectability of individual MCs in each lesion from the for-presentation images by a commonly used difference-of-Gaussians (DoG) detector. Finally, we study the diagnostic accuracy in discriminating between benign and malignant MC lesions from the for-presentation images by a pretrained support vector machine (SVM) classifier. To accommodate the underlying background suppression and image enhancement in for-presentation images, a normalization procedure is applied. The quantitative image features of MC lesions from for-presentation images are highly consistent with that from for-processing images. The values of Pearson's correlation coefficient between features from the two formats range from 0.824 to 0.961 for the 10 MC image features, and from 0.871 to 0.963 for the 12 textural features. In detection of individual MCs, the FROC curve from for-presentation is similar to that from for-processing. In particular, at sensitivity level of 80%, the average number of false-positives (FPs) per image region is 9

  14. The effects of a reminder of underwater trauma on behaviour and memory-related mechanisms in the rat dentate gyrus.

    Science.gov (United States)

    Ardi, Ziv; Ritov, Gilad; Lucas, Morgan; Richter-Levin, Gal

    2014-04-01

    Intrusive re-experiencing is a core symptom in post-traumatic stress disorder (PTSD), often triggered by contextual cues associated with the trauma. It is not yet clear if intrusive re-experiencing is only the result, or whether it may contribute to the establishment of PTSD following acute stress. This study aimed at examining the impact of an underwater trauma (UWT) reminder on anxiety-like behaviour and on neuronal activity and plasticity in the hippocampus and the amygdala. Sprague-Dawley rats were exposed to UWT and 24 h later were re-exposed to the context. The effects on behaviour, activation of the amygdala (BLA) and dentate gyrus (DG), and on long-term potentiation (LTP) and local circuit activity (frequency-dependent inhibition (FDI) and paired-pulse inhibition (PPI)) in the DG were assessed. The exposure to UWT by itself resulted in increased anxiety behaviour in the open field, together with increased PPI. Upon exposure to the UWT reminder, an additional increase in anxiety was also observed in the EPM and in FDI. Moreover, reminder exposure resulted in impaired DG LTP and a significant BLA extracellular-signal-regulated kinases (ERK) 2 activation. In conclusion, these observed effects of exposure to a trauma reminder, following the exposure to the initial trauma, might be associated with the progression of trauma-related pathologies and the development of related disorders.

  15. Telephone follow-up to a mail survey: when to offer an interview compared to a reminder call

    Directory of Open Access Journals (Sweden)

    Ziegenfuss Jeanette Y

    2012-03-01

    Full Text Available Abstract Background Using a different mode of contact on the final follow-up to survey non-respondents is an identified strategy to increase response rates. This study was designed to determine if a reminder phone call or a phone interview as a final mode of contact to a mailed survey works better to increase response rates and which strategy is more cost effective. Methods A randomized study was embedded within a survey study of individuals treated with ulcerative colitis conducted in March 2009 in Olmsted County, Minnesota. After two mail contacts, non-respondents were randomly assigned to either a reminder telephone call or a telephone interview. Average cost per completed interview and response rates were compared between the two experimental conditions. Results The response rate in the reminder group and the interview did not differ where we considered both a completed survey and a signed form a complete (24% vs. 29%, p = 0.08. However, if such a signed form was not required, there was a substantial advantage to completing the interview over the phone (24% vs. 43%, p Conclusions The additional cost of completing an interview is worth it when an additional signed form is not required of the respondent. However, when such a signed form is required, offering an interview instead of a reminder phone call as a follow up to non-respondents does not increase response rates enough to outweigh the additional costs.

  16. The Effect of Verbal Reminders on Memory Reactivation in 2-, 3-, and 4-Year-Old Children

    Science.gov (United States)

    Imuta, Kana; Scarf, Damian; Hayne, Harlene

    2013-01-01

    For adults, verbal reminders provide a powerful key to unlock our memories. For example, a simple question, such as "Do you remember your wedding day?" can reactivate rich memories of the past, allowing us to recall experiences that may have occurred days, weeks, and even decades earlier. The ability to use another person's language to…

  17. Positive stereotypes, negative outcomes: Reminders of the positive components of complementary gender stereotypes impair performance in counter-stereotypical tasks.

    Science.gov (United States)

    Kahalon, Rotem; Shnabel, Nurit; Becker, Julia C

    2018-04-01

    Gender stereotypes are complementary: Women are perceived to be communal but not agentic, whereas men are perceived to be agentic but not communal. The present research tested whether exposure to reminders of the positive components of these gender stereotypes can lead to stereotype threat and subsequent performance deficits on the complementary dimension. Study 1 (N = 116 female participants) revealed that compared to a control/no-stereotype condition, exposure to reminders of the stereotype about women's communality (but not to reminders of the stereotype about women's beauty) impaired women's math performance. In Study 2 (N = 86 male participants), reminders of the stereotype about men's agency (vs. a control/no-stereotype condition) impaired men's performance in a test of socio-emotional abilities. Consistent with previous research on stereotype threat, in both studies the effect was evident among participants with high domain identification. These findings extend our understanding of the potentially adverse implications of seemingly positive gender stereotypes. © 2018 The British Psychological Society.

  18. 78 FR 42889 - Pipeline Safety: Reminder of Requirements for Utility LP-Gas and LPG Pipeline Systems

    Science.gov (United States)

    2013-07-18

    ... DEPARTMENT OF TRANSPORTATION Pipeline and Hazardous Materials Safety Administration 49 CFR Part 192 [Docket No. PHMSA-2013-0097] Pipeline Safety: Reminder of Requirements for Utility LP-Gas and LPG Pipeline Systems AGENCY: Pipeline and Hazardous Materials Safety Administration (PHMSA), DOT. ACTION...

  19. A daily SMS reminder increases adherence to asthma treatment: a three-month follow-up study

    DEFF Research Database (Denmark)

    Strandbygaard, Ulla; Thomsen, Simon Francis; Backer, Vibeke

    2010-01-01

    Poor adherence to asthma treatment is a well-recognised challenge and is associated with increased morbidity, mortality and consumption of health care resources. This study examined the impact of receiving a daily text message reminder on one's cell phone on adherence to asthma treatment....

  20. Automated electronic reminders to prevent miscommunication among primary medical, surgical and anaesthesia providers: a root cause analysis.

    Science.gov (United States)

    Freundlich, Robert E; Grondin, Louise; Tremper, Kevin K; Saran, Kelly A; Kheterpal, Sachin

    2012-10-01

    In this case report, the authors present an adverse event possibly caused by miscommunication among three separate medical teams at their hospital. The authors then discuss the hospital's root cause analysis and its proposed solutions, focusing on the subsequent hospital-wide implementation of an automated electronic reminder for abnormal laboratory values that may have helped to prevent similar medical errors.

  1. Controller adherence following hospital discharge in high risk children: A pilot randomized trial of text message reminders.

    Science.gov (United States)

    Kenyon, Chén C; Gruschow, Siobhan M; Quarshie, William O; Griffis, Heather; Leach, Michelle C; Zorc, Joseph J; Bryant-Stephens, Tyra C; Miller, Victoria A; Feudtner, Chris

    2018-02-13

    To assess the feasibility of a mobile health, inhaled corticosteroid (ICS) adherence reminder intervention and to characterize adherence trajectories immediately following severe asthma exacerbation in high-risk urban children with persistent asthma. Children aged 2-13 with persistent asthma were enrolled in this pilot randomized controlled trial during an asthma emergency department (ED) visit or hospitalization. Intervention arm participants received daily text message reminders for 30 days, and both arms received electronic sensors to measure ICS use. Primary outcomes were feasibility of sensor use and text message acceptability. Secondary outcomes included adherence to prescribed ICS regimen and 30-day adherence trajectories. Group-based trajectory modeling was used to examine adherence trajectories. Forty-one participants (mean age 5.9) were randomized to intervention (n = 21) or control (n = 20). Overall, 85% were Black, 88% had public insurance, and 51% of the caregivers had a high school education or less. Thirty-two participant families (78%) transmitted medication adherence data; of caregivers who completed the acceptability survey, 25 (96%) chose to receive daily reminders beyond that study interval. Secondary outcome analyses demonstrated similar average daily adherence between groups (intervention = 36%; control = 32%, P = 0.73). Three adherence trajectories were identified with none ever exceeding 80% adherence. Within a high-risk pediatric cohort, electronic monitoring of ICS use and adherence reminders delivered via text message were feasible for most participants, but there was no signal of effect. Adherence trajectories following severe exacerbation were suboptimal, demonstrating an important opportunity for asthma care improvement.

  2. Free and Cued Selective Reminding Test is superior to the Wechsler Memory Scale in discriminating mild cognitive impairment from Alzheimer's disease.

    Science.gov (United States)

    Lemos, Raquel; Cunha, Catarina; Marôco, João; Afonso, Ana; Simões, Mário R; Santana, Isabel

    2015-08-01

    The Logical Memory (LM) and the Verbal Paired Associative Learning (VPAL) are subtests from the Wechsler Memory Scale commonly used to characterize the memory deficit of amnestic mild cognitive impairment (aMCI) and Alzheimer's disease (AD). The Free and Cued Selective Reminding Test (FCSRT) was suggested to assess the memory impairment of AD spectrum patients by the International Working Group on AD. In the present study, we compared the properties of the tests and their accuracy in classifying aMCI and AD. A group of aMCI patients (n = 85) and AD patients (n = 43) were included. The reliability and the validity of the three tests were analyzed. AD patients showed a significant pattern of worse impairment on all tests than aMCI. The FCSRT was able to classify more patients as having memory impairment in the aMCI group rather than the WMS subtests. The FCSRT proved to be good in discriminating the two groups in both lower and higher educational levels, whereas the LM was more useful in higher educated patients. Although the instruments had good results, the FCSRT was more accurate in discriminating MCI from AD, and less influenced by the educational level. © 2014 Japan Geriatrics Society.

  3. Evaluation of information-theoretic similarity measures for content-based retrieval and detection of masses in mammograms

    International Nuclear Information System (INIS)

    Tourassi, Georgia D.; Harrawood, Brian; Singh, Swatee; Lo, Joseph Y.; Floyd, Carey E.

    2007-01-01

    The purpose of this study was to evaluate image similarity measures employed in an information-theoretic computer-assisted detection (IT-CAD) scheme. The scheme was developed for content-based retrieval and detection of masses in screening mammograms. The study is aimed toward an interactive clinical paradigm where physicians query the proposed IT-CAD scheme on mammographic locations that are either visually suspicious or indicated as suspicious by other cuing CAD systems. The IT-CAD scheme provides an evidence-based, second opinion for query mammographic locations using a knowledge database of mass and normal cases. In this study, eight entropy-based similarity measures were compared with respect to retrieval precision and detection accuracy using a database of 1820 mammographic regions of interest. The IT-CAD scheme was then validated on a separate database for false positive reduction of progressively more challenging visual cues generated by an existing, in-house mass detection system. The study showed that the image similarity measures fall into one of two categories; one category is better suited to the retrieval of semantically similar cases while the second is more effective with knowledge-based decisions regarding the presence of a true mass in the query location. In addition, the IT-CAD scheme yielded a substantial reduction in false-positive detections while maintaining high detection rate for malignant masses

  4. A new parameter enhancing breast cancer detection in computer-aided diagnosis of X-ray mammograms

    International Nuclear Information System (INIS)

    Tanki, Nobuyoshi; Murase, Kenya; Nagao, Michinobu

    2006-01-01

    The purpose of this study was to introduce a new parameter which enhances breast cancer detection using X-ray mammography. We used the database of X-ray mammograms generated by the Japan Society of Radiological Technology. The new parameter called 'quasi-fractal dimension (Q-FD)' was calculated from the relationship between the cutoff values for the maximum image intensity in the lesion set at 21 levels from 20% to 100% at equal intervals and the number of pixels with an intensity exceeding the cutoff value. In addition to Q-FD, the image features such as curvature (C) and eccentricity (E) were extracted. The conventional fractal dimension (C-FD) was also calculated using the box-counting method. We used artificial neural networks (ANNs) as a classification method. When using C, E, C-FD and age as inputs in ANNs and taking the number of neurons in the hidden layer as 50, we found the area under the receiver operating characteristic curve (A Z ) was 0.87±0.07 in the task differentiating between benign and malignant masses. When Q-FD was added to inputs in addition to the above parameters, the A Z value was significantly improved to become 0.93±0.09. These results suggested that Q-FD is effective for discriminating between benign and malignant masses. (author)

  5. Analysis of the effect of spatial resolution on texture features in the classification of breast masses in mammograms

    International Nuclear Information System (INIS)

    Rangayyan, R.M.; Nguyen, T.M.; Ayres, F.J.; Nandi, A.K.

    2007-01-01

    The present study investigates the effect of spatial resolution on co-occurrence matrix-based texture features in discriminating breast lesions as benign masses or malignant tumors. The highest classification result, in terms of the area under the receiver operating characteristics (ROC) curve, of A z 0.74, was obtained at the spatial resolution of 800 μm using all 14 of Haralick's texture features computed using the margins, or ribbons, of the breast masses as seen on mammograms. Furthermore, our study indicates that texture features computed using the ribbons resulted in higher classification accuracy than the same texture features computed using the corresponding regions of interest within the mass boundaries drawn by an expert radiologist. Classification experiments using each single texture feature showed that the texture F 8 , sum entropy, gives consistently high classification results with an average A z of 0.64 across all levels of resolution. At certain levels of resolution, the textures F 5 , F 9 , and F 11 individually gave the highest classification result with A z = 0.70. (orig.)

  6. Fusion of dynamic contrast-enhanced magnetic resonance mammography at 3.0 T with X-ray mammograms: Pilot study evaluation using dedicated semi-automatic registration software

    Energy Technology Data Exchange (ETDEWEB)

    Dietzel, Matthias, E-mail: dietzelmatthias2@hotmail.com [Institute of Diagnostic and Interventional Radiology, Friedrich-Schiller-University Jena, Erlanger Allee 101, D-07740 Jena (Germany); Hopp, Torsten; Ruiter, Nicole [Karlsruhe Institute of Technology (KIT), Institute for Data Processing and Electronics, Postfach 3640, D-76021 Karlsruhe (Germany); Zoubi, Ramy [Institute of Diagnostic and Interventional Radiology, Friedrich-Schiller-University Jena, Erlanger Allee 101, D-07740 Jena (Germany); Runnebaum, Ingo B. [Clinic of Gynecology and Obstetrics, Friedrich-Schiller-University Jena, Bachstrasse 18, D-07743 Jena (Germany); Kaiser, Werner A. [Institute of Diagnostic and Interventional Radiology, Friedrich-Schiller-University Jena, Erlanger Allee 101, D-07740 Jena (Germany); Medical School, University of Harvard, 25 Shattuck Street, Boston, MA 02115 (United States); Baltzer, Pascal A.T. [Institute of Diagnostic and Interventional Radiology, Friedrich-Schiller-University Jena, Erlanger Allee 101, D-07740 Jena (Germany)

    2011-08-15

    Rationale and objectives: To evaluate the semi-automatic image registration accuracy of X-ray-mammography (XR-M) with high-resolution high-field (3.0 T) MR-mammography (MR-M) in an initial pilot study. Material and methods: MR-M was acquired on a high-field clinical scanner at 3.0 T (T1-weighted 3D VIBE {+-} Gd). XR-M was obtained with state-of-the-art full-field digital systems. Seven patients with clearly delineable mass lesions >10 mm both in XR-M and MR-M were enrolled (exclusion criteria: previous breast surgery; surgical intervention between XR-M and MR-M). XR-M and MR-M were matched using a dedicated image-registration algorithm allowing semi-automatic non-linear deformation of MR-M based on finite-element modeling. To identify registration errors (RE) a virtual craniocaudal 2D mammogram was calculated by the software from MR-M (with and w/o Gadodiamide/Gd) and matched with corresponding XR-M. To quantify REs the geometric center of the lesions in the virtual vs. conventional mammogram were subtracted. The robustness of registration was quantified by registration of X-MRs to both MR-Ms with and w/o Gadodiamide. Results: Image registration was performed successfully for all patients. Overall RE was 8.2 mm (1 min after Gd; confidence interval/CI: 2.0-14.4 mm, standard deviation/SD: 6.7 mm) vs. 8.9 mm (no Gd; CI: 4.0-13.9 mm, SD: 5.4 mm). The mean difference between pre- vs. post-contrast was 0.7 mm (SD: 1.9 mm). Conclusion: Image registration of high-field 3.0 T MR-mammography with X-ray-mammography is feasible. For this study applying a high-resolution protocol at 3.0 T, the registration was robust and the overall registration error was sufficient for clinical application.

  7. Fusion of dynamic contrast-enhanced magnetic resonance mammography at 3.0 T with X-ray mammograms: Pilot study evaluation using dedicated semi-automatic registration software

    International Nuclear Information System (INIS)

    Dietzel, Matthias; Hopp, Torsten; Ruiter, Nicole; Zoubi, Ramy; Runnebaum, Ingo B.; Kaiser, Werner A.; Baltzer, Pascal A.T.

    2011-01-01

    Rationale and objectives: To evaluate the semi-automatic image registration accuracy of X-ray-mammography (XR-M) with high-resolution high-field (3.0 T) MR-mammography (MR-M) in an initial pilot study. Material and methods: MR-M was acquired on a high-field clinical scanner at 3.0 T (T1-weighted 3D VIBE ± Gd). XR-M was obtained with state-of-the-art full-field digital systems. Seven patients with clearly delineable mass lesions >10 mm both in XR-M and MR-M were enrolled (exclusion criteria: previous breast surgery; surgical intervention between XR-M and MR-M). XR-M and MR-M were matched using a dedicated image-registration algorithm allowing semi-automatic non-linear deformation of MR-M based on finite-element modeling. To identify registration errors (RE) a virtual craniocaudal 2D mammogram was calculated by the software from MR-M (with and w/o Gadodiamide/Gd) and matched with corresponding XR-M. To quantify REs the geometric center of the lesions in the virtual vs. conventional mammogram were subtracted. The robustness of registration was quantified by registration of X-MRs to both MR-Ms with and w/o Gadodiamide. Results: Image registration was performed successfully for all patients. Overall RE was 8.2 mm (1 min after Gd; confidence interval/CI: 2.0-14.4 mm, standard deviation/SD: 6.7 mm) vs. 8.9 mm (no Gd; CI: 4.0-13.9 mm, SD: 5.4 mm). The mean difference between pre- vs. post-contrast was 0.7 mm (SD: 1.9 mm). Conclusion: Image registration of high-field 3.0 T MR-mammography with X-ray-mammography is feasible. For this study applying a high-resolution protocol at 3.0 T, the registration was robust and the overall registration error was sufficient for clinical application.

  8. Beyond mere pill taking: SMS reminders for HIV treatment adherence delivered to mobile phones of clients in a community support network in Australia.

    Science.gov (United States)

    Mao, Limin; Buchanan, Andrew; Wong, Horas Tze Hoo; Persson, Asha

    2018-01-15

    SMS reminders sent to personal mobiles are increasingly used by clinical services to promote patient engagement, including adherence to antiretroviral treatment (ART) for HIV. From August to September 2015, a 6-week, randomised SMS reminder for ART adherence intervention was implemented among 98 HIV-positive clients of Australian's largest HIV charitable organisation located in Sydney. This was followed by a mixed-method evaluation, comprising a self-completed online survey and a one-to-one interview. Of the 62 survey participants, all being men, the majority were gay (85.5%) and living long-term with HIV (median year of HIV diagnosis = 1998). While everyone was on ART, a substantial proportion (n = 27, 43.5%) had interrupted treatment in the past. At the end of the intervention, based on the standard SMAQ measure, 82% had consistently adhered to ART in the previous week. While there was no statistically significant intervention effect, perceiving less stigma were independently associated with better ART adherence (adjusted odds ratio = 0.37; 95% CI 0.16-0.89; P = .026). Of the 11 interviewees, despite limited add-on effects on individual ART adherence, the campaign was well-received as a unique community support service. This study underscores the essential role of empowerment through enhancing disease self-management, increasing social support and reducing stigma, particularly for long-term HIV survivors. SMS messaging, part of mHealth, delivered by community services could have broader impacts on reducing health and social inequity. © 2018 John Wiley & Sons Ltd.

  9. Value of FNAC in abnormal axillary lymph nodes with non specific mammograms

    Directory of Open Access Journals (Sweden)

    Rania S.M. Ibrahim

    2018-06-01

    Conclusions: FNAC was a good cytological predictor in the majority of patients with abnormal lymph nodes and nonspecific mammography. FNAC is cost effective in assessing axillary lymph node status especially in limited resource setting like in our developing country. FNAC is preferred diagnostic tool in all cases of abnormal axillary lymph adenopathy.

  10. The Effectiveness of Mobile Phone Text Messaging in Improving Medication Adherence for Patients with Chronic Diseases: A Systematic Review

    OpenAIRE

    Ershad Sarabi, Roghayeh; Sadoughi, Farahnaz; Jamshidi Orak, Roohangiz; Bahaadinbeigy, Kambiz

    2016-01-01

    Context Medication non-adherence is a commonly observed problem in the self-administration of treatment, regardless of the disease type. Text messaging reminders, as electronic reminders, provide an opportunity to improve medication adherence. In this study, we aimed to provide evidence addressing the question of whether text message reminders were effective in improving patients? adherence to medication. Evidence Acquisition We carried out a systematic literature search, using the five elect...

  11. Health Care Professionals’ Beliefs About Using Wiki-Based Reminders to Promote Best Practices in Trauma Care

    Science.gov (United States)

    Bilodeau, Andrea; Gagnon, Marie-Pierre; Aubin, Karine; Lavoie, André; Lapointe, Jean; Poitras, Julien; Croteau, Sylvain; Pham-Dinh, Martin; Légaré, France

    2012-01-01

    Background Wikis are knowledge translation tools that could help health professionals implement best practices in acute care. Little is known about the factors influencing professionals’ use of wikis. Objectives To identify and compare the beliefs of emergency physicians (EPs) and allied health professionals (AHPs) about using a wiki-based reminder that promotes evidence-based care for traumatic brain injuries. Methods Drawing on the theory of planned behavior, we conducted semistructured interviews to elicit EPs’ and AHPs’ beliefs about using a wiki-based reminder. Previous studies suggested a sample of 25 EPs and 25 AHPs. We purposefully selected participants from three trauma centers in Quebec, Canada, to obtain a representative sample. Using univariate analyses, we assessed whether our participants’ gender, age, and level of experience were similar to those of all eligible individuals. Participants viewed a video showing a clinician using a wiki-based reminder, and we interviewed participants about their behavioral, control, and normative beliefs—that is, what they saw as advantages, disadvantages, barriers, and facilitators to their use of a reminder, and how they felt important referents would perceive their use of a reminder. Two reviewers independently analyzed the content of the interview transcripts. We considered the 75% most frequently mentioned beliefs as salient. We retained some less frequently mentioned beliefs as well. Results Of 66 eligible EPs and 444 eligible AHPs, we invited 55 EPs and 39 AHPs to participate, and 25 EPs and 25 AHPs (15 nurses, 7 respiratory therapists, and 3 pharmacists) accepted. Participating AHPs had more experience than eligible AHPs (mean 14 vs 11 years; P = .04). We noted no other significant differences. Among EPs, the most frequently reported advantage of using a wiki-based reminder was that it refreshes the memory (n = 14); among AHPs, it was that it provides rapid access to protocols (n = 16). Only 2 EPs

  12. REMINDER Saved Leave Scheme (SLS) : Transfer of leave to saved leave accounts

    CERN Multimedia

    HR Division

    2002-01-01

    Under the provisions of the voluntary saved leave scheme (SLS), a maximum total of 10 days'*) annual and compensatory leave (excluding saved leave accumulated in accordance with the provisions of Administrative Circular No. 22B) can be transferred to the saved leave account at the end of the leave year (30 September). We remind you that, since last year, unused leave of all those taking part in the saved leave scheme at the closure of the leave-year accounts is transferred automatically to the saved leave account on that date. Therefore, staff members have no administrative steps to take. In addition, the transfer, which eliminates the risk of omitting to request leave transfers and rules out calculation errors in transfer requests, will be clearly shown in the list of leave transactions that can be consulted in EDH from October 2002 onwards. Furthermore, this automatic leave transfer optimizes staff members' chances of benefiting from a saved leave bonus provided that they are still participants in the schem...

  13. REMINDER: SUPPLEMENTARY CONTRIBUTION PAYABLE TO THE HEALTH INSURANCE SCHEME FOR THE SPOUSE'S COVERAGE

    CERN Document Server

    2003-01-01

    Staff Members, Fellows and Pensioners are reminded that any change in the marital status of members of the personnel, as well as any change in the spouse's income or health insurance cover, shall be notified in writing to CERN, within 30 calendar days of the change, in accordance with Article R IV 1.17 of the Staff Regulations. Such changes may have consequences on the conditions of the spouse's affiliation to the CERN Health Insurance Scheme (CHIS) or on the payment of the supplementary contribution to the CHIS for the coverage of the spouse. In 2003, for the following income brackets, the indexed amounts in Swiss francs of the supplementary contribution are : - more than 30'000 CHF and up to 50'000 CHF: 134.- - more than 50'000 CHF and up to 90'000 CHF: 234.- - more than 90'000 CHF and up to 130'000 CHF: 369.- - more than 130'000 CHF: 468.- It is in the member of the personnel's interest to declare as soon as possible a change in the annual income of his spouse in order that the contribution is adjusted w...

  14. Self-Organizing Wearable Device Platform for Assisting and Reminding Humans in Real Time

    Directory of Open Access Journals (Sweden)

    Yu Jin Park

    2016-01-01

    Full Text Available Most older persons would prefer “aging in my place,” that is, to remain in good health and live independently in their own home as long as possible. For assisting the independent living of older people, the ability to gather and analyze a user’s daily activity data would constitute a significant technical advance, enhancing their quality of life. However, the general approach based on centralized server has several problems such as the usage complexity, the high price of deployment and expansion, and the difficulty in identifying an individual person. To address these problems, we propose a wearable device platform for the life assistance of older persons that automatically records and analyzes their daily activity without intentional human intervention or a centralized server (i.e., cloud server. The proposed platform contains self-organizing protocols, Delay-Tolerant Messaging system, knowledge-based analysis and alerting for daily activities, and a hardware platform that provides low power consumption. We implemented a prototype smart watch, called Personal Activity Assisting and Reminding (PAAR, as a testbed for the proposed platform, and evaluated the power consumption and the service time of example scenarios.

  15. Structural Equation Modelling in Behavioral Intention to Use Safety Helmet Reminder System

    Directory of Open Access Journals (Sweden)

    Rosli Naida

    2016-01-01

    Full Text Available Motorcycle is one of private transportation which has been widely used in many countries including Malaysia. However, motorcycles are the most dangerous form of motorized transport. Royal Malaysian Police (PDRM statistics recorded that motorcycle is the highest vehicle (45.9% involved in traffic accident compared to other vehicles. The potential cause of the death to the motorcyclist was due to the head injury. One of strategy to mitigate this problem is through proper usage of safety helmet. Therefore, this paper was introduce a new approach on motorcyclist safety by using the Technology Acceptance Model (TAM with additional determinants that contribute to behavioral intention and to increase the proper usage of safety helmets among Malaysian motorcyclists. The Structural Equation Modelling (SEM was used to test the structural TAM proposed. The evaluation for structural model showed the goodness of fit indices are excellent fit. This study found that perceived ease of use, perceived usefulness and social norm are significant towards behavioral intention to use Safety Helmet Reminder System (SHR.

  16. REMINDER CONCERNING THE SUPPLEMENTARY CONTRIBUTION PAYABLE TO THE HEALT INSURANCE SCHEME FOR SPOUSE COVERAGE

    CERN Multimedia

    Human Resources Division

    2002-01-01

    Staff members, fellows and pensioners are reminded that any change in the marital status of members of the personnel, as well as any change in the spouse's income or health insurance cover, shall be notified in writing to CERN, within 30 calendar days of the change, in accordance with Article R IV 1.17 of the Staff Regulations. Such changes may have consequences on the affiliation of the spouse to the CERN Health Insurance Scheme (CHIS) or on the payment of the supplementary contribution to the CHIS for the coverage of the spouse. In 2002, for the following income brackets, the indexed amounts in Swiss francs of the supplementary contribution are:   more than 30'000 CHF and up to 50'000 CHF: 134.- more than 50'000 CHF and up to 90'000 CHF: 234.- more than 90'000 CHF and up to 130'000 CHF: 369.- more than 130'000 CHF: 461.- It is in the member of the personnel's interest to declare a change in the annual income of his/her spouse as soon as possible in order to adjust contributions with the m...

  17. Drivers' attitudes toward front or rear child passenger belt use and seat belt reminders at these seating positions.

    Science.gov (United States)

    Kidd, David G; McCartt, Anne T

    2014-01-01

    Passengers, especially those in rear seating positions, use seat belts less frequently than drivers. In-vehicle technology can inform drivers when their passengers are unbuckled and encourage passengers to use belts. The current study collected information about drivers' attitudes toward passenger belt use and belt reminders for front passengers and children in back seats. A national telephone survey of 1218 people 18 and older was conducted, of which 477 respondents were drivers who transport a front seat passenger at least once a week and 254 were drivers who transport an 8- to 15-year-old child in the back seat. Respondents were asked about their attitudes toward belt use by their front passengers or rear child passengers and preferences for different passenger belt reminder features. Ninety percent of drivers who regularly transport front seat passengers said that the passengers always use seat belts. Reported belt use was even higher among 8- to 15-year-old children in the back seat (97%). Among the drivers whose children do not always buckle up, about half said their child unbuckled the belt during the trip. Almost every full-time belt use driver (96%) would encourage front passengers to buckle up if not belted, compared to 57 percent of part-time belt users and nonusers. In contrast, nearly every driver who transports children in the back seat would encourage their belt use, regardless of the driver's belt use habits. Most drivers who transport front passengers wanted passenger belt reminders to encourage passengers to buckle up. Most of these drivers wanted a chime/buzzer or warning light or text display and wanted the reminder to last indefinitely. Most drivers who transport child passengers in the rear seat wanted the vehicle to indicate whether child passengers are unbuckled. A large majority of these drivers wanted notifications via a visual diagram of seating positions and belt use, a chime/buzzer, and a warning light or text display. These drivers

  18. It should be indicate a biopsy for BI-RADS 3 mammogram?

    Directory of Open Access Journals (Sweden)

    Anahi Ofelia Vera San Miguel

    2016-12-01

    Full Text Available Background: Worldwide, mammography is the imaging method most commonly used for early detection of breast cancer, decisive for prior to the onset of symptoms diagnosed. The malignancy that is recorded more frequently in women is breast cancer, regarded worldwide as a major public health problem. By implementing the BI-RADS manual seeks to standardize mammographic report. Objective: To determine the radiographic and anatomic-pathologic concordance of mammographic findings in women of thirty years and more, who consulted in the Hospital Central del Instituto de Previsión Social- Paraguay, during the first semester of 2015. Materials and Methods: We performed a cross-sectional, retrospective study. The variables age, reasons for seeing a doctor, mammographic findings, histopathological diagnoses obtained from breast biopsy and reporting BI-RADS were studied. Results: The sample consisted of 138 women. The age range of the patients was 30 to 89 years, with an average of 55 years. The annual routine check represented the most frequent reason for consultation (52.0%. 71.0% of the findings corresponded to dense nodules, and they were 75.0% malignancies. Conclusion: The agreement was moderate with Kappa index. In patients with BI-RADS 3, there were found 30.62% malignancies, so it is suggested to consider from this level for pathological study.

  19. Parameter optimization of a computer-aided diagnosis scheme for the segmentation of microcalcification clusters in mammograms

    International Nuclear Information System (INIS)

    Gavrielides, Marios A.; Lo, Joseph Y.; Floyd, Carey E. Jr.

    2002-01-01

    Our purpose in this study is to develop a parameter optimization technique for the segmentation of suspicious microcalcification clusters in digitized mammograms. In previous work, a computer-aided diagnosis (CAD) scheme was developed that used local histogram analysis of overlapping subimages and a fuzzy rule-based classifier to segment individual microcalcifications, and clustering analysis for reducing the number of false positive clusters. The performance of this previous CAD scheme depended on a large number of parameters such as the intervals used to calculate fuzzy membership values and on the combination of membership values used by each decision rule. These parameters were optimized empirically based on the performance of the algorithm on the training set. In order to overcome the limitations of manual training and rule generation, the segmentation algorithm was modified in order to incorporate automatic parameter optimization. For the segmentation of individual microcalcifications, the new algorithm used a neural network with fuzzy-scaled inputs. The fuzzy-scaled inputs were created by processing the histogram features with a family of membership functions, the parameters of which were automatically extracted from the distribution of the feature values. The neural network was trained to classify feature vectors as either positive or negative. Individual microcalcifications were segmented from positive subimages. After clustering, another neural network was trained to eliminate false positive clusters. A database of 98 images provided training and testing sets to optimize the parameters and evaluate the CAD scheme, respectively. The performance of the algorithm was evaluated with a FROC analysis. At a sensitivity rate of 93.2%, there was an average of 0.8 false positive clusters per image. The results are very comparable with those taken using our previously published rule-based method. However, the new algorithm is more suited to generalize its

  20. Application of support vector machines to breast cancer screening using mammogram and clinical history data

    Science.gov (United States)

    Land, Walker H., Jr.; McKee, Dan; Velazquez, Roberto; Wong, Lut; Lo, Joseph Y.; Anderson, Francis R.

    2003-05-01

    The objectives of this paper are to discuss: (1) the development and testing of a new Evolutionary Programming (EP) method to optimally configure Support Vector Machine (SVM) parameters for facilitating the diagnosis of breast cancer; (2) evaluation of EP derived learning machines when the number of BI-RADS and clinical history discriminators are reduced from 16 to 7; (3) establishing system performance for several SVM kernels in addition to the EP/Adaptive Boosting (EP/AB) hybrid using the Digital Database for Screening Mammography, University of South Florida (DDSM USF) and Duke data sets; and (4) obtaining a preliminary evaluation of the measurement of SVM learning machine inter-institutional generalization capability using BI-RADS data. Measuring performance of the SVM designs and EP/AB hybrid against these objectives will provide quantative evidence that the software packages described can generalize to larger patient data sets from different institutions. Most iterative methods currently in use to optimize learning machine parameters are time consuming processes, which sometimes yield sub-optimal values resulting in performance degradation. SVMs are new machine intelligence paradigms, which use the Structural Risk Minimization (SRM) concept to develop learning machines. These learning machines can always be trained to provide global minima, given that the machine parameters are optimally computed. In addition, several system performance studies are described which include EP derived SVM performance as a function of: (a) population and generation size as well as a method for generating initial populations and (b) iteratively derived versus EP derived learning machine parameters. Finally, the authors describe a set of experiments providing preliminary evidence that both the EP/AB hybrid and SVM Computer Aided Diagnostic C++ software packages will work across a large population of patients, based on a data set of approximately 2,500 samples from five different

  1. Examining Unlock Journaling with Diaries and Reminders for In Situ Self-Report in Health and Wellness.

    Science.gov (United States)

    Zhang, Xiaoyi; Pina, Laura R; Fogarty, James

    2016-05-07

    In situ self-report is widely used in human-computer interaction, ubiquitous computing, and for assessment and intervention in health and wellness. Unfortunately, it remains limited by high burdens. We examine unlock journaling as an alternative. Specifically, we build upon recent work to introduce single-slide unlock journaling gestures appropriate for health and wellness measures. We then present the first field study comparing unlock journaling with traditional diaries and notification-based reminders in self-report of health and wellness measures. We find unlock journaling is less intrusive than reminders, dramatically improves frequency of journaling, and can provide equal or better timeliness . Where appropriate to broader design needs, unlock journaling is thus an overall promising method for in situ self-report.

  2. Lack of chart reminder effectiveness on family medicine resident JNC-VI and NCEP III guideline knowledge and attitudes

    Directory of Open Access Journals (Sweden)

    Upshur Ross EG

    2004-07-01

    Full Text Available Abstract Background The literature demonstrates that medical residents and practicing physicians have an attitudinal-behavioral discordance concerning their positive attitudes towards clinical practice guidelines (CPG, and the implementation of these guidelines into clinical practice patterns. Methods A pilot study was performed to determine if change in a previously identified CPG compliance factor (accessibility would produce a significant increase in family medicine resident knowledge and attitude toward the guidelines. The primary study intervention involved placing a summary of the Sixth Report of the Joint National Committee on Prevention, Detection, Evaluation, and Treatment of High Blood Pressure (JNC VI and the National Cholesterol Education Program Expert Panel on Detection, Evaluation, and Treatment of High Blood Cholesterol in Adults (NCEP III CPGs in all patient (>18 yr. charts for a period of three months. The JNC VI and NCEP III CPGs were also distributed to each Wayne State family medicine resident, and a copy of each CPG was placed in the preceptor's area of the involved clinics. Identical pre- and post- intervention questionnaires were administered to all residents concerning CPG knowledge and attitude. Results Post-intervention analysis failed to demonstrate a significant difference in CPG knowledge. A stastically significant post-intervention difference was found in only on attitude question. The barriers to CPG compliance were identified as 1 lack of CPG instruction; 2 lack of critical appraisal ability; 3 insufficient time; 4 lack of CPG accessibility; and 5 lack of faculty modeling. Conclusion This study demonstrated no significant post intervention changes in CPG knowledge, and only one question that reflected attitude change. Wider resident access to dedicated clinic time, increased faculty modeling, and the implementation of an electronic record/reminder system that uses a team-based approach are compliance factors that

  3. Health Care Professionals’ Beliefs About Using Wiki-Based Reminders to Promote Best Practices in Trauma Care

    OpenAIRE

    Archambault, Patrick Michel; Bilodeau, Andrea; Gagnon, Marie-Pierre; Aubin, Karine; Lavoie, André; Lapointe, Jean; Poitras, Julien; Croteau, Sylvain; Pham-Dinh, Martin; Légaré, France

    2012-01-01

    Background Wikis are knowledge translation tools that could help health professionals implement best practices in acute care. Little is known about the factors influencing professionals’ use of wikis. Objectives To identify and compare the beliefs of emergency physicians (EPs) and allied health professionals (AHPs) about using a wiki-based reminder that promotes evidence-based care for traumatic brain injuries. Methods Drawing on the theory of planned behavior, we conducted semistructured int...

  4. Lifestyle intervention using an internet-based curriculum with cell phone reminders for obese Chinese teens: a randomized controlled study.

    Directory of Open Access Journals (Sweden)

    Anisha A Abraham

    Full Text Available Obesity is an increasing public health problem affecting young people. The causes of obesity are multi-factorial among Chinese youth including lack of physical activity and poor eating habits. The use of an internet curriculum and cell phone reminders and texting may be an innovative means of increasing follow up and compliance with obese teens. The objectives of this study were to determine the feasibility of using an adapted internet curriculum and existing nutritional program along with cell phone follow up for obese Chinese teens.This was a randomized controlled study involving obese teens receiving care at a paediatric obesity clinic of a tertiary care hospital in Hong Kong. Forty-eight subjects aged 12 to 18 years were randomized into three groups. The control group received usual care visits with a physician in the obesity clinic every three months. The first intervention (IT group received usual care visits every three months plus a 12-week internet-based curriculum with cell phone calls/texts reminders. The second intervention group received usual care visits every three months plus four nutritional counselling sessions.The use of the internet-based curriculum was shown to be feasible as evidenced by the high recruitment rate, internet log-in rate, compliance with completing the curriculum and responses to phone reminders. No significant differences in weight were found between IT, sLMP and control groups.An internet-based curriculum with cell phone reminders as a supplement to usual care of obesity is feasible. Further study is required to determine whether an internet plus text intervention can be both an effective and a cost-effective adjunct to changing weight in obese youth.Chinese Clinical Trial Registry ChiCTR-TRC-12002624.

  5. Effects of viewing ordered pictorial reminders on long-term memory in the first year of life

    OpenAIRE

    Carver, Leslie J.

    2011-01-01

    Previous research has shown that reminders can be effective for extending and enhancing a variety of kinds of memory in infants. We investigated the effects of viewing pictorial representations of actions that were included in imitation events used to measure long-term memory in young infants. Infants who saw the pictures of actions displayed in the order in which they comprised events showed evidence of memory for the events. Infants who saw the actions presented randomly did not. These resu...

  6. Recommendations for the management of patients with obstructive sleep apnoea and hypertension

    DEFF Research Database (Denmark)

    Parati, Gianfranco; Lombardi, Carolina; Hedner, Jan

    2013-01-01

    Respiratory Society and the European Society of Hypertension. In particular, these recommendations are aimed at reminding cardiovascular experts to consider the occurrence of sleep-related breathing disorders in patients with high blood pressure. They are also aimed at reminding respiration experts...

  7. Clinicopathogical characteristics and mammographic features of breast cancer showing architectural distortion on a mammogram

    International Nuclear Information System (INIS)

    Kanzaki, Masao; Hirose, Naoko; Suwa, Kaori; Yoshida, Masayuki; Otuki, Yoshiro; Kobayashi, Hiroshi

    2012-01-01

    Seven hundred and twenty-seven cases of breast cancer were diagnosed in this clinic between January 2003 and December 2010. Of those, 97 patients who showed architectural distortion on mammography were examined regarding the clinicopathological characteristics and mammographic features. The overall rate of architectural distortion was 13.3%, which became higher with progression of the clinical stage. The rate of lymph node metastasis was 50.5% histologically, and the most common histological type was scirrhous carcinoma at 36.2%, papillotubular carcinoma at 33%, invasive lobular carcinoma at 12.1%, and ductal carcinoma in situ at 11%. Cases of extensive ductal spread beyond the breast quadrant, accompanied by microcalcifications or showing architectural distortion in two views on mammography, were present at significantly high rates. Cases showing architectural distortion in two views on mammography accounted for 66% of the total, and, when these cases were not associated with any other mammographic findings, the most suspected histology of the lesion was invasive lobular carcinoma or carcinoma in situ. (author)

  8. Do pre-trained deep learning models improve computer-aided classification of digital mammograms?

    Science.gov (United States)

    Aboutalib, Sarah S.; Mohamed, Aly A.; Zuley, Margarita L.; Berg, Wendie A.; Luo, Yahong; Wu, Shandong

    2018-02-01

    Digital mammography screening is an important exam for the early detection of breast cancer and reduction in mortality. False positives leading to high recall rates, however, results in unnecessary negative consequences to patients and health care systems. In order to better aid radiologists, computer-aided tools can be utilized to improve distinction between image classifications and thus potentially reduce false recalls. The emergence of deep learning has shown promising results in the area of biomedical imaging data analysis. This study aimed to investigate deep learning and transfer learning methods that can improve digital mammography classification performance. In particular, we evaluated the effect of pre-training deep learning models with other imaging datasets in order to boost classification performance on a digital mammography dataset. Two types of datasets were used for pre-training: (1) a digitized film mammography dataset, and (2) a very large non-medical imaging dataset. By using either of these datasets to pre-train the network initially, and then fine-tuning with the digital mammography dataset, we found an increase in overall classification performance in comparison to a model without pre-training, with the very large non-medical dataset performing the best in improving the classification accuracy.

  9. Dose to patient in tomosynthesis

    International Nuclear Information System (INIS)

    Minambres Moro, A.; Fernandez Leton, P.; Garcia Rui-Zorrilla, J.; Perez Moreno, J. M.; Zucca Aparicio, D.

    2013-01-01

    They are beginning to implement digital mammography with the possibility of acquiring in tomosynthesis, whose biggest advantage is to distinguish structures without overlapping through of pseudotridimensionals images. With these modified mammograms can acquire a planar mammography, with fixed x-ray tube, or a tomosynthesis with tube by turning. For acquire tomosynthesis is necessary a detector of high efficiency together with tungsten white tubes. The objective of this study is to know the dose received by the patient with this new imaging. (Author)

  10. Change of behaviour when selecting food products in a supermarket environment after reminding consumers about weight management.

    Science.gov (United States)

    Saarela, Anna-Maria

    2014-05-01

    The aim was to explore how the behaviour of consumers changed while they selected food in a supermarket environment after they were reminded about weight management. This investigation was carried out from the perspective of selection criteria, reading of package labels, nutritional quality of the products selected and time taken to select a product. The subjects, who were actively watching their weight, participated in two consecutive tasks in a supermarket. They were given a shopping list of eleven food categories and asked to think aloud while selecting from each category a product they usually buy and a product they would use for weight management. The data (n 792 selections) were collected through interviews and a verbal analysis protocol combined with wireless audio-visual observation. Thirty-six consumers were recruited from a sample of 367 supermarket customers. Kuopio, Finland. The subjects' behaviour changed radically after they were reminded about weight management. In the first selection, taste and familiarity were the main food selection criteria while in the latter selection the energy/fat content predominated. Consequently, the nutritional quality of products improved greatly because subjects read package labels twice as much in the latter selection. The time taken to select a product increased significantly, on average, from 23 (sd 10) to 60 (sd 51) s/product (P = 0·000). Only by reminding consumers about weight management was there a significant impact on their food selection behaviour. Marketing communication should be developed which quickly and easily promotes consumers' awareness of healthy food in supermarkets.

  11. Effect of a reminder video using a mobile phone on the retention of CPR and AED skills in lay responders.

    Science.gov (United States)

    Ahn, Ji Yun; Cho, Gyu Chong; Shon, You Dong; Park, Seung Min; Kang, Ku Hyun

    2011-12-01

    Skills related to cardiopulmonary resuscitation (CPR) and automated external defibrillator (AED) use by lay responders decay rapidly after training, and efforts are required to maintain competence among trainees. We examined whether repeated viewing of a reminder video on a mobile phone would be an effective means of maintaining CPR and AED skills in lay responders. In a single-blind case-control study, 75 male students received training in CPR and AED use. They were allocated either to the control or to the video-reminded group, who received a memory card containing a video clip about CPR and AED use for their mobile phone, which they were repeatedly encouraged to watch by SMS text message. CPR and AED skills were assessed in scenario format by examiners immediately and 3 months after initial training. Three months after initial training, the video-reminded group showed more accurate airway opening (PCPR after defibrillation (PCPR confidence scores and increased willingness to perform bystander CPR in cardiac arrest than the controls at 3 months (PCPR and AED skills in lay responders. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  12. Disease-specific direct-to-consumer advertising for reminding consumers to take medications.

    Science.gov (United States)

    Bhutada, Nilesh S; Rollins, Brent L

    2015-01-01

    To assess the relationship between disease-specific direct-to-consumer (DTC) advertising, via traditional advertising effectiveness measures, and consumers' self-reported medication-taking behavior. Data were gathered for 514 respondents (age 18 and above) using an online survey panel. Participants were exposed to a disease-specific (i.e., nonbranded) DTC advertising for depression. The advertising stimulus created for the study was based on the Food and Drug Administration guidelines for disease-specific DTC advertising and modeled after current print disease-specific DTC advertising. Participants reviewed the advertising stimulus through the online program and then responded to a questionnaire containing closed-ended questions assessing the constructs. Data were analyzed using chi-square tests. All tests were interpreted at an a priori alpha of 0.05. Significantly more respondents who were highly involved, paid more attention to the advertisement, and were responsive to DTC advertisements in the past indicated that the disease-specific DTC advertising stimulus reminded them to take their depression and other medications. These exploratory results show disease-specific DTC advertising can help people remember to take their prescription medication when viewed, which may lead to more positive medication-taking behavior and increased medication adherence. Additionally, given the fair balance and legal issues surrounding product-specific DTC advertising, disease-specific DTC advertising can serve as an effective component of the marketing mix for pharmaceutical manufacturers. Future research should attempt to study the impact of disease-specific DTC advertising on consumers' actual medication adherence using standardized adherence measures such as prescription records.

  13. Construct validity of the Free and Cued Selective Reminding Test in older adults with memory complaints.

    Science.gov (United States)

    Clerici, Francesca; Ghiretti, Roberta; Di Pucchio, Alessandra; Pomati, Simone; Cucumo, Valentina; Marcone, Alessandra; Vanacore, Nicola; Mariani, Claudio; Cappa, Stefano Francesco

    2017-06-01

    The Free and Cued Selective Reminding Test (FCSRT) is the memory test recommended by the International Working Group on Alzheimer's disease (AD) for the detection of amnestic syndrome of the medial temporal type in prodromal AD. Assessing the construct validity and internal consistency of the Italian version of the FCSRT is thus crucial. The FCSRT was administered to 338 community-dwelling participants with memory complaints (57% females, age 74.5 ± 7.7 years), including 34 with AD, 203 with Mild Cognitive Impairment, and 101 with Subjective Memory Impairment. Internal Consistency was estimated using Cronbach's alpha coefficient. To assess convergent validity, five FCSRT scores (Immediate Free Recall, Immediate Total Recall, Delayed Free Recall, Delayed Total Recall, and Index of Sensitivity of Cueing) were correlated with three well-validated memory tests: Story Recall, Rey Auditory Verbal Learning test, and Rey Complex Figure (RCF) recall (partial correlation analysis). To assess divergent validity, a principal component analysis (an exploratory factor analysis) was performed including, in addition to the above-mentioned memory tasks, the following tests: Word Fluencies, RCF copy, Clock Drawing Test, Trail Making Test, Frontal Assessment Battery, Raven Coloured Progressive Matrices, and Stroop Colour-Word Test. Cronbach's alpha coefficients for immediate recalls (IFR and ITR) and delayed recalls (DFR and DTR) were, respectively, .84 and .81. All FCSRT scores were highly correlated with those of the three well-validated memory tests. The factor analysis showed that the FCSRT does not load on the factors saturated by non-memory tests. These findings indicate that the FCSRT has a good internal consistency and has an excellent construct validity as an episodic memory measure. © 2015 The British Psychological Society.

  14. The personalized reminder information and social management system (PRISM) trial: rationale, methods and baseline characteristics.

    Science.gov (United States)

    Czaja, Sara J; Boot, Walter R; Charness, Neil; A Rogers, Wendy; Sharit, Joseph; Fisk, Arthur D; Lee, Chin Chin; Nair, Sankaran N

    2015-01-01

    Technology holds promise in terms of providing support to older adults. To date, there have been limited robust systematic efforts to evaluate the psychosocial benefits of technology for older people and identify factors that influence both the usability and uptake of technology systems. In response to these issues, we developed the Personal Reminder Information and Social Management System (PRISM), a software application designed for older adults to support social connectivity, memory, knowledge about topics, leisure activities and access to resources. This trail is evaluating the impact of access to the PRISM system on outcomes such as social isolation, social support and connectivity. This paper reports on the approach used to design the PRISM system, study design, methodology and baseline data for the trial. The trial is multi-site randomized field trial. PRISM is being compared to a Binder condition where participants received a binder that contained content similar to that found on PRISM. The sample includes 300 older adults, aged 65-98 years, who lived alone and at risk for being isolated. The primary outcome measures for the trial include indices of social isolation and support and well-being. Secondary outcomes measures include indices of computer proficiency, technology uptake and attitudes towards technology. Follow-up assessments occurred at 6 and 12 months post-randomization. The results of this study will yield important information about the potential value of technology for older adults. The study also demonstrates how a user-centered iterative design approach can be incorporated into the design and evaluation of an intervention protocol. Copyright © 2014 Elsevier Inc. All rights reserved.

  15. Characteristics of breast cancers detected by ultrasound screening in women with negative mammograms

    International Nuclear Information System (INIS)

    Bae, Min-Sun; Han, Wonshik; Koo, Hye-Ryoung

    2011-01-01

    Screening ultrasound (US) can increase the detection of breast cancer. However, little is known about the clinicopathologic characteristics of breast cancers detected by screening US. A search of the database for patients with breast cancer yielded a dataset in 6837 women who underwent breast surgery at Seoul National University Hospital (Korea). Of 6837 women, 1047 were asymptomatic and had a non-palpable cancer. Two hundred fifty-four women with 256 cancers detected by US (US-detected cancer) and 793 women with 807 cancers detected by mammography (MG-detected cancer) were identified. The imaging, clinicopathologic, and molecular data were reviewed. Univariate and multivariate analyses were carried out. Women with US-detected cancer were younger and were more likely to undergo breast-conserving surgery and to have node-negative invasive cancer (P 2 cm in size, tumors that were ≤1 cm in size were 2.2-fold more likely to be US-detected cancers (P=0.02). Compared to the luminal A subtype tumors (estrogen receptor [ER]+, PR+, HER2-), luminal B subtype tumors (ER+, PR+, HER2+) were less likely to be in the US-detected cancer group (P<0.01). Women with dense breasts were more likely to have US-detected cancer (P<0.01) versus those with non-dense breasts. Screening US-detected cancers were less likely to be diagnosed as category 5 instead of category 4 (P<0.01). In conclusion, women with US-detected breast cancer are more likely to have small-sized invasive cancer and more likely associated with the luminal A subtype. (author)

  16. Disparities in abnormal mammogram follow-up time for Asian women compared to non-Hispanic Whites and between Asian ethnic groups

    Science.gov (United States)

    Nguyen, KH; Pasick, RJ; Stewart, SL; Kerlikowske, K; Karliner, LS

    2017-01-01

    Background Delays in abnormal mammogram follow-up contribute to poor outcomes. We examined abnormal screening mammogram follow-up differences for non-Hispanic Whites (NHW) and Asian women. Methods Prospective cohort of NHW and Asian women with a Breast Imaging Reporting and Data System abnormal result of 0 or 3+ in the San Francisco Mammography Registry between 2000–2010. We performed Kaplan-Meier estimation for median-days to follow-up with a diagnostic radiologic test, and compared proportion with follow-up at 30, 60 and 90 days, and no follow-up at one-year for Asians overall (and Asian ethnic groups) and NHWs. We additionally assessed the relationship between race/ethnicity and time-to-follow-up with adjusted Cox proportional hazards models. Results Among Asian women, Vietnamese and Filipinas had the longest, and Japanese the shortest, median follow-up time (32, 28, 19 days, respectively) compared to NHWs (15 days). The proportion of women receiving follow-up at 30 days was lower for Asians vs NHWs (57% vs 77%, pAsian ethnic groups except Japanese. Asians had a reduced hazard of follow-up compared with NHWs (aHR 0.70, 95% CI 0.69–0.72). Asians also had a higher rate than NHWs of no follow-up (15% vs 10%; pAsian ethnic groups, Filipinas had the highest percentage of women with no follow-up (18.1%). Conclusion Asian, particularly Filipina and Vietnamese, women were less likely than NHWs to receive timely follow-up after an abnormal screening mammogram. Research should disaggregate Asian ethnicity to better understand and address barriers to effective cancer prevention. PMID:28603859

  17. Evaluation of SMS reminder messages for altering treatment adherence and health seeking perceptions among malaria care-seekers in Nigeria.

    Science.gov (United States)

    Liu, Jenny X; Modrek, Sepideh

    2016-12-01

    In Nigeria, access to malaria diagnostics may be expanded if drug retailers were allowed to administer malaria rapid diagnostic tests (RDTs). A 2012 pilot intervention showed that short message service (SMS) reminder messages could boost treatment adherence to RDT results by 10-14% points. This study aimed to replicate the SMS intervention in a different population, and additionally test the effect of an expanded message about anticipated RDT access policy change on customers' acceptability for drug retailers' administration of RDTs. One day after being tested with an RDT, participants who purchased malaria treatment from drug shops were randomized to receive (1) a basic SMS reminder repeating the RDT result and appropriate treatment actions, (2) an expanded SMS reminder additionally saying that the 'government might allow pharmacists/chemists to do RDTs' or (3) no SMS reminders (i.e. control). Using regression analysis, we estimate intent-to-treat (ITT) and treatment effects on the treated for 686 study participants. Results corroborate previous findings that a basic SMS reminder increased treatment adherence [odds ratio (OR) = 1.53, 95% CI 0.96-2.44] and decreased use of unnecessary anti-malarials for RDT-negative adults [OR = 0.63, 95% CI 0.39-1.00]. The expanded SMS also increased adherence for adults [OR = 1.42, 95% CI 0.97-2.07], but the effects for sick children differed-the basic SMS did not have any measurable impact on treatment adherence [OR = 0.87, 95% CI 0.24-3.09] or use of unnecessary anti-malarials [OR = 1.27, 95% CI 0.32-1.93], and the expanded SMS actually led to poorer treatment adherence [OR = 0.26, 95% CI 0.10-0.66] and increased use of unnecessary anti-malarials [OR = 4.67, 95% CI 1.76-12.43]. Further, the targeted but neutral message in the expanded SMS lowered acceptance for drug retailers' administration of RDTs [OR = 0.55, 95% CI 0.10-2.93], counter to what we hypothesized. Future SMS interventions should

  18. Patients' thoughts on patient- retained medical records

    African Journals Online (AJOL)

    was also thought to motivate the patients to act on the advice given, and the records also served as a reminder to take their ... to use it and to standardise the information that is recorded; and health planners should be motivated to implement .... Table I: Combined list of themes identified and quotations supporting them.

  19. Grief: Coping with the Reminders After a Loss: Grief Doesn't Magically End at a Certain Point After a Loved One's Death

    Science.gov (United States)

    ... at a certain point after a loved one's death. Reminders often bring back the pain of loss. ... return on the anniversary of your loved one's death or other special days throughout the year. These ...

  20. A balanced approach to the management of patients with stable ...

    African Journals Online (AJOL)

    2009-02-23

    Feb 23, 2009 ... 1.5% and the annual incidence of myocardial infarction about. 1.4%.1 It is ... lifestyle interventions such as quitting smoking, increasing physical ... therapy? Patients should be reminded that medical therapy is a lifelong.

  1. The effect of requesting a reason for non-adherence to a guideline in a long running automated reminder system for PONV prophylaxis.

    Science.gov (United States)

    Kooij, Fabian O; Klok, Toni; Preckel, Benedikt; Hollmann, Markus W; Kal, Jasper E

    2017-03-29

    Automated reminders are employed frequently to improve guideline adherence, but limitations of automated reminders are becoming more apparent. We studied the reasons for non-adherence in the setting of automated reminders to test the hypothesis that a separate request for a reason in itself may further improve guideline adherence. In a previously implemented automated reminder system on prophylaxis for postoperative nausea and vomiting (PONV), we included additional automated reminders requesting a reason for non-adherence. We recorded these reasons in the pre-operative screening clinic, the OR and the PACU. We compared adherence to our PONV guideline in two study groups with a historical control group. Guideline adherence on prescribing and administering PONV prophylaxis (dexamethasone and granisetron) all improved compared to the historical control group (89 vs. 82% (preason for not prescribing PONV prophylaxis was disagreement with the risk estimate by the decision support system. In the OR/PACU, the main reasons for not administering PONV prophylaxis were: 'unintended non-adherence' and 'failure to document'. In this study requesting a reason for non-adherence is associated with improved guideline adherence. The effect seems to depend on the underlying reason for non-adherence. It also illustrates the importance of human factors principles in the design of decision support. Some reasons for non-adherence may not be influenced by automated reminders.

  2. Accuracy of Mammograms

    Science.gov (United States)

    ... Choosing a Hospital Getting a Second Opinion Interpreter (Translator) Services Talking With Your Doctor Types of Treatment ... Grant Get Involved Get Involved Donate Donate Donate Online Memorials & Dedications Join The Promise Society Today Matching ...

  3. Impact of compressed breast thickness and dose on lesion detectability in digital mammography: FROC study with simulated lesions in real mammograms

    Energy Technology Data Exchange (ETDEWEB)

    Salvagnini, Elena, E-mail: elena.salvagnini@gmail.com [Department of Imaging and Pathology, Radiology, KUL, Herestraat 49, Leuven B-3000 (Belgium); SCK-CEN, Boeretang 200, Mol 2400 (Belgium); Bosmans, Hilde; Marshall, Nicholas W. [Department of Imaging and Pathology, Radiology, KUL, Herestraat 49, Leuven B-3000 (Belgium); Department of Radiology, Radiology, UZ Gasthuisberg, Herestraat 49, Leuven B-3000 (Belgium); Van Ongeval, Chantal; Van Steen, Andreas; Cockmartin, Lesley [Department of Radiology, Radiology, UZ Gasthuisberg, Herestraat 49, Leuven B-3000 (Belgium); Michielsen, Koen [Department of Imaging and Pathology, Nuclear Medicine and Molecular Imaging, KUL, Herestraat 49, Leuven B-3000 (Belgium); Struelens, Lara [SCK-CEN, Boeretang 200, Mol 2400 (Belgium)

    2016-09-15

    Purpose: The aim of this work was twofold: (1) to examine whether, with standard automatic exposure control (AEC) settings that maintain pixel values in the detector constant, lesion detectability in clinical images decreases as a function of breast thickness and (2) to verify whether a new AEC setup can increase lesion detectability at larger breast thicknesses. Methods: Screening patient images, acquired on two identical digital mammography systems, were collected over a period of 2 yr. Mammograms were acquired under standard AEC conditions (part 1) and subsequently with a new AEC setup (part 2), programmed to use the standard AEC settings for compressed breast thicknesses ≤49 mm, while a relative dose increase was applied above this thickness. The images were divided into four thickness groups: T1 ≤ 29 mm, T2 = 30–49 mm, T3 = 50–69 mm, and T4 ≥ 70 mm, with each thickness group containing 130 randomly selected craniocaudal lesion-free images. Two measures of density were obtained for every image: a BI-RADS score and a map of volumetric breast density created with a software application (VolparaDensity, Matakina, NZ). This information was used to select subsets of four images, containing one image from each thickness group, matched to a (global) BI-RADS score and containing a region with the same (local) VOLPARA volumetric density value. One selected lesion (a microcalcification cluster or a mass) was simulated into each of the four images. This process was repeated so that, for a given thickness group, half the images contained a single lesion and half were lesion-free. The lesion templates created and inserted in groups T3 and T4 for the first part of the study were then inserted into the images of thickness groups T3 and T4 acquired with higher dose settings. Finally, all images were visualized using the ViewDEX software and scored by four radiologists performing a free search study. A statistical jackknife-alternative free-response receiver operating

  4. Electronic and postal reminders for improving immunisation coverage in children: protocol for a systematic review and meta-analysis.

    Science.gov (United States)

    Chachou, Martel J; Mukinda, Fidele K; Motaze, Villyen; Wiysonge, Charles S

    2015-10-15

    Worldwide, suboptimal immunisation coverage causes the deaths of more than one million children under five from vaccine-preventable diseases every year. Reasons for suboptimal coverage are multifactorial, and a combination of interventions is needed to improve compliance with immunisation schedules. One intervention relies on reminders, where the health system prompts caregivers to attend immunisation appointments on time or re-engages caregivers who have defaulted on scheduled appointments. We undertake this systematic review to investigate the potential of reminders using emails, phone calls, social media, letters or postcards to improve immunisation coverage in children under five. We will search for published and unpublished randomised controlled trials and non-randomised controlled trials in PubMed, Scopus, CINAHL, CENTRAL, Science Citation Index, WHOLIS, Clinicaltrials.gov and the WHO International Clinical Trials Platform. We will conduct screening of search results, study selection, data extraction and risk-of-bias assessment in duplicate, resolving disagreements by consensus. In addition, we will pool data from clinically homogeneous studies using random-effects meta-analysis; assess heterogeneity of effects using the χ(2) test of homogeneity; and quantify any observed heterogeneity using the I(2) statistic. This protocol does not need approval by an ethics committee because we will use publicly available data, without directly involving human participants. The results will provide updated evidence on the effects of electronic and postal reminders on immunisation coverage, and we will discuss the applicability of the findings to low and middle-income countries. We plan to disseminate review findings through publication in a peer-reviewed journal and presentation at relevant conferences. In addition, we will prepare a policymaker-friendly summary using a validated format (eg, SUPPORT Summary) and disseminate this through social media and email discussion

  5. Our trial to improve patient positioning during mammography

    International Nuclear Information System (INIS)

    Nakayama, Takashi; Kotsuma, Yoshikazu; Hiramatsu, Sawako

    2007-01-01

    For effective breast cancer screening, reading of high-quality mammograms is essential, and for this purpose proper patient positioning during mammography is important. At our Shin-Osaka Mammography Seminar, which includes eight institutions, a physician and nine radiology technicians get together weekly in order to critically review mammogram reading and techniques for obtaining good mammograms. We have recognized that patient positioning has a great effect on mammogram quality, particularly for women in their 40 s who have dense mammary glands, and we have adopted a digital mammography system, or comparative mammography for such patients. Since July 2005, we have critically reviewed positioning every 3 or 4 months with the aim of improving our technique. Eight institutions have participated in this trial, each contributing mammograms taken recently from 20 to 30 consecutive participants, and the grade of positioning has been determined according to the Institutional Mammogram Estimation Standard (6 items, each scoring a maximum of 4 points, total 24 points) proposed by the Central Committee for Quality Control of Mammography Screening. The estimation has been done by both ourselves and committee members. When a total of 20 points or more is obtained and all 6 items score 3 points or more, it is considered that the positioning has been good, and this is termed ''Positioning A'' (P-A). On the other hand, if the total score is less than 20 points, and any one of the 6 items scores less than 3 points, it is considered that positioning has been inadequate, and this is termed ''Positioning-D'' (P-D). At the first review meeting, which was held before our critical study, P-A accounted for 48% of cases, and this had improved to 72% at the second meeting, and to 66% at the third. P-D accounted for 41% of cases at the first meeting, 20% at the second, and 21% at the third. Thus our trial involving discussion between a physician and technicians to critically review good

  6. The Nurse Watch: Design and Evaluation of a Smart Watch Application with Vital Sign Monitoring and Checklist Reminders.

    Science.gov (United States)

    Bang, Magnus; Solnevik, Katarina; Eriksson, Henrik

    Computerized wearable devices such as smart watches will become valuable nursing tools. This paper describes a smart-watch system developed in close collaboration with a team of nurses working in a Swedish ICU. The smart-watch system provides real-time vital-sign monitoring, threshold alarms, and to-do reminders. Additionally, a Kanban board, visualized on a multitouch screen provides an overview of completed and upcoming tasks. We describe an approach to implement automated checklist systems with smart watches and discuss aspects of importance when implementing such memory and attention support. The paper is finalized with an in-development formative evaluation of the system.

  7. "Thanks for Letting Us All Share Your Mammogram Experience Virtually": Developing a Web-Based Hub for Breast Cancer Screening.

    Science.gov (United States)

    Galpin, Adam; Meredith, Joanne; Ure, Cathy; Robinson, Leslie

    2017-10-27

    The decision around whether to attend breast cancer screening can often involve making sense of confusing and contradictory information on its risks and benefits. The Word of Mouth Mammogram e-Network (WoMMeN) project was established to create a Web-based resource to support decision making regarding breast cancer screening. This paper presents data from our user-centered approach in engaging stakeholders (both health professionals and service users) in the design of this Web-based resource. Our novel approach involved creating a user design group within Facebook to allow them access to ongoing discussion between researchers, radiographers, and existing and potential service users. This study had two objectives. The first was to examine the utility of an online user design group for generating insight for the creation of Web-based health resources. We sought to explore the advantages and limitations of this approach. The second objective was to analyze what women want from a Web-based resource for breast cancer screening. We recruited a user design group on Facebook and conducted a survey within the group, asking questions about design considerations for a Web-based breast cancer screening hub. Although the membership of the Facebook group varied over time, there were 71 members in the Facebook group at the end point of analysis. We next conducted a framework analysis on 70 threads from Facebook and a thematic analysis on the 23 survey responses. We focused additionally on how the themes were discussed by the different stakeholders within the context of the design group. Two major themes were found across both the Facebook discussion and the survey data: (1) the power of information and (2) the hub as a place for communication and support. Information was considered as empowering but also recognized as threatening. Communication and the sharing of experiences were deemed important, but there was also recognition of potential miscommunication within online

  8. Breast amyloidosis in a female patient with multiple myeloma: Ultrasonographic and mammographic findings

    Energy Technology Data Exchange (ETDEWEB)

    Woo, Ah Rhm; Kim, Joon Mee; Nam, Se Jin [Inha University Hospital, Incheon (Korea, Republic of)

    2017-05-15

    Amyloidosis is a rare disease characterized by pathological protein deposits in organs or tissues. Breast involvement by amyloidosis is rare. We report a female patient with amyloidosis in the breast, with underlying multiple myeloma, which presents as a focal asymmetry on a screening mammogram and a low suspicious mass lesion by ultrasonography.

  9. Disparities in abnormal mammogram follow-up time for Asian women compared with non-Hispanic white women and between Asian ethnic groups.

    Science.gov (United States)

    Nguyen, Kim H; Pasick, Rena J; Stewart, Susan L; Kerlikowske, Karla; Karliner, Leah S

    2017-09-15

    Delays in abnormal mammogram follow-up contribute to poor outcomes. In the current study, the authors examined differences in abnormal screening mammogram follow-up between non-Hispanic white (NHW) and Asian women. The authors used a prospective cohort of NHW and Asian women with a Breast Imaging, Reporting and Data System (BI-RADS) abnormal result of category 0 or 3-plus in the San Francisco Mammography Registry between 2000 and 2010. Kaplan-Meier estimation for the median number of days to follow-up with a diagnostic radiologic test was performed, and the authors compared the percentage of women with follow-up at 30 days, 60 days, and 90 days and no follow-up at 1 year for Asian women overall (and Asian ethnic groups) and NHW women. In addition, the authors assessed the relationship between race/ethnicity and time to follow-up with adjusted Cox proportional hazards models. Among Asian women, Vietnamese and Filipina women had the longest, and Japanese women the shortest, median follow-up (32 days, 28 days, and 19 days, respectively) compared with NHW women (15 days). The percentage of women receiving follow-up at 30 days was lower for Asians versus NHWs (57% vs 77%; PAsian ethnic groups except Japanese. Asian women had a reduced hazard of follow-up compared with NHW women (adjusted hazard ratio, 0.70; 95% confidence interval, 0.69-0.72). Asian women also had a higher rate of receiving no follow-up compared with NHW women (15% vs 10%; PAsian ethnic groups, Filipinas were found to have the highest percentage of women with no follow-up (18.1%). Asian women, particularly Filipina and Vietnamese women, were less likely than NHW women to receive timely follow-up after an abnormal screening mammogram. Research should disaggregate Asian ethnicity to better understand and address barriers to effective cancer prevention. Cancer 2017;123:3468-75. © 2017 American Cancer Society. © 2017 American Cancer Society.

  10. Translation of associative learning models into extinction reminders delivered via mobile phones during cue exposure interventions for substance use.

    Science.gov (United States)

    Rosenthal, M Zachary; Kutlu, Munir G

    2014-09-01

    Despite experimental findings and some treatment research supporting the use of cues as a means to induce and extinguish cravings, interventions using cue exposure have not been well integrated into contemporary substance abuse treatments. A primary problem with exposure-based interventions for addiction is that after learning not to use substances in the presence of addiction cues inside the clinic (i.e., extinction), stimuli in the naturalistic setting outside the clinic may continue to elicit craving, drug use, or other maladaptive conditioned responses. For exposure-based substance use interventions to be efficacious, new approaches are needed that can prevent relapse by directly generalizing learning from the therapeutic setting into naturalistic settings associated with a high risk for relapse. Basic research suggests that extinction reminders (ERs) can be paired with the context of learning new and more adaptive conditioned responses to substance abuse cues in exposure therapies for addiction. Using mobile phones and automated dialing and data collection software, ERs can be delivered in everyday high-risk settings to inhibit conditioned responses to substance-use-related stimuli. In this review, we describe how associative learning mechanisms (e.g., conditioned inhibition) can inform how ERs are conceptualized, learned, and implemented to prevent substance use when delivered via mobile phones. This approach, exposure with portable reminders of extinction, is introduced as an adjunctive intervention that uses brief automated ERs between clinic visits when individuals are in high-risk settings for drug use.

  11. The effects of exercise reminder software program on office workers' perceived pain level, work performance and quality of life.

    Science.gov (United States)

    Irmak, A; Bumin, G; Irmak, R

    2012-01-01

    In direct proportion to current technological developments, both the computer usage in the workplaces is increased and requirement of leaving the desk for an office worker in order to photocopy a document, send or receive an e-mail is decreased. Therefore, office workers stay in the same postures accompanied by long periods of keyboard usage. In recent years, with intent to reduce the incidence of work related musculoskeletal disorders several exercise reminder software programs have been developed. The purpose of this study is to evaluate the effectiveness of the exercise reminder software program on office workers' perceived pain level, work performance and quality of life. 39 healthy office workers accepted to attend the study. Participants were randomly split in to two groups, control group (n = 19) and intervention group (n = 20). Visual Analogue Scale to evaluate the perceived pain was administered all of the participants in the beginning and at the end of the study. The intervention group used the program for 10 weeks. Findings showed that the control group VAS scores remained the same, but the intervention group VAS scores decreased in a statistically significant way (p software programs may help to reduce perceived pain among office workers. Further long term studies with more subjects are needed to describe the effects of these programs and the mechanism under these effects.

  12. Healthy dining. Subtle diet reminders at the point of purchase increase low-calorie food choices among both chronic and current dieters.

    Science.gov (United States)

    Papies, Esther K; Veling, Harm

    2013-02-01

    There is a growing consensus that our food-rich living environment contributes to rising numbers of people with overweight and obesity. Low-cost, effective intervention tools are needed to facilitate healthy eating behavior, especially when eating away from home. Therefore, we present a field experiment in a restaurant that tested whether providing subtle environmental diet reminders increases low-calorie food choices among both chronic and current dieters. For half of the participants, the menu was supplemented with diet-related words, as reminders of healthy eating and dieting. We recorded customers' choices of low-calorie or high-calorie items from the menu, and we assessed chronic and current dieting. Consistent with our hypotheses, we found that diet reminders increased choices for low-calorie foods, among both chronic and current dieters. After a diet reminder, around half of dieters made a healthy menu choice. This study demonstrates the efficacy of providing subtle diet reminders as a low-cost practical intervention to increase low-calorie food choices among weight-concerned individuals, who are motivated to regulate their eating behavior but have been found to often fail in food-rich environments. Copyright © 2012 Elsevier Ltd. All rights reserved.

  13. Working Memory Load and Reminder Effect on Event-Based Prospective Memory of High- and Low-Achieving Students in Math.

    Science.gov (United States)

    Chen, Youzhen; Lian, Rong; Yang, Lixian; Liu, Jianrong; Meng, Yingfang

    The effects of working memory (WM) demand and reminders on an event-based prospective memory (PM) task were compared between students with low and high achievement in math. WM load (1- and 2-back tasks) was manipulated as a within-subject factor and reminder (with or without reminder) as a between-subject factor. Results showed that high-achieving students outperformed low-achieving students on all PM and n-back tasks. Use of a reminder improved PM performance and thus reduced prospective interference; the performance of ongoing tasks also improved for all students. Both PM and n-back performances in low WM load were better than in high WM load. High WM load had more influence on low-achieving students than on high-achieving students. Results suggest that low-achieving students in math were weak at PM and influenced more by high WM load. Thus, it is important to train these students to set up an obvious reminder for their PM and improve their WM.

  14. Intervention strategies for improving patient adherence to follow-up in the era of mobile information technology: a systematic review and meta-analysis.

    Directory of Open Access Journals (Sweden)

    Haotian Lin

    Full Text Available Patient adherence to follow-up plays a key role in the medical surveillance of chronic diseases and affects the implementation of clinical research by influencing cost and validity. We previously reported a randomized controlled trial (RCT on short message service (SMS reminders, which significantly improved follow-up adherence in pediatric cataract treatment.RCTs published in English that reported the impact of SMS or telephone reminders on increasing or decreasing the follow-up rate (FUR were selected from Medline, EMBASE, PubMed, and the Cochrane Library through February 2014. The impacts of SMS and telephone reminders on the FUR of patients were systematically evaluated by meta-analysis and bias was assessed.We identified 13 RCTs reporting on 3276 patients with and 3402 patients without SMS reminders and 8 RCTs reporting on 2666 patients with and 3439 patients without telephone reminders. For the SMS reminders, the majority of the studies (>50% were at low risk of bias, considering adequate sequence generation, allocation concealment, blinding, evaluation of incomplete outcome data, and lack of selective reporting. For the studies on the telephone reminders, only the evaluation of incomplete outcome data accounted for more than 50% of studies being at low risk of bias. The pooled odds ratio (OR for the improvement of follow-up adherence in the SMS group compared with the control group was 1.76 (95% CI [1.37, 2.26]; P<0.01, and the pooled OR for the improvement of follow-up adherence in the telephone group compared with the control group was 2.09 (95% CI [1.85, 2.36]; P<0.01; both sets showed no evidence of publication bias.SMS and telephone reminders could both significantly improve the FUR. Telephone reminders were more effective but had a higher risk of bias than SMS reminders.

  15. Automated reminders increase adherence to guidelines for administration of prophylaxis for postoperative nausea and vomiting

    NARCIS (Netherlands)

    Kooij, Fabian O.; Klok, Toni; Hollmann, Markus W.; Kal, Jasper E.

    2010-01-01

    Background and objective Correct identification of patients at high risk for postoperative nausea and vomiting (PONV), prescription of PONV prophylaxis and correct administration of medication are all important for effective PONV prophylaxis. This has been acknowledged by development of guidelines

  16. Short message service reminder intervention doubles sexually transmitted infection/HIV re-testing rates among men who have sex with men.

    Science.gov (United States)

    Bourne, C; Knight, V; Guy, R; Wand, H; Lu, H; McNulty, A

    2011-04-01

    To evaluate the impact of a short message service (SMS) reminder system on HIV/sexually transmitted infection (STI) re-testing rates among men who have sex with men (MSM). The SMS reminder programme started in late 2008 at a large Australian sexual health clinic. SMS reminders were recommended 3-6 monthly for MSM considered high-risk based on self-reported sexual behaviour. The evaluation compared HIV negative MSM who had a HIV/STI test between 1 January and 31 August 2010 and received a SMS reminder (SMS group) with those tested in the same time period (comparison group) and pre-SMS period (pre-SMS group, 1 January 2008 and 31 August 2008) who did not receive the SMS. HIV/STI re-testing rates were measured within 9 months for each group. Baseline characteristics were compared between study groups and multivariate logistic regression used to assess the association between SMS and re-testing and control for any imbalances in the study groups. There were 714 HIV negative MSM in the SMS group, 1084 in the comparison group and 1753 in the pre-SMS group. In the SMS group, 64% were re-tested within 9 months compared to 30% in the comparison group (preminders increased HIV/STI re-testing among HIV negative MSM. SMS offers a cheap, efficient system to increase HIV/STI re-testing in a busy clinical setting.

  17. Drinker prototype alteration and cue reminders as strategies in a tailored Web-based intervention reducing adults' alcohol consumption: Randomized controlled trial

    NARCIS (Netherlands)

    B. van Lettow (Britt); H. de Vries (Hein); A. Burdorf (Alex); B.J.F. Boon (Brigitte); P. van Empelen (Pepijn)

    2015-01-01

    textabstractBackground: Excessive alcohol use is a prevalent and worldwide problem. Excessive drinking causes a significant burden of disease and is associated with both morbidity and excess mortality. Prototype alteration and provision of a cue reminder could be useful strategies to enhance the

  18. Attentional Bias for Trauma-Film Reminders : Towards a Laboratory Analogue for Studying the Role of Attention in the Persistence of Intrusive Memories

    NARCIS (Netherlands)

    Verwoerd, Johan; Wessel, Ineke; de Jong, Peter J.

    Two experiments examined whether exposure to a trauma-film induced an attentional bias (AB) for intrinsically neutral (visual) reminders of the film. In experiment 1, half of the participants (n = 33) completed a rapid serial visual presentation (RSVP) task after presentation of a trauma film,

  19. Toward the breast screening balance sheet: cumulative risk of false positives for annual versus biennial mammograms commencing at age 40 or 50.

    Science.gov (United States)

    Winch, Caleb J; Sherman, Kerry A; Boyages, John

    2015-01-01

    This study aimed to: (1) Estimate cumulative risk of recall from breast screening where no cancer is detected (a harm) in Australia; (2) Compare women screened annually versus biennially, commencing age 40 versus 50; and (3) Compare with international findings. At the no-cost metropolitan program studied, women attended biennial screening, but were offered annual screening if regarded at elevated risk for breast cancer. The cumulative risk of at least one recall was estimated using discrete-time survival analysis. Cancer detection statistics were computed. In total, 801,636 mammograms were undertaken in 231,824 women. Over 10 years, cumulative risk of recall was 13.3 % (95 % CI 12.7-13.8) for those screened biennially, and 19.9 % (CI 16.6-23.2) for those screened annually from age 50-51. Cumulative risk of complex false positive involving a biopsy was 3.1 % (CI 2.9-3.4) and 5.0 % (CI 3.4-6.6), respectively. From age 40-41, the risk of recall was 15.1 % (CI 14.3-16.0) and 22.5 % (CI 17.9-27.1) for biennial and annual screening, respectively. Corresponding rates of complex false positive were 3.3 % (CI 2.9-3.8) and 6.3 % (CI 3.4-9.1). Over 10 mammograms, invasive cancer was detected in 3.4 % (CI 3.3-3.5) and ductal carcinoma in situ in 0.7 % (CI 0.6-0.7) of women, with a non-significant trend toward a larger proportion of Tis and T1N0 cancers in women screened annually (74.5 %) versus biennially (70.1 %), χ (2) = 2.77, p = 0.10. Cancer detection was comparable to international findings. Recall risk was equal to European estimates for women screening from 50 and lower for screening from 40. Recall risk was half of United States' rates across start age and rescreening interval categories. Future benefit/harm balance sheets may be useful for communicating these findings to women.

  20. Effect of the Availability of Prior Full-Field Digital Mammography and Digital Breast Tomosynthesis Images on the Interpretation of Mammograms

    Science.gov (United States)

    Catullo, Victor J.; Chough, Denise M.; Ganott, Marie A.; Kelly, Amy E.; Shinde, Dilip D.; Sumkin, Jules H.; Wallace, Luisa P.; Bandos, Andriy I.; Gur, David

    2015-01-01

    Purpose To assess the effect of and interaction between the availability of prior images and digital breast tomosynthesis (DBT) images in decisions to recall women during mammogram interpretation. Materials and Methods Verbal informed consent was obtained for this HIPAA-compliant institutional review board–approved protocol. Eight radiologists independently interpreted twice deidentified mammograms obtained in 153 women (age range, 37–83 years; mean age, 53.7 years ± 9.3 [standard deviation]) in a mode by reader by case-balanced fully crossed study. Each study consisted of current and prior full-field digital mammography (FFDM) images and DBT images that were acquired in our facility between June 2009 and January 2013. For one reading, sequential ratings were provided by using (a) current FFDM images only, (b) current FFDM and DBT images, and (c) current FFDM, DBT, and prior FFDM images. The other reading consisted of (a) current FFDM images only, (b) current and prior FFDM images, and (c) current FFDM, prior FFDM, and DBT images. Fifty verified cancer cases, 60 negative and benign cases (clinically not recalled), and 43 benign cases (clinically recalled) were included. Recall recommendations and interaction between the effect of prior FFDM and DBT images were assessed by using a generalized linear model accounting for case and reader variability. Results Average recall rates in noncancer cases were significantly reduced with the addition of prior FFDM images by 34% (145 of 421) and 32% (106 of 333) without and with DBT images, respectively (P < .001). However, this recall reduction was achieved at the cost of a corresponding 7% (23 of 345) and 4% (14 of 353) reduction in sensitivity (P = .006). In contrast, availability of DBT images resulted in a smaller reduction in recall rates (false-positive interpretations) of 19% (76 of 409) and 26% (71 of 276) without and with prior FFDM images, respectively (P = .001). Availability of DBT images resulted in 4% (15 of

  1. Drinker prototype alteration and cue reminders as strategies in a tailored web-based intervention reducing adults' alcohol consumption: randomized controlled trial.

    Science.gov (United States)

    van Lettow, Britt; de Vries, Hein; Burdorf, Alex; Boon, Brigitte; van Empelen, Pepijn

    2015-02-04

    Excessive alcohol use is a prevalent and worldwide problem. Excessive drinking causes a significant burden of disease and is associated with both morbidity and excess mortality. Prototype alteration and provision of a cue reminder could be useful strategies to enhance the effectiveness of online tailored interventions for excessive drinking. Through a Web-based randomized controlled trial, 2 strategies (ie, prototype alteration and cue reminders) within an existing online personalized feedback intervention (Drinktest) aimed to reduce adults' excessive drinking. It was expected that both strategies would add to Drinktest and would result in reductions in alcohol consumption by intrinsic motivation and the seizure of opportunities to act. Participants were recruited online and through printed materials. Excessive drinking adults (N=2634) were randomly assigned to 4 conditions: original Drinktest, Drinktest plus prototype alteration, Drinktest plus cue reminder, and Drinktest plus prototype alteration and cue reminder. Evaluation took place at 1-month posttest and 6-month follow-up. Differences in drinking behavior, intentions, and behavioral willingness (ie, primary outcomes) were assessed by means of longitudinal multilevel analyses using a last observation carried forward method. Measures were based on self-reports. All conditions showed reductions in drinking behavior and willingness to drink, and increased intentions to reduce drinking. Prototype alteration (B=-0.15, Pprototypes. Thus, prototype alteration and cue reminder usage may be feasible and simple intervention strategies to promote reductions in alcohol consumption among adults, with an effect up to 6 months. Nederlands Trial Register (NTR): 4169; http://www.trialregister.nl/trialreg/admin/rctview.asp?TC=4169 (Archived by WebCite at http://www.webcitation.org/6VD2jnxmB).

  2. Drinker Prototype Alteration and Cue Reminders as Strategies in a Tailored Web-Based Intervention Reducing Adults’ Alcohol Consumption: Randomized Controlled Trial

    Science.gov (United States)

    2015-01-01

    Background Excessive alcohol use is a prevalent and worldwide problem. Excessive drinking causes a significant burden of disease and is associated with both morbidity and excess mortality. Prototype alteration and provision of a cue reminder could be useful strategies to enhance the effectiveness of online tailored interventions for excessive drinking. Objective Through a Web-based randomized controlled trial, 2 strategies (ie, prototype alteration and cue reminders) within an existing online personalized feedback intervention (Drinktest) aimed to reduce adults’ excessive drinking. It was expected that both strategies would add to Drinktest and would result in reductions in alcohol consumption by intrinsic motivation and the seizure of opportunities to act. Methods Participants were recruited online and through printed materials. Excessive drinking adults (N=2634) were randomly assigned to 4 conditions: original Drinktest, Drinktest plus prototype alteration, Drinktest plus cue reminder, and Drinktest plus prototype alteration and cue reminder. Evaluation took place at 1-month posttest and 6-month follow-up. Differences in drinking behavior, intentions, and behavioral willingness (ie, primary outcomes) were assessed by means of longitudinal multilevel analyses using a last observation carried forward method. Measures were based on self-reports. Results All conditions showed reductions in drinking behavior and willingness to drink, and increased intentions to reduce drinking. Prototype alteration (B=–0.15, Pprototypes. Thus, prototype alteration and cue reminder usage may be feasible and simple intervention strategies to promote reductions in alcohol consumption among adults, with an effect up to 6 months. Trial Registration Nederlands Trial Register (NTR): 4169; http://www.trialregister.nl/trialreg/admin/rctview.asp?TC=4169 (Archived by WebCite at http://www.webcitation.org/6VD2jnxmB). PMID:25653199

  3. Intervention strategies for improving patient adherence to follow-up in the era of mobile information technology: a systematic review and meta-analysis.

    Science.gov (United States)

    Lin, Haotian; Wu, Xiaohang

    2014-01-01

    Patient adherence to follow-up plays a key role in the medical surveillance of chronic diseases and affects the implementation of clinical research by influencing cost and validity. We previously reported a randomized controlled trial (RCT) on short message service (SMS) reminders, which significantly improved follow-up adherence in pediatric cataract treatment. RCTs published in English that reported the impact of SMS or telephone reminders on increasing or decreasing the follow-up rate (FUR) were selected from Medline, EMBASE, PubMed, and the Cochrane Library through February 2014. The impacts of SMS and telephone reminders on the FUR of patients were systematically evaluated by meta-analysis and bias was assessed. We identified 13 RCTs reporting on 3276 patients with and 3402 patients without SMS reminders and 8 RCTs reporting on 2666 patients with and 3439 patients without telephone reminders. For the SMS reminders, the majority of the studies (>50%) were at low risk of bias, considering adequate sequence generation, allocation concealment, blinding, evaluation of incomplete outcome data, and lack of selective reporting. For the studies on the telephone reminders, only the evaluation of incomplete outcome data accounted for more than 50% of studies being at low risk of bias. The pooled odds ratio (OR) for the improvement of follow-up adherence in the SMS group compared with the control group was 1.76 (95% CI [1.37, 2.26]; Pimprovement of follow-up adherence in the telephone group compared with the control group was 2.09 (95% CI [1.85, 2.36]; Pimprove the FUR. Telephone reminders were more effective but had a higher risk of bias than SMS reminders.

  4. Dose to patient in tomosynthesis; Dosis a paciente en tomosintesis

    Energy Technology Data Exchange (ETDEWEB)

    Minambres Moro, A.; Fernandez Leton, P.; Garcia Rui-Zorrilla, J.; Perez Moreno, J. M.; Zucca Aparicio, D.

    2013-07-01

    They are beginning to implement digital mammography with the possibility of acquiring in tomosynthesis, whose biggest advantage is to distinguish structures without overlapping through of pseudotridimensionals images. With these modified mammograms can acquire a planar mammography, with fixed x-ray tube, or a tomosynthesis with tube by turning. For acquire tomosynthesis is necessary a detector of high efficiency together with tungsten white tubes. The objective of this study is to know the dose received by the patient with this new imaging. (Author)

  5. Animation-assisted CPRII program as a reminder tool in achieving effective one-person-CPR performance.

    Science.gov (United States)

    Cho