WorldWideScience

Sample records for pas

  1. PAs: Fifty years young.

    Science.gov (United States)

    Mandel, Ellen D; North, Shannon

    2017-10-01

    The PA profession is 50 years young. Practicing PAs and current students hail from several generational categories ranging from Builders to Generation Z. This article reviews how different generations may have experienced PA program expansion, professional identity, state licensing, and prescription delegation. The authors sampled a cohort of PA program applicants about their views on what evokes optimism and concern for the PA profession. These themes mirror the recently paved professional road, while posing the all-important question: What construction lies on the horizon?

  2. Ford Partnership for Advanced Studies (Ford PAS)

    Science.gov (United States)

    Carrier, Cheryl

    2006-01-01

    This article features the Ford Partnership for Advanced Studies (Ford PAS) program that helps students gain knowledge about real-life business issues. Ford PAS is an educational program that combines college-prep academics with the critical 21st century skills students will need to succeed in college and in the workplace. The Ford PAS program uses…

  3. A history of US Army PAs.

    Science.gov (United States)

    Chalupa, Robyn L; Marble, W Sanders

    2017-11-01

    The US military has a long tradition of using physician assistants (PAs). The Army began using PAs in 1971 in an effort to supplement the physicians and surgeons in the medical corps. As their numbers grew, PAs gradually replaced general medical officers assigned to battalions. Later, specialty positions developed in aviation medicine, orthopedics, and emergency medicine. The need for a PA serving as an adviser in the major commands slowly developed at all levels of leadership. In 2015, the Army removed limitations on female PAs assigned to combat units. PAs lead in tactical and clinical settings, filling command roles, senior clinical positions, and administrative leadership roles.

  4. Uncertainties in Organ Burdens Estimated from PAS

    International Nuclear Information System (INIS)

    La Bone, T.R.

    2004-01-01

    To calculate committed effective dose equivalent, one needs to know the quantity of the radionuclide in all significantly irradiated organs (the organ burden) as a function of time following the intake. There are two major sources of uncertainty in an organ burden estimated from personal air sampling (PAS) data: (1) The uncertainty in going from the exposure measured with the PAS to the quantity of aerosol inhaled by the individual, and (2) The uncertainty in going from the intake to the organ burdens at any given time, taking into consideration the biological variability of the biokinetic models from person to person (interperson variability) and in one person over time (intra-person variability). We have been using biokinetic modeling methods developed by researchers at the University of Florida to explore the impact of inter-person variability on the uncertainty of organ burdens estimated from PAS data. These initial studies suggest that the uncertainties are so large that PAS might be considered to be a qualitative (rather than quantitative) technique. These results indicate that more studies should be performed to properly classify the reliability and usefulness of using PAS monitoring data to estimate organ burdens, organ dose, and ultimately CEDE

  5. The Role of PAS Kinase in PASsing the Glucose Signal

    Directory of Open Access Journals (Sweden)

    Julianne H. Grose

    2010-06-01

    Full Text Available PAS kinase is an evolutionarily conserved nutrient responsive protein kinase that regulates glucose homeostasis. Mammalian PAS kinase is activated by glucose in pancreatic beta cells, and knockout mice are protected from obesity, liver triglyceride accumulation, and insulin resistance when fed a high-fat diet. Yeast PAS kinase is regulated by both carbon source and cell integrity stress and stimulates the partitioning of glucose toward structural carbohydrate biosynthesis. In our current model for PAS kinase regulation, a small molecule metabolite binds the sensory PAS domain and activates the enzyme. Although bona fide PAS kinase substrates are scarce, in vitro substrate searches provide putative targets for exploration.

  6. Manual for THOR-AirPAS - air pollution assessment system

    DEFF Research Database (Denmark)

    Jensen, Steen Solvang; Ketzel, Matthias; Brandt, Jørgen

    The report provides an outline of the THOR-AirPAS - air pollution assessment system and a brief manual for getting started with the air quality models and input data included in THOR-AirPAS.......The report provides an outline of the THOR-AirPAS - air pollution assessment system and a brief manual for getting started with the air quality models and input data included in THOR-AirPAS....

  7. Three instruments for positron annihilation spectroscopy (PAS)

    International Nuclear Information System (INIS)

    Ivanov, E.A.; Plostinaru, D.; Catana, D.; Racolta, P.M.; Vata, I.

    2003-01-01

    The instruments presented here and dedicated to positron annihilation spectroscopy, PAS, are: 1. High Resolution Life Time Spectrometer (LTS) with time resolution τ = 260 ps, based on large BaF 2 scintillators; 2. Doppler Broadening Spectrometer (DBS) having a 1.6 keV resolution at 514 keV; 3. Positronium Life Time - Perturbed Angular Distribution Spectrometer ( PLT-PAD); positronium life time, in samples under high vacuum in magnetic field, is measured for time intervals up to 500 ns. Results of measurements are shown to illustrate performances of the instruments. (authors)

  8. Spanish validation of the Premorbid Adjustment Scale (PAS-S).

    Science.gov (United States)

    Barajas, Ana; Ochoa, Susana; Baños, Iris; Dolz, Montse; Villalta-Gil, Victoria; Vilaplana, Miriam; Autonell, Jaume; Sánchez, Bernardo; Cervilla, Jorge A; Foix, Alexandrina; Obiols, Jordi E; Haro, Josep Maria; Usall, Judith

    2013-02-01

    The Premorbid Adjustment Scale (PAS) has been the most widely used scale to quantify premorbid status in schizophrenia, coming to be regarded as the gold standard of retrospective assessment instruments. To examine the psychometric properties of the Spanish version of the PAS (PAS-S). Retrospective study of 140 individuals experiencing a first episode of psychosis (n=77) and individuals who have schizophrenia (n=63), both adult and adolescent patients. Data were collected through a socio-demographic questionnaire and a battery of instruments which includes the following scales: PAS-S, PANSS, LSP, GAF and DAS-sv. The Cronbach's alpha was performed to assess the internal consistency of PAS-S. Pearson's correlations were performed to assess the convergent and discriminant validity. The Cronbach's alpha of the PAS-S scale was 0.85. The correlation between social PAS-S and total PAS-S was 0.85 (p<0.001); while for academic PAS-S and total PAS-S it was 0.53 (p<0.001). Significant correlations were observed between all the scores of each age period evaluated across the PAS-S scale, with a significance value less than 0.001. There was a relationship between negative symptoms and social PAS-S (0.20, p<0.05) and total PAS-S (0.22, p<0.05), but not with academic PAS-S. However, there was a correlation between academic PAS-S and general subscale of the PANSS (0.19, p<0.05). Social PAS-S was related to disability measures (DAS-sv); and academic PAS-S showed discriminant validity with most of the variables of social functioning. PAS-S did not show association with the total LSP scale (discriminant validity). The Spanish version of the Premorbid Adjustment Scale showed appropriate psychometric properties in patients experiencing a first episode of psychosis and who have a chronic evolution of the illness. Moreover, each domain of the PAS-S (social and academic premorbid functioning) showed a differential relationship to other characteristics such as psychotic symptoms, disability

  9. Pasca-Islamisme dalam PAS: Analisis terhadap Kesan Tahalluf Siyasi

    Directory of Open Access Journals (Sweden)

    MUHAMMAD FAIZ MUKMIN ABDUL MUTALIB

    2015-12-01

    Full Text Available This study discusses the impact of post-Islamism in the Parti Islam Se-Malaysia (PAS, specifically on tahalluf siyasi (political alliance with Pakatan Rakyat (People Coalition. Post Islamism is a contemporary Islamist school of thought with regard to politics. The characteristics of post-Islamism such as toleration, participation and inclusivism has greatly influenced the modus operandi of the Islamic movement including PAS. Inclusiveness in post-Islamism had motivated PAS in having political coalition with more liberal parties such as Parti Keadilan Rakyat (PKR and Democratic Action Party (DAP. Post-Islamism as popularised by Asef Bayat was established on Western knowledge narratives, therefore such study as this should be done in order to recognise its negative impacts. To achieve this objective, the researchers used qualitative method through the process of collecting by scrutinising and analysing related data on the discourse of post-Islamism. The result of the study shows that PAS has been affected by the post-Islamism. The impact of post-Islamism in PAS however shows that PAS did not play dominant role in the Coalition throughout the political alliance. Besides, PAS also compromised a lot with its principles including its Islamic principles. Post-Islamism had also affected PAS in reducing the Muslims vote to PAS because of their support for DAP. This study therefore exposed the negative sides of post-Islamism to Islamic movement. With current development in PAS, it is hoped that this exposure will consult the Islamic movements in critically weighing their support to any kind of ideas particularly from the West.

  10. Histopathological examination of nail clippings using PAS staining (HPE-PAS): gold standard in diagnosis of Onychomycosis.

    Science.gov (United States)

    Jeelani, Shazia; Ahmed, Qazi Masood; Lanker, Audil Mohmad; Hassan, Iffat; Jeelani, Nasir; Fazili, Tawheeda

    2015-01-01

    Onychomycosis is fungal infection of one or more of the nail units. However, because fungi cause only about half of all nail dystrophies, the use of appropriate diagnostic techniques is important to ensure correct diagnosis and treatment. Aim of the present study was to compare direct microscopy, culture and HPE-PAS for diagnosis of onychomycosis by evaluating their sensitivity and various other relevant statistical parameters. A prospective, hospital-based, cross-sectional study was conducted on 216 patients with a high degree of clinical suspicion of onychomycosis. Nail specimens were evaluated using three diagnostic methods, i.e. direct microscopy using 20% Potassium hydroxide (KOH) & 40% Di-methyl-suphoxide (DMSO), culture and histopathological examination using PAS stain (HPE-PAS). Of 216 patients direct microscopy was positive in 138 (63.9%), culture in 147 (68%) and HPE-PAS in 164 patients (76%). One hundred and seventy-nine patients fitted into the criteria set for confirmed diagnosis of onychomycosis. Using this as a denominator; direct microscopy, culture and HPE-PAS had sensitivities of 77.1%, 70% and 91.6% respectively. Also, HPE-PAS showed the highest sensitivity of 94.7% in 19 cases with prediagnostic antimycotic treatment compared to direct microscopy (42.1%) or culture (57.9%). HPE-PAS shows high sensitivity for diagnosis of onychomycosis and can be considered as a gold standard in the diagnosis of onychomycosis. © 2014 Blackwell Verlag GmbH.

  11. Feasibility of classification of clay minerals by using PAS

    International Nuclear Information System (INIS)

    Honda, Y; Yoshida, Y; Akiyama, Y; Nishijima, S

    2015-01-01

    After the nuclear power plant disaster, the evaluation of radioactive Cs kept in soil, especially in clay minerals and the elucidation of its movement are urgent subjects to promote decontamination. It is known that the extractable level of Cs depends on the sort of clay minerals. We tried to find the characteristics of clay minerals belonging to phillosilicate group using positron annihilation spectroscopy (PAS) and the relationship between the results of PAS and the amounts of substantially extracted Cs from the clay minerals. The results showed that each clay mineral was found to be distinguishable from other clay minerals by PAS and the extraction rate of Cs was different among those clay minerals, however the direct correlation between the results of PAS and the extraction rates of Cs was not found. (paper)

  12. [Development of the Parenting in Adolescence Scale (PAS)].

    Science.gov (United States)

    Utsumi, Shoka

    2013-08-01

    The present study developed the Parenting in Adolescence Scale (PAS) based on the three-factor model of parenting by Schaefer (1965), and examined its psychometric properties. Adolescents (n = 103 junior high, 273 high school and 667 university students) completed a questionnaire. Exploratory factor analysis identified three distinct factors labeled "Acceptance" (6 items), "Psychological control" (6 items) and "Parental monitoring" (3 items). Confirmatory factor analysis demonstrated the stability of the factor structure with adequate goodness of fit indices. The three subscales of PAS had adequate internal consistency and satisfactory test-retest reliability. The three scales also correlated significantly with measures of adolescent conduct problems, peer problems, risk-taking experience, prosocial behavior, self-esteem, and another parenting scale, which indicated construct and concurrent validity. The practical use of the PAS was discussed.

  13. Ceux-ci ne sont pas : [luuletused] / Kalju Kruusa

    Index Scriptorium Estoniae

    Kruusa, Kalju, pseud., 1973-

    2003-01-01

    Sisu: Ceux-ci ne sont pas ; Köögivahet ; "Taara..." ; "Pakane pistab pisikesi ..." ; "Meri on kaet mattklaasiga ; Pydemise päivil ; "Toas muusika mängib ..." ; "Jäin juustu imetlema ; "Mu elu on mustikas ..." ; Hingepidetus ; ŁNo me gusta la cocina

  14. IkPas : Een definitieve breuk met het verleden?

    NARCIS (Netherlands)

    Bovens, R.H.L.M.; Schuitema, A.; P.M., Schmidt

    2017-01-01

    IkPas (‘No Thanks’) is a Dutch 30 or 40 days temporary alcohol abstinence challenge, aiming at alcohol awareness and changing habitual drinking behavior. Former effect evaluations show a significant decrease in alcohol use measured 6 months after finishing the challenge. In this study the authors

  15. The PAS fold: A redefinition of the PAS domain based upon structural prediction. A large-scale homology modelling study

    NARCIS (Netherlands)

    Hefti, M.H.; Francoijs, C.J.J.; Vries, de S.C.; Dixon, R.; Vervoort, J.J.M.

    2004-01-01

    In the postgenomic era it is essential that protein sequences are annotated correctly in order to help in the assignment of their putative functions. Over 1300 proteins in current protein sequence databases are predicted to contain a PAS domain based upon amino acid sequence alignments. One of the

  16. Procedures and acceptance criteria for PAS-1 cask inspections

    International Nuclear Information System (INIS)

    Mercado, J.E.

    1998-01-01

    The procedures and acceptance criteria that comprise this document were prepared to support a one-time test to certify two PAS-1 casks in accordance with US Department of Energy Certificate of Compliance US A/9184/B(U), which was issued in 1998. The specific inspections addressed in this document are the visual weld inspection and a dimensional inspection of the primary containment vessel

  17. 47 CFR Appendix B to Part 64 - Priority Access Service (PAS) for National Security and Emergency Preparedness (NSEP)

    Science.gov (United States)

    2010-10-01

    ... PAS, enforce PAS rules and regulations, and act as final authority for approval, revision, or.... f. The Telecommunications Service Priority Oversight Committee will identify and review any systemic...

  18. A history of PAs in the US Public Health Service.

    Science.gov (United States)

    McKinnon, Mark F; Elizondo, Epifanio; Bonfiglio, Susan M; Hunter-Buskey, Robin N; Placide, Frances P; Bunnell, Rebecca A

    2016-12-01

    Since 1798, the men and women of the Commissioned Corps of the US Public Health Service (USPHS), one of the seven US uniformed services, have served on the front lines of public health. Two hundred years after the start of the USPHS, the first physician assistant (PA) entered the service to carry on the tradition of protecting, promoting, and advancing the health and safety of the nation. These dedicated clinicians are involved in healthcare delivery to underserved and vulnerable populations, disease control and prevention, biomedical research, food and drug regulation, and national and international response efforts for natural and man-made disasters. This article describes how PAs in the Commissioned Corps of the USPHS have impacted the health and safety of not only the United States but also the international community.

  19. Die dramatiese discours in Pas de deux van Hugo Claus

    Directory of Open Access Journals (Sweden)

    R. Vaughan

    1990-05-01

    Full Text Available Drama is action, verbal drama is speech action, and the dramatic text is subject to a similar set of rules as that governing the extra-literary communication situation. Dramatic irony, the very essence of drama itself, is generated by a dual, mutually interactive process of communication, whereby the audience is “written into” the text in a way distinguishing it from other literary genres, and by a systematic flouting of the rules governing communication. Pas de deux demonstrates the peculiar duality of dramatic discourse by its complex exploitation of the breakdown/non-breakdown of Grice’s Co-operative Principle-. communication/non-communication becomes reversible and, therefore, mutually constitutive concepts “releasing meaning” and conveying the “ideology” of this play.

  20. Multi-PAS domain-mediated protein oligomerization of PpsR from Rhodobacter sphaeroides

    International Nuclear Information System (INIS)

    Heintz, Udo; Meinhart, Anton; Winkler, Andreas

    2014-01-01

    Crystal structures of two truncated variants of the transcription factor PpsR from R. sphaeroides are presented that enabled the phasing of a triple PAS domain construct. Together, these structures reveal the importance of α-helical PAS extensions for multi-PAS domain-mediated protein oligomerization and function. Per–ARNT–Sim (PAS) domains are essential modules of many multi-domain signalling proteins that mediate protein interaction and/or sense environmental stimuli. Frequently, multiple PAS domains are present within single polypeptide chains, where their interplay is required for protein function. Although many isolated PAS domain structures have been reported over the last decades, only a few structures of multi-PAS proteins are known. Therefore, the molecular mechanism of multi-PAS domain-mediated protein oligomerization and function is poorly understood. The transcription factor PpsR from Rhodobacter sphaeroides is such a multi-PAS domain protein that, in addition to its three PAS domains, contains a glutamine-rich linker and a C-terminal helix–turn–helix DNA-binding motif. Here, crystal structures of two N-terminally and C-terminally truncated PpsR variants that comprise a single (PpsR Q-PAS1 ) and two (PpsR N-Q-PAS1 ) PAS domains, respectively, are presented and the multi-step strategy required for the phasing of a triple PAS domain construct (PpsR ΔHTH ) is illustrated. While parts of the biologically relevant dimerization interface can already be observed in the two shorter constructs, the PpsR ΔHTH structure reveals how three PAS domains enable the formation of multiple oligomeric states (dimer, tetramer and octamer), highlighting that not only the PAS cores but also their α-helical extensions are essential for protein oligomerization. The results demonstrate that the long helical glutamine-rich linker of PpsR results from a direct fusion of the N-cap of the PAS1 domain with the C-terminal extension of the N-domain that plays an important

  1. Criterion validity of the Physical Activity Scale (PAS2) in Danish adults

    DEFF Research Database (Denmark)

    Lunde Pedersen, Eva Sophie; Mortensen, L H; Brage, S

    2017-01-01

    BACKGROUND: The Physical Activity Scale (PAS2) was developed to measure physical activity (PA) during work, transportation and leisure time, in the Danish adult population. The objective of this study was to assess the criterion validity of PAS2 against a combined accelerometer and heart rate mon...

  2. ANALISIS KUALITAS PELAYANAN PAS BANDARA INTERNASIONAL NGURAH RAI DENGAN MENGGUNAKAN MODEL SERVQUAL

    Directory of Open Access Journals (Sweden)

    I Made Suska V

    2013-03-01

    Full Text Available Permit to a person to enter the restricted area at Ngurah Rai Airport which is called Airport Pas can be given in accordance with the duties and activities of a person at the airport. On permit service, there are disappointments and complaints of the Pas applicant that can still be found in the Pas service like duration of Pas completion and officer service at the time of application. The different perception and expectation of Pas applicant must remain in the regulation corridors and prioritize security at airports. The purpose of this research is assesing the quality of Pas service in the Airport Authority Region IV by using a SERVQUAL (Service Quality model. The model is comparing the two main factors, namely real customer perception of the service that they received (Perceived Service with the actual services expected/desirable (Expected Service which consists of 5 (five dimensions, those are Tangibles (physical, Reliability, Responsiveness, Assurance and Empathy (attention. By using these models, it is known that the quality of Pas service in the Airport Authority Region IV is still less than the expectations of the applicant and the most important dimension to enhance is Responsiveness. Gaps between perception and expectation as follows: Responsiveness (-0,2240, Assurance (-0,2171, Reliability (-0,2099, Tangibles (-0,1994, dan Empathy (-0,1373.

  3. Nitrogen Approach Program. In line with the European law?; Aanpak van stikstof. Europeesrechtelijk in de pas?

    Energy Technology Data Exchange (ETDEWEB)

    Schrijnemaekers, J.; Van der Sluis, C. [Ploum Lodder Princen, Rotterdam (Netherlands)

    2011-02-15

    Nitrogen deposition is causing problems in protected areas designated by the Natural 2000 program with a view to protect biodiversity . To deal with these problems the Dutch government developed the Programmatic Approach to Nitrogen (Programmatische Aanpak Stikstof - PAS). This approach is discussed in this article. [Dutch] De depositie van stikstof in gebieden waarvoor het zogenaamde Natura 2000 programma de biodiversiteit moet beschermen zorgt voor problemen. Om de problemen het hoofd te bieden heeft de Nederlandse overheid de Programmatische Aanpak Stikstof (PAS) ontwikkeld. In dit artikel wordt aandacht besteed aan PAS.

  4. Crystallization and preliminary crystallographic characterization of the PAS domains of EAG and ELK potassium channels

    International Nuclear Information System (INIS)

    Adaixo, Ricardo; Morais-Cabral, João Henrique

    2010-01-01

    The N-terminal PAS domains from the eukaryotic EAG potassium channels are thought to have a regulatory function. Here the expression, purification, crystallization and preliminary crystallographic characterization of two of these domains are described. Per–Arnt–Sim (PAS) domains are ubiquitous in nature; they are ∼130-amino-acid protein domains that adopt a fairly conserved three-dimensional structure despite their low degree of sequence homology. These domains constitute the N-terminus or, less frequently, the C-terminus of a number of proteins, where they exert regulatory functions. PAS-containing proteins generally display two or more copies of this motif. In this work, the crystallization and preliminary analysis of the PAS domains of two eukaryotic potassium channels from the ether-à-go-go (EAG) family are reported

  5. Form Quality in Rorschach Comprehensive System and R-PAS: Sample of Psychiatric Cases

    Directory of Open Access Journals (Sweden)

    Latife Yazigi

    2016-04-01

    Full Text Available Abstract The creation of the Rorschach Performance Assessment System (R-PAS requires research that allows its use in the Brazilian population. The Formal Quality (FQ category is essential both for clinic and research. The aim of this study was to compare form quality variables in Rorschach protocols from psychiatric patients and ratings coded in the Comprehensive System (CS and R-PAS. The sample comprised 206 Rorschach protocols from adult patients in psychiatric treatment, who were also assessed by SCID-I and SCID-II. Most protocols were administered in the CS and recoded according to the R-PAS. The kappa coefficient was calculated, and we compared the means of these variables in both systems. The kappa results varied from almost perfect to substantial consistency for all variables, however, the descriptive statistics confirmed that the R-PAS elicits more FQ Ordinary coding while the CS elicits more FQ minus coding.

  6. ON THE MYTH OF PARENTAL ALIENATION SYNDROME (PAS AND THE DSM-5

    Directory of Open Access Journals (Sweden)

    Ramón Vilalta

    2017-09-01

    Full Text Available This paper discusses the controversy over the existence of Parental Alienation Syndrome (PAS or any other name it may be given. The negative judgements regarding PAS are diverse in nature: from criticism about the personality of the term’s creator, to the most repeated criticism that PAS does not exist in the Diagnostic and Statistical Manual of Mental Disorders DSM-5. This paper analyzes some of these criticisms in the Spanish judicial context, especially those exposed in the Guidelines of the Group of Experts on the Fight against Domestic and Gender Violence of the General Council of the Judiciary (CGPJ, published in 2016. It is argued that PAS is widely recognized by the professional and scientific community and may be described and classified in the DSM-5 as a “Parent–Child Relational Problem V61.20 (Z62.820”.

  7. How electronic health records can unmask the hidden value of PAs.

    Science.gov (United States)

    Ogunfiditimi, Folusho; Sherry, Scott P; Foote, Monica; Christie, Sarah L; Shock, Lisa P; Cawley, James; Browne, Aaron

    2017-06-01

    The Fee for Value (FFV) Task Force, a subgroup of the American Academy of PAs' Research and Strategic Initiatives Commission, has examined tools and mechanisms aimed at better clarifying the volume and value of PA work and how that work contributes to improving access to high-quality care. Establishing the value of PAs has been a challenging task for many healthcare providers. Often, PA value has been defined by their clinical productivity, without any clear direction as to what constitutes value versus productivity. The objective of this article is to unmask the value of PAs through the role of electronic health records and highlight PAs' ability to produce services that are value-oriented and quantifiably productive.

  8. EGF increases expression and activity of PAs in preimplantation rat embryos and their implantation rate

    Directory of Open Access Journals (Sweden)

    Har-Vardi Iris

    2007-01-01

    Full Text Available Abstract Background Embryo implantation plays a major role in embryogenesis and the outcome of pregnancy. Plasminogen activators (PAs have been implicated in mammalian fertilization, early stages of development and embryo implantation. As in-vitro developing embryos resulted in lower implantation rate than those developed in-vivo we assume that a reduced PAs activity may be involved. In the present work we studied the effect of EGF on PAs activity, quantity and embryo implantation. Methods Zygotes were flushed from rat oviducts on day one of pregnancy and grown in-vitro in R1ECM supplemented with EGF (10 ng/ml and were grown up to the blastocyst stage. The control groups were grown in the same medium without EGF. The distribution and quantity of the PAs were examined using fluorescence immunohistochemistry followed by measurement of PAs activity using the chromogenic assay. Implantation rate was studied using the embryo donation model. Results PAs distribution in the embryos was the same in EGF treated and untreated embryos. Both PAs were localized in the blastocysts' trophectoderm, supporting the assumption that PAs play a role in the implantation process in rats. EGF increased the quantity of uPA at all stages studied but the 8-cell stage as compared with controls. The tissue type PA (tPA content was unaffected except the 8-cell stage, which was increased. The activity of uPA increased gradually towards the blastocyst stage and more so due to the presence of EGF. The activity of tPA did not vary with the advancing developmental stages although it was also increased by EGF. The presence of EGF during the preimplantation development doubled the rate of implantation of the treated group as compared with controls.

  9. Les scientifiques du CERN n'oublient pas l'Irak pour eux, les préoccupations humanitaires n'ont pas de passeport

    CERN Multimedia

    2003-01-01

    Scientists from the CERN club ConCERNed for Humanity have written to the Swiss Federal Councellor, Micheline Calmy-Rey, with 550 signatures on a petition "pas en notre nom" - not in our name - to ask her to do all that is in her capacity to end the conflict in Iraq (0.5 page)

  10. Les sciences cognitives ne sont pas des sciences humaines

    Directory of Open Access Journals (Sweden)

    Albert Ogien

    2011-10-01

    Full Text Available Cet article analyse les limites du naturalisme social que Laurence Kaufman et Laurent Cordonier proposent d’adopter dans cette même revue, en critiquant leur plaidoyer pour l’intégration des savoirs des sciences cognitives et des sciences humaines et sociales. Cette critique repose sur la réfutation de trois idées soutenues par les auteurs : 1 la description scientifique des mécanismes cognitifs élémentaires fournit une explication causale des conduites sociales qui doit se substituer à celles des sciences humaines et sociales ; 2 le recours au naturalisme permet de falsifier les préconceptions que ces dernières continuent à entretenir ; 3 le programme de naturalisation de l’esprit n’implique aucune forme de réductionnisme. Cette triple critique permet de rejeter leur appel en faveur d’un modèle intégré de la conduite humaine, en avançant un constat : dans la mesure où on ne sait pas comment combler le hiatus qui sépare les descriptions détaillées du cerveau au travail de l’explication des conduites des individus et de la manière dont ils en assurent la coordination dans le temps même où ils agissent en commun, les sciences humaines et sociales ont peu de choses à aller glaner du côté des sciences cognitives pour améliorer la manière dont elles analysent l’action. C’est que le travail de celles-ci se situe soit au niveau infra-humain du fonctionnement moléculaire, soit au niveau supra-humain de l’évolution ; et que seules les sciences humaines et sociales placent leurs analyses à un niveau simplement humain, en faisant des individus tels qu’ils vivent ensemble la mesure de toutes les choses qui les concernent. Ce qu’elles ne peuvent faire sur un mode naturaliste.Cognitive sciences are not social sciencesThis article examines the limits of the social naturalism proposed by Laurence Kauffman and Laurent Cordonier in this journal by criticizing their plea concerning knowledge integration of

  11. Epitaxial nanowire formation in metamorphic GaAs/GaPAs short-period superlattices

    Science.gov (United States)

    Zheng, Nan; Ahrenkiel, S. Phillip

    2017-07-01

    Metamorphic growth presents routes to novel nanomaterials with unique properties that may be suitable for a range of applications. We discuss self-assembled, epitaxial nanowires formed during metalorganic chemical vapor deposition of metamorphic GaAs/GaPAs short-period superlattices. The heterostructures incorporate strain-engineered GaPAs compositional grades on 6°-B miscut GaAs substrates. Lateral diffusion within the SPS into vertically aligned, three-dimensional columns results in nanowires extending along A directions with a lateral period of 70-90 nm. The microstructure is probed by transmission electron microscopy to confirm the presence of coherent GaAs nanowires within GaPAs barriers. The compositional profile is inferred from analysis of {200} dark-field image contrast and lattice images.

  12. Digital radiography using amorphous selenium: photoconductively activated switch (PAS) readout system.

    Science.gov (United States)

    Reznik, Nikita; Komljenovic, Philip T; Germann, Stephen; Rowlands, John A

    2008-03-01

    A new amorphous selenium (a-Se) digital radiography detector is introduced. The proposed detector generates a charge image in the a-Se layer in a conventional manner, which is stored on electrode pixels at the surface of the a-Se layer. A novel method, called photoconductively activated switch (PAS), is used to read out the latent x-ray charge image. The PAS readout method uses lateral photoconduction at the a-Se surface which is a revolutionary modification of the bulk photoinduced discharge (PID) methods. The PAS method addresses and eliminates the fundamental weaknesses of the PID methods--long readout times and high readout noise--while maintaining the structural simplicity and high resolution for which PID optical readout systems are noted. The photoconduction properties of the a-Se surface were investigated and the geometrical design for the electrode pixels for a PAS radiography system was determined. This design was implemented in a single pixel PAS evaluation system. The results show that the PAS x-ray induced output charge signal was reproducible and depended linearly on the x-ray exposure in the diagnostic exposure range. Furthermore, the readout was reasonably rapid (10 ms for pixel discharge). The proposed detector allows readout of half a pixel row at a time (odd pixels followed by even pixels), thus permitting the readout of a complete image in 30 s for a 40 cm x 40 cm detector with the potential of reducing that time by using greater readout light intensity. This demonstrates that a-Se based x-ray detectors using photoconductively activated switches could form a basis for a practical integrated digital radiography system.

  13. Correlating the content and context of PAS 55 with the ISO 55000 series

    Directory of Open Access Journals (Sweden)

    Van den Honert, A. F.

    2013-08-01

    Full Text Available The ISO 55000 series is soon to supersede PAS 55 as the most recognised international standard for asset management. A correlation of the content and context of PAS 55 with the ISO 55000 series is required to assist organisations with the transition. After analysis of the structures, similarities, differences, and omissions of the two standards, a map was created to correlate the summarised content and context. The map established that, although both sets of standards have a similar structural framework, the ISO 55000 series is a more comprehensive and detailed standard, creating a clearer way to implement an asset management system within an organisation.

  14. Partai Islam Se-Malaysia (PAS) dan Partai Keadilan Sejahtera (PKS) sebagai Partai Islam Pendukung Demokrasi PKS Pada Pemilu

    OpenAIRE

    Ahmad Ali Nurdin

    2015-01-01

    The article compares the achievement of Partai Islam se-Malaysia (PAS) and Partai Keadilan Sejahtera (PKS) in the latest general election held in 2013 in Malaysia and in 2014 in Indonesia. The writer finds that the political performance of PAS and PKS has indicated differently contrast results. While political electability of PAS in the 2013 Malaysia’s general election has disappointed this party, PKS has successfully proved that surveys held by a number of survey institutes—predicting that t...

  15. Test report for PAS-1 cask certification for shipping payload B

    International Nuclear Information System (INIS)

    MERCADO, J.E.

    1998-01-01

    This test report documents the successful inspection and testing to certify two NuPac PAS-1 casks in accordance with US Department of Energy Certificate of Compliance (CoC) USA/9184/B(U). The primary and secondary containment vessels of each cask met the acceptance criteria defined in the CoC and the test plan

  16. Peer Relations and the Understanding of Faux Pas: Longitudinal Evidence for Bidirectional Associations

    Science.gov (United States)

    Banerjee, Robin; Watling, Dawn; Caputi, Marcella

    2011-01-01

    Research connecting children's understanding of mental states to their peer relations at school remains scarce. Previous work by the authors demonstrated that children's understanding of mental states in the context of a faux pas--a social blunder involving unintentional insult--is associated with concurrent peer rejection. The present report…

  17. 1 1) Pourquoi est-ce que je ne parviens pas à ouvrir les formulaires ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC CRDI

    Faites vos calculs avec soin car votre demande pourrait ne pas être admissible.) 6) Existe-t-il une liste de pays admissibles dans lesquels mon établissement ou organisme est autorisé à travailler ou à avoir des partenaires ? Non, le CRDI n'a rien de tel; cependant, il ne soutient des travaux que dans les pays à faible.

  18. Whole-genome sequence of Starmerella bacillaris PAS13, a nonconventional enological yeast with antifungal activity

    DEFF Research Database (Denmark)

    Lemos Junior, Wilson Jose Fernandes; Treu, Laura; Duarte, Vinicius da Silva

    2017-01-01

    Starmerella bacillaris is a fermentative yeast commonly found in vineyards. Here, we present the draft genome sequence of S. bacillaris PAS13, a nonconventional enological yeast with a potential role as a biocontrol agent. This gene sequence will provide insights into the genetic basis of yeast...

  19. Evidentiary requirements to identify potentially acceptable sites (PAS) in crystalline rock

    International Nuclear Information System (INIS)

    Comella, P.A.; Smith, B.H.

    1985-01-01

    This report contains information on the evidentiary requirements to identify potentially acceptable sites in crystalline rock for waste disposal. Topics addressed include: chronology, key regulatory assumptions, statutory framework for identifying potentially acceptable sites, application of 10 disqualifiers, consideration of favorable and potentially adverse conditions, a composite favorability analysis, and a proposed outline for PAS identification decision document

  20. Neuchatel ne gardera pas le Palais de l'equilibre apres Expo.02

    CERN Multimedia

    2002-01-01

    "La ville de Neuchatel ne souhaite pas conserver le Palais de l'equilibre apres Expo.02. Par 24 voix contre 7, le Conseil general a rejete le plan special du Conseil communal qui proposait de transformer l'edifice en un centre de congres" (1/2 page).

  1. Psychometric Properties and Norms of the German ABC-Community and PAS-ADD Checklist

    Science.gov (United States)

    Zeilinger, Elisabeth L.; Weber, Germain; Haveman, Meindert J.

    2011-01-01

    Aim: The aim of the present study was to standardize and generate psychometric evidence of the German language versions of two well-established English language mental health instruments: the "Aberrant Behavior Checklist-Community" (ABC-C) and the "Psychiatric Assessment Schedule for Adults with Developmental Disabilities" (PAS-ADD) Checklist. New…

  2. Validity of samul's paediatric appendicitis score (pas) in the diagnosis of acute appendicitis in children

    International Nuclear Information System (INIS)

    Rehman, S.; Butt, M. Q.

    2014-01-01

    Objective: To validate the paediatric appendicitis score for the diagnosis of acute appendicitis in children using histopathology as a gold standard. Study Design: Case control study. Place and Duration of Study: Military Hospital (MH) and Combined Military Hospital (CMH) Rawalpindi, Pakistan from Dec 2009 to Jul 2010. Patients and Methods: Eighty five children 1-7year old who came to our tertiary surgical department with the chief complaint of abdominal pain of less than 7 days duration were included in the study. Paediatric appendicitis score (PAS) components including fever > 380 C, anorexia, nausea/vomiting, cough/percussion/hopping tenderness, right-lower-quadrant tenderness, migration of pain, leukocytosis > 10,000 (109/1) and polymorphonuclear - neutrophilia > 7500 (109/1) were assessed and recorded on admission, but the sum was not calculated until later and the score did not play any role in the management of the patient. The diagnosis of appendicitis was made by the trainees and consultants clinically and with the aid of routine sonography of abdomen. After appendicetomies, resected specimens were sent for histopathological examination. Pre-operative PAS, histopathology report of resected appendix were endorsed on patient's performa. A two by two table was used to determine sensitivity, specificity, positive and negative predictive values and diagnostic efficacy of PAS. Results: Sensitivity of PAS was 92.16%, specificity 88.23%, positive predictive value 92.16%, negative predictive value 88.23% and the diagnostic efficacy 90.59%. Conclusion: PAS is a highly sensitive test with fair degree of specificity in diagnosing acute appendicitis in children and its routine usage may improve the diagnostic accuracy. (author)

  3. PAS positivity of erythroid precursor cells is associated with a poor prognosis in newly diagnosed myelodysplastic syndrome patients.

    Science.gov (United States)

    Masuda, Kenta; Shiga, Shuichi; Kawabata, Hiroshi; Takaori-Kondo, Akifumi; Ichiyama, Satoshi; Kamikubo, Yasuhiko

    2018-07-01

    Myelodysplastic syndrome (MDS) is a group of clonal stem cell disorders characterized by hematopoietic insufficiency. The accurate risk stratification of patients with MDS is essential for selection of appropriate therapies. We herein conducted a retrospective cohort study to examine the prognostic value of periodic acid-Schiff (PAS) reaction-positive erythroblasts in MDS patients. We examined the PAS positivity of the bone marrow erythroblasts of 144 patients newly diagnosed with MDS; 26 (18.1%) of them had PAS-positive erythroblasts, whereas 118 (81.9%) did not. The PAS-positive group showed significantly poorer karyotypes as defined in the revised International Prognostic Scoring System (IPSS-R) and higher scores in age-adjusted IPSS-R (IPSS-RA) than the PAS-negative group. Overall survival (OS) and leukemia-free survival (LFS) were also significantly shorter in the PAS-positive group than in the PAS-negative group. Similar results were obtained when only high- and very high risk groups were analyzed using IPSS-RA. This retrospective study suggested that the PAS positivity of erythroblasts is an additional prognostic factor combined with other risk scores for OS and LFS in MDS, and our results may contribute to improved clinical decision-making and rapid risk stratification.

  4. Return on investment of advanced practice medical degrees: NPs vs. PAs.

    Science.gov (United States)

    Craig, Christopher K; Holmes, James H; Carter, Jeffery E

    2017-06-01

    As the United States faces a predicted physician shortage over the next 2 decades, physician assistants (PAs) and NPs are expected to fill the void. At the same time, because education is expensive, student loan and tuition increases have many potential applicants assessing differences in reimbursement and wondering about their return on investment (ROI). An analysis compared PA and NP salaries by incorporating national salary data, federal income tax, and student loans for a comparative analysis of each career pathway. Salaries were abstracted from the 2012 Bureau of Labor Statistics database. The net present value (NPV) of PA and NP salaries was calculated with a 5% discount rate. Principal and interest for student loans was calculated at a 6% interest fixed-rate loan over 30 years. NPVs were then compared with projected ROI at retirement age. Relative career values were also given to each career choice, based on a retirement age of 65 years, which translates to about 41 years of employment for both PAs and NPs. PAs' and NPs' educational loans both equalled $129,484 on total repayment. The median annual salary of a PA was $90,930 and $89,960 for an NP. PA data yielded a 5% NPV of $781,323 compared with $764,348 for NPs. Of note, the 5% NPV of a 4-year nursing degree is $728,436. PAs have a slightly higher ROI compared with NPs. These findings may change due to adjustments in nursing training models. Many PA programs allow matriculation immediately after obtaining a bachelor's degree. NP schools often require nursing experience before entering their program. Some schools are considering an accelerated NP program, allowing immediate matriculation after obtaining a bachelor's degree. Because many NP programs have become doctoral degrees, the increased duration of training, higher tuition, and fewer years worked before retirement lower the overall NP ROI. A similar reduction in ROI was considered marginal in PAs who attend residency programs-though these programs are

  5. Balanced ScoreCard Y las Normas de Integración PAS 99:2006

    Directory of Open Access Journals (Sweden)

    Soler González, Rafael H.

    2013-12-01

    Full Text Available For the development of this work the authors used the Norton & Kaplan recommendations for the implementation of the Balanced Scorecard (BSC, and novel diagnostic tools as SISTRAT, strategy maps software for LINUX UBUNTU DC Map.xls and development of Box Mando. Once the BSC was implemented, a longitudinal study of data in the scorecard was carried out in order to analyze to what extent the implementation of the BSC in the Design and Engineering Company (EDIN coincided with the seven principles of integration standards PAS 99:2006. For this comparison Hamming´s relative distances were used as a measurement tool. Respective analyzes were performed to the extent that the relative distances were declining which showed that the BSC implemented in EDIN was consistent with PAS 99:2006.

  6. SELECTED REQUIREMENTS OF INTEGRATED MANAGEMENT SYSTEMS BASED ON PAS 99 SPECIFICATION

    Directory of Open Access Journals (Sweden)

    Paweł Nowicki

    2013-03-01

    Full Text Available The aim this research was to analyze the ways of integration of management systems in food sector. The study involved the documentation, audits, corrective and preventive actions and management's review phases described in the specification PAS 99, which is one of common elements of integrated management systems. Four organizations were selected for the study. The organizations had introduced and certified at least two standardized management systems. It was assumed that the investigated organizations should have implemented the HACCP system. Studies were conducted as a case study. The employees responsible for the functioning of management systems were interviewed in all four organizations. The study was conducted in the form of in-depth interviews based on pre-prepared script. The scenario was developed based on the PAS 99 guideline. The process of integration of management systems implemented in the studied companies reveals the full compliance of an integrated management system with PASS 99 in the policy area.

  7. Noninvasive glucose sensing in scattering media using OCT, PAS, and TOF techniques

    Science.gov (United States)

    Alarousu, Erkki; Hast, Jukka T.; Kinnunen, Matti T.; Kirillin, Mikhail Y.; Myllyla, Risto A.; Plucinski, Jerzy; Popov, Alexey P.; Priezzhev, Alexander V.; Prykari, Tuukka; Saarela, Juha; Zhao, Zuomin

    2004-08-01

    In this paper, optical measurement techniques, which enable non-invasive measurement, are superimposed to glucose sensing in scattering media. Used measurement techniques are Optical Coherence Tomography (OCT), Photoacoustic spectroscopy (PAS) and laser pulse Time-of-Flight (TOF) measurement using a streak camera. In parallel with measurements, a Monte-Carlo (MC) simulation models have been developed. Experimental in vitro measurements were performed using Intralipid fat emulsion as a tissue simulating phantom for OCT and TOF measurements. In PAS measurements, a pork meat was used as a subject but also preliminary in vivo measurements were done. OCT measurement results show that the slope of the OCT signal's envelope changes as a function of glucose content in the scattering media. TOF measurements show that the laser pulse full width of half maximum (FWHM) changes a little as function of glucose content. An agreement with MC-simulations and measurements with Intralipid was also found. Measurement results of PAS technique show that changes in glucose content in the pork meat tissue can be measured. In vivo measurements with a human volunteer show that other factors such as physiological change, blood circulation and body temperature drift may interfere the PA response of glucose.

  8. [Parental alienation syndrome (PAS): unknown in medical settings, endemic in courts].

    Science.gov (United States)

    Pignotti, Maria Serenella

    2013-02-01

    A purposed syndrome of so-called parental alienation (PAS), unsupported by any evidence-based data, unknown in medical settings, unquoted in medical books, absent in DSM and ICD, never demonstrated by controlled studies published in high scientific level journals, is rampant in Courts where it can lead to loose parental custody. During a divorce trial, almost always the mothers and the children, become joint in a sort of folie au deux, in a denigration campaign of ex-husband/father. From a review on this issue it seems evident its theoretical roots lie on a theory that justify gender violence and children sexual abuse. The bias that both of them are layers and that he children have not autonomy block their possibility of any defence in front of a Court. In severe cases, PAS becomes a new and efficient tool of intra-familiar violence. The treatment of severe cases is to stop any contact between mother and children. The resort to PAS in Courts must be strongly rejected.

  9. Unique and cross-reactive T cell epitope peptides of the major Bahia grass pollen allergen, Pas n 1.

    Science.gov (United States)

    Etto, Tamara; de Boer, Carmela; Prickett, Sara; Gardner, Leanne M; Voskamp, Astrid; Davies, Janet M; O'Hehir, Robyn E; Rolland, Jennifer M

    2012-01-01

    Bahia grass pollen (BaGP) is a major cause of allergic rhinitis. Subcutaneous allergen-specific immunotherapy is effective for grass pollen allergy, but is unsuitable for patients with moderate to severe asthma due to the risk of anaphylaxis. T cell-reactive but IgE nonreactive peptides provide a safer treatment option. This study aimed to identify and characterize dominant CD4(+) T cell epitope peptides of the major BaGP allergen, Pas n 1. Pas n 1-specific T cell lines generated from the peripheral blood of BaGP-allergic subjects were tested for proliferative and cytokine response to overlapping 20-mer Pas n 1 peptides. Cross-reactivity to homologous peptides from Lol p 1 and Cyn d 1 of Ryegrass and Bermuda grass pollen, respectively, was assessed using Pas n 1 peptide-specific T cell clones. MHC class II restriction of Pas n 1 peptide T cell recognition was determined by HLA blocking assays and peptide IgE reactivity tested by dot blotting. Three Pas n 1 peptides showed dominant T cell reactivity; 15 of 18 (83%) patients responded to one or more of these peptides. T cell clones specific for dominant Pas n 1 peptides showed evidence of species-specific T cell reactivity as well as cross-reactivity with other group 1 grass pollen allergens. The dominant Pas n 1 T cell epitope peptides showed HLA binding diversity and were non-IgE reactive. The immunodominant T cell-reactive Pas n 1 peptides are candidates for safe immunotherapy for individuals, including those with asthma, who are allergic to Bahia and possibly other grass pollens. Copyright © 2012 S. Karger AG, Basel.

  10. Le big bang n'est pas une théorie comme les autres

    CERN Document Server

    Bonnet-Bidaud, Jean-Marc; Leglu, Dominique; Reinisch, Gilbert

    2009-01-01

    Le big bang n'est pas une théorie comme les autres. Ce n'est d'ailleurs pas une théorie physique au sens propre du terme, mais un scénario cosmologique issu des équations de la relativité générale. Il est le modèle qui s'ajuste le mieux aux observations actuelles, mais à quel prix ? Il nous livre un Univers composé à 96 % de matière et d'énergie noires inconnues. C'est donc un euphémisme que de dire que le big bang semble poser autant - sinon plus - de questions qu'il n'en résout. En ce sens, le big bang apparaît davantage comme une paramétrisation de notre ignorance plutôt que comme une modélisation d'un phénomène. Pourtant, le succès du big bang et l'adhésion qu'il suscite, tant dans la sphère scientifique que dans la sphère médiatique, ne se démentent pas. Surmédiatisé, son statut dépasse celui de modèle théorique, et la simple évocation de son nom suffit pour justifier des opérations de marketing scientifique ou rejeter des cosmologies alternatives. Pour éclaircir les pr...

  11. Second Annual Maintenance, Inspection, and Test Report for PAS-1 Cask Certification for Shipping Payload B

    International Nuclear Information System (INIS)

    KELLY, D.J.

    2000-01-01

    The Nuclear Packaging, Inc. (NuPac), PAS-1 cask is required to undergo annual maintenance and inspections to retain certification in accordance with U.S. Department of Energy (DOE) Certificate of Compliance USA/9184B(U) (Appendix A). The packaging configuration being tested and maintained is the NuPac PAS-1 cask for Payload B. The intent of the maintenance and inspections is to ensure the packaging remains in unimpaired physical condition. Two casks, serial numbers 2162-026 and 2162-027, were maintained, inspected, and tested at the 306E Development, Fabrication, and Test Laboratory, located at the Hanford Site's 300 Area. Waste Management Federal Services, Inc. (WMFS), a subsidiary of GTS Duratek, was in charge of the maintenance and testing. Cogema Engineering Corporation (Cogema) directed the operations in the test facility. The maintenance, testing, and inspections were conducted successfully with both PAS-1 casks. The work conducted on the overpacks included weighing, gasket replacement, and plastic pipe plug and foam inspections. The work conducted on the secondary containment vessel (SCV) consisted of visual inspection of the vessel and threaded parts (i.e., fasteners), visual inspection of sealing surfaces, replacement of O-ring seals, and a helium leak test. The work conducted on the primary containment vessel (PCV) consisted of visual inspection of the vessel and threaded parts (i.e., fasteners), visual inspection of sealing surfaces, replacement of O-ring seals, dimensional inspection of the vessel bottom, a helium leak test, and dye penetrant inspection of the welds. The vermiculite material used in the cask rack assembly was replaced

  12. [Gardner syndrome--parent alienation syndrome (PAS). Diagnosis or family reality?].

    Science.gov (United States)

    Namysłowska, Irena; Heitzman, Janusz; Siewierska, Anna

    2009-01-01

    The authors present characteristics of Parental Alienation Syndrome (PAS) proposed by Gardner as well as data, which may help to differentiate that syndrome with real psychological, physical and sexual abuse. The consequences of Gardner Syndrome for legal decisions in the court cases of child custody and the critique of this syndrome in forensic and psychiatric literature are also discussed, and several questions posed. Authors propose to treat Gardner Syndrome not as as a child disorder but as a specific, dynamic family situation, which occurs sometimes, during divorce and fight about child custody.

  13. Pas de remède miracle Parvenir à une couverture santé universelle ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    26 oct. 2012 ... Pas de remède miracle Parvenir à une couverture santé universelle grâce à des systèmes de santé équitables ... Le Nigeria, qui compte parmi les pays qui affichent les taux les plus élevés de mortalité des mères, des enfants et des nouveau-nés, a fait des soins de santé primaires sa plus grande priorité.

  14. Protective effects of ebselen (Ebs) and para-aminosalicylic acid (PAS) against manganese (Mn)-induced neurotoxicity

    Energy Technology Data Exchange (ETDEWEB)

    Marreilha dos Santos, A.P., E-mail: apsantos@ff.ul.pt [I-Med.UL, Department of Toxicology and Food Sciences, Faculty of Pharmacy, University of Lisbon, Lisbon (Portugal); Lucas, Rui L.; Andrade, Vanda; Mateus, M. Luísa [I-Med.UL, Department of Toxicology and Food Sciences, Faculty of Pharmacy, University of Lisbon, Lisbon (Portugal); Milatovic, Dejan; Aschner, Michael [Department of Pediatrics, Vanderbilt University Medical Center, Nashville, TN 37232 (United States); Batoreu, M. Camila [I-Med.UL, Department of Toxicology and Food Sciences, Faculty of Pharmacy, University of Lisbon, Lisbon (Portugal)

    2012-02-01

    Chronic, excessive exposure to manganese (Mn) may induce neurotoxicity and cause an irreversible brain disease, referred to as manganism. Efficacious therapies for the treatment of Mn are lacking, mandating the development of new interventions. The purpose of the present study was to investigate the efficacy of ebselen (Ebs) and para-aminosalicylic acid (PAS) in attenuating the neurotoxic effects of Mn in an in vivo rat model. Exposure biomarkers, inflammatory and oxidative stress biomarkers, as well as behavioral parameters were evaluated. Co-treatment with Mn plus Ebs or Mn plus PAS caused a significant decrease in blood and brain Mn concentrations (compared to rats treated with Mn alone), concomitant with reduced brain E{sub 2} prostaglandin (PGE{sub 2}) and enhanced brain glutathione (GSH) levels, decreased serum prolactin (PRL) levels, and increased ambulation and rearing activities. Taken together, these results establish that both PAS and Ebs are efficacious in reducing Mn body burden, neuroinflammation, oxidative stress and locomotor activity impairments in a rat model of Mn-induced toxicity. -- Highlights: ► The manuscript is unique in its approach to the neurotoxicity of Mn. ► The manuscript incorporates molecular, cellular and functional (behavioral) analyses. ► Both PAS and Ebs are effective in restoring Mn behavioral function. ► Both PAS and Ebs are effective in reducing Mn-induced oxidative stress. ► Both PAS and Ebs led to a decrease in Mn-induced neuro-inflammation.

  15. Protective effects of ebselen (Ebs) and para-aminosalicylic acid (PAS) against manganese (Mn)-induced neurotoxicity

    International Nuclear Information System (INIS)

    Marreilha dos Santos, A.P.; Lucas, Rui L.; Andrade, Vanda; Mateus, M. Luísa; Milatovic, Dejan; Aschner, Michael; Batoreu, M. Camila

    2012-01-01

    Chronic, excessive exposure to manganese (Mn) may induce neurotoxicity and cause an irreversible brain disease, referred to as manganism. Efficacious therapies for the treatment of Mn are lacking, mandating the development of new interventions. The purpose of the present study was to investigate the efficacy of ebselen (Ebs) and para-aminosalicylic acid (PAS) in attenuating the neurotoxic effects of Mn in an in vivo rat model. Exposure biomarkers, inflammatory and oxidative stress biomarkers, as well as behavioral parameters were evaluated. Co-treatment with Mn plus Ebs or Mn plus PAS caused a significant decrease in blood and brain Mn concentrations (compared to rats treated with Mn alone), concomitant with reduced brain E 2 prostaglandin (PGE 2 ) and enhanced brain glutathione (GSH) levels, decreased serum prolactin (PRL) levels, and increased ambulation and rearing activities. Taken together, these results establish that both PAS and Ebs are efficacious in reducing Mn body burden, neuroinflammation, oxidative stress and locomotor activity impairments in a rat model of Mn-induced toxicity. -- Highlights: ► The manuscript is unique in its approach to the neurotoxicity of Mn. ► The manuscript incorporates molecular, cellular and functional (behavioral) analyses. ► Both PAS and Ebs are effective in restoring Mn behavioral function. ► Both PAS and Ebs are effective in reducing Mn-induced oxidative stress. ► Both PAS and Ebs led to a decrease in Mn-induced neuro-inflammation.

  16. A novel source of MeV positron bunches driven by energetic protons for PAS application

    Energy Technology Data Exchange (ETDEWEB)

    Tan, Zongquan, E-mail: tqq1123@mail.ustc.edu.cn [State Key Laboratory of Particle Detection and Electronics, University of Science and Technology of China, Hefei, Anhui 230026 (China); Department of Modern Physics, University of Science and Technology of China, Hefei, Anhui 230026 (China); Xu, Wenzhen; Liu, Yanfen; Xiao, Ran; Kong, Wei [State Key Laboratory of Particle Detection and Electronics, University of Science and Technology of China, Hefei, Anhui 230026 (China); Department of Modern Physics, University of Science and Technology of China, Hefei, Anhui 230026 (China); Ye, Bangjiao, E-mail: bjye@ustc.edu.cn [State Key Laboratory of Particle Detection and Electronics, University of Science and Technology of China, Hefei, Anhui 230026 (China); Department of Modern Physics, University of Science and Technology of China, Hefei, Anhui 230026 (China)

    2014-11-01

    This paper proposes a novel methodology of MeV positrons generation for PAS application. Feasibility of this proposal analyzed by G4Beamline and Transport have shown reasonable success. Using 2 Hz, 1.6 GeV, 100 ns and 1.5 μC/bunch proton bunches for bombarding a graphite target, about 100 ns e{sup +} bunches are generated. Quasi-monochromatic positrons in the range of 1–10 MeV included in these bunches have a flux of >10{sup 7}/s, peak brightness of 10{sup 14}/s. A magnetic-confinement beamline is utilized to transport the positrons and a “Fast Beam Chopper” is unprecedentedly extended to chop those relativistic bunches. The positron beam can be finally characterized by the energy range of 1–10 MeV and bunch width from one hundred ps up to 1 ns. Such ultrashort bunches can be useful in tomography-type positron annihilation spectroscopy (PAS) as well as other applications.

  17. A novel source of MeV positron bunches driven by energetic protons for PAS application

    Science.gov (United States)

    Tan, Zongquan; Xu, Wenzhen; Liu, Yanfen; Xiao, Ran; Kong, Wei; Ye, Bangjiao

    2014-11-01

    This paper proposes a novel methodology of MeV positrons generation for PAS application. Feasibility of this proposal analyzed by G4Beamline and Transport have shown reasonable success. Using 2 Hz, 1.6 GeV, 100 ns and 1.5 μC/bunch proton bunches for bombarding a graphite target, about 100 ns e+ bunches are generated. Quasi-monochromatic positrons in the range of 1-10 MeV included in these bunches have a flux of >107/s, peak brightness of 1014/s. A magnetic-confinement beamline is utilized to transport the positrons and a "Fast Beam Chopper" is unprecedentedly extended to chop those relativistic bunches. The positron beam can be finally characterized by the energy range of 1-10 MeV and bunch width from one hundred ps up to 1 ns. Such ultrashort bunches can be useful in tomography-type positron annihilation spectroscopy (PAS) as well as other applications.

  18. Evropski zeleni pas – narava ne pozna meja. Od železne zavese do popkovine Evrope.

    Directory of Open Access Journals (Sweden)

    Liana Geidezis

    2004-01-01

    Full Text Available Od Barentsovega do Črnega morja je železna zavesa Evropo delila skoraj štirideset let. Bila je politična, ideološka in fizična ovira, še najbolj izrazito v Nemčiji. Čeprav je bila docela nečloveška, je omogočila naravi premor: narava se je razbohotila in razvilo se je nekaj izjemno redkega v intenzivno uporabljeni krajini – t. i. zeleni pas. Od padca železne zavese leta 1989, poteka prek Evrope popkovina habitatov, dolga skoraj 8.500 km. Z izhodišči v projektu Green Belt Germany, nastalem na pobudo BUND, se je razvil projekt Zeleni pas Evrope ali Green Belt Europe. Lahko postane hrbtenica ekološkega omrežja, ki bo globalni simbol čezmejnega sodelovanja in ohranjanja narave ter vzdržnega razvoja. Še več, povezuje ljudi in kaže, da ima lahko povečana Evropska unija poleg kulturne tudi skupno naravno dediščino. To je enkratna priložnost za premagovanje starih meja in ovir med vzhodom in zahodom – živo znamenje skupne rasti v Evropi.

  19. Inhibitory PAS domain protein is a negative regulator of hypoxia-inducible gene expression

    Science.gov (United States)

    Makino, Yuichi; Cao, Renhai; Svensson, Kristian; Bertilsson, Göran; Asman, Mikael; Tanaka, Hirotoshi; Cao, Yihai; Berkenstam, Anders; Poellinger, Lorenz

    2001-11-01

    Alteration of gene expression is a crucial component of adaptive responses to hypoxia. These responses are mediated by hypoxia-inducible transcription factors (HIFs). Here we describe an inhibitory PAS (Per/Arnt/Sim) domain protein, IPAS, which is a basic helix-loop-helix (bHLH)/PAS protein structurally related to HIFs. IPAS contains no endogenous transactivation function but demonstrates dominant negative regulation of HIF-mediated control of gene expression. Ectopic expression of IPAS in hepatoma cells selectively impairs induction of genes involved in adaptation to a hypoxic environment, notably the vascular endothelial growth factor (VEGF) gene, and results in retarded tumour growth and tumour vascular density in vivo. In mice, IPAS was predominantly expressed in Purkinje cells of the cerebellum and in corneal epithelium of the eye. Expression of IPAS in the cornea correlates with low levels of expression of the VEGF gene under hypoxic conditions. Application of an IPAS antisense oligonucleotide to the mouse cornea induced angiogenesis under normal oxygen conditions, and demonstrated hypoxia-dependent induction of VEGF gene expression in hypoxic corneal cells. These results indicate a previously unknown mechanism for negative regulation of angiogenesis and maintenance of an avascular phenotype.

  20. Meeting with Jean-Yves Le Meur, author of "Faux Pas"

    CERN Multimedia

    2008-01-01

    A CERN engineer and an accomplished sportsman, Jean-Yves Le Meur (IT Department) has recently published his first book "Faux pas". Meet him and hear about his exceptional life on 23 April 2008 in the Globe. An accident cost him his legs when he was young, and it was sheer force of character and a passion for the mountains that carried Jean-Yves Le Meur, with one artificial leg and crutches to stay upright, to the very summit of the Mont-Blanc. In his book, Jean-Yves, a computer engineer at CERN, recounts with detachment his personal battle to win back his life and make this impossible ascent. "Faux Pas" depicts a series of encounters and people, and recreates the extreme emotions of a man who reconstructed his life and pushed himself beyond his limits. It is a moving personal account, whose message is universal. The question-and-answer session with the author will be preceded by the projection of "4810M, CAHIN-CAHA",...

  1. PAs and NPs in an emergency room-linked acute care clinic.

    Science.gov (United States)

    Currey, C J

    1984-12-01

    The use of hospital emergency rooms for nonurgent care during evenings hours often strains medical resources and may affect the quality of emergency care. One facility's effective use of an after-hours acute care clinic staffed by PAs and NPs to divert nonurgent problems away from its emergency room is outlined. PAs and NPs work during peak demand hours (evenings and weekends) under the supervision of an emergency room physician, and receive supplementary support from other emergency room personnel. Incoming patients are referred to the emergency room or acute care clinic, depending on the nature of their problems. Acute care clinic patients are then treated by the PA or NP and either released or referred to an emergency room physician, if their conditions warrant additional treatment. As a result, use of the acute care clinic has greatly reduced the amount of non-urgent medical treatment in the emergency room and has provided other advantages to both patients and staff as well. These advantages and the encouraging statistics following six months of the clinic's operation are discussed.

  2. Combined Protocol for Acute Malnutrition Study (ComPAS) in rural South Sudan and urban Kenya

    DEFF Research Database (Denmark)

    Bailey, Jeanette; Lelijveld, Natasha; Marron, Bethany

    2018-01-01

    Background: Acute malnutrition is a continuum condition, but severe and moderate forms are treated separately, with different protocols and therapeutic products, managed by separate United Nations agencies. The Combined Protocol for Acute Malnutrition Study (ComPAS) aims to simplify and unify...... the treatment of uncomplicated severe and moderate acute malnutrition (SAM and MAM) for children 6-59 months into one protocol in order to improve the global coverage, quality, continuity of care and cost-effectiveness of acute malnutrition treatment in resource-constrained settings.  Methods/design: This study...... is a multi-site, cluster randomized non-inferiority trial with 12 clusters in Kenya and 12 clusters in South Sudan. Participants are 3600 children aged 6-59 months with uncomplicated acute malnutrition. This study will evaluate the impact of a simplified and combined protocol for the treatment of SAM and MAM...

  3. « Y être ou pas ? » Le mystère Dylan

    Directory of Open Access Journals (Sweden)

    Christophe Lebold

    2009-09-01

    Full Text Available Fidèle à ses rendez-vous annuels que ses aficionados appellent depuis vingt ans "la tournée sans fin", Bob Dylan est revenu en France. Au mois de juin 2008, tout juste de retour d’une tournée en Amérique du Sud et d’un passage éclair en Nouvelle Angleterre, récemment couronné d’un prix Pulitzer, il a donné deux nouveaux concerts, l’un à Toulouse, l’autre à Grenoble. Pour une fois, je n’y étais pas, occupé à suivre en Europe une autre icône de la chanson, Leonard Cohen. Mais je sais cependant ...

  4. Exploiter la Littérature en Classe du Fle: Allah N'est Pas Obligé D ...

    African Journals Online (AJOL)

    Prof

    allons exploiter un extrait d'un texte littéraire: Allah n'est pas obligé d'Ahmadou. Kourouma au niveau A1/A2 du CECR. Dans Allah n'est pas obligé l'écrivain ivoirien dépeint le phénomène d'enfant soldat à travers la vie et les pérégrinations de Birahima le protagoniste. Etat de lieu. Pour se tirer de la situation ci-dessus, ...

  5. Valores y pautas de crianza familiar en los montes del Pas

    Directory of Open Access Journals (Sweden)

    Petra María PÉREZ ALONSO-GETA

    2009-11-01

    Full Text Available RESUMEN: La comunidad asentada en los montes del Pas es una sociedad que se define como agrícola, rural y campesina. La familia es a la vez unidad doméstica y productiva, ocupada básicamente en labores agrarias y ganaderas.El objetivo final de este estudio es el conocimiento de las pautas de crianza y transmisión cultural del pueblo pasiego. Tratamos de conocer mejor el mundo de la educación familiar para desde ese conocimiento avanzar adecuadamente en la toma de decisiones pedagógicas. Por los datos recogidos cabe hablar de la existencia de unas relaciones intergeneracionales cálidas y positivas, donde la atención, cooperación y solidaridad son un hecho. La familia comparte espacios, tiempos y tareas. Los niños aprenden a través del modelado los valores, normas y pautas de conducta. Enseñan a los niños a tener palabra, ser trabajadores y respetuosos. Los niños van al campo desde muy pequeños a ayudar. Trabajan mucho. Los valores que definen son la laboriosidad, el esfuerzo para el progreso económico, lealtad, tener palabra y solidaridad. Se ayudan mucho entre ellos.ABSTRACT: The community settled in the mountains of the Pas is a society which is described as agricultural and rural. The family is both the domestic and productive unit, basically working in farming and stockbreeding tasks.The final aim of this estudy is to know the nurturing and cultural transmission guidelines of the pasiego people. We aim to know the world of the education within the family better and, from this knowledge, to advance appropriately in the educational decission making. From the gathered data we may assume that there are warm and positive intergenerational relationships, where care, cooperation and solidarity are real. The familiy share spaces, time and tasks; children learn through the modeling of valúes, norms and guidelines. They are taught to have their own voice, to work hard and to be respectful. They do work hard. The defining valúes in

  6. Safety evaluation for packaging for the transport of K Basin sludge samples in the PAS-1 cask

    International Nuclear Information System (INIS)

    SMITH, R.J.

    1998-01-01

    This safety evaluation for packaging authorizes the shipment of up to two 4-L sludge samples to and from the 325 Lab or 222-S Lab for characterization. The safety of this shipment is based on the current U.S. Department of Energy Certification of Compliance (CoC) for the PAS-1 cask, USA/9184/B(U) (DOE)

  7. Crystallization and preliminary crystallographic data of the PAS domain of the NifL protein from Azotobacter vinelandii.

    NARCIS (Netherlands)

    Hefti, M.H.; Hendle, J.; Enroth, C.; Vervoort, J.J.M.; Tucker, P.A.

    2001-01-01

    The Azotobacter vinelandii NifL protein is a redox-sensing flavoprotein which inhibits the activity of the nitrogen-specific transcriptional activator NifA. The N-terminal PAS domain has been overexpressed in Escherichia coli and crystallized by the hanging-drop vapour-diffusion method. The crystal

  8. Effect of PAS triple therapy on nerve injury, oxidative stress and inflammatory response in patients with cerebral infarction

    Directory of Open Access Journals (Sweden)

    Li-Jun Deng

    2017-10-01

    Full Text Available Objective: To study the effect of probucol + aspirin + atorvastatin (PAS triple therapy on nerve injury, oxidative stress and inflammatory response in patients with cerebral infarction. Methods: Patients with acute cerebral infarction who were treated in Affiliated Hospital of Jianghan University between February 2015 and January 2015 were selected and randomly divided into the PAS group who received probucol + aspirin + atorvastatin triple therapy and the control group who received aspirin + atorvastatin double therapy. The markers of nerve injury, oxidative stress and inflammatory response were determined before treatment and 15 d after treatment. Results: 15 d after treatment, peripheral blood Keap-1 expression and serum GPX1 contents of both groups of patients were significantly higher than those before treatment while peripheral blood Nrf-2 and ARE expression as well as serum S100B, NSE, sTRAIL, FKN, HMGB-1, sICAM-1, Chemerin and 8-iso-PGF2α contents were significantly lower than those before treatment, and peripheral blood Keap-1 expression and serum GPX1 content of PAS group were significantly higher than those of control group while peripheral blood Nrf-2 and ARE expression as well as serum S100B, NSE, sTRAIL, FKN, HMGB-1, sICAM-1, Chemerin and 8-iso-PGF2α contents were significantly lower than those of control group. Conclusion: PAS triple therapy can reduce the nerve injury as well as oxidative stress response and inflammatory response in patients with cerebral infarction.

  9. Safety evaluation for packaging for the transport of K Basin sludge samples in the PAS-1 cask

    Energy Technology Data Exchange (ETDEWEB)

    SMITH, R.J.

    1998-11-17

    This safety evaluation for packaging authorizes the shipment of up to two 4-L sludge samples to and from the 325 Lab or 222-S Lab for characterization. The safety of this shipment is based on the current U.S. Department of Energy Certification of Compliance (CoC) for the PAS-1 cask, USA/9184/B(U) (DOE).

  10. The Effects of the Paired Associates Strategy (PAS) on the Recall of Factual Information by Postsecondary Students with Learning Disabilities

    Science.gov (United States)

    Patwa, Shamim S.; Chafouleas, Sandra M.; Madaus, Joseph W.

    2005-01-01

    Despite the success of independence-oriented interventions such as strategy instruction (SI) in secondary populations, very little research has examined the effectiveness of SI at the postsecondary level. Thus, we sought to determine if one form of SI, the Paired Associates Strategy (PAS), improved the recall of factual information by…

  11. Biological control of Aeromonas salmonicida subsp. salmonicida infection in rainbow trout (Oncorhynchus mykiss) using Aeromonas phage PAS-1.

    Science.gov (United States)

    Kim, J H; Choresca, C H; Shin, S P; Han, J E; Jun, J W; Park, S C

    2015-02-01

    The potential control efficacy of Aeromonas phage PAS-1 was evaluated against Aeromonas salmonicida subsp. salmonicida infection in rainbow trout (Oncorhynchus mykiss) model in this study. The phage was co-cultured with the virulent A. salmonicida subsp. salmonicida strain AS05 that possesses the type III secretion system (TTSS) ascV gene, and efficient bacteriolytic activity was observed against the bacteria. The administration of PAS-1 in rainbow trout demonstrated that the phage was cleared from the fish within 200 h post-administration, and a temporal neutralizing activity against the phage was detected in the sera of phage-administrated fish. The administration of PAS-1 (multiplicity of infection: 10 000) in A. salmonicida subsp. salmonicida infected rainbow trout model showed notable protective effects, with increased survival rates and mean times to death. These results demonstrated that Aeromonas phage PAS-1 could be considered as an alternative biological control agent against A. salmonicida subsp. salmonicida infections in rainbow trout culture. © 2013 Blackwell Verlag GmbH.

  12. Partai Islam Se-Malaysia (PAS dan Partai Keadilan Sejahtera (PKS sebagai Partai Islam Pendukung Demokrasi PKS Pada Pemilu

    Directory of Open Access Journals (Sweden)

    Ahmad Ali Nurdin

    2015-11-01

    Full Text Available The article compares the achievement of Partai Islam se-Malaysia (PAS and Partai Keadilan Sejahtera (PKS in the latest general election held in 2013 in Malaysia and in 2014 in Indonesia. The writer finds that the political performance of PAS and PKS has indicated differently contrast results. While political electability of PAS in the 2013 Malaysia’s general election has disappointed this party, PKS has successfully proved that surveys held by a number of survey institutes—predicting that the party would cease within the 2014 Indonesia’s national election—were totally false. Many political figures of PAS have failed to gain positions in the legislative assembly. Meanwhile, in viewing PKS’s political performance during the 2014 national election, one may assume that this party was luckily survive. This is because, a number of surveys conducted before the election had predicted that PKS could be considered lucky when it was able to gain five percent of vote, as its former president has been suspected of being corrupt for his involvement in cows import. However, the fact shows that PKS has not only magnificently survived but it was even able to gain almost seven percent of voters’ vote. Unfortunately, PKS was unsuccessful to achieve its political target to be the biggest three of national vote.

  13. Spondylodiscite granulomateuse: surtout la tuberculose mais ne pas omettre le lymphome

    Science.gov (United States)

    Zinebi, Ali; Rkiouak, Adil; Akhouad, Yousef; Reggad, Ahmed; Kasmy, Zohour; Boudlal, Mostafa; Lho, Abdelhamid Nait; Rabhi, Moncef; Sinaa, Mohamed; Ennibi, Khalid; Chaari, Jilali

    2016-01-01

    Les douleurs lombaires relèvent d'étiologies multiples dont le diagnostic peut être source de grandes difficultés. Le lymphome rachidien primitif est rare et son diagnostic nécessite une biopsie souvent scanoguidée. Un homme de 30 ans, était hospitalisé pour lombalgies inflammatoires évoluant dans un contexte d'altération de l'état général avec à l'examen des douleurs à la palpation des apophyses épineux L2L3, sans syndrome tumoral périphérique. Le bilan biologique montrait un syndrome inflammatoire. Le bilan morphologique était en faveur d'une spondylodiscite. La première biopsie montrait une ostéite granulomateuse. L'aggravation clinique et radiologique sous anti bacillaire a mené à reconsidérer le diagnostic et la deuxième biopsie confirme le diagnostic du lymphome. Le diagnostic de tuberculose osseuse en particulier vertébrale nécessite une confirmation bactériologique et ou histologique pour ne pas méconnaître un lymphome osseux primitif. PMID:28292061

  14. Interacciones sin nombre. Un caso emblemático: Ne me quitte pas (Cirque du Soleil

    Directory of Open Access Journals (Sweden)

    Óscar Quezada-Macchiavello

    2014-02-01

    Full Text Available El presente artículo esboza una teoría tensiva, figural, de la interacción, que se opone y complementa con la teoría narrativa y fi gurativa propuesta por Eric Landowski. Esta última propone una taxonomía de las interacciones dispuesta en el cuadrado semiótico; aquella, mientras tanto, respetando dicha taxonomía, la dispone en intervalo(s sobre los que se deslizan cursos vectoriales. Estos últimos dan cuenta de cuatro zonas de tensión: desprogramación, reprogramación, desajuste, reajuste. Esa irrupción de la gradualidad permite imaginar una gama de «interacciones sin nombre». La mencionada propuesta teórica se pone a prueba en el análisis de las cómicas peripecias de una parodia de la célebre canción de Jacques Brel, Ne me quitt e pas, puesta en escena por el Cirque du Soleil’s Varekai.

  15. Microbial communities in a coastal cave: Cova des Pas de Vallgornera (Mallorca, Western Mediterranean

    Directory of Open Access Journals (Sweden)

    Antoni Busquets

    2014-05-01

    Full Text Available As a part of an ongoing project on the role of microbes in the biogeochemistry of Majorcan caves, the species diversity of microbial communities present in cave pools of anchialine waters in the Cova des Pas de Vallgornera (Mallorca, western Mediterranean is investigated by a culture-dependent method. Two-hundred and forty-eight strains isolated from this characteristic cave environment of the littoral karst are identified by whole-cell-MALDI-TOF mass spectrometry and phylogeneticaly by 16S rRNA gene sequences. Total cell counts and species diversity of the bacterial communities decreas with the distance to the entrance of the cave and to the sea. Strains are mainly identified as members of the Gammaproteobacteria and Actinobacteria. Around 20% of the isolates are able to precipitate carbonates. Calcite is the predominant phase, growing in all the precipitates, although struvite is also found in one Pseudomonas and in one Aspergillus cultures. Differences in crystal characteristics of external shape (habit and growth are observed according to the bacterial species promoting the precipitates. Bacteria associated with multicolored ferromanganese deposits, present in several parts of the cave, are also studied and are identified as Pseudomonas benzenivorans and Nocardioides luteus. The preponderance of Pseudomonas species and the possible contribution of bacteria in calcite deposition are discussed.

  16. Cova des Pas de Vallgornera, (Mallorca, Spain: history of exploration and cave description

    Directory of Open Access Journals (Sweden)

    Antoni Merino

    2014-05-01

    Full Text Available The Cova des Pas de Vallgornera lies in the Llucmajor municipality, in southern Mallorca, and is the longest cave in the Balearic Islands. Currently its surveyed length is over 74,000 metres, including more than 17,000 of underwater extensions. The cave was discovered accidentally in 1968, but it was in 2004 when a major breakthrough shed light on its real extension and importance. The cave roughly shows two tiers of passages, apart from the underwater extensions, the first one is between 7 and 11 m above the mean sea level, the second one is about at the water table level. The importance of the cave is not only related to its extension, but also to the presence of a wide variety of speleothems and outstanding solutional morphologies that evidence a complex evolution. The cave is under the protection of Conselleria de Medi Ambient, Govern de les Illes Balears (the Regional Environmental Authority and was declared Site of Community Importance, within the Natura 2000 Network

  17. The neuronal PAS domain protein 4 (Npas4 is required for new and reactivated fear memories.

    Directory of Open Access Journals (Sweden)

    Jonathan E Ploski

    Full Text Available The Neuronal PAS domain protein 4 (Npas4 is a neuronal activity-dependent immediate early gene that has recently been identified as a transcription factor which regulates the transcription of genes that control inhibitory synapse development and synaptic plasticity. The role Npas4 in learning and memory, however, is currently unknown. Here, we systematically examine the role of Npas4 in auditory Pavlovian fear conditioning, an amygdala-dependent form of emotional learning. In our first series of experiments, we show that Npas4 mRNA and protein are regulated in the rat lateral nucleus of the amygdala (LA in a learning-dependent manner. Further, knockdown of Npas4 protein in the LA via adeno-associated viral (AAV mediated gene delivery of RNAi was observed to impair fear memory formation, while innate fear and the expression of fear memory were not affected. In our second series of experiments, we show that Npas4 protein is regulated in the LA by retrieval of an auditory fear memory and that knockdown of Npas4 in the LA impairs retention of a reactivated, but not a non-reactivated, fear memory. Collectively, our findings provide the first comprehensive look at the functional role of Npas4 in learning and memory.

  18. A novel signal transduction protein: Combination of solute binding and tandem PAS-like sensor domains in one polypeptide chain.

    Science.gov (United States)

    Wu, R; Wilton, R; Cuff, M E; Endres, M; Babnigg, G; Edirisinghe, J N; Henry, C S; Joachimiak, A; Schiffer, M; Pokkuluri, P R

    2017-04-01

    We report the structural and biochemical characterization of a novel periplasmic ligand-binding protein, Dret_0059, from Desulfohalobium retbaense DSM 5692, an organism isolated from Lake Retba, in Senegal. The structure of the protein consists of a unique combination of a periplasmic solute binding protein (SBP) domain at the N-terminal and a tandem PAS-like sensor domain at the C-terminal region. SBP domains are found ubiquitously, and their best known function is in solute transport across membranes. PAS-like sensor domains are commonly found in signal transduction proteins. These domains are widely observed as parts of many protein architectures and complexes but have not been observed previously within the same polypeptide chain. In the structure of Dret_0059, a ketoleucine moiety is bound to the SBP, whereas a cytosine molecule is bound in the distal PAS-like domain of the tandem PAS-like domain. Differential scanning flourimetry support the binding of ligands observed in the crystal structure. There is significant interaction between the SBP and tandem PAS-like domains, and it is possible that the binding of one ligand could have an effect on the binding of the other. We uncovered three other proteins with this structural architecture in the non-redundant sequence data base, and predict that they too bind the same substrates. The genomic context of this protein did not offer any clues for its function. We did not find any biological process in which the two observed ligands are coupled. The protein Dret_0059 could be involved in either signal transduction or solute transport. © 2017 The Protein Society.

  19. Toxic pyrrolizidinalkaloids as undesired contaminants in food and feed: degradation of the PAs from Senecio jacobaea in silage.

    Science.gov (United States)

    Becerra-Jiminez, J; Kuschak, M; Roeder, E; Wiedenfeld, H

    2013-07-01

    Pyrrolizidine alkaloids (PAs) can show a hazardous potential for men and animals. They can act as cancerogenic, mutagenic, teratogenic and fetotoxic agents. One pathway of a human intoxication is its occurence as contaminants in food and feed. Here, the contamination of cereals already led to severe and fatal intoxication episodes. Besides this, milk is of special concern as it is the main food for children which show a very high susceptibility for a PA intoxication. Milk can contain PAs in case the milk producing animals have access to contaminated feed. In this context it is of special interest whether the PA content of contaminated silage remains stable during the ensiling procedure or show a more or less high level of decomposition. We could show that ensiling will not lead to PA-free silage.

  20. Ne réduisez pas les programmes destinés aux femmes. Intégrez-les ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    27 juil. 2017 ... Au cours des derniers mois, nous avons entendu dire que l'administration Trump a prévu de réduire le financement de plusieurs programmes s'adressant aux femmes, comme le Bureau des affaires mondiales relatives aux femmes du département d'État. Ce n'est pas le seul programme. Une évaluation ...

  1. Determination of drug content in semisolid formulations by non-invasive spectroscopic methods: FTIR - ATR, - PAS, - Raman and PDS

    International Nuclear Information System (INIS)

    Gotter, B; Hein, J; Neubert, R H H; Faubel, W; Heissler, St

    2010-01-01

    This study elucidates the potential use of photothermal deflection spectroscopy (PDS), FTIR photoacoustic (FTIR-PAS), FT Raman, and FTIR-attenuated total reflection (FTIR-ATR) spectroscopy as analytical tools for investigating the drug content in semisolid formulations. Regarding the analytical parameters, this study demonstrates the photothermal beam deflection to be definitely comparable to well established spectroscopic methods for this purpose. The correlation coefficients range from 0.990 to 0.999. Likewise, repeatability and limit of detection are comparable.

  2. Your Way to a Better Theory of Mind: A Healthy Diet Relates to Better Faux Pas Recognition in Older Adults.

    Science.gov (United States)

    Ruffman, Ted; Zhang, Julie; Taumoepeau, Mele; Skeaff, Sheila

    2016-01-01

    Aging is characterized by a well-documented worsening of general cognition, and also a decline in social understanding such as the ability to recognize emotions or detect socially inappropriate behavior (faux pas). Several studies have demonstrated that lifestyle factors (diet, exercise, social integration, smoking) tend to offset general cognitive decline, and we examined whether they also help to offset age-related declines in social cognition. There were 56 participants aged 60 years or over. General cognition was measured using a matrices task and the Mini-Mental State Examination (MMSE). Emotion recognition was measured by the matching of faces to emotion sounds and bodies to sounds. Faux pas recognition was measured by 16 videos, examining participants' ability to differentiate appropriate and inappropriate social behavior. Diet, exercise, social integration, and smoking habits were measured via questionnaires. For general cognition, diet, pr = .32, p smoking, pr = -.32, p = .02, and education, pr = .48, p exercise habits, smoking, and social integration, a healthy diet explained independent variance in the ability to identify appropriate social behavior, pr = .29, p = .04. We replicated previous research in finding that lifestyle factors were related to fluid intelligence. In addition, we obtained the novel finding that a healthy diet is associated with better recognition of faux pas in older adults, likely acting through facilitation of brain health, and providing initial support for a means of enhancing social functioning and well-being in old age.

  3. Mapping potential freshwater services, and their representation within Protected Areas (PAs, under conditions of sparse data. Pilot implementation for Cambodia

    Directory of Open Access Journals (Sweden)

    Leonardo Sáenz

    2016-07-01

    Full Text Available Freshwater is arguably one of Earth’s most threatened natural resources, on which more than 7 billion people depend. Pressures on freshwater resources from infrastructure, resource development, agricultural pollution and deforestation are mounting, particularly in developing countries. To date, conservation responses such as Protected Areas (PAs have not typically targeted freshwater ecosystems and their services, and thus little is known about the effectiveness of these efforts in protecting them. This paper proposes and pilots an innovative freshwater services metrics framework to quantify the representation of potential freshwater services in PAs under conditions of scarce data, with a pilot application for Cambodia. Our results indicate that conservation actions have more effectively represented potential freshwater regulation services than potential freshwater provisioning services, with major rivers remaining generally unprotected. Results from the framework are then used to propose a series of context and region specific management options to improve the conservation of freshwater services in Cambodia. There is an acute need for such management options, as the country’s food security depends largely on important freshwater ecosystems such as the Tonle Sap Lake and the deep water pools systems of the Mekong River. The framework proposed can be applied in other countries or large river basins to explore the degree of representation of freshwater services within PAs systems, under conditions of sparse data.

  4. Combining protein sequence, structure, and dynamics: A novel approach for functional evolution analysis of PAS domain superfamily.

    Science.gov (United States)

    Dong, Zheng; Zhou, Hongyu; Tao, Peng

    2018-02-01

    PAS domains are widespread in archaea, bacteria, and eukaryota, and play important roles in various functions. In this study, we aim to explore functional evolutionary relationship among proteins in the PAS domain superfamily in view of the sequence-structure-dynamics-function relationship. We collected protein sequences and crystal structure data from RCSB Protein Data Bank of the PAS domain superfamily belonging to three biological functions (nucleotide binding, photoreceptor activity, and transferase activity). Protein sequences were aligned and then used to select sequence-conserved residues and build phylogenetic tree. Three-dimensional structure alignment was also applied to obtain structure-conserved residues. The protein dynamics were analyzed using elastic network model (ENM) and validated by molecular dynamics (MD) simulation. The result showed that the proteins with same function could be grouped by sequence similarity, and proteins in different functional groups displayed statistically significant difference in their vibrational patterns. Interestingly, in all three functional groups, conserved amino acid residues identified by sequence and structure conservation analysis generally have a lower fluctuation than other residues. In addition, the fluctuation of conserved residues in each biological function group was strongly correlated with the corresponding biological function. This research suggested a direct connection in which the protein sequences were related to various functions through structural dynamics. This is a new attempt to delineate functional evolution of proteins using the integrated information of sequence, structure, and dynamics. © 2017 The Protein Society.

  5. Low-dose radiation pretreatment improves survival of human ceiling culture-derived proliferative adipocytes (ccdPAs) under hypoxia via HIF-1 alpha and MMP-2 induction

    International Nuclear Information System (INIS)

    Adachi, Naoki; Kubota, Yoshitaka; Kosaka, Kentarou; Akita, Shinsuke; Sasahara, Yoshitarou; Kira, Tomoe; Kuroda, Masayuki; Mitsukawa, Nobuyuki; Bujo, Hideaki; Satoh, Kaneshige

    2015-01-01

    Poor survival is a major problem of adipocyte transplantation. We previously reported that VEGF and MMPs secreted from transplanted adipocytes are essential for angiogenesis and adipogenesis. Pretreatment with low-dose (5 Gy) radiation (LDR) increased VEGF, MMP-2, and HIF-1 alpha mRNA expression in human ceiling culture-derived proliferative adipocytes (hccdPAs). Gene expression after LDR differed between adipose-derived stem cells (hASCs) and hccdPAs. Pretreatment with LDR improved the survival of hccdPAs under hypoxia, which is inevitable in the early stages after transplantation. Upregulation of VEGF and MMP-2 after LDR in hccdPAs is mediated by HIF-1 alpha expression. Our results suggest that pretreatment with LDR may improve adipocyte graft survival in a clinical setting through upregulation of VEGF and MMP-2 via HIF-1 alpha. - Highlights: • Ceiling culture-derived proliferative adipocytes (ccdPAs) react to radiation. • Low-dose radiation (LDR) pretreatment improves survival of ccdPAs under hypoxia. • Gene expression after LDR differs between ccdPAs and adipose-derived stem cells. • LDR-induced increase in MMP-2 and VEGF is dependent on HIF-1 alpha induction. • LDR pretreatment may improve the adipocyte graft survival rate in clinical settings

  6. Low-dose radiation pretreatment improves survival of human ceiling culture-derived proliferative adipocytes (ccdPAs) under hypoxia via HIF-1 alpha and MMP-2 induction

    Energy Technology Data Exchange (ETDEWEB)

    Adachi, Naoki [Department of Plastic Surgery, Chiba University, 1-8-1, Inohana, Chuo-ku, Chiba-city, Chiba, #260-8677 (Japan); Kubota, Yoshitaka, E-mail: kubota-cbu@umin.ac.jp [Department of Plastic Surgery, Chiba University, 1-8-1, Inohana, Chuo-ku, Chiba-city, Chiba, #260-8677 (Japan); Kosaka, Kentarou; Akita, Shinsuke; Sasahara, Yoshitarou; Kira, Tomoe [Department of Plastic Surgery, Chiba University, 1-8-1, Inohana, Chuo-ku, Chiba-city, Chiba, #260-8677 (Japan); Kuroda, Masayuki [Center for Advanced Medicine, Chiba University, 1-8-1, Inohana, Chuo-ku, Chiba-city, Chiba, #260-8677 (Japan); Mitsukawa, Nobuyuki [Department of Plastic Surgery, Chiba University, 1-8-1, Inohana, Chuo-ku, Chiba-city, Chiba, #260-8677 (Japan); Bujo, Hideaki [Department of Clinical-Laboratory and Experimental-Research Medicine, Toho University, Sakura Medical Center, 564-1 Shimoshizu, Sakura-shi, Chiba, #285-8741 (Japan); Satoh, Kaneshige [Department of Plastic Surgery, Chiba University, 1-8-1, Inohana, Chuo-ku, Chiba-city, Chiba, #260-8677 (Japan)

    2015-08-07

    Poor survival is a major problem of adipocyte transplantation. We previously reported that VEGF and MMPs secreted from transplanted adipocytes are essential for angiogenesis and adipogenesis. Pretreatment with low-dose (5 Gy) radiation (LDR) increased VEGF, MMP-2, and HIF-1 alpha mRNA expression in human ceiling culture-derived proliferative adipocytes (hccdPAs). Gene expression after LDR differed between adipose-derived stem cells (hASCs) and hccdPAs. Pretreatment with LDR improved the survival of hccdPAs under hypoxia, which is inevitable in the early stages after transplantation. Upregulation of VEGF and MMP-2 after LDR in hccdPAs is mediated by HIF-1 alpha expression. Our results suggest that pretreatment with LDR may improve adipocyte graft survival in a clinical setting through upregulation of VEGF and MMP-2 via HIF-1 alpha. - Highlights: • Ceiling culture-derived proliferative adipocytes (ccdPAs) react to radiation. • Low-dose radiation (LDR) pretreatment improves survival of ccdPAs under hypoxia. • Gene expression after LDR differs between ccdPAs and adipose-derived stem cells. • LDR-induced increase in MMP-2 and VEGF is dependent on HIF-1 alpha induction. • LDR pretreatment may improve the adipocyte graft survival rate in clinical settings.

  7. Proyecciones Vintage: Mad Men y Cuéntame cómo pasó / Vintage Projections: Mad Men and Cuéntame cómo pasó

    Directory of Open Access Journals (Sweden)

    Laura García Pousa

    2016-09-01

    Full Text Available Las series de televisión han puesto a prueba la capacitación del drama mediante la construcción de un discurso propio y diferenciado, que las convierte en uno de los referentes artísticos contemporáneos de mayor expansión. En este artículo acudimos a su estudio específico como nuevos artefactos culturales que trabajan con múltiples realidades y niveles narrativos creando ficciones capaces de aglutinar éxito comercial y nuevas parcelas audiovisuales que generan reflexiones sobre la representación de la memoria histórica. Aunque distantes en su concepción, desarrollo, producción y tratamiento, nos centramos en Mad Men (AMC: 2007- y en Cuéntame cómo pasó (Grupo Ganga: 2001- por su importante trabajo de contextualización dramática donde la cultura popular, la visión mediatizada y los mitos se convierten en constantes de sus narraciones. El estudio comparativo de dos nudos dramáticos como son el asesinato de John F. Kennedy en Mad Men y el atentado contra Carrero Blanco en Cuéntame cómo pasó nos permitirá iniciar y profundizar en las formas argumentales, discursivas y estéticas de ambas producciones dentro de su desarrollo en continuidad como obras de ficción de largo recorrido.Palabras clave: series de televisión, ficción, memoria, historia, representación, Mad Men, Cuéntame cómo pasó, cultura popular, identidad.AbstractTelevision series have challenged the drama by constructing a personal and differentiated discourse, turning it into one of the contemporary artistic genres experiencing the greatest expansion at the moment. In this article, we’ve undertaken the study of such series as new cultural artifacts that work with multiple realities and narrative levels, creating fictions that garner commercial success, and new audiovisual parcels that generate reflections on the representations of historical memory. Although distinct in their conception, development, production and material, we will focus on the series Mad

  8. Comparative analysis of Gram’s method and PAS for the identification of Candida spp. samples from the oral mucosa

    Directory of Open Access Journals (Sweden)

    Cátia Martins Leite Padilha

    2014-10-01

    Full Text Available Introduction: Candida species are part of the normal microbiota of healthy subjects, living as commensals. However, they can become pathogenic when changes in the mechanisms of host defense or disruption of anatomic barriers occur. Candidiasis is the most common fungal infection in the oral cavity, mainly caused by Candida albicans. The diagnosis is based on symptoms and clinical aspects, in association with laboratory methods. Objective: To evaluate the sensitivity and specificity of Gram’s method for Candida spp. identification in scrapes from the buccal mucosa and evaluate the degree of concordance between clinical and cytological methods in the diagnosis of oral candidiasis. Material and methods: A blind study was performed in 170 smears from patients of Hospital Universitário Antônio Pedro of Universidade Federal Fluminense (HUAP/UFF, stained by Gram (n = 57, periodic acid-Schiff (PAS (n = 57 and Papanicolaou (Pap (n = 57 methods. Results: The comparative analysis of the methods demonstrated a higher prevalence of Candida spp. (12% in PAS than in Gram staining, without statistic significance. The cytology method was positive in 93% of the clinical diagnosis of candidiasis. Conclusion: Gram was an adequate method; however more intensive professional training would be necessary to identify the fungus morphological structures. Although Pap test is the most common method of routine cytopathologic examination, for candidiasis diagnosis PAS staining is also recommended. Thus, it is suggested that candidiasis diagnosis should be accomplished by clinical evaluation in association with cytopathological analysis based on the identification of hyphae and/or pseudohyphae.

  9. The PAS domains of the major sporulation kinase in Bacillus subtilis play a role in tetramer formation that is essential for the autokinase activity.

    Science.gov (United States)

    Kiehler, Brittany; Haggett, Lindsey; Fujita, Masaya

    2017-08-01

    Sporulation in Bacillus subtilis is induced upon starvation. In a widely accepted model, an N-terminal "sensor" domain of the major sporulation kinase KinA recognizes a hypothetical starvation signal(s) and autophosphorylates a histidine residue to activate the master regulator Spo0A via a multicomponent phosphorelay. However, to date no confirmed signal has been found. Here, we demonstrated that PAS-A, the most N-terminal of the three PAS domains (PAS-ABC), is dispensable for the activity, contrary to a previous report. Our data indicated that the autokinase activity is dependent on the formation of a functional tetramer, which is mediated by, at least, PAS-B and PAS-C. Additionally, we ruled out the previously proposed notion that NAD + /NADH ratio controls KinA activity through the PAS-A domain by demonstrating that the cofactors show no effects on the kinase activity in vitro. In support of these data, we found that the cofactors exist in approximately 1000-fold excess of KinA in the cell and the cofactors' ratio does not change significantly during growth and sporulation, suggesting that changes in the cofactor ratio might not play a role in controlling KinA activity. These data may refute the widely-held belief that the activity of KinA is regulated in response to an unknown starvation signal(s). © 2017 The Authors. MicrobiologyOpen published by John Wiley & Sons Ltd.

  10. The presence of glutamate residues on the PAS sequence of the stimuli-sensitive nano-ferritin improves in vivo biodistribution and mitoxantrone encapsulation homogeneity.

    Science.gov (United States)

    Falvo, Elisabetta; Malagrinò, Francesca; Arcovito, Alessandro; Fazi, Francesco; Colotti, Gianni; Tremante, Elisa; Di Micco, Patrizio; Braca, Aldo; Opri, Roberta; Giuffrè, Alessandro; Fracasso, Giulio; Ceci, Pierpaolo

    2018-04-10

    A genetically engineered human ferritin heavy chain (HFt)-based construct has been recently shown by our group to efficiently entrap and deliver doxorubicin to cancer cells. This construct, named HFt-MP-PAS, contained a tumor-selective sequence (MP) responsive to proteolytic cleavage by tumor proteases (MMPs), located between each HFt subunit and an outer shielding polypeptide sequence rich in proline (P), serine (S) and alanine (A) residues (PAS). HFt-MP-PAS displayed excellent therapeutic efficacy in xenogenic pancreatic and head and neck cancer models in vivo, leading to a significant increase in overall animal survivals. Here we report a new construct obtained by the genetic insertion of two glutamate residues in the PAS sequence of HFt-MP-PAS. Such new construct, named HFt-MP-PASE, is characterized by improved performances as drug biodistribution in a xenogenic pancreatic cancer model in vivo. Moreover, HFt-MP-PASE efficiently encapsulates the anti-cancer drug mitoxantrone (MIT), and the resulting MIT-loaded nanoparticles proved to be more soluble and monodispersed than the HFt-MP-PAS counterparts. Importantly, in vitro MIT-loaded HFt-MP-PASE kills several cancer cell lines of different origin (colon, breast, sarcoma and pancreas) at least as efficiently as the free drug. Finally, our MIT loaded protein nanocages allowed in vivo an impressive incrementing of the drug accumulation in the tumor with respect to the free drug. Copyright © 2018 Elsevier B.V. All rights reserved.

  11. The Cova des Pas de Vallgornera (Llucmajor, Mallorca: a singular deposit bearing an exceptional well preserved Early Pleistocene vertebrate fauna

    Directory of Open Access Journals (Sweden)

    Pere Bover

    2014-05-01

    Full Text Available The Cova des Pas de Vallgornera is the longest cave of Mallorca (Balearic Islands, Western Mediterranean and one of the 30 longest caves in the world. The exploration of one of the galleries allowed the discovery of a fossiliferous deposit of vertebrate remains in a remarkable preservation state. The fossil faunal complex found in this gallery is composed of up to 5 mammalian species (Myotragus aff. kopperi, Hypnomys onicensis, Nesiotites aff. ponsi, Rhinolophus aff. mehelyi and Pipistrellus sp., at least 14 bird species (among them two Mallorcan endemic taxa: Pica mourerae and Athene vallgornerensis, one reptile (Podarcis aff. lilfordi and one amphibian (Discoglossus sp.. This faunal composition is similar to the one recorded in the Pedrera de s’Ònix, a well known deposit from the Early Pleistocene of Mallorca, and shared morphological characteristics between taxa of both deposits suggest that the chronology of the Cova des Pas de Vallgornera should be considered Early Pleistocene as well. Both taxonomical analysis and chronology of this fauna furnished information on some speleological aspects of the cave.

  12. Taking energy efficiency to a new scale: the climate change action plan in Nord-Pas de Calais region

    International Nuclear Information System (INIS)

    Lafolie, Bertrand; Tillerson, Kenya

    2005-01-01

    Through the experience of a new climate change action plan in the French region 'Nord-Pas de Calais', the paper highlights the urgent necessity as well as the inherent difficulties for energy efficiency strategies to penetrate everyday practices and policies in order to reduce emissions in line with national and international commitments. Nord-Pas de Calais takes pride in two decades of sustained promotion of energy efficiency and renewable energy. Nevertheless, observation shows that regional consumption grows at roughly the same rate as does national consumption. The paper will present the history of energy efficiency in the region and relate the steps in elaborating a new climate change action plan that moves away from a focus on innovative projects towards the integration of easily replicable practices in business as usual. It then discusses some of the practical roadblocks that are faced in attempting to change the scale of achievements. Surprisingly, the main barrier met with until now seems not to be lack of interest and motivation towards energy efficiency from the general public but the way energy efficiency practitioners traditionally work and think eceee '005 Panel 2

  13. Ácaros (Arahcnida: Acari asociados a escarabajos pasálidos (Coleóptera: Passalidae de Colombia

    Directory of Open Access Journals (Sweden)

    José Orlando Combita Heredia

    2006-01-01

    Full Text Available Se determinaron taxonómicamente a nivel de familia y en algunos casos a género, los ácaros asociados a escarabajos de la familia Passalidae de Colombia. Se hallaron 23  morfoespecies de ácaros, se identificaron ocho géneros correspondientes a 11 familias, la gran mayoría pertenecen al suborden Mesostigmata, cohorte Monogynaspida; la familia Uropodidae fue la más predominante. El género Heterocheylus se encontró asociado exclusivamente al género Passalus. Todos los individuos revisados en este trabajo presentaron evidencias de una asociación forética con los pasálidos. Fueron detectadas para algunas morfoespecies y géneros una distribución específica sobre el cuerpo del escarabajo y una repartición de los microhábitats en las superficies de adhesión del pasálido. Se hace el primer registro para Colombia de las familias Diplogynidae y Anoetidae, se proporciona una clave ilustrada para familias de América con algunos comentarios sobre las familias presentes en Colombia y se aporta una colección de referencia.

  14. Hardware Interface Description for the Integrated Power, Avionics, and Software (iPAS) Space Telecommunications Radio Ssystem (STRS) Radio

    Science.gov (United States)

    Shalkhauser, Mary Jo W.; Roche, Rigoberto

    2017-01-01

    The Space Telecommunications Radio System (STRS) provides a common, consistent framework for software defined radios (SDRs) to abstract the application software from the radio platform hardware. The STRS standard aims to reduce the cost and risk of using complex, configurable and reprogrammable radio systems across NASA missions. To promote the use of the STRS architecture for future NASA advanced exploration missions, NASA Glenn Research Center (GRC) developed an STRS-compliant SDR on a radio platform used by the Advance Exploration System program at the Johnson Space Center (JSC) in their Integrated Power, Avionics, and Software (iPAS) laboratory. The iPAS STRS Radio was implemented on the Reconfigurable, Intelligently-Adaptive Communication System (RIACS) platform, currently being used for radio development at JSC. The platform consists of a Xilinx ML605 Virtex-6 FPGA board, an Analog Devices FMCOMMS1-EBZ RF transceiver board, and an Embedded PC (Axiomtek eBox 620-110-FL) running the Ubuntu 12.4 operating system. Figure 1 shows the RIACS platform hardware. The result of this development is a very low cost STRS compliant platform that can be used for waveform developments for multiple applications.The purpose of this document is to describe how to develop a new waveform using the RIACS platform and the Very High Speed Integrated Circuits (VHSIC) Hardware Description Language (VHDL) FPGA wrapper code and the STRS implementation on the Axiomtek processor.

  15. Waveform Developer's Guide for the Integrated Power, Avionics, and Software (iPAS) Space Telecommunications Radio System (STRS) Radio

    Science.gov (United States)

    Shalkhauser, Mary Jo W.; Roche, Rigoberto

    2017-01-01

    The Space Telecommunications Radio System (STRS) provides a common, consistent framework for software defined radios (SDRs) to abstract the application software from the radio platform hardware. The STRS standard aims to reduce the cost and risk of using complex, configurable and reprogrammable radio systems across NASA missions. To promote the use of the STRS architecture for future NASA advanced exploration missions, NASA Glenn Research Center (GRC) developed an STRS-compliant SDR on a radio platform used by the Advance Exploration System program at the Johnson Space Center (JSC) in their Integrated Power, Avionics, and Software (iPAS) laboratory. The iPAS STRS Radio was implemented on the Reconfigurable, Intelligently-Adaptive Communication System (RIACS) platform, currently being used for radio development at JSC. The platform consists of a Xilinx(Trademark) ML605 Virtex(Trademark)-6 FPGA board, an Analog Devices FMCOMMS1-EBZ RF transceiver board, and an Embedded PC (Axiomtek(Trademark) eBox 620-110-FL) running the Ubuntu 12.4 operating system. The result of this development is a very low cost STRS compliant platform that can be used for waveform developments for multiple applications. The purpose of this document is to describe how to develop a new waveform using the RIACS platform and the Very High Speed Integrated Circuits (VHSIC) Hardware Description Language (VHDL) FPGA wrapper code and the STRS implementation on the Axiomtek processor.

  16. Living better in Nord-Pas de Calais region. For an energy turn and societal transformations - Full report, Synthesis

    International Nuclear Information System (INIS)

    2015-12-01

    In 2008, the NGO Virage-energie Nord-Pas de Calais published a scenario of nuclear power phaseout including objectives of reduction of green gas emissions in the region of Nord-Pas de Calais. In 2013, Virage-energie Nord-Pas de Calais published Scenarios on energy sufficiency and societal transformations: the results of a research project on the evaluation of energy savings potentials from public policies and lifestyle changes. Using data models and assumptions, this study has highlighted that energy sufficiency could generate energy savings from 26 % to 40 %. Global scenarios presented in this report, realised with the financial support of ADEME and regional council of the region Nord-Pas de Calais in partnership with two academic laboratories (TVES, University of Lille 1 - Science and Technologies; and Ceraps, University of Lille 2 - Health and Law), complete previous works with a global vision for the future energetic and social systems. Scenarios explore interactions between energy, lifestyles, agriculture, food habits, consumer goods, industry, buildings, transport and employment, in order to identify and to reduce human, social, economic and environmental vulnerabilities to energetic crisis. Energy sufficiency and resilience are at the heart of this research. Energy sufficiency is a voluntary and organized strategy to reduce energy consumption through lifestyles changes and societal transformations. Energy sufficiency is different from energy efficiency, which concerns only improvement of technical performances in order to reduce energy consumption of a system (building, vehicle, etc.). Sufficiency re-evaluates uses and needs of energy, but also imaginary and culture of a society and its individual and collective organisations. Resilience is the capacity for a system (territory, population, etc.) to absorb a perturbation, to reorganize itself and to continue to remain in a functionally similar state. Through three possible scenarios for the territory and the

  17. A comprehensive protein-protein interactome for yeast PAS kinase 1 reveals direct inhibition of respiration through the phosphorylation of Cbf1.

    Science.gov (United States)

    DeMille, Desiree; Bikman, Benjamin T; Mathis, Andrew D; Prince, John T; Mackay, Jordan T; Sowa, Steven W; Hall, Tacie D; Grose, Julianne H

    2014-07-15

    Per-Arnt-Sim (PAS) kinase is a sensory protein kinase required for glucose homeostasis in yeast, mice, and humans, yet little is known about the molecular mechanisms of its function. Using both yeast two-hybrid and copurification approaches, we identified the protein-protein interactome for yeast PAS kinase 1 (Psk1), revealing 93 novel putative protein binding partners. Several of the Psk1 binding partners expand the role of PAS kinase in glucose homeostasis, including new pathways involved in mitochondrial metabolism. In addition, the interactome suggests novel roles for PAS kinase in cell growth (gene/protein expression, replication/cell division, and protein modification and degradation), vacuole function, and stress tolerance. In vitro kinase studies using a subset of 25 of these binding partners identified Mot3, Zds1, Utr1, and Cbf1 as substrates. Further evidence is provided for the in vivo phosphorylation of Cbf1 at T211/T212 and for the subsequent inhibition of respiration. This respiratory role of PAS kinase is consistent with the reported hypermetabolism of PAS kinase-deficient mice, identifying a possible molecular mechanism and solidifying the evolutionary importance of PAS kinase in the regulation of glucose homeostasis. © 2014 DeMille et al. This article is distributed by The American Society for Cell Biology under license from the author(s). Two months after publication it is available to the public under an Attribution–Noncommercial–Share Alike 3.0 Unported Creative Commons License (http://creativecommons.org/licenses/by-nc-sa/3.0).

  18. Pas de Vallgornera Cave, Majorca (Spain): one the largest littoral caves in Europe; La cueva des Pas de Vallgornera, Mallorca (Espana): unas de las cuevas litorales mas grandes de Europa

    Energy Technology Data Exchange (ETDEWEB)

    Lopez, B.; Mulet, T.; Rodriguez-Homar, M.; Merino, A.

    2016-07-01

    The Pas de Vallgornera cave is the longest cave in the Balearic Islands and one of the largest in Europe (more than 73 km long). It is found on the Miocene reef of Llucmajor Platform and its genesis is related to the development of normal faults and associated fracture systems with N 180° S and N 60° E orientation that took place during the Neogene. It is noteworthy for the abundance, variety and beauty of the speleothems, paleontological richness and to present evidence of hypogene basal recharge. Due to its singularity, it has served as the basis of several scientific studies on groundwater level fluctuations during the quaternary period and others related to the existence of one of most important paleontological sites in Mallorca as far as vertebrates are concerned. (Author)

  19. L’église Notre-Dame de Rocquigny (Pas-de-Calais : restauration, reconstruction ou abandon ?

    Directory of Open Access Journals (Sweden)

    Jacques Philippon

    2009-11-01

    Full Text Available IntroductionLe village de Rocquigny (274 habitants est situé au sud du département du Pas-de-Calais (canton de Bapaume, à proximité immédiate d’une des importantes lignes de front de la Grande Guerre : la ligne Hindenburg. Ce qui explique que la quasi-totalité des villages de ce territoire ont été totalement détruits notamment lors des grandes offensives de 1917.C’est ainsi que le village s’est retrouvé au cœur du vaste dispositif de la Reconstruction mis en œuvre dans les années 1920 par l...

  20. Exhibition of the winning pictures from CERN Photowalk 2015 | 4 - 14 April | “Pas Perdus” area

    CERN Multimedia

    2016-01-01

    Twenty photos entered into the “CERN Photowalk 2015: Behind the scenes at the Laboratory” competition will be on display in the “Pas Perdus” area (Buildings 500 and 61) from 4 to 14 April.    The ISOLDE installation as seen by Andrew Hara, one of the photographers who took part in the CERN Photowalk 2015 competition. In September 2015, 19 photographers from all over the world visited CERN, cameras at the ready, to find out what goes on behind the scenes at the Laboratory. They had the opportunity to take photographs of daily life on the CERN site and of facilities including the Linac 4 linear accelerator, the main workshop and ISOLDE. A jury selected the best photos taken at CERN and the top three were entered into the world's biggest physics photography competition, the Global Physics Photowalk, in which eight laboratories participated. The winners of the Global Physics Photowalk can be seen here.

  1. Measurements of Cs 137 and Cs 134 internal contamination during 1987 by the Bologna Enea PAS whole body counter

    International Nuclear Information System (INIS)

    Melandri, C.; Castellani, C.M.; Torroni, G.; Formignani, M.

    1988-01-01

    Internal contamination data obtained during 1987 at the ENEA PAS-FIBI- AEROSOL Laboratory in Bologna, following the accident at the nuclear reactor in Chernobyl, are presented. The data are referred to person living in the Bologna area, in other Italian regions and to individuals returned from abroad, mainly from Eastern Europe countries. Trend of Cs-137 and Cs-134 internal body burden in adult men resident in Bologna are given together with values of mean daily intake by ingestion and evaluation of the commited dose equivalents up to decembre 1987. Measurement campaigns, specifically projected in order to evaluate the men/women activity differences and the distribution of the internal contamination in various Italian regions, have been performed

  2. Viveret Patrick, 2005, Pourquoi ça ne va pas plus mal?, Fayard, 264 p.

    Directory of Open Access Journals (Sweden)

    Fabien Thurette

    2008-05-01

    Full Text Available Patrick Viveret est philosophe de formation et Conseiller-maître à la Cour des comptes. Il a, en outre, été chargé d’une mission, confiée par l'éphémère Secrétaire d'État à l'économie solidaire Guy Hascoët, puis prolongée par le Président Chirac sur une « autre approche de la richesse », dont le rapport final a été publié sous le titre Reconsidérer la richesse (2004.Dans son essai Pourquoi ça ne va pas plus mal ? publié en 2005, Patrick Viveret nous livre une analyse philosophique sur le « m...

  3. H2O2 production rate in Lactobacillus johnsonii is modulated via the interplay of a heterodimeric flavin oxidoreductase with a soluble 28 Kd PAS domain containing protein.

    Science.gov (United States)

    Valladares, Ricardo B; Graves, Christina; Wright, Kaitlyn; Gardner, Christopher L; Lorca, Graciela L; Gonzalez, Claudio F

    2015-01-01

    Host and commensals crosstalk, mediated by reactive oxygen species (ROS), has triggered a growing scientific interest to understand the mechanisms governing such interaction. However, the majority of the scientific studies published do not evaluate the ROS production by commensals bacteria. In this context we recently showed that Lactobacillus johnsonii N6.2, a strain of probiotic value, modulates the activity of the critical enzymes 2,3-indoleamine dioxygenase via H2O2 production. L. johnsonii N6.2 by decreasing IDO activity, is able to modify the tryptophan/kynurenine ratio in the host blood with further systemic consequences. Understanding the mechanisms of H2O2 production is critical to predict the probiotic value of these strains and to optimize bacterial biomass production in industrial processes. We performed a transcriptome analysis to identify genes differentially expressed in L. johnsonii N6.2 cells collected from cultures grown under different aeration conditions. Herein we described the biochemical characteristics of a heterodimeric FMN reductase (FRedA/B) whose in vitro activity is controlled by LjPAS protein with a typical Per-Arnst-Sim (PAS) sensor domain. Interestingly, LjPAS is fused to the FMN reductase domains in other lactobacillaceae. In L. johnsonii, LjPAS is encoded by an independent gene which expression is repressed under anaerobic conditions (>3 fold). Purified LjPAS was able to slow down the FRedA/B initial activity rate when the holoenzyme precursors (FredA, FredB, and FMN) were mixed in vitro. Altogether the results obtained suggest that LjPAS module regulates the H2O2 production helping the cells to minimize oxidative stress in response to environmental conditions.

  4. H2O2 production rate in Lactobacillus johnsonii is modulated via the interplay of a heterodimeric flavin oxidoreductase with a soluble 28 Kd PAS domain containing protein.

    Directory of Open Access Journals (Sweden)

    Ricardo B Valladares

    2015-07-01

    Full Text Available Host and commensals crosstalk, mediated by reactive oxygen species (ROS, has triggered a growing scientific interest to understand the mechanisms governing such interaction. However, the majority of the scientific studies published do not evaluate the ROS production by commensals bacteria. In this context we recently showed that Lactobacillus johnsonii N6.2, a strain of probiotic value, modulates the activity of the critical enzymes 2,3-indoleamine dioxygenase via H2O2 production. L. johnsonii N6.2 by decreasing IDO activity, is able to modify the tryptophan/kynurenine ratio in the host blood with further systemic consequences. Understanding the mechanisms of H2O2 production is critical to predict the probiotic value of these strains and to optimize bacterial biomass production in industrial processes. We performed a transcriptome analysis to identify genes differentially expressed in L. johnsonii N6.2 cells collected from cultures grown under different aeration conditions. Herein we described the biochemical characteristics of a heterodimeric FMN reductase (FRedA/B whose in vitro activity is controlled by LjPAS protein with a typical Per-Arnst-Sim (PAS sensor domain. Interestingly, LjPAS is fused to the FMN reductase domains in other lactobacillaceae. In L. johnsonii, LjPAS is encoded by an independent gene which expression is repressed under anaerobic conditions (>3 fold. Purified LjPAS was able to slow down the FRedA/B initial activity rate when the holoenzyme precursors (FredA, FredB and FMN were mixed in vitro. Altogether the results obtained suggest that LjPAS module regulates the H2O2 production helping the cells to minimize oxidative stress in response to environmental conditions.

  5. Deciphering Dimerization Modes of PAS Domains: Computational and Experimental Analyses of the AhR:ARNT Complex Reveal New Insights Into the Mechanisms of AhR Transformation.

    Science.gov (United States)

    Corrada, Dario; Soshilov, Anatoly A; Denison, Michael S; Bonati, Laura

    2016-06-01

    The Aryl hydrocarbon Receptor (AhR) is a transcription factor that mediates the biochemical response to xenobiotics and the toxic effects of a number of environmental contaminants, including dioxins. Recently, endogenous regulatory roles for the AhR in normal physiology and development have also been reported, thus extending the interest in understanding its molecular mechanisms of activation. Since dimerization with the AhR Nuclear Translocator (ARNT) protein, occurring through the Helix-Loop-Helix (HLH) and PER-ARNT-SIM (PAS) domains, is needed to convert the AhR into its transcriptionally active form, deciphering the AhR:ARNT dimerization mode would provide insights into the mechanisms of AhR transformation. Here we present homology models of the murine AhR:ARNT PAS domain dimer developed using recently available X-ray structures of other bHLH-PAS protein dimers. Due to the different reciprocal orientation and interaction surfaces in the different template dimers, two alternative models were developed for both the PAS-A and PAS-B dimers and they were characterized by combining a number of computational evaluations. Both well-established hot spot prediction methods and new approaches to analyze individual residue and residue-pairwise contributions to the MM-GBSA binding free energies were adopted to predict residues critical for dimer stabilization. On this basis, a mutagenesis strategy for both the murine AhR and ARNT proteins was designed and ligand-dependent DNA binding ability of the AhR:ARNT heterodimer mutants was evaluated. While functional analysis disfavored the HIF2α:ARNT heterodimer-based PAS-B model, most mutants derived from the CLOCK:BMAL1-based AhR:ARNT dimer models of both the PAS-A and the PAS-B dramatically decreased the levels of DNA binding, suggesting this latter model as the most suitable for describing AhR:ARNT dimerization. These novel results open new research directions focused at elucidating basic molecular mechanisms underlying the

  6. Deciphering Dimerization Modes of PAS Domains: Computational and Experimental Analyses of the AhR:ARNT Complex Reveal New Insights Into the Mechanisms of AhR Transformation.

    Directory of Open Access Journals (Sweden)

    Dario Corrada

    2016-06-01

    Full Text Available The Aryl hydrocarbon Receptor (AhR is a transcription factor that mediates the biochemical response to xenobiotics and the toxic effects of a number of environmental contaminants, including dioxins. Recently, endogenous regulatory roles for the AhR in normal physiology and development have also been reported, thus extending the interest in understanding its molecular mechanisms of activation. Since dimerization with the AhR Nuclear Translocator (ARNT protein, occurring through the Helix-Loop-Helix (HLH and PER-ARNT-SIM (PAS domains, is needed to convert the AhR into its transcriptionally active form, deciphering the AhR:ARNT dimerization mode would provide insights into the mechanisms of AhR transformation. Here we present homology models of the murine AhR:ARNT PAS domain dimer developed using recently available X-ray structures of other bHLH-PAS protein dimers. Due to the different reciprocal orientation and interaction surfaces in the different template dimers, two alternative models were developed for both the PAS-A and PAS-B dimers and they were characterized by combining a number of computational evaluations. Both well-established hot spot prediction methods and new approaches to analyze individual residue and residue-pairwise contributions to the MM-GBSA binding free energies were adopted to predict residues critical for dimer stabilization. On this basis, a mutagenesis strategy for both the murine AhR and ARNT proteins was designed and ligand-dependent DNA binding ability of the AhR:ARNT heterodimer mutants was evaluated. While functional analysis disfavored the HIF2α:ARNT heterodimer-based PAS-B model, most mutants derived from the CLOCK:BMAL1-based AhR:ARNT dimer models of both the PAS-A and the PAS-B dramatically decreased the levels of DNA binding, suggesting this latter model as the most suitable for describing AhR:ARNT dimerization. These novel results open new research directions focused at elucidating basic molecular mechanisms

  7. A lecithin phosphatidylserine and phosphatidic acid complex (PAS) reduces symptoms of the premenstrual syndrome (PMS): Results of a randomized, placebo-controlled, double-blind clinical trial.

    Science.gov (United States)

    Schmidt, Katja; Weber, Nicole; Steiner, Meir; Meyer, Nadin; Dubberke, Anne; Rutenberg, David; Hellhammer, Juliane

    2018-04-01

    Many women experience emotional and physical symptoms around the time of ovulation and more so before menstruation interfering with their daily normal life also known as premenstrual syndrome (PMS). Recent observational data suggest that supplementation with Lipogen's phosphatidylserine (PS) and phosphatidic acid (PA) complex (PAS) alleviates these PMS symptoms. The aim of this study was to confirm these observations on the effects of PAS on PMS symptom severity within a controlled clinical trial setting. Forty women aged 18-45 years with a diagnosis of PMS were assigned to either take PAS (containing 400 mg PS & 400 mg PA per day) or a matching placebo. The study comprised 5 on-site visits including 1 baseline menstrual cycle followed by 3 treatment cycles. Treatment intake was controlled for by using an electronic device, the Medication Event Monitoring System (MEMS ® ). Primary outcome of the study was the PMS symptoms severity as assessed by using the Daily Record of Severity of Problems (DRSP). Further, SIPS questionnaire (a German version of the Premenstrual Symptoms Screening Tool (PSST)), salivary hormone levels (cortisol awakening response (CAR) and evening cortisol levels) as well as serum levels (cortisol, estradiol, progesterone and corticosteroid binding globulin (CBG)) were assessed. PMS symptoms as assessed by the DRSP Total score showed a significantly better improvement (p = 0.001) over a 3 cycles PAS intake as compared to placebo. In addition, PAS treated women reported a greater improvement in physical (p = 0.002) and depressive symptoms (p = 0.068). They also reported a lower reduction of productivity (p = 0.052) and a stronger decrease in interference with relationships with others (p = 0.099) compared to the placebo group. No other DRSP scale or item showed significant results. Likewise, the reduction in the number of subjects fulfilling PMS or premenstrual dysphoric disorder (PMDD) criteria as classified by the SIPS did not

  8. Extinction, seeing and sky transparency monitoring at the Observatorio Astrofísico de Javalambre for J-PAS and J-PLUS calibration and scheduling

    Science.gov (United States)

    Vázquez Ramió, H.; Díaz-Martín, M. C.; Varela, J.; Ederoclite, A.; Maícas, N. Lamadrid, J. L.; Abril, J.; Iglesias-Marzoa, R.; Rodríguez, S.; Tilve, V.; Cenarro, A. J.; Antón Bravo, J. L.; Bello Ferrer, R.; Cristóbal-Hornillos, D.; Guillén Civera, L.; Hernández-Fuertes, J.; Jiménez Mejías, D.; Lasso-Cabrera, N. M.; López Alegre, G.; López Sainz, A.; Luis-Simoes, R. M.; Marín-Franch, A.; Moles, M.; Rueda-Teruel, F.; Rueda-Teruel, S.; Suárez López, O.; Yanes-Díaz, A.

    2015-05-01

    The Javalambre-Physics of the Accelerating Universe Astrophysical Survey (J-PAS; see Benítez et al. 2014) and the Javalambre-Photometric Local Universe Survey (J-PLUS) will be conducted at the brand-new Observatorio Astrofísico de Javalambre (OAJ) in Teruel, Spain. J-PLUS is planned to start by the first half of 2015 while J-PAS first light is expected to happen along 2015. Besides the two main telescopes (with 2.5 m and 80 cm apertures), several smaller-sized facilities are present at the OAJ devoted to site characterization and supporting measurements to be used to calibrate the J-PAS and J-PLUS photometry and to feed up the OAJ's Sequencer with the integrated seeing and the sky transparency. These instruments are: i) an extinction monitor, an 11 " telescope estimating the atmospheric extinction to finally obtain the OAJ extinction curve, which is the initial step to J-PAS overall photometric calibration procedure; ii) an 8 " telescope implementing the Differential Image Motion Monitor (DIMM) technique to obtain the integrated seeing; and iii) an All-Sky Transmission MONitor (ASTMON), a roughly all-sky instrument providing the sky transparency as well as sky brightness and the atmospheric extinction too.

  9. Crystal structures of the F and pSLT plasmid TraJ N-terminal regions reveal similar homodimeric PAS folds with functional interchangeability

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Jun; Wu, Ruiying; Adkins, Joshua N.; Joachimiak, Andrzej; Glover, Mark

    2014-09-16

    In the F-family of conjugative plasmids, TraJ is an essential transcriptional activator of the tra operon that encodes most of the proteins required for conjugation. Here we report for the first time the X-ray crystal structures of the TraJ N-terminal regions from the prototypic F plasmid (TraJF11-130) and from the Salmonella virulence plasmid pSLT (TraJpSLT 1-128). Both proteins form similar homodimeric Per-ARNT-Sim (PAS) fold structures. Mutational analysis reveals that the observed dimeric interface is critical for TraJF transcriptional activation, indicating that dimerization of TraJ is required for its in vivo function. An artificial ligand (oxidized dithiothreitol) occupies a cavity in the TraJF dimer interface, while a smaller cavity in corresponding region of the TraJpSLT structure lacks a ligand. Gas chromatography/mass spectrometry-electron ionization analysis of dithiothreitol-free TraJF suggests indole may be the natural TraJ ligand; however, disruption of the indole biosynthetic pathway does not affect TraJF function. Heterologous PAS domains from pSLT and R100 TraJ can functionally replace the TraJF PAS domain, suggesting that TraJ allelic specificity is mediated by the region C-terminal to the PAS domain.

  10. Differential effects of baseline drinking status : Effects of an alcohol prevention program targeting students and/or parents (PAS) among weekly drinking students

    NARCIS (Netherlands)

    Koning, Ina M.; Lugtig, Peter; Vollebergh, Wilma A M

    2014-01-01

    The effects of an intervention designed to prevent onset of weekly drinking in non drinking students (PAS) were investigated in the group of students that was already drinking at baseline. A cluster randomized trial was used including 3,490 Dutch early adolescents (M age. =. 12.66, SD=. 0.49)

  11. Psychometric Evaluation of a Dutch Version of the Mini PAS-ADD for Assessing Psychiatric Disorders in Adults with Different Levels of Intellectual Disability

    Science.gov (United States)

    Janssen, R.; Maes, B.

    2013-01-01

    Background: People with intellectual disabilities (ID) have an increased vulnerability to develop psychiatric problems. Moreover, the early recognition and the accurate diagnosis of psychiatric disorders in the population of persons with ID are challenging. Method: A Dutch version of the Mini PAS-ADD, which is a screening instrument for…

  12. Development and validation of the Psychological Adaptation Scale (PAS): use in six studies of adaptation to a health condition or risk.

    Science.gov (United States)

    Biesecker, Barbara B; Erby, Lori H; Woolford, Samuel; Adcock, Jessica Young; Cohen, Julie S; Lamb, Amanda; Lewis, Katie V; Truitt, Megan; Turriff, Amy; Reeve, Bryce B

    2013-11-01

    We introduce The Psychological Adaptation Scale (PAS) for assessing adaptation to a chronic condition or risk and present validity data from six studies of genetic conditions. Informed by theory, we identified four domains of adaptation: effective coping, self-esteem, social integration, and spiritual/existential meaning. Items were selected from the PROMIS "positive illness impact" item bank and adapted from the Rosenberg self-esteem scale to create a 20-item scale. Each domain included five items, with four sub-scale scores. Data from studies of six populations: adults affected with or at risk for genetic conditions (N=3) and caregivers of children with genetic conditions (N=3) were analyzed using confirmatory factor analyses (CFA). CFA suggested that all but five posited items converge on the domains as designed. Invariance of the PAS amongst the studies further suggested it is a valid and reliable tool to facilitate comparisons of adaptation across conditions. Use of the PAS will standardize assessments of adaptation and foster understanding of the relationships among related health outcomes, such as quality of life and psychological well-being. Clinical interventions can be designed based on PAS data to enhance dimensions of psychological adaptation to a chronic health condition or risk. Published by Elsevier Ireland Ltd.

  13. An Investigation of Interrater Reliability for the Rorschach Performance Assessment System (R-PAS) in a Nonpatient U.S. Sample.

    Science.gov (United States)

    Kivisalu, Trisha M; Lewey, Jennifer H; Shaffer, Thomas W; Canfield, Merle L

    2016-01-01

    The Rorschach Performance Assessment System (R-PAS) aims to provide an evidence-based approach to administration, coding, and interpretation of the Rorschach Inkblot Method (RIM). R-PAS analyzes individualized communications given by respondents to each card to code a wide pool of possible variables. Due to the large number of possible codes that can be assigned to these responses, it is important to consider the concordance rates among different assessors. This study investigated interrater reliability for R-PAS protocols. Data were analyzed from a nonpatient convenience sample of 50 participants who were recruited through networking, local marketing, and advertising efforts from January 2013 through October 2014. Blind recoding was used and discrepancies between the initial and blind coders' ratings were analyzed for each variable with SPSS yielding percent agreement and intraclass correlation values. Data for Location, Space, Contents, Synthesis, Vague, Pairs, Form Quality, Populars, Determinants, and Cognitive and Thematic codes are presented. Rates of agreement for 1,168 responses were higher for more simplistic coding (e.g., Location), whereas agreement was lower for more complex codes (e.g., Cognitive and Thematic codes). Overall, concordance rates achieved good to excellent agreement. Results suggest R-PAS is an effective method with high interrater reliability supporting its empirical basis.

  14. Functional immunoglobulin E cross-reactivity between Pas n 1 of Bahia grass pollen and other group 1 grass pollen allergens.

    Science.gov (United States)

    Davies, J M; Dang, T D; Voskamp, A; Drew, A C; Biondo, M; Phung, M; Upham, J W; Rolland, J M; O'Hehir, R E

    2011-02-01

    Grass pollens are major triggers of allergic rhinitis and asthma, but the immunological relationships between pollen allergens of the subtropical Bahia grass, Paspalum notatum, and temperate grasses are unresolved. To assess serum IgE cross-reactivity between subtropical P. notatum and temperate Lolium perenne (Ryegrass) pollen allergens. Serum IgE reactivities of grass pollen-allergic patients with P. notatum, L. perenne and Cynodon dactylon (Bermuda grass) pollen extracts and their respective purified group 1 allergens, Pas n 1, Lol p 1 and Cyn d 1, were compared by immunoblotting, ELISA and basophil activation. In a cohort of 51 patients from a temperate region, a high frequency of IgE reactivity with each grass pollen was detected, but reactivity with L. perenne pollen was substantially greater than with P. notatum and C. dactylon pollen. Similarly, serum IgE reactivity with Lol p 1 was greater than with Pas n 1 or Cyn d 1. For seven of eight sera studied in detail, asymmetric serum IgE cross-reactivity was observed; L. perenne pollen inhibited IgE reactivity with P. notatum pollen but not the converse, and IgE reactivity with Pas n 1 was inhibited by Lol p 1 but IgE reactivity with Lol p 1 was not inhibited by Pas n 1 or Cyn d 1. Importantly, P. notatum pollen and Pas n 1 activated basophils in grass pollen-allergic patients from a temperate region, although stimulation was greater by pollen of L. perenne than P. notatum or C. dactylon, and by Lol p 1 than Pas n 1 or Cyn d 1. In contrast, a cohort of 47 patients from a subtropical region showed similar IgE reactivity with P. notatum and L. perenne pollen, and reciprocal cross-inhibition of IgE reactivity between L. perenne and P. notatum. Pollen allergens of the subtropical P. notatum, including Pas n 1, show clinically relevant IgE cross-reactivity with pollen allergens of L. perenne but also species-specific IgE reactivity. © 2011 Blackwell Publishing Ltd.

  15. Geologic constraints and speleogenesis of Cova des Pas de Vallgornera, a complex coastal cave from Mallorca Island (Western Mediterranean

    Directory of Open Access Journals (Sweden)

    Joaquín Ginés

    2014-05-01

    Full Text Available The flat areas of eastern and southern Mallorca host a remarkable coastal karst, where Cova des Pas de Vallgornera stands out due to its length (more than 74 km and its special morphological suite. The pattern of the cave is quite heterogeneous showing sharp differences produced by the architecture of the Upper Miocene reef: spongework mazes and collapse chambers dominate in the reef front facies, whereas joint-guided conduits are the rule in the back reef carbonates. Regarding the speleogenesis of the system, a complex situation is envisaged involving three main agents: coastal mixing dissolution, drainage of meteoric diffuse recharge, and hypogene basal recharge related to local geothermal phenomena. The cave system is disposed in two main tiers of passages, of which geomorphologic interpretations are derived from their elevation data. The evolutionary trends as well as the chronology of the different cave sections are difficult to establish owing to the frequent shifting of the coastal base level during the Plio-Quaternary. In this respect, the genesis and evolution of the cave were fully controlled by sea-level fluctuations in the Western Mediterranean basin, with the main phases of cave formation, based on vertebrate paleontological data, going back to mid-Pliocene times.

  16. A novel signal transduction protein: Combination of solute binding and tandem PAS-like sensor domains in one polypeptide chain: Periplasmic Ligand Binding Protein Dret_0059

    Energy Technology Data Exchange (ETDEWEB)

    Wu, R. [Midwest Center for Structural Genomics, Argonne National Laboratory, Argonne Illinois 60439; Biosciences Division, Argonne National Laboratory, Argonne Illinois 60439; Wilton, R. [Biosciences Division, Argonne National Laboratory, Argonne Illinois 60439; Cuff, M. E. [Midwest Center for Structural Genomics, Argonne National Laboratory, Argonne Illinois 60439; Biosciences Division, Argonne National Laboratory, Argonne Illinois 60439; Structural Biology Center, Argonne National Laboratory, Argonne Illinois 60439; Endres, M. [Midwest Center for Structural Genomics, Argonne National Laboratory, Argonne Illinois 60439; Babnigg, G. [Midwest Center for Structural Genomics, Argonne National Laboratory, Argonne Illinois 60439; Biosciences Division, Argonne National Laboratory, Argonne Illinois 60439; Edirisinghe, J. N. [Mathematics and Computer Science Division, Argonne National Laboratory, Argonne Illinois 60439; Computation Institute, University of Chicago, Chicago Illinois 60637; Henry, C. S. [Mathematics and Computer Science Division, Argonne National Laboratory, Argonne Illinois 60439; Computation Institute, University of Chicago, Chicago Illinois 60637; Joachimiak, A. [Midwest Center for Structural Genomics, Argonne National Laboratory, Argonne Illinois 60439; Biosciences Division, Argonne National Laboratory, Argonne Illinois 60439; Structural Biology Center, Argonne National Laboratory, Argonne Illinois 60439; Department of Biochemistry and Molecular Biology, University of Chicago, Chicago Illinois 60637; Schiffer, M. [Biosciences Division, Argonne National Laboratory, Argonne Illinois 60439; Pokkuluri, P. R. [Biosciences Division, Argonne National Laboratory, Argonne Illinois 60439

    2017-03-06

    We report the structural and biochemical characterization of a novel periplasmic ligand-binding protein, Dret_0059, from Desulfohalobium retbaense DSM 5692, an organism isolated from the Salt Lake Retba in Senegal. The structure of the protein consists of a unique combination of a periplasmic solute binding protein (SBP) domain at the N-terminal and a tandem PAS-like sensor domain at the C-terminal region. SBP domains are found ubiquitously and their best known function is in solute transport across membranes. PAS-like sensor domains are commonly found in signal transduction proteins. These domains are widely observed as parts of many protein architectures and complexes but have not been observed previously within the same polypeptide chain. In the structure of Dret_0059, a ketoleucine moiety is bound to the SBP, whereas a cytosine molecule is bound in the distal PAS-like domain of the tandem PAS-like domain. Differential scanning flourimetry support the binding of ligands observed in the crystal structure. There is significant interaction between the SBP and tandem PAS-like domains, and it is possible that the binding of one ligand could have an effect on the binding of the other. We uncovered three other proteins with this structural architecture in the non-redundant sequence data base, and predict that they too bind the same substrates. The genomic context of this protein did not offer any clues for its function. We did not find any biological process in which the two observed ligands are coupled. The protein Dret_0059 could be involved in either signal transduction or solute transport.

  17. An analysis of characteristics of post-authorisation studies registered on the ENCePP EU PAS Register [version 2; referees: 2 approved

    Directory of Open Access Journals (Sweden)

    Robert Carroll

    2017-11-01

    Full Text Available Background: The objective of this study was to investigate the study design characteristics of Post-Authorisation Studies (PAS requested by the European Medicines Agency which were recorded on the European Union (EU PAS Register held by the European Network of Centres for Pharmacoepidemiology and Pharmacovigilance (ENCePP. Methods: We undertook a cross-sectional descriptive analysis of all studies registered on the EU PAS Register as of 18th October 2016. Results: We identified a total of 314 studies on the EU PAS Register, including 81 (26% finalised, 160 (51% ongoing and 73 (23% planned. Of those studies identified, 205 (65% included risk assessment in their scope, 133 (42% included drug utilisation and 94 (30% included effectiveness evaluation. Just over half of the studies (175; 56% used primary data capture, 135 (43% used secondary data and 4 (1% used a hybrid design combining both approaches. Risk assessment and effectiveness studies were more likely to use primary data capture (60% and 85% respectively as compared to 39% and 14% respectively for secondary. The converse was true for drug utilisation studies where 59% were secondary vs. 39% for primary. For type 2 diabetes mellitus, database studies were more commonly used (80% vs 3% chart review, 3% hybrid and 13% primary data capture study designs whereas for studies in oncology, primary data capture were more likely to be used (85% vs 4% chart review, and 11% database study designs. Conclusions: Results of this analysis show that PAS design varies according to study objectives and therapeutic area.

  18. Television and Nostalgia. The Wonder Years and Cuéntame cómo pasó/ Televisión y nostalgia. The Wonder Years y Cuéntame cómo pasó

    Directory of Open Access Journals (Sweden)

    Dra. Amparo Guerra Gómez; aguerrag@ccinf.ucm.es, amparoguerragomez@yahoo.es

    2009-01-01

    Full Text Available From the start historical fiction had been functioning as a worldwide resource for television programming and contents. Concerning to dynamics and diachronic ways of development a couple of trends can be observed in re-constructions of the past of this sort. On a hand, visual resources tend to be represented by characters and scenes in the form of a diverse but affluent model that prevails in universal television products. On the other, formats show a clear confluence in terms of specific social and cultural treatment, local or national. This paper explores two representative examples of historical family television series: the American The Wonder Years (1988-1993, and the more recent Spanish one Cuéntame como pasó (2001…-. In the pages that follow contents and profiles of each fiction will be analyzed from a theoretical point of view and a methodology that remarks proper issues and topics in order to establish historical events in which narrative is supported. Both sharing nostalgia and empathy as key forms of identification in television evocative stories and ways of approaching to different audiences, each one refered to distant geographical and social contexts. La ficción histórica constituye un recurso característico en la programación televisiva internacional. En su desarrollo diacrónico pueden resaltarse dos dinámicas confluyentes: la derivada de la internacionalización de propuestas y formatos, y la referida a su adecuación a coordenadas socioculturales, mucho más específicas, de carácter nacional o local.Estos programas se han ambientado en escenarios históricos diversos. En lo que respecta a su emplazamiento en períodos relativamente próximos, con frecuencia han apelado a claves de reconocimiento nostálgico, implicadas con la memoria personal de un grueso de espectadores.Este trabajo se aproxima a dos ejemplos bien definidos de ficción histórica televisiva: la serie estadounidense The Wonder Years (1988-1993, y la

  19. Peripheral Insertion of a Central Venous Access Device Under Fluoroscopic Guidance Using a Peripherally Accessed System (PAS) Port in the Forearm

    International Nuclear Information System (INIS)

    Hata, Yasuhiro; Morita, Sojiro; Morita, Yoshitaka; Awatani, Toshihide; Takasaki, Motohiro; Horimi, Tadashi; Ozawa, Zen

    1998-01-01

    Purpose: We describe the technique, efficacy, and complications of fluoroscopy-guided implantation of a central venous access device using a peripherally accessed system (PAS) port via the forearm. Methods: Beginning in July 1994, 105 central venous access devices were implanted in 104 patients for the long-term infusion of antibiotics or antineoplasmic agents, blood products, or parenteral nutrition. The devices was inserted under fluoroscopic guidance with real-time venography from a peripheral route. Results: All ports were successfully implanted. There were no procedure-related complications. No thrombosis or local infection was observed; however, in six patients catheter-related phlebitis occurred. Conclusion: Fluoroscopy-guided implantation of a central venous access device using a PAS port via the forearm is safe and efficacious, and injection of contrast medium through a peripheral IV catheter before introduction of the catheter helps to avoid catheter-related phlebitis

  20. El frañol en Pas pleurer de Lydie Salvayre y su traducción al español

    Directory of Open Access Journals (Sweden)

    Benoît Filhol

    2018-04-01

    Full Text Available Set in the spanish civil war and resonant with autobiographical echoes, Lydie Salvayre’s Pas pleurer exemplifies the contact between Spanish and French, by means of the mixed language called frañol. In terms of reception, this prominent stylistic factor –often highlighted by critics– led to a mixture of praise and disapproval. This article has a two-fold objective: first, conducting an exhaustive analysis of frañol in the novel, by means of a classification system allowing us to interpret Salvayre’s stylistic choices. Second, examining the Spanish translation of Pas pleurer, taking into consideration the challenges embedded in the translation of frañol. Le roman Pas pleurer de Lydie Salvayre se plonge dans l’épisode historique de la guerre civile espagnole au travers d’une histoire aux accents autobiographiques et rejoint les œuvres écrites en fragnol, une langue qui mélange le français et l’espagnol. Cette spécificité linguistique fut l’aspect le plus évoqué par la critique et sa réception recueillit aussi bien des éloges que des réprobations. Cet article poursuit deux objectifs. Tout d’abord, nous avons réalisé une analyse exhaustive du fragnol dans le roman au travers d’un système de classification adapté à l’œuvre qui nous permet d’interpréter le choix stylistique opéré par Salvayre. Dans un second temps, nous examinons la traduction espagnole de Pas pleurer, considérant que la transposition du fragnol constitue un défi de premier ordre pour le traducteur.

  1. Psychometric evaluation of a Dutch version of the Mini PAS-ADD for assessing psychiatric disorders in adults with different levels of intellectual disability

    OpenAIRE

    Janssen, Rianne; Maes, Bea

    2013-01-01

    Background People with intellectual disabilities (ID) have an increased vulnerability to develop psychiatric problems. Moreover, the early recognition and the accurate diagnosis of psychiatric disorders in the population of persons with ID are challenging. Method A Dutch version of the Mini PAS-ADD, which is a screening instrument for identification of mental health problems in people with ID, was evaluated in terms of internal consistency, interinformant reliability, item grouping and ...

  2. Psychometric evaluation of a Dutch version of the Mini PAS-ADD for assessing psychiatric disorders in adults with different levels of intellectual disability.

    Science.gov (United States)

    Janssen, R; Maes, B

    2013-08-01

    People with intellectual disabilities (ID) have an increased vulnerability to develop psychiatric problems. Moreover, the early recognition and the accurate diagnosis of psychiatric disorders in the population of persons with ID are challenging. A Dutch version of the Mini PAS-ADD, which is a screening instrument for identification of mental health problems in people with ID, was evaluated in terms of internal consistency, interinformant reliability, item grouping and criterion validity based on a large-scale random sample (n = 377) and a clinical sample (n = 99) of adults with ID. The Dutch version of the Mini PAS-ADD showed moderate internal consistency, and moderate concordance among informants. Both aspects of the reliability were comparable for different levels of ID. A factor analysis largely confirmed the scale structure. Concurrent validity with the Reiss Screen for Maladaptive Behavior was high for the Depression, Psychosis and Autism scale. The outcome of the criterion-validity analysis indicated high specificity. The sensitivity for specific psychiatric disorders by the corresponding scales was moderate, but the general sensitivity for the presence of psychopathology on the basis of any of the scales was satisfying. The present research reconfirmed the use of the Mini PAS-ADD as a primary screening device for the identification of mental health problems among people with ID. © 2012 The Authors. Journal of Intellectual Disability Research © 2012 John Wiley & Sons Ltd, MENCAP & IASSID.

  3. [Sources of information on suicide attempts in the Nord - Pas-de-Calais (France). Contributions and limitations].

    Science.gov (United States)

    Plancke, L; Ducrocq, F; Clément, G; Chaud, P; Haeghebaert, S; Amariei, A; Chan-Chee, C; Goldstein, P; Vaiva, G

    2014-12-01

    There are very few permanent indicators of mental health in France; suicidal behavior is often only understood on the basis of deaths by suicide. The epidemiological interest and methodological limits of four medico-administrative databases from which data on suicide attempts can be extracted have been the subject of a study in the Nord - Pas-de-Calais Region of France: telephone calls for emergency medical assistance after suicide attempt (2009 to 2011), admissions in emergency services with a diagnosis of suicide attempt (2012), medical-surgical hospital admissions as a result of suicide attempt (2009 to 2011), and psychiatric admissions with a diagnosis of suicide attempt (2011). Usable data were provided by one of two emergency medical assistance units, five of thirty emergency departments and all medical-surgical and psychiatric units; in data from the latter two sources, a unique anonymous identifier gave individual statistics, while the first two covered only suicide attempts. In 2011, the number of suicide attempt calls per 100,000 inhabitants was 304, whereas the number of hospitalisations with this diagnosis was 275; rates are highest in men between 20 and 49 years of age, and in women below 20 years of age and between 40 and 49. Sources are seen to be very homogeneous with regards to the average age at which suicide took place (between 37.8 and 38.5 years, depending on the source), and to the sex (55.0% to 57.6% of women). In 2011, the number of patients with a diagnosis of suicide attempt treated in psychiatry is 2.6 times lower than the number hospitalised for suicide attempt in medical-surgical units (3563 vs 9327). Permanent gathering of data, and the large volume of data recorded, should encourage the use of these databases in the definition and assessment of mental health policy: an increased contribution from emergency call centers and emergency services, and the coding of the suicidal nature of intoxications by a few clearly under-declaring units

  4. Pourquoi l’industrie automobile n’a pas inventé la bioéthique ?

    Directory of Open Access Journals (Sweden)

    Christian Bonah

    2008-12-01

    ègles strictes d'évaluation et de mise sur le marché d'un médicament, réalisant ainsi une demande formulée depuis longtemps sans succès par l'industrie pharmaceutique. Ainsi, et aussi contradictoire que cela puisse paraître, certaines des positions des associations rejoignent et la rhétorique du laisser-faire de l'économie libérale en faveur d'une régulation économique des marchés et les sirènes de l'industrie pharmaceutique chantant la plainte de la sur-réglementation qui empêche l'innovation. Pour sa part, peut-être que l'industrie automobile n'avait pas besoin d'inventer la bioéthique puisqu'elle n'a jamais quitté l'espace d'une régulation par les marchés.

  5. 13–18 metų našlaičių, gyvenančių globos įstaigoje ir pas globėjus, socializacijos ypatumai

    OpenAIRE

    Dailydaitė, Aušra

    2008-01-01

    Tyrimo tikslas: Nustatyti 13–18 metų našlaičių, gyvenančių globos įstaigoje ir pas globėjus, socializacijos ypatumus. Tyrimo uždaviniai: 1. Nustatyti našlaičių, gyvenančių globos įstaigoje ir pas globėjus, socialinės adaptacijos ypatumus 2006 ir 2008 metais. 2. Išryškinti našlaičių, gyvenančių globos įstaigoje ir pas globėjus, vidinės būsenos ypatumus 2006 ir 2008 metais. 3. Išsiaiškinti našlaičių, gyvenančių globos įstaigoje ir pas globėjus, ateities perspektyvos suvokimo ypatu...

  6. Tortugas del Cretácico Inferior de la Cuenca Vasco-Cantábrica: el registro Hauteriviense-Barremiense de Vega de Pas (Cantabria)

    OpenAIRE

    Pérez García, Adán; Murelaga, Xabier

    2013-01-01

    El registro de tortugas del Cretácico Inferior de España es muy abundante y diverso. Hasta ahora todos los hallazgos provenían de la Cordillera Ibérica. Se presenta aquí material de tortugas hallado en la Cuenca Vasco- Cantábrica. Estos ejemplares, provenientes del Hauteriviense-Barremiense de la Formación Vega de Pas (Cantabria), corresponden a placas tanto del espaldar como del plastrón. Se reconoce la presencia de un representante indeterminado de Eucryptodira, que difier...

  7. Characterization of CgHIFα-Like, a Novel bHLH-PAS Transcription Factor Family Member, and Its Role under Hypoxia Stress in the Pacific Oyster Crassostrea gigas.

    Directory of Open Access Journals (Sweden)

    Ting Wang

    Full Text Available Hypoxia-inducible factor (HIF, a critical member of the basic-helix-loop-helix (bHLH-containing Per-Arnt-Sim (PAS protein family, is a master transcription factor involved in maintaining oxygen homeostasis. In the present study, we isolated and characterized a novel bHLH-PAS family member, CgHIFα-like gene, from the Pacific oyster Crassostrea gigas, and determined its importance during hypoxia stress. The 3020-bp CgHIFα-like cDNA encoded a protein of 888 amino acids. The predicted CgHIFα-like amino acid sequence was conserved in the N-terminal bHLH, PAS, and PAC domains (but not in the C-terminal domain and was most closely related to the HIF family in the bHLH-PAS protein phylogenic tree. Similar to the mammalian HIF-1α, CgHIFα-like could be expressed as four mRNA isoforms containing alternative 5'-untranslated regions and different translation initiation codons. At the mRNA level, these isoforms were expressed in a tissue-specific manner and showed increased transcription to varying degrees under hypoxic conditions. Additionally, the western blot analysis demonstrated that CgHIFα-like was induced by hypoxia. Electrophoretic mobility shift assay indicated that CgHIFα-like could bind to the hypoxia responsive element (HRE, whereas dual-luciferase reporter analysis demonstrated that CgHIFα-like could transactivate the reporter gene containing the HREs. In addition to CgHIFα-like, we identified CgARNT from the C. gigas, analyzed its expression pattern, and confirmed its interaction with CgHIFα-like using a yeast two-hybrid assay. In conclusion, this is the first report on the cloning and characterization of a novel hypoxia transcription factor in mollusks, which could accumulate under hypoxia and regulate hypoxia related gene expression by binding to HRE and dimerizing with CgARNT. As only one member of HIF has been identified in invertebrates to date, our results provide new insights into the unique mechanisms of hypoxia tolerance in

  8. El paisaje cultural como elemento de patrimonialización: el caso de Vega de Pas, Cantabria, España

    Directory of Open Access Journals (Sweden)

    Jorge Magaña Ochoa

    2008-06-01

    Full Text Available El presente artículo esboza algunos de los cambios histórico-sociales más importantes sufridos por la cultura pasiega (Vega de Pas, sobre todo a partir de la aplicación de las políticas económicas europeas que provocaron el declive y la pérdida de centralidad del trabajo ganadero. Con dichas políticas se pretende actualmente “integrar” a los pasiegos en un proceso de patrimonialización de su paisaje y de su cultura.

  9. Henri FAYOL, 100 ans et pas une ride L’apport de l’œuvre de Fayol dans le monde moderne

    OpenAIRE

    Brodhag, Christian

    2016-01-01

    International audience; Demain se tiendra à l'Ecole un colloque scientifique sur Henri FAYOL, il permettra à des chercheurs d'horizons variés de porter des regards croisés sur l'oeuvre de notre glorieux ancien. Certains sont déjà présents ce soir, et je les salue. En posant la question de la pertinence de l'actualité de l'oeuvre de FAYOL, je ne me départirai pas de la rigueur qui sied au scientifique, mais je ne m'accorderai une licence plus politique. En effet cette dimension de l'oeuvre de ...

  10. A Hashtag Worth a Thousand Words: Discursive Strategies Around #JeNeSuisPasCharlie After the 2015 Charlie Hebdo Shooting

    Directory of Open Access Journals (Sweden)

    Fabio Giglietto

    2017-01-01

    Full Text Available Following a shooting attack by two self-proclaimed Islamist gunmen at the offices of French satirical weekly Charlie Hebdo on 7 January 2015, there emerged the hashtag #JeSuisCharlie on Twitter as an expression of solidarity and support for the magazine’s right to free speech. Almost simultaneously, however, there was also #JeNeSuisPasCharlie explicitly countering the former, affirmative hashtag. Based on a multimethod analysis of 74,047 tweets containing #JeNeSuisPasCharlie posted between 7 and 11 January, this article reveals that users of the hashtag under study employed various discursive strategies and tactics to challenge the mainstream framing of the shooting as the universal value of freedom of expression being threatened by religious extremism, while protecting themselves from the risk of being viewed as disrespecting victims or endorsing the violence committed. The significance of this study is twofold. First, it extends the literature on strategic speech acts by examining how such acts take place in a social media context. Second, it highlights the need for a multidimensional and reflective methodology when dealing with data mined from social media.

  11. The Ability of PAS, Acetylsalicylic Acid and Calcium Disodium EDTA to Protect Against the Toxic Effects of Manganese on Mitochondrial Respiration in Gill of Crassostrea virginica.

    Science.gov (United States)

    Crawford, Sherine; Davis, Kiyya; Saddler, Claudette; Joseph, Jevaun; Catapane, Edward J; Carroll, Margaret A

    2011-01-01

    Manganese (Mn) is an essential metal that at excessive levels in brain causes Manganism, a condition similar to Parkinson's disease. Previously we showed that Mn had a neurotoxic effect on the dopaminergic, but not serotonergic, innervation of the lateral ciliated cells in the gill of the Eastern Oyster, Crassostrea virginica. While the mechanism of action of Mn toxicity is not completely understood, studies suggest that Mn toxicity may involve mitochondrial damage and resulting neural dysfunction in the brain's dopaminergic system. In this study we utilized micro-batch chambers and oxygen probes to measure oyster gill mitochondrial respiration in the presence of Mn and potential Mn blockers. The addition of Mn to respiring mitochondria caused a dose dependent decrease in mitochondrial O(2) consumption. Pretreating mitochondria with calcium disodium EDTA (caEDTA), p aminosalicylic acid (PAS) or acetylsalicylic acid (ASA) before Mn additions, provided full protection against the toxic effects of Mn. While mitochondrial pretreatment with any of the 3 drugs effectively blocked Mn toxicity, none of the drugs tested was able to reverse the decrease in mitochondrial O(2) consumption seen in Mn treated mitochondria. The study found that high levels of Mn had a toxic effect on gill mitochondrial O(2) consumption and that this effect could be blocked by the drugs caEDTA, PAS and ASA. C. virginica continues to be a good model with which to investigate the mechanism that underlies manganese neurotoxcity and in the pharmacological study of drugs to treat or prevent Manganism.

  12. Latvijas Komercbanku pasīvās operācijas, to nozīme stabilitātes nodrošināšanā

    OpenAIRE

    Supe, Gita

    2014-01-01

    Darba mērķis ir izanalizēt banku pasīvo operāciju nozīmi Latvijas komercbanku stabilitātes nodrošināšanā, kā arī apskatīt, kādi ir banku pasīvo operāciju ietekmējošie faktori, un kā tie ietekmē Latvijas komercbanku darbību. Lai sasniegtu izvirzīto mērķi darba gaitā tika veikti šādi uzdevumi: •raksturotas banku pasīvās operācijas un loma stabilitātes nodrošināšanā; •izpētīti Latvijas komercbanku pasīvi laika periodā 2010. – 2013.g. •izanalizēta banku pasīvo operāciju faktoru ietekm...

  13. Storage of the complement components C4, C3, and C 3-activator in the human liver as PAS-negative globular hyaline bodies.

    Science.gov (United States)

    Storch, W; Riedel, H; Trautmann, B; Justus, J; Hiemann, D

    1982-01-01

    Liver biopsies of a 58-year-old clinically healthy patient with a hepatomegaly and intracisternal PAS-negative globular hyaline bodies were immunofluorescent-optically examined for the content of the complement components C 1 q, C 4, C 9, C 1-inactivator, C 3-activator. Further examinations were performed for fibrinogen, IgG, IgA, IgM, IgD, IgE, L-chain (type chi and lambda), alpha 1-antitrypsin, alpha 1-fetoprotein, alpha 1- and alpha 2-glycoprotein, cholinesterase, ceruloplasmin, myoglobin, hemopexin, HBsAg and HBsAg. Th inclusion bodies reacted with antisera against the complement components C 4, C 3 and C 3-activator, as also identified by double immunofluorescence. Probably this is a disturbance of the protein metabolism of the liver cell with abnormal complement storage in the presence of normal total complement and normal complement components in the serum.

  14. Focus - Les établissements publics fonciers, des outils pour la biodiversité des zones humides : le cas de l’EPF Nord-Pas de Calais

    Directory of Open Access Journals (Sweden)

    LEMOINE, Guillaume

    2017-09-01

    Full Text Available Les établissements publics fonciers (EPF ont pour mission recycler le foncier dégradé pour favoriser, dans le cadre du développement durable, le renouvellement urbain, notamment pour aider la construction de logements tout en luttant contre l’étalement urbain. Devenus propriétaires de nombreux terrains, dont des zones humides, ils sont également concernés par la protection et la valorisation de ces espaces naturels. À travers l'exemple des actions menées par l’EPF Nord-Pas de Calais pour préserver ces zones humides, ce focus s'intéresse au rôle que peuvent jouer les EPF dans la préservation des espaces agricoles et naturels.

  15. Internal and atmospheric contamination measurament by means of whole body counter performed up to 31.21.1986 by Bologna ENEA-PAS following the Chernobyl accident

    International Nuclear Information System (INIS)

    Melandri, C.; Castellani, C.M.; Calamosca, M.; Torroni, G.; Formignani, M.; De Zaiacomo, T.

    1987-01-01

    Internal contamination and atmospheric sampling data obtained at ENEA PAS-FIBI-AEROSOL Laboratory in Bologna (Italy), following the accident at the nuclear reactor in Chernobyl, are presented. Internal contamination data are related to persons coming from European countries (mainly the USSR) and Italy, measured in Bologna in the period May-Dicember 1986, while the atmospheric contamination samplings were performed in Bologna during the first decade of May. Descriptions of the measurement methods, data analysis and the evaluation of the committed dose equivalent due to both inhalation and ingestion of radioactive contaminants are given. The last chapter reports an estimation of the possible trend of internal contamination due to Cs-134 and Cs-137 up to 1991

  16. « L’urne ne parle pas » : multipartismes et mobilisations électorales des liens sociaux (Mali, Maasina)

    OpenAIRE

    Fay, Claude

    2013-01-01

    Si les élections africaines n’apparaissent pas, au premier abord, être « comme les autres », c’est à cause de l’apparente originalité du processus électoral lui-même (on évoque alors les thèmes de la contrainte, de l’irrégularité et de la fraude, de la violence) et de celle des motivations des électeurs (on évoque alors les thèmes des votes « communautaires », « clientélistes » ou « marchands »). Cette vision stéréotypée, qui ne définit son objet que par un contraste péjoratif avec les électi...

  17. Técnicas FT-IR (PAS, UATR e Objetiva ATR Aplicadas à Caracterização de EPDM Modificada com Plasma

    Directory of Open Access Journals (Sweden)

    Renata Patrícia dos Santos

    2014-06-01

    Full Text Available Técnicas FT-IR (UATR, PAS e MIC, com objetiva ATR foram escolhidas para a caracterização da superfície da borracha de EPDM vulcanizada, após tratamento em plasma de Ar/O2 e N2/H2/Ar gerado em micro-ondas. Após tratamento, grupos oxigenados foram detectados por UATR e MIC/FT-IR, com objetiva ATR para as duas misturas gasosas, e possíveis grupos nitrogenados foram inseridos na superfície das amostras tratadas com plasma de N2/H2/Ar. A análise MIC/FT-IR sugeriu a formação de grupos em uma camada mais externa, para as amostras tratadas com plasma de N2/H2/Ar, sendo possível observar a redução na intensidade das bandas da absorção do CH2 e CH3, o que pode estar relacionado ao fato de o nitrogênio ser um gás menos permeável que o oxigênio. Diferentes velocidades, 0,05 cm.s-1 e 0,2 cm.s-1, foram utilizadas na análise PAS para avaliar a superfície após tratamento, e apenas para a velocidade 0,05 cm.s-1 com plasma de Ar/O2 alterações espectroscópicas foram detectadas. A redução na medida de ângulo de contato e o aumento na resistência ao descascamento da colagem indicaram melhoras nas propriedades adesivas da superfície. Falhas de adesão foram observadas entre a interface do filme de adesivo de PU e da borracha de EPDM, e confirmados por UATR/FT-IR.

  18. Kopūstinės kandies (Plutella xylostella L.) (Lepidoptera: Plutelidae) skraidymo ir kenkimo intensyvumo dinamika vasarinių rapsų ir gūžinių kopūstų pasėliuose

    OpenAIRE

    Vyšniauskaitė, Sigrida

    2013-01-01

    Magistrantūros studijų baigiamajame darbe pateikiami kopūstinės kandies skraidymo bei kenkimo dinamikos vasarinių rapsų ir gūžinių kopūstų pasėliuose tyrimų rezultatai. Darbo objektas – kopūstinė kandis (Plutella xylostella L.) Darbo metodai – kopūstinės kandies skraidymo dinamika tirta naudojant feromonines “delta” tipo gaudykles, 2012 m. gegužės – rugpjūčio mėnesiais, vasarinių rapsų ir ankstyvųjų bei vėlyvųjų baltagūžių kopūstų pasėliuose. Vasarinių rapsų pasėlyje buvo įrengta 12 ga...

  19. Anaortic off-pump versus clampless off-pump using the PAS-Port device versus conventional coronary artery bypass grafting: mid-term results from a matched propensity score analysis of 5422 unselected patients.

    Science.gov (United States)

    Furukawa, Nobuyuki; Kuss, Oliver; Preindl, Konstantin; Renner, André; Aboud, Anas; Hakim-Meibodi, Kavous; Benzinger, Michael; Pühler, Thomas; Ensminger, Stephan; Fujita, Buntaro; Becker, Tobias; Gummert, Jan F; Börgermann, Jochen

    2017-10-01

    Meta-analyses from observational and randomized studies have demonstrated benefits of off-pump surgery for hard and surrogate endpoints. In some of them, increased re-revascularization was noted in the off-pump groups, which could impact their long-term survival. Therefore, we analyzed the course of all patients undergoing isolated coronary surgery regarding the major cardiac and cerebrovascular event (MACCE) criteria. A prospective register was taken from a high-volume off-pump center recording all anaortic off-pump (ANA), clampless off-pump (PAS-Port) and conventional (CONV) coronary artery bypass operations between July 2009 and June 2015. Propensity Score Matching was performed based on 28 preoperative risk variables. We identified 935 triplets (N = 2805). Compared with CONV, in-hospital mortality of both the ANA group (OR for ANA [95% CI] 0.25 [0.06; 0.83], P = 0.021), and the PAS-Port group was lower (OR for PAS-Port [95% CI] 0.50 [0.17; 1.32], P = 0.17). In the mid-term follow-up there were no significant differences between the groups regarding mortality (HR for ANA [95%-CI] 0.83 [0.55-1.26], P = 0.38; HR for PAS-Port [95%-CI] 1.06 [0.70-1.59], P = 0.79), incidence of stroke (HR for ANA 0.81 [0.43-1.53], P = 0.52; HR for PAS-Port 0.78 [0.41-1.50], P = 0.46), myocardial infarction (HR for ANA 0.53 [0.22-1.31], P = 0.17; HR for PAS-Port 0.78 [0.37-1.66], P = 0.52) or re-revascularization rate (HR for ANA 0.99 [0.67-1.44], P = 0.94; HR for PAS-Port 0.95 [0.65-1.38], P = 0.77). Both off-pump clampless techniques were associated with lower in-hospital mortality compared with conventional CABG. The mid-term course showed no difference with regard to the MACCE criteria between anaortic off-pump, clampless off-pump using PAS-Port and conventional CABG. © The Author 2017. Published by Oxford University Press on behalf of the European Association for Cardio-Thoracic Surgery. All rights reserved.

  20. Advance and prospectus of seasonal prediction: assessment of the APCC/CliPAS 14-model ensemble retrospective seasonal prediction (1980-2004)

    Science.gov (United States)

    Wang, Bin; Lee, June-Yi; Kang, In-Sik; Shukla, J.; Park, C.-K.; Kumar, A.; Schemm, J.; Cocke, S.; Kug, J.-S.; Luo, J.-J.; Zhou, T.; Wang, B.; Fu, X.; Yun, W.-T.; Alves, O.; Jin, E. K.; Kinter, J.; Kirtman, B.; Krishnamurti, T.; Lau, N. C.; Lau, W.; Liu, P.; Pegion, P.; Rosati, T.; Schubert, S.; Stern, W.; Suarez, M.; Yamagata, T.

    2009-07-01

    We assessed current status of multi-model ensemble (MME) deterministic and probabilistic seasonal prediction based on 25-year (1980-2004) retrospective forecasts performed by 14 climate model systems (7 one-tier and 7 two-tier systems) that participate in the Climate Prediction and its Application to Society (CliPAS) project sponsored by the Asian-Pacific Economic Cooperation Climate Center (APCC). We also evaluated seven DEMETER models’ MME for the period of 1981-2001 for comparison. Based on the assessment, future direction for improvement of seasonal prediction is discussed. We found that two measures of probabilistic forecast skill, the Brier Skill Score (BSS) and Area under the Relative Operating Characteristic curve (AROC), display similar spatial patterns as those represented by temporal correlation coefficient (TCC) score of deterministic MME forecast. A TCC score of 0.6 corresponds approximately to a BSS of 0.1 and an AROC of 0.7 and beyond these critical threshold values, they are almost linearly correlated. The MME method is demonstrated to be a valuable approach for reducing errors and quantifying forecast uncertainty due to model formulation. The MME prediction skill is substantially better than the averaged skill of all individual models. For instance, the TCC score of CliPAS one-tier MME forecast of Niño 3.4 index at a 6-month lead initiated from 1 May is 0.77, which is significantly higher than the corresponding averaged skill of seven individual coupled models (0.63). The MME made by using 14 coupled models from both DEMETER and CliPAS shows an even higher TCC score of 0.87. Effectiveness of MME depends on the averaged skill of individual models and their mutual independency. For probabilistic forecast the CliPAS MME gains considerable skill from increased forecast reliability as the number of model being used increases; the forecast resolution also increases for 2 m temperature but slightly decreases for precipitation. Equatorial Sea Surface

  1. Advance and prospectus of seasonal prediction: assessment of the APCC/CliPAS 14-model ensemble retrospective seasonal prediction (1980-2004)

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Bin; Lee, June-Yi; Fu, X.; Liu, P. [University of Hawaii, Department of Meteorology and International Pacific Research Center, IPRC, School of Ocean and Earth Science and Technology, Honolulu, HI (United States); Kang, In-Sik; Kug, J.S. [Seoul National University, School of Earth and Environmental Sciences, Seoul (Korea); Shukla, J.; Jin, E.K.; Kinter, J.; Kirtman, B. [George Mason University and COLA, Climate Dynamics Program, Calverton, MD (United States); Park, C.K. [APEC Climate Center, Busan (Korea); Kumar, A.; Schemm, J. [Climate Prediction Center/NCEP, Camp Springs, MD (United States); Cocke, S.; Krishnamurti, T. [Florida State University, Tallahassee, FL (United States); Luo, J.J. [Frontier Research Center for Global Chnage, Yokohama (Japan); Zhou, T.; Wang, B. [Chinese Academy of Sciences, LASG/Institute of Atmospheric Physics, Beijing (China); Yun, W.T. [Korean Meteorological Administration, Seoul (Korea); Alves, O. [Bureau of Meteorology Research Center, Melburne (Australia); Lau, N.C.; Rosati, T.; Stern, W. [Princeton University, Geophysical Fluid Dynamics Laboratory/NOAA, Princeton, NJ (United States); Lau, W.; Pegion, P.; Schubert, S.; Suarez, M. [Godard Space Flight Center/NASA, Greenbelt, MD (United States)

    2009-07-15

    We assessed current status of multi-model ensemble (MME) deterministic and probabilistic seasonal prediction based on 25-year (1980-2004) retrospective forecasts performed by 14 climate model systems (7 one-tier and 7 two-tier systems) that participate in the Climate Prediction and its Application to Society (CliPAS) project sponsored by the Asian-Pacific Economic Cooperation Climate Center (APCC). We also evaluated seven DEMETER models' MME for the period of 1981-2001 for comparison. Based on the assessment, future direction for improvement of seasonal prediction is discussed. We found that two measures of probabilistic forecast skill, the Brier Skill Score (BSS) and Area under the Relative Operating Characteristic curve (AROC), display similar spatial patterns as those represented by temporal correlation coefficient (TCC) score of deterministic MME forecast. A TCC score of 0.6 corresponds approximately to a BSS of 0.1 and an AROC of 0.7 and beyond these critical threshold values, they are almost linearly correlated. The MME method is demonstrated to be a valuable approach for reducing errors and quantifying forecast uncertainty due to model formulation. The MME prediction skill is substantially better than the averaged skill of all individual models. For instance, the TCC score of CliPAS one-tier MME forecast of Nino 3.4 index at a 6-month lead initiated from 1 May is 0.77, which is significantly higher than the corresponding averaged skill of seven individual coupled models (0.63). The MME made by using 14 coupled models from both DEMETER and CliPAS shows an even higher TCC score of 0.87. Effectiveness of MME depends on the averaged skill of individual models and their mutual independency. For probabilistic forecast the CliPAS MME gains considerable skill from increased forecast reliability as the number of model being used increases; the forecast resolution also increases for 2 m temperature but slightly decreases for precipitation. Equatorial Sea Surface

  2. La répartition géographique des poissons d'eau douce en France : qui est autochtone et qui ne l'est pas ?

    Directory of Open Access Journals (Sweden)

    PERSAT H.

    1997-01-01

    Full Text Available Les bouleversements intervenus ces dernières décennies dans la composition de l'ichtyofaune d'eau douce française incitent, d'une part, à faire un bilan de la situation présente (cf. l'Atlas des poissons d'eau douce de France et, d'autre part, à promouvoir une politique de gestion cohérente avec le principe de protection du patrimoine biologique naturel. Cette notion de patrimoine reste toutefois à définir. En effet, les changements actuels ne sont que les derniers d'une longue série, où l'homme est un acteur capital depuis plus longtemps qu'on ne le croit. De fait, beaucoup des espèces dites françaises n'ont probablement pas de valeur patrimoniale dans nombre de nos bassins fluviaux. Le présent article a pour ambition de décrire l'ampleur du problème et de solliciter la communauté scientifique, afin de rassembler les informations et développer les investigations selon un cadre géographique et historique précis.

  3. Energies of the future in Nord-Pas de Calais. Which solutions to climate disruption - Global Report version 1.0, january 2008

    International Nuclear Information System (INIS)

    2008-01-01

    This study aims at identifying means to be implemented in the Nord-Pas de Calais region to divide by four regional emissions of CO 2 , and to do it without the renewal of nuclear reactors located in Gravelines. A first part presents the methods used for this study, the hypotheses selected to elaborate scenarios, the presentation, results and comparison of various scenarios, and an assessment of energy imports. The second part addresses the different renewable energy resources of the region and their potential to reach the expected results. The third part reports the study of the evolution of transport organisation by 2050: pollutions related to transports, regional costs of these pollutions, dysfunctions and possible actions in the competition between transports modes (road, rail, river, sea, air). A chapter then addresses the issue of the relationship between urban planning and mobility. The next chapter discusses the possibilities of action in the building sector (housing and office building, policies to be implemented to comply with the chosen scenario). The possibilities of solar energy are then discussed

  4. Les premiers pas d’Agnon à Jaffa (1908-1912 First Steps of S.Y. Agnon in Jaffa (1908-1912 ראשית דרכו של עגנון ביפו (1908 עד 1912

    Directory of Open Access Journals (Sweden)

    Masha Itzhaki

    2012-11-01

    Full Text Available Les premiers pas du célèbre auteur S. Y. Agnon lors de son premier séjour à Jaffa (1908-1912 sont liés aux deux revues hébraïques : Ha-Omer, histoire d’un échec, et Ha-po‘el ha-tsa‘ir, histoire d’une réussite, et aux rédacteurs en chef de ces revues, les écrivains et pères spirituels du jeune Agnon, Sh. Ben Tzion, un écrivain esthétique, bourgeois, et Y. H. Brenner, un penseur tourmenté, un véritable intellectuel socialiste.The first period of the famous writer S. Y. Agnon in Jaffa (1908-1912 has a lot to do with two literary Hebrew periodicals: Ha-Omer, a story of a failure, and Ha-po‘el ha-tsa‘ir, a successful one, as well as  with two major figures in Hebrew literary milieu at that time, the editors, Sh. Ben Tzion and Y. H. Brenner.

  5. Juvenile hormone counteracts the bHLH-PAS transcription factors MET and GCE to prevent caspase-dependent programmed cell death in Drosophila.

    Science.gov (United States)

    Liu, Ying; Sheng, Zhentao; Liu, Hanhan; Wen, Di; He, Qianyu; Wang, Sheng; Shao, Wei; Jiang, Rong-Jing; An, Shiheng; Sun, Yaning; Bendena, William G; Wang, Jian; Gilbert, Lawrence I; Wilson, Thomas G; Song, Qisheng; Li, Sheng

    2009-06-01

    Juvenile hormone (JH) regulates many developmental and physiological events in insects, but its molecular mechanism remains conjectural. Here we report that genetic ablation of the corpus allatum cells of the Drosophila ring gland (the JH source) resulted in JH deficiency, pupal lethality and precocious and enhanced programmed cell death (PCD) of the larval fat body. In the fat body of the JH-deficient animals, Dronc and Drice, two caspase genes that are crucial for PCD induced by the molting hormone 20-hydroxyecdysone (20E), were significantly upregulated. These results demonstrated that JH antagonizes 20E-induced PCD by restricting the mRNA levels of Dronc and Drice. The antagonizing effect of JH on 20E-induced PCD in the fat body was further confirmed in the JH-deficient animals by 20E treatment and RNA interference of the 20E receptor EcR. Moreover, MET and GCE, the bHLH-PAS transcription factors involved in JH action, were shown to induce PCD by upregulating Dronc and Drice. In the Met- and gce-deficient animals, Dronc and Drice were downregulated, whereas in the Met-overexpression fat body, Dronc and Drice were significantly upregulated leading to precocious and enhanced PCD, and this upregulation could be suppressed by application of the JH agonist methoprene. For the first time, we demonstrate that JH counteracts MET and GCE to prevent caspase-dependent PCD in controlling fat body remodeling and larval-pupal metamorphosis in Drosophila.

  6. Chemical and isotopic tracing of underground water in relation with leaching of mine spoils, Nord-Pas-de-Calais Coal Basin (France)

    International Nuclear Information System (INIS)

    Denimal, S.; Tribovillard, N.; Meilliez, F.; Barbecot, F.; Dever, L.

    2001-01-01

    Coal mining activity in the Nord-Pas-de-Calais region (Northern France) has generated many mine spoils. The oxidation of the pyrite content of such coal shales and their leaching can be a source of sulfate pollution for the underlying chalk aquifer, i.e. the main drinking water resource of the region. Two sites of study have been retained: one in the free water table zone and the other in the confined water table zone. Samples from both mine spoils have been analyzed with respect to their carbon and sulfur content and a superficial leaching of these elements has been evidenced. Water has been sampled in piezometers and boreholes close to the mine spoils and also along natural flux lines. The use of sulfur isotopes as markers of the different sulfate sources has confirmed the spoils source but has permitted to identify another source in the second site which is the Tertiary gypsum-bearing Ostricourt sands. This study has shown also that in the confined water table zone, part of the exported sulfates is reduced. This bacterial reduction of sulfates is due to a joint leaching of both carbon and sulfur in the mine spoils. A self-purification phenomenon occurs when the chalk aquifer is confined beneath the Cenozoic cover. (J.S.)

  7. Increase in PAS-induced neuroplasticity after a treatment course of intranasal ketamine for depression. Report of three cases from a placebo-controlled trial.

    Science.gov (United States)

    Gálvez, Verònica; Nikolin, Stevan; Ho, Kerrie-Anne; Alonzo, Angelo; Somogyi, Andrew A; Loo, Colleen K

    2017-02-01

    Animal studies suggest that neural plasticity may play a role in the antidepressant effects of a single ketamine dose. However, the potential effects of repeated ketamine treatments on human neuroplasticity are unknown. This pilot RCT study measured plasticity-induced changes before and after a ketamine course, in three treatment-resistant depressed subjects, who were randomized to receive 8 intranasal treatments of 100mg ketamine or 4.5mg midazolam. Mood ratings were performed by a trained blinded rater at baseline and 24h-48h after the ketamine course, using the Montgomery Asberg Depression Rating Scale (MADRS). Neuroplasticity was assessed in the motor cortex using a paired associative stimulation (PAS) paradigm at baseline and 24h-48h after the treatment course. No changes in current psychotropic medication or dosage were permitted for 4weeks prior to trial entry and throughout the trial. The subject receiving ketamine, but not those receiving midazolam, presented a marked increase in neural plasticity after the treatment course. However, mood changes were not associated with changes in neural plasticity. Pilot study with small sample size. Concomitant antidepressant medications taken. Plasticity was tested in the motor cortex only, thus the generalizability of these findings to other brain areas cannot be assumed. These results suggest that a course of intranasal ketamine may enhance synaptic plasticity in subjects with depression, but this was not associated with antidepressant effects. Further research on this topic is warranted. Copyright © 2016 Elsevier Inc. All rights reserved.

  8. Et pourquoi pas au CERN ?

    CERN Multimedia

    Staff Association

    2015-01-01

    Télétravail ou travail à distance, aménagement des horaires de travail et autres évolutions favorables à un meilleur équilibre vie privée et vie professionnelle sont adoptés par nombre d’entreprises et d’organisations !   Rendu possible grâce au développement de nouvelles technologies dont Internet, le travail à distance séduit de plus en plus de personnels, ainsi que de plus en plus de sociétés qui y trouvent des avantages en matière de gestion de l’espace, de sécurité (moins de trajets domicile-entreprise), de développement durable (moins de pollution), de motivation et de bien-être de leurs personnels. Les horaires aménagés, voire les « core-hours1 », sont également des pratiques de plus e...

  9. “Música em PAS”: music as an evaluation object of the program of serial university entrance examination of University of Brasília (PAS/UnB

    Directory of Open Access Journals (Sweden)

    Maria Cristina de C. C. de Azevedo

    2012-01-01

    Full Text Available This paper discusses the musical proposal to Program of Serial University Entrance Examination of University of Brasília (PAS/UnB. The discussion is based on author’s participation on elaboration, systematization, and review groups of 2001 and 2006 programs, as well her researches and her teacher training activities with PAS. The text presents the program, its evaluation conception and the music-pedagogical principles and purposes that guide the insertion of musical knowledge as compulsory evaluation’s object in the university entrance examination. The last program’s version has adopted an Evaluation’s Matrix with some music competences, abilities and evaluation’s objects. The development of music’s competences and abilities is oriented by a music repertoire that defi- nes the content and should be a way for development of musical practices and experiences (performance, improvisation and composition, reception (musical appraising and context. In this process, the schools and its music teachers are responsible for create learning and teaching situations where the musical experience could be celebrated in sense of to promote a musical significant learning experience and the student’s success in PAS/UnB exams.

  10. Changes in pH and NADPH regulate the DNA binding activity of neuronal PAS domain protein 2, a mammalian circadian transcription factor.

    Science.gov (United States)

    Yoshii, Katsuhiro; Tajima, Fumihisa; Ishijima, Sumio; Sagami, Ikuko

    2015-01-20

    Neuronal PAS domain protein 2 (NPAS2) is a core clock transcription factor that forms a heterodimer with BMAL1 to bind the E-box in the promoter of clock genes and is regulated by various environmental stimuli such as heme, carbon monoxide, and NAD(P)H. In this study, we investigated the effects of pH and NADPH on the DNA binding activity of NPAS2. In an electrophoretic mobility shift (EMS) assay, the pH of the reaction mixture affected the DNA binding activity of the NPAS2/BMAL1 heterodimer but not that of the BMAL1/BMAL1 homodimer. A change in pH from 7.0 to 7.5 resulted in a 1.7-fold increase in activity in the absence of NADPH, and NADPH additively enhanced the activity up to 2.7-fold at pH 7.5. The experiments using truncated mutants revealed that N-terminal amino acids 1-61 of NPAS2 were sufficient to sense the change in both pH and NADPH. We further analyzed the kinetics of formation and DNA binding of the NPAS2/BMAL1 heterodimer at various pH values. In the absence of NADPH, a change in pH from 6.5 to 8.0 decreased the KD(app) value of the E-box from 125 to 22 nM, with an 8-fold increase in the maximal level of DNA binding for the NPAS2/BMAL1 heterodimer. The addition of NADPH resulted in a further decrease in KD(app) to 9 nM at pH 8.0. Furthermore, NPAS2-dependent transcriptional activity in a luciferase assay using NIH3T3 cells also increased with the pH of the culture medium. These results suggest that NPAS2 has a role as a pH and metabolite sensor in regulating circadian rhythms.

  11. Valores morales, empatía e identificación con los personajes de ficción. El universo representativo de “Cuéntame cómo pasó” (TVE Moral Values, Empathy and Identification with Fictional Characters: The Representative Universe at “Cuéntame cómo pasó” (TVE

    Directory of Open Access Journals (Sweden)

    Sebastián SÁNCHEZ CASTILLO

    2012-08-01

    Full Text Available En la presente investigación se muestran los resultados de un estudio de base experimental sobre el análisis de los valores morales presentes en la serie emitida por Televisión Española “Cuéntame cómo pasó”. La discusión se centra en los valores morales como el aspecto nuclear de este constructo audiovisual, en especial en su posible correlación con la identificación de los personajes y la empatía ficcional del formato. En el estudio participaron 47 estudiantes universitarios y 36 personas de más edad, quienes fueron sometidos a unos cuestionarios analíticos anteriores y posteriores al visionado de dos capítulos de la serie televisiva. Tras la aplicación pre-test y post-test de la Escala de Comportamientos Morales Controvertidos, y las escalas EDI (Identificación con los personajes de relatos audiovisuales de ficción e IRI (Interpersonal Reactivity Index, se revela que aunque el sexo y la edad no son factores explicativos, el visionado del capítulo de ficción es capaz de provocar un cambio en la escala moral en los sujetos.AbstractThe present paper contributes the results of an experimental base study on the analysis of the moral values present in “Cuéntame cómo pasó”, a TV series broadcast by public Spanish TV channel TVE-1. Discussion focuses on moral values as the core issue in this audiovisual construct, particularly as they are likely to be related to the format's characters and fictional empathy. 47 undergraduates and 36 older individuals took part in the study, thus being asked to fill in analytical questionnaires both before and after watching some chapters of this TV series. The application of the pre- and post-test in the Morally Debatable Behaviours Scale as well as the Scales of Identification and Empathy with Fictional Characters (EDI and Interpersonal Reactivity Index (IRI reveals that, although gender and age are not explanatory factors, chapter viewing can lead to substantial changes in the viewers

  12. Chemical and isotopic tracing of underground water in relation with leaching of mine spoils, Nord-Pas-de-Calais Coal Basin (France); Tracage chimique et isotopique des eaux souterraines en relation avec les eaux de lixiviation de terrils, bassin minier du Nord-Pas-de-Calais (France)

    Energy Technology Data Exchange (ETDEWEB)

    Denimal, S.; Tribovillard, N.; Meilliez, F. [Lille-1 Univ., Lab. de Sedimentologie et Geodynamique, UMR 8577, 59 - Villeneuve-d' Ascq (France); Barbecot, F.; Dever, L. [Paris-11 Univ., Lab. d' Hydrologie et de Geochimie Isotopique, UMR 8616, 91 - Orsay (France)

    2001-07-01

    Coal mining activity in the Nord-Pas-de-Calais region (Northern France) has generated many mine spoils. The oxidation of the pyrite content of such coal shales and their leaching can be a source of sulfate pollution for the underlying chalk aquifer, i.e. the main drinking water resource of the region. Two sites of study have been retained: one in the free water table zone and the other in the confined water table zone. Samples from both mine spoils have been analyzed with respect to their carbon and sulfur content and a superficial leaching of these elements has been evidenced. Water has been sampled in piezometers and boreholes close to the mine spoils and also along natural flux lines. The use of sulfur isotopes as markers of the different sulfate sources has confirmed the spoils source but has permitted to identify another source in the second site which is the Tertiary gypsum-bearing Ostricourt sands. This study has shown also that in the confined water table zone, part of the exported sulfates is reduced. This bacterial reduction of sulfates is due to a joint leaching of both carbon and sulfur in the mine spoils. A self-purification phenomenon occurs when the chalk aquifer is confined beneath the Cenozoic cover. (J.S.)

  13. LOGEMENT DES PERSONNES ÂGÉES DANS LE PAS-DE-CALAIS. APPROCHE DU RISQUE ET DE SES REPRÉSENTATIONS: L'EXEMPLE DES BÉGUINAGES

    Directory of Open Access Journals (Sweden)

    Sylvie Coupleux-Vanmeirhaeghe

    2010-01-01

    Full Text Available La cuestión de la vivienda de los mayores se confirma por numerosas razones entre las preocupaciones de los elegidos y los arrendadores sociales. Una de las soluciones al envejecimiento de inquilinos del sector social, en Pas-de-Calais, es el «Béguinage», pequeno barrio «cerrado» para personas mayores. Los primeros resultados de dos encuestas llevadas cerca de diferentes actores y presentados en esta contribución permiten acercar los efectos del cierre sobre el sentimiento de seguridad y la vida de los inquilinos, particularmente por el estudio de las representaciones del riesgo de los seniores.

  14. Recenser et étudier le patrimoine religieux du XXe siècle : l’exemple de l’inventaire des églises du Nord-Pas-de-Calais (1945-2000

    Directory of Open Access Journals (Sweden)

    Céline Frémaux

    2009-11-01

    Full Text Available La seconde moitié du XXe siècle fut une période de mutation accélérée de l’architecture religieuse en France. L’inventaire des églises paroissiales reconstruites et construites dans la région Nord-Pas-de-Calais entre 1945 et 2000 en reflète les divers aspects. Le corpus de 183 églises servant de base à une thèse de doctorat révèle l’effort d’adaptation de l’Église aux mutations historiques, économiques et sociales de cette périodeThe second half of the 20th century was a time of tumultuous changes in French religious architecture. The survey of parish churches built in the Nord-Pas-de-Calais region between 1945 and 2000 reflects all these changes. The corpus of 183 churches, on which a thesis has been based, reveals the church’s ability as an institution to adapt to the historical, economic and social changes of its time.

  15. Regional prospective and strategy for energy. A comparison of scenarios for the Pays-de-la-Loire, Nord-Pas-de-Calais, and Provence-Cote-d'Azur regions

    International Nuclear Information System (INIS)

    Fink, Meike

    2014-01-01

    A report proposes an overview of prospective studies in France. It discusses the criteria which distinguish various prospective scenarios, comments the emergence of a shared and common vocabulary for prospective studies, proposes a historical overview of prospective studies on energy in France, and a qualitative comparison of ten prospective regional studies in France. In a second part, it reports a data-based and qualitative analysis of scenarios for three regions (Pays de la Loire, Nord Pas de Calais, and Provence-Alps-Cote d'Azur): methodology, context of elaboration of prospective studies and comparison of scenarios in the three regions, data for years of reference, used variables, compliance with national commitments, application to different sectors (industry, agriculture, building, transports), analysis of energy supply. A first version of this report is provided

  16. Žemės dirbimo intensyvumo, šiaudų ir žaliosios trąšos įtaka agroekosistemos komponentams miežių pasėlyje

    OpenAIRE

    Balandė, Monika

    2013-01-01

    Magistrantūros studijų baigiamajame darbe pateikiami pasėlio sudygimo, tankumo, piktžolėtumo tyrimo duomenys skirtingo intensyvumo žemės dirbimo, padengimo šiaudais ir žaliąja trąša laukeliuose. Stacionarus dviejų veiksnių eksperimentas vykdomas nuo 1999 metų. Tyrimai buvo vykdomi nuo 2011 - 2012 m. Eksperimentas buvo vykdomas pagal tokią schemą: A veiksnys: Šiaudų įterpimas: šiaudai pašalinti (-Š), šiaudai susmulkinti ir paskleisti (+Š). B veiksnys: Žemės dirbimo sistemos. Atlikus tyr...

  17. Appréhension du sentiment épilinguistique à travers la textualisation d'un fait de langue: ne vs ne... pas dans les Pensées de Pascal

    Directory of Open Access Journals (Sweden)

    Molard-Riocreux Ingrid

    2012-07-01

    Full Text Available L’étude de la négation en langue classique est sans doute le domaine de la recherche qui cristallise le mieux l’opposition entre illusion du chaos et illusion téléologique, les deux présupposés théoriques majeurs de la linguistique historique. La confrontation des thèses les plus marquantes permet de mettre au jour les preuves d’une orientation, plus ou moins assumée selon les cas, vers l’un ou l’autre de ces deux postulats. La conséquence est double : d’abord, il semble impossible de déterminer pourquoi tel auteur de langue classique emploie en telle occasion la négation pleine plutôt que simple (ou l’inverse et il paraît même illégitime de poser la question en croyant pouvoir y répondre ; ensuite, la possibilité même d’une stylistique historique est invalidée par principe. Il convient donc d’examiner le problème sous un angle nouveau. En combinant, à l’échelle d’une œuvre aussi riche et diverse que les Pensées, différents niveaux d’analyse — statistique lexicale, relevés d’occurrences, étude de tous les cas particuliers (encore trop souvent regardés comme des exceptions — et en confrontant cette œuvre à des écrits de la même époque, on voit apparaître des options très marquées, des choix d’auteur, que ne paraît pas pouvoir expliquer seule la tendance dominante chez les locuteurs du temps, mais qui témoignent bien plutôt d’un véritable sentiment épilinguistique et de son corollaire que l’on pourrait appeler la conscience stylistique. Surtout, il devient possible d’affirmer avec un haut degré de certitude que l’opposition entre négation simple et négation pleine, quoique non théorisée, était perçue dès l’époque classique mais pas nécessairement (ou pas uniquement en termes de force et de renforcement, comme on aurait pu le penser. Les critères les plus opératoires semblent bien plutôt de nature sémantico-énonciative et argumentative.

  18. Actinide(IV) and actinide(VI) carbonate speciation studies by PAS and NMR spectroscopies. Yucca Mountain Project: Milestone report 3031-WBS 1.2.3.4.1.3.1

    International Nuclear Information System (INIS)

    Clark, D.L.; Ekberg, S.A.; Morris, D.E.; Palmer, P.D.; Tait, C.D.

    1994-09-01

    Pulsed-laser photoacoustic spectroscopy (PAS) and Fourier-transform nuclear magnetic resonance (NMR) spectroscopy were used to study speciation of actinide(IV) and actinide(VI) ions (Np, Pu, Am) in aqueous carbonate solutions vs of pH, carbonate concentration, actinide content, and temperature. PAS focused on Pu(IV) speciation. Stability fields on a pH (8.4 to 12.0) versus total carbonate content (0.003 to 1.0 M) plot for dilute Pu(IV) carbonate species ([Pu] tot = 1 mM) were mapped. Four plutonium species, with absorption peaks at 486, 492, 500, and 512 nm were found. Loss of a single carbonate ligand does not account for the difference in speciation for the 486 and 492 nm absorption peaks, nor can any of the observed species be identified as colloidal Pu(IV). NMR data have been obtained for UO 2 2+ , PuO 2 2+ and AmO 2 2+ . This report focuses on results for PuO 2 2+ . The ligand exchange reaction between free and coordinated carbonate on the PuO 2 (CO 3 ) 3 4- systems has been examined by variable temperature 13 C NMR spectroscopy. In each of the six different PuO 2 (CO 3 ) 3 4- samples, two NMR signals are present, one for the free carbonate ligand and one for the carbonate ligand coordinated to a paramagnetic plutonium metal center. The single 13 C resonance line for coordinated carbonate is consistent with expectations of a monomeric PuO 2 (CO 3 ) 3 4- species in solution. A modified Carr-Purcell-Meiboom-Gill NMR pulse sequence was used for determining of ligand exchange parameters for paramagnetic actinide complexes. Eyring analysis at standard conditions provided activation parameters of ΔH = 38 KJ/M and ΔS = -60 J/K for the plutonyl triscarbonate system, suggesting an associative transition state for the plutonyl(VI) carbonate complex self-exc

  19. Mārketinga pasākumu nozīme starptautiska zīmola atpazīstamības veicināšanai Latvijā

    OpenAIRE

    Ozoliņš, Arnis

    2012-01-01

    Darba tēmas izvēle ir saistīta ar būtisku mūsdienu ekonomikas iezīmi - marketinga aktivitāšu un zīmola mijiedarbību. Autors šajā darbā izvirza mērķi noskaidrot starptautiska zīmola atpazīstamības veicinošos faktorus, ir apzinājis zīmola Nike darbību Latvijā, iepazinies ar SIA Sportland mārketinga aktivitātēm un analizējis zīmola izplatību veicinošos pasākumus. Mērķa sasniegšanai tika izvirzīti uzdevumi: noskaidrot mārketinga vidi un preces izvēli veicinošos faktorus, izpētīt un analiz...

  20. Darba vides riski farmācijas pētniecības laboratorijās, aizsardzības un preventīvie pasākumi

    OpenAIRE

    Veidemane, Agnese

    2017-01-01

    „Darba vides riski farmācijas pētniecības laboratorijās, aizsardzības un preventīvie pasākumi”. Darba autore: A.Veidemane. Darba zinātniskais vadītājs: prof. Dr. chem. A.Vīksna. Maģistra darbs izklāstīts uz 100 lpp., ietver 51 attēlus, 19 tabulas, 80 literatūras avotus, 18 pielikumus. Pētījums sastāv no trīs daļām. Pirmajā daļā ir apkopota un analizēta literatūra par izplatītākajiem riskiem farmācijas pētniecības laboratorijās, aplūkota to ietekme uz veselību un nodarbināto darbspējām. Darb...

  1. Psihosociālo risku ietekme uz nodarbinātajiem izglītības iestādē. Preventīvie pasākumi

    OpenAIRE

    Reine, Inga

    2013-01-01

    Maģistra darbs,, Psihosociālo risku ietekme uz izglītības nozarē strādājošajiem. Preventīvie pasākumi” izstrādāts ar mērķi analizēt psihosociālos riskus Latvijas izglītības sistēmā kopumā un to ietekmi uz pedagoga arodveselību un darbaspējām.Darbā apkopota informācija un dažādu autoru teorētiskās nostādnes par psihosociālajiem riskiem, pētīta stresa ietekme uz cilvēka veselību un darba kvalitāti.Maģistra darba praktiskajā daļā tiek veikta Rīgas Centra sākumskolas pedagogu kolektīva darba vi...

  2. A loss-of-function mutation in the PAS kinase Rim15p is related to defective quiescence entry and high fermentation rates of Saccharomyces cerevisiae sake yeast strains.

    Science.gov (United States)

    Watanabe, Daisuke; Araki, Yuya; Zhou, Yan; Maeya, Naoki; Akao, Takeshi; Shimoi, Hitoshi

    2012-06-01

    Sake yeast cells have defective entry into the quiescent state, allowing them to sustain high fermentation rates. To reveal the underlying mechanism, we investigated the PAS kinase Rim15p, which orchestrates initiation of the quiescence program in Saccharomyces cerevisiae. We found that Rim15p is truncated at the carboxyl terminus in modern sake yeast strains as a result of a frameshift mutation. Introduction of this mutation or deletion of the full-length RIM15 gene in a laboratory strain led to a defective stress response, decreased synthesis of the storage carbohydrates trehalose and glycogen, and impaired G(1) arrest, which together closely resemble the characteristic phenotypes of sake yeast. Notably, expression of a functional RIM15 gene in a modern sake strain suppressed all of these phenotypes, demonstrating that dysfunction of Rim15p prevents sake yeast cells from entering quiescence. Moreover, loss of Rim15p or its downstream targets Igo1p and Igo2p remarkably improved the fermentation rate in a laboratory strain. This finding verified that Rim15p-mediated entry into quiescence plays pivotal roles in the inhibition of ethanol fermentation. Taken together, our results suggest that the loss-of-function mutation in the RIM15 gene may be the key genetic determinant of the increased ethanol production rates in modern sake yeast strains.

  3. Ceci n'est pas une pipe

    Directory of Open Access Journals (Sweden)

    Luis Rojo de Castro

    2012-12-01

    Full Text Available

    Resumen

    El texto propone una reflexión descriptiva de los procesos de descontextualización de los objetos propios de la cultura moderna, iniciando el recorrido en las imágenes del Museo Etnográfico del Tocadero de París, fundado en 1878 y  transformado en el Museo del Hombre en 1930. La tesis del artículo es desvelar los mecanismos culturales y productivos de descontextualización y re‐contextualizacion propios del siglo XX, usando como soporte las imágenes originales del Museo Etnográfico, de los estudios de artistas como Braque, Breton o Picasso, y de espacios urbanos de la época (Pasajes y Galerías.
    Todas estas fotografías tienen algo en común: nos ofrecen espacios interiores e interiorizados, en los que los objetos se  agrupan y flotan con sorprendente autonomía. Son los  fragmentos de otras culturas, de otros sistemas, que ahora se ‘coleccionan’ unos junto a otros como fragmentos. Ajenos a su función original, descontextualizados de su entorno original,  ocupan el espacio obligados a participar en un sistema de  relaciones que los objetualiza, los hace opacos, los separa de su origen y de su ‘naturaleza’. De una función activa –cultural,  semiótica, social, etc.‐ han pasado a una función pasiva. Han perdido el significado que les era propio, y ahora esperan que el observador les dote de uno nuevo fruto de la relación construida entre ambos, los sitúe en un nuevo lugar.
    Esta técnica del ‘extrañamiento y la fragmentación’ provoca el  desmembramiento que subyace en el "sistema de los objetos" propio de nuestro tiempo, en el que la coherencia de los  sistemas de relaciones (propia de cada lugar se ha sustituido por la exuberancia de la producción y la simulación de la experiencia.

    Palabras clave

    descontextualización, imágenes, mecanismos, colección, lugar

    Abstract

    This article proposes a descriptive reflection on the processes of decontextualization of objects pertaining to modern culture. It starts its journey with images of the Ethnographic Museum at the Trocadero in Paris, founded in 1878 and transformed into the  Museum of Man in 1930. The thesis of the article is about  uncovering the cultural and productive mechanisms of  decontextualization and re‐contextualization characteristic of the 20th century, based on the original images of the Ethnographic Museum and of artists such as Braque, Breton or Picasso, along with images of urban spaces from that particular period of time  (galleries and arcades.
    All these photographs have something in common: they offer us interior and interiorized spaces in which objects are grouped together and float with a surprising degree of autonomy. They  are fragments from other cultures, other systems, that are now “collected” together next to other fragments. Alien to their  original function, decontextualized from their original  environment, they now share a common space, forced to  participate in a system of relations that turns them into objects, makes them opaque, and separates them from their origin and  “nature.” From an active role (cultural, semiotic, social, etc., they have gone to play a passive role. They have lost the meaning that belonged to them, and now they wait for the  observer to endow them with the new fruit of the relationship created between them, which will take them to a new place.
    This technique of 'strangeness and fragmentation' causes the dismemberment underlying "system objects" of our own time, in which coherence of relations systems (specific to each place has been replaced by the exuberance of simulating production and  experience.

    Key words

    decontextualization, images, mechanisms, collection, place

  4. Pas på? Science kom...?

    DEFF Research Database (Denmark)

    Kinnerup, Lars Bo

    2012-01-01

    tværgående, projektorienteret undervisning indenfor rammerne af de eksisterende fag, herunder også fx historie og samfundsfag. Denne artikel er hverken for eller imod science. Jeg vil i stedet forsøge, at tegne et billede af nogle muligheder for at positionere geografi anderledes end det er i dag, bl.a. ved......Der har i de senere år været sagt og skrevet en del om en eventuel indførelse af et science-fag i folkeskolen – og dermed også på læreruddannelsen. I Geografisk Orientering 2012/2 er Geografforbundets ståsted således klargjort i en tydelig afvisning af science-faget sammen med et forslag om mere...... at se på hvordan fagene ser ud i lande, der har science gennem hele skoleforløbet....

  5. Pas de remède miracle

    International Development Research Centre (IDRC) Digital Library (Canada)

    publiques. Toutefois, l'éloignement, le manque d'éducation, les barrières linguistiques et la discrimination constante empêchent les populations autochtones d'exercer pleinement leurs droits. En 2007, une coalition dirigée par le Centro de Estudios para la Equidad y Gobernanza en los Sistemas de Salud a entrepris.

  6. CERN Entrepreneur Mixer | 21 June | Pas perdus

    CERN Multimedia

    2016-01-01

      CERN Knowledge Transfer group is hosting an Entrepreneur Mixer, an event dedicated to building bridges between CERN innovative entrepreneurs. This will be a unique opportunity to discover business projects initiated by former CERN people, and to see how CERN technology is being exploited by start-up companies. The deadline for registration is Friday, 17 June. For more information, please visit the Indico page of the event: https://indico.cern.ch/event/537167/

  7. Forêt et conservation des dunes littorales : le cas exemplaire de la Réserve biologique domaniale de la Côte d'Opale (Pas-de-Calais

    Directory of Open Access Journals (Sweden)

    Yves Petit-Berghem

    2012-02-01

    Full Text Available La Réserve biologique domaniale de la Côte d’Opale représente en France l’un des rares systèmes dunaires marqués par la libre expression des processus dynamiques. La mobilité du site garantit le renouvellement et la diversité des biotopes et donc des habitats et des espèces qui leur sont associées. Comme toute réserve, il s’agit d’un espace réglementé où les actions de gestion sont orientées dans un sens conservatoire et strictement contrôlées. La difficulté des gestionnaires est aujourd’hui de définir un objectif à plus long terme de cette réserve. Quelles sont les structures partenaires à privilégier ? Quel degré d’ouverture au public ? Quelles sont les pistes de recherche à développer ? Comment concilier une politique de conservation écologique avec un développement durable du territoire ? Ces différents questionnements appellent une réflexion entre nature et société et renvoient à la gouvernance des territoires et à la place de l’homme dans son environnement.The coastal dunes of the Pas-de-Calais area (dunes of Berck-Merlimont with the « Réserve biologique domaniale de la Côte d’Opale », northwest France is one of the few dune systems in France characterized by the free expression of dynamic processes. The mobility of the site ensures the renewal and diversity of dune environments and thus habitats and species associated with them. Like any reserve, it is a regulated area where management actions are oriented in one direction (conservation management and strictly controlled. The challenge for managers today is to define a longer-term objective of this reserve. What are the working partners for which it would be possible to collaborate? What degree of openness to the public? What are the research topics to develop? How to reconcile a policy of environmental conservation with sustainable territorial development? These questions require a discussion between nature and society and

  8. La Presse ecrite pas a pas (The Printed Media, Step by Step).

    Science.gov (United States)

    Nott, David

    1985-01-01

    Argues that effective use of the print media in French instruction requires considerable preparation and participation on the teacher's part. A variety of exercises for thematic and lexical awareness, comprehension, guided production, autonomous production, simulation, grammar development, and other objectives are suggested. (MSE)

  9. Être là ou ne pas être là – esquisse de typologie du spectral dans quelques œuvres littéraires occidentales contemporaines

    Directory of Open Access Journals (Sweden)

    Catherine Grall

    2017-06-01

    Full Text Available Abrstact (english Contemporary realistic fiction sometimes includes features which echo ancient ghost tales. Some characters come back after their death, other experience great difficulties inhabiting the present, as if they were haunted. Can we suggest and interpret a categorization of such novels ? A varied corpus enables us to make a few hypotheses, to be explored in further  research developments. Novels in French, English, Spanish, Portuguese, German or Serbian reveal at least three non exclusive groups : the past, other  cultures, unaccomplished revolutions trouble realistic writings, that can be enlightened by theories of the novel (Ricœur, Pavel, theses taken from aesthtetics (Warburg, Foster, Didi-Hubermann, ideas coming from cultural studies and philosophy (Bhabha, Zizek, Derrida. Through such fictions, the reader is confronted with radical forms of alterity which he cannot ignore. It is a new « ideographic » dimension (to borrow Pavel’s word in La Pensée du roman, in which the paradigm of actions is replaced by pathetic patterns which take on broader social and ethical issues.   Résumeé (français La fiction contemporaine soucieuse du monde actuel accueille parfois, de manière paradoxale, des phénomènes qui font penser aux récits de fantômes anciens : certains  personnages sont des revenants, d’autres, comme hantés, éprouvent de vraies difficultés à vivre au présent. Peut-on définir une typologie de ces personnages et celle-ci peut-elle être interprétée? Un corpus assez varié permet d’esquisser des hypothèses, à développer dans un travail plus ample. Des romans de langues française, anglaise, espagnole, portugaise, allemande, serbe révèlent au moins trois grandes catégories, qui ne sont pas exclusives : le passé, l’autre culture, la révolution non accomplie travaillent des écritures que l’on peut éclairer grâce à des théories du roman (Ricœur, Pavel, des emprunts à l

  10. “L’homme qui n’élève pas ses enfants ne devrait pas être appelé un père” ? Les tendances du discours sur la paternité et le dilemme paternel au Japon “The Man who Doesn’t Raise his Child Shouldn’t Be Called a Father”? The Trends of Discourse on Fatherhood and Father’s Dilemma in Japan

    Directory of Open Access Journals (Sweden)

    Futoshi Taga

    2011-03-01

    Full Text Available La paternité japonaise a longtemps été caractérisée par un engagement professionnel exacerbé et une absence marquée au niveau familial. Cependant, le contexte économique et politique récent a induit certains changements dans la manière d’appréhender la paternité. Il est ainsi possible d’identifier trois types de positionnements dans les discours récents relatifs à la paternité au Japon : 1 le père “pourvoyeur”, garantissant les ressources économiques nécessaires aux besoins des enfants, 2 le père “socialisateur”, encadrant ses enfants dans l’apprentissage des normes sociales, 3 le père “soigneur”, aidant ses enfants pour ce qu’ils ne peuvent faire. Il n’est pas facile pour les pères de trouver un équilibre par rapport aux responsabilités que ces trois approches supposent. Les codes professionnels valorisant “l’homme dominant” et les carences du système d’encadrement des enfants obligent de nombreux pères à s’investir énormément dans leur vie professionnelle tandis que de nombreuses mères restent à la maison. Les réactions des pères face à cette situation sont variées. Certains valorisent une division genrée des responsabilités parentales et se consacrent pleinement à leur travail. D’autres articulent travail et famille tandis que l’épouse reste à la maison. D’autres, enfin, optent pour une articulation travail/famille impliquant les deux membres du couple, redéfinissant ainsi la signification de la masculinité.Japanese fatherhood has been characterized as preoccupation with work and alienation from family. However, Japan’s recent political and economic conditions have brought about changes and diversification in fatherhood. We can recognize three types of father’s responsibilities in recent discourses on fatherhood in Japan : 1 “provider,” supplying necessary economic resources for the growth of children, 2 “socializer,” supporting children to learn

  11. Experimentação e uso regular de bebidas alcoólicas, cigarros e outras substâncias psicoativas/SPA na adolescência Experimentation and regular use of alcoholic beverages, cigarettes and other Psychoactive Substances (PAS during adolescence

    Directory of Open Access Journals (Sweden)

    Maria Conceição O. Costa

    2007-10-01

    Full Text Available OBJETIVO: analisar o uso de bebidas alcoólicas, cigarros, outras substâncias psicoativas - SPA e fatores de risco entre adolescentes das escolas de um município com 500 mil/hab., Bahia/Brasil. MÉTODO: estudo transversal, com amostra aleatória, estratificada por conglomerado com adolescentes de 14 a 19 anos, totalizando 10 escolas públicas e 1.409 alunos de Feira de Santana. O instrumento auto-aplicável foi elaborado segundo a OMS e outros estudos nacionais adequados à faixa adolescente, com rigoroso procedimento, garantindo anonimato e sigilo. RESULTADOS: 86,5% dos adolescentes consideravam-se bem informados sobre SPA, a maioria por TV, rádio e escola; 57,0% relataram uso de bebidas alcoólicas, principalmente cervejas e vinhos; 23,3% usavam cigarros e 5,2% outras SPA (cânabis, solventes e cocaína; 29,3% usavam bebidas uma a três vezes/mês e 13% todo final de semana. Na faixa de 10 a 14 anos, 47% experimentaram bebidas e 16,7% outras SPA. A razão de prevalência (RP mostrou consumo de bebidas, cigarros e outras SPA significantemente maiores na faixa 17 a 19 anos e sexo masculino. A curiosidade foi a principal motivação; na companhia de amigos e pais; festas e casas de colegas. CONCLUSÕES: A Necessidade de institucionalização de atividades adequadas nas escolas à prevenção do uso das SPA entre jovens.OBJECTIVE: To analyze the use of alcoholic beverages, cigarettes, other psychoactive substances - PAS , among adolescents of public schools of Feira de Santana, Bahia/Brazil. METHOD: Cross sectional study with random samples, stratified in terms of conglomerate units (schools and students. The sample of the study totalled 1,409 adolescents between 14 and 19 years old from 10 public schools; 30% of the total of schools of the municipality with 500,000/inhabitants. The representation of schools and students was respected. The self-report instrument was elaborated according to OMS recommendations and as used in others studies1

  12. Which place for nuclear power? The cost of power supplies security. The tariffs of power networks use. Towards a new regime of natural gas transportation in France. The mastery of raw materials supplies. The behaviour of the estate park of the collieries of the Nord-Pas-de-Calais basin

    International Nuclear Information System (INIS)

    Mattatia, St.; Bonnet, J.Ph.; Singly, B. de; Philippe, R.; Thouvenin, V.; Clain, Y.; Dalnoky, M.

    2002-01-01

    This issue of 'Energies et Matieres Premieres' quarterly newsletter comprises 6 articles dealing with: the share of nuclear power in the future world and French energy status (environmental and economical aspects, service life of nuclear power plants and coming up renewal, uncertainties); the cost of the security of power supplies (the improvement of power networks after the 1999 storms, the burial of power lines); how to charge for the uncatchable: the tariffs of use of power networks (the uncatchable notion of electricity transport, the first proposals of the French commission of electric power regulation (CRE), the general principles of tariffing and their practical implementation); towards a new regime of natural gas transportation in France (a legal regime that became singular inside the European Union, a careful financial evaluation of concessions, the new regime of transport permission); the mastery of raw materials supplies: a giant world scale 'Go' game (the Chinese control of the tungsten file, the titanium market, the policy of security of supplies for the sensible raw materials); the behaviour of the estate park of the old collieries of Nord-Pas de Calais region (northern France) belonging to the national group 'Charbonnages de France' (context and implementation of the transfer). The status of the evolution of the French energy consumption and bill since January 2000 is presented in a series of graphics at the end of this issue. (J.S.)

  13. Social-historical memory about soviet the pas: empiric research

    Directory of Open Access Journals (Sweden)

    E. G. Pozdnyakova­Kirbatyeva

    2014-06-01

    Also considered komomeratyvni properties attitude to the soviet past in the population of different regions of the country and the most general description of the memory of the soviet past, namely the degree of interest of the population of different regions to the past.

  14. Une rencontre PAS comme les autres | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    15 oct. 2010 ... Dans ce récit à la première personne, Angelica Ospina, administratrice de programmes principale au CRDI , raconte sa rencontre avec Orlando, un jeune graphiste péruvien remarquable qui lutte en première ligne contre le VIH/sida dans son pays. Angelica a fait la connaissance d'Orlando et d'autres ...

  15. 'Des Yeux Qui Ne Voient Pas...': The smartphones

    Directory of Open Access Journals (Sweden)

    Luca Di Lorenzo

    2018-04-01

    Full Text Available Three of the most influential chapters of Le Corbusier’s Vers une Architecture are collected under the common title ‘Des yeux qui ne voient pas…’ (Eyes which do not see…. Liners, airplanes, and automobiles are shown as the expression of the powerful beauty of practical form: honest, simple, functional and technological. These very famous pages remind us that form is not only derived from precise typological choices or from reasoned morphogenetic diagrams, but it could also be a direct expression of the Kunstwollen. What are the paquebots of the twenty-first century? Which buildings embody this new paradigm? This graphic analysis starts from the statement that one of the ‘not seen’ features of this era is the smartphone. The subject of the survey is the first BMW Guggenheim Lab, designed in 2010 by Atelier Bow-Wow. Described by the architects themselves as a ‘travel toolbox’ or ‘pop-up fly loft theatre in the city’, this compact architecture is the incarnation of three interesting formal qualities usually associated with smartphones: the clear division between the hardware and the ergonomic user interface; the possibility to operate different functions (or software in the same space (or screen; and the real and virtual connection with different urban situations.

  16. The Nifl PAS domain: Insight into its structure and function

    NARCIS (Netherlands)

    Hefti, M.H.

    2003-01-01

    Azotobacter vinelandii is an aerobic soil-dwelling organism with a wide variety of metabolic capabilities which include the ability to fix atmospheric nitrogen by converting it to ammonia. The biosynthesis of ammonia is controlled by 15 to 20 different nif gene products. The activation

  17. n gereformeerd-narratiewe pas- torale terapie 1. probleemstelling

    African Journals Online (AJOL)

    Worldview Lifestyle” te Yalta, Crimea. MORGAN A. 2000. What is narritive therapy? Adelaide: Dulwich Centre Publ. MÜLLER, J. 2004. A narrative-based pastoral conversation following the experience of trauma. Praktiese Teologie in SA 19(1):77-88 ...

  18. Intuition and Creativity: A Pas de Deux for Qualitative Researchers.

    Science.gov (United States)

    Janesick, Valerie J.

    The importance of intuition and creativity in qualitative research is discussed. By discussing lessons learned from well-known creative individuals, it is possible to find ways to open a conversation on creativity. Since the researcher is the research instrument in qualitative research projects, the definition of the role of the researcher is…

  19. La couverture musicale ne couvre pas le social

    OpenAIRE

    Hemptinne, Pierre

    2004-01-01

    Je voudrais reprendre ici quelques éléments d’un travail d’écriture et de notes entamé pour cerner ce que j’appelle le « métier d’écouter ». Un métier qui commence bien avant l’écoute proprement dite, par l’examen de tout ce qui environne l’écoute. J’utilise la notion de « métier » pour me tenir à l’écart de toute la sphère un peu irrationnelle qui entoure l’utilisation des sens et des émotions, pour positionner cette activité dans le cadre d’une objectivation des connaissances qu’elle peut c...

  20. LA BD EN CLASSE DE FLE ? POURQUOI PAS !

    Directory of Open Access Journals (Sweden)

    Ana-Marina Tomescu

    2009-11-01

    Full Text Available Dans la présente étude nous allons essayer de démontrer que la BD représente certainement un phénomène de civilisation, qui donne la possibilité aux apprenants d’une langue étrangère de mieux comprendre un comportement culturel spécifique. Elle aide les apprenants à améliorer leur compétence socio-culturelle, parce qu’elle fait ressortir des éléments de civilisation pertinents, des clichés fréquemment rencontrés dans le monde francophone. La langue utilisée dans les BD est le français de tous les jours, l’accent est mis sur la conversation dans les plus diverses situations et à l’aide des registres de langue différents. Ce sont des motifs suffisants qui recommandent l’utilisation de la BD en classe de FLE, sans oublier de mentionner un atout essentiel : l’humour.

  1. Process, Voltage and Temperature Compensation Technique for Cascode Modulated PAs

    DEFF Research Database (Denmark)

    Sira, Daniel; Larsen, Torben

    2013-01-01

    , that represents a transistor level model (empirical model) of the cascode modulated PA, is utilized in a PA analog predistorter. The analog predistorter linearizes and compensates for PVT variation of the cascode modulated PA. The empirical model is placed in the negative feedback of an operational...... transconductance amplifier. The predistorted varying envelope signal is applied to the cascode gate of the PA. It is shown that the proposed PVT compensation technique significantly reduces the PVT spread of the PA linearity indicators and improves the PA linearity. Simulations were performed in a 0.13 μm CMOS...

  2. Interpretation of the French negation ne…pas

    DEFF Research Database (Denmark)

    Nølke, Henning

    2017-01-01

    .), I distinguish three interpretation types of sentence negation, and I propose a polyphonic analysis according to which the polemic use is fundamental. e metalinguistic and descriptive negations are derived from this primary value. I show that this pragmatic semantic analysis has some precise...

  3. Pourquoi la Commission de la santé et de la sécurité du travail du Québec n’est pas le premier recours des enseignantes et des préposées à l’aide domestique ayant des lésions professionnelles

    Directory of Open Access Journals (Sweden)

    Nancy Guberman

    2005-05-01

    Full Text Available Cet article examine les motifs de deux groupes de travailleuses pour s’adresser ou pas à la Commission de la santé et de la sécurité du travail du Québec (CSST pour des lésions perçues comme étant liées au travail. Il est basé sur des entrevues qualitatives auprès de 16 enseignantes et de 16 préposées à l’aide domestique. Pour les deux groupes, les motifs de non-recours incluent la croyance que la CSST existe essentiellement pour les accidents et les retraits préventifs des femmes enceintes, l’image de la CSST comme un organisme qui accorde difficilement des indemnisations ainsi que la difficulté perçue de prouver le lien entre le travail et le problème de santé. Pour les préposées, le manque à gagner entre les prestations et le revenu d’emploi est aussi un facteur tandis que pour les enseignantes l’accès relativement facile à une assurance salaire joue contre le recours à la CSST. De plus, pour bien comprendre les choix des répondantes, il faut tenir compte de leur rapport à leur emploi et à leur santé et de la culture de leur milieu de travail.This article examines the motives behind the decisions of two groups of workers on whether or not to submit claims to the Workers’ Compensation Board (CSST for perceived work-related accidents or illnesses. It is based on qualitative interviews with 16 teachers and 16 cleaners. For both groups, motives for not making claims include the belief that the CSST is essentially for accidents and preventive work withdrawal for pregnant women, the view that compensation is difficult to obtain from the CSST, as well as a perceived difficulty of proving a relationship between their work and their health problem. For the cleaners, the difference between the compensation and employment income is also a factor, while for teachers, the fact that they have relatively easy access to wage-replacement insurance is one reason they do not submit claims to the CSST. To better

  4. « Nous le verrons plus bas », « voir ci-dessus », « je ne reviens pas ici » : retours sur les propriétés de la langue écrite

    Directory of Open Access Journals (Sweden)

    Lefebvre Julie

    2014-07-01

    Full Text Available La présente communication porte sur des séquences du type de « je ne reviens pas ici sur » ou encore « nous verrons plus loin que » qui, comportant un syntagme adverbial soutenant un repérage spatial de type déictique, se présentent comme des suites ordonnées de termes constituant un tout sous le rapport d’une activité de type métadiscursif. Ces séquences prennent pour objet le dire en train de se faire en tant qu’il est écrit et que, en tant que tel, il a des propriétés singulières qui sont celles de la « langue écrite » (Vachek (1939, Catach (éd. (1988, Anis (1988. La nature de l’activité réflexive à l’œuvre dans ces séquences est principalement abordée à travers l’analyse des propriétés de l’emploi déictique de l’adverbe « ici » à l’écrit. L’examen de cette activité est complété par une amorce de description des composés « ci-dessus » et « ci-dessous », des groupes adverbiaux « plus haut », « plus bas » et « plus loin », et des adverbes latins « infra » et « supra ». Enfin, à travers quelques exemples, on montre quelles perspectives ouvre, pour l’analyse des textes et des discours, l’attention portée aux « postures énonciatives » (Authier-Revuz, 1995/2012 qui se dessinent dans ces séquences témoignant du rapport du locuteur — scripteur, en l’occurrence — à son « dire écrit ».

  5. [Effect of a Physical activity program on self-esteem in subjects with chronic diseases. 'Pas a Pas' community intervention trial].

    Science.gov (United States)

    Villalobos, Felipe; Vinuesa, Angels; Pedret, Roser; Reche, Alicia; Domínguez, Eva; Arija, Victoria

    2018-05-01

    To evaluate the effectiveness of a 9 months of supervised Physical Activity (PA) Program with sociocultural activities, on self-esteem and its association on the control of chronic diseases in adult primary care users. Multicenter, randomized, controlled community intervention. 4 Primary care centers in Reus-Tarragona, Spain. 364 subjects, randomized to the Control Group (CG=104) and Intervention Group (IG=260). Supervised walking program of 120min/week with sociocultural activities once a month. At baseline and at post-intervention we assessed: PA (IPAQ-S), self-esteem (Rosenberg scale) and cardiovascular indicators: smoking, systolic (SBP) and diastolic (DBP) blood pressure, serum LDL and HDL cholesterol, and serum glucose. Sociodemographic characteristics and diagnostic of chronic diseases are recorded. The Program increased the PA in the IG (P=.001), while it decreased in the CG (P=.002), and also the self-esteem in the group of participants (1.28 points, P=.006) and in the groups with diagnoses of hypertension (1.60 points, P=.005), dyslipidemia (1.62 points, P=.012), excess weight (1.24 points, P=.011) or anxiety/depression (1.53 points, P=.045), assessed by multivariate statistical models. The increase in self-esteem during the intervention decreased SBP -0.5mmHg (P=.030) in the hypertension group, regardless of baseline SBP and the effect of the intervention. The PA program increased the PA and self-esteem in adult primary care users. The increase of self-esteem improved the control of SBP in hypertensive patients. Copyright © 2018 The Authors. Publicado por Elsevier España, S.L.U. All rights reserved.

  6. Organisatiecultuur en performance management : pas op voor het Pavlov-effect

    NARCIS (Netherlands)

    Nieboer, Stephanie

    Dit artikel bespreekt de relatie tussen organisatiecultuur en performance management. De auteurs stellen dat gedrag niet op zichzelf staat, maar wordt gevormd door onderliggende waarden en overtuigingen. Om performance management in de praktijk succesvol te laten zijn, moet het worden opgenomen in

  7. EGNOS Monitoring Prepared in Space Research Centre P.A.S. for SPMS Project

    Science.gov (United States)

    Swiatek, Anna; Jaworski, Leszek; Tomasik, Lukasz

    2017-12-01

    The European Geostationary Overlay Service (EGNOS) augments Global Positioning System (GPS) by providing correction data and integrity information for improving positioning over Europe. EGNOS Service Performance Monitoring Support (SPMS) project has assumed establishment, maintenance and implementation of an EGNOS performance monitoring network. The paper presents preliminary results of analyses prepared in Space Research Centre, Polish Academy of Sciences (Warsaw), as one of partners in SPMS project.

  8. Non-superconducting persistent currents. Des courants permanents mais pas supraconducteurs

    Energy Technology Data Exchange (ETDEWEB)

    Benoit, A; Mailly, D

    1993-03-01

    Forecasted ten years ago a quantum effect is evidenced: persistent currents in small non-superconducting loops in a magnetic field at low temperature. The loop (diameter 2.5 micrometer) is etched in a semiconducting structure GaAs/GaAlAs, where the coherence length is 25 [mu]m, the current is measured with a squid on the same chip, a value of 4 nano amps is found which agrees well with the theoretical value of 5 nA.

  9. Effect of hydrothermal modification on the structure of REY zeolite studied by PAS

    International Nuclear Information System (INIS)

    Zhu Jun; Wang Shaojie

    2003-01-01

    The effect of temperature of the hydrothermal modification on the structure of Rare-earth Y zeolite (REY) was studied by positron annihilation spectroscopy. We measured the positron lifetime spectrum as a function of the temperature (300-800 degree C) of one hour hydrothermal modification for the REY zeolite after through pre-heated dehydration at 150 degree C. All lifetime spectra could be resolved into five components. The fifth lifetime component and its intensity were found to be related to the size and number of the secondary pores. The experimental results showed that the secondary pore in REY zeolite was produced by hydrothermal modification in some temperature range, and the largest size and the greatest quantity of the secondary pores were observed in the sample treated at 500 degree C for 1 hour. The effect of hydrothermal modification on REY zeolite without pre-heated dehydration was also discussed

  10. Le salaire minimum n'est pas toujours le meilleur moyen d'accroître ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    4 mai 2016 ... De fait, cette intervention vigoureuse sur le marché du travail est une ... la mobilité des travailleurs entre le secteur structuré et le secteur non structuré, ... On peut certes se constituer rapidement du capital politique en faisant ...

  11. Histoire de ne pas forcement en rire (A Story To Not Necessarily Laugh About).

    Science.gov (United States)

    Lenoble, Martine

    1996-01-01

    A rationale is presented for using humor as a French language teaching tool, and several class activities designed for different language skill levels and using humor as a central element are described. Some suggestions are offered for selecting appropriate instructional materials. (MSE)

  12. Sur les pas de Romain Rolland pyrénéen …

    OpenAIRE

    Brancy , Jean-Yves

    2010-01-01

    International audience; Nous connaissons bien l’attirance de l’écrivain français pour les paysages de montagne qui, dès son plus jeune âge, ont imprimé fortement chez lui le sentiment du grandiose, de la puissance de la nature. C’est dans ces lieux qu’il alla chercher, à différents moments de sa vie, cette « leçon d’énergie et de combat » dont il avait tant besoin pour continuer son action et son œuvre. Un pèlerinage aux sources en quelque sorte, comme chacun pourrait trouver le sien, et aprè...

  13. La flêche du temps pas de retour vers le futur pour les particules

    CERN Multimedia

    CERN Press Office. Geneva

    1998-01-01

    We have all laughed at those fragments of film run backwards, where broken vases miraculously reassemble themselves, or sprinters reverse at full speed into their starting blocks. In the everyday world these things could never happen time's arrow only points forwards. Hitherto, the laws of fundamental physics have seemed to be reversible: a film of elementary particle behaviour run backwards is indistinguishable from the same film run forwards.

  14. Recovery of waste from wind blade manufacturing; Reaproveitamento de residuos da fabricacao de pas eolicas

    Energy Technology Data Exchange (ETDEWEB)

    Toubia, Carim Miguel; Guerrero, Patricia Carla; Mancini, Sandro Donnini [Universidade Estadual Paulista - UNESP, Sorocaba, SP (Brazil)], e-mail: mancini@unesp.br

    2011-07-01

    Large wind turbines are equipped with blades manufactured in a complex process that employs composite ceramic / polymer and consequent generation and disposal of certain waste. Aiming to solve this problem, recycling processes must be applied to reduce the impact of disposal of such waste into the environment and the mechanical recycling, without melting the material, is one of the options for this purpose. The results from characterization tests showed that the waste materials have 40% and 70% fiberglass by weight and that the introduction of 10% waste to a virgin matrix reduces tensile strength by 25% although increases by 30% the modulus of elasticity. Overall, the study can demonstrate the existence of technically feasible solutions to the use of such waste. (author)

  15. Ceci n’est pas une pipe. The architectural drawing between representation and function

    Directory of Open Access Journals (Sweden)

    Claus Peder Pedersen

    2012-11-01

    Full Text Available In The Sciences of the Artificial Herbert A. Simon reflects that “Engineering, medicine, business, architecture, and painting are concerned not with the necessary but with the contingent – not with how things are but with how they might be – in short, with design.” The reflection serves as an introduction to Simon’s attempt at developing a design theory: A theory about the conception of that which differs from what we already know. A theory in a challenged dialog with the contingent. Simon is aware that traditionally, design theory has been orientated towards the establishment of an understanding of the canonized and typical, and that the theory as such should serve as a guideline for what was to be created. Traditionally, the theory has been a reflected list of answers. By way of example, consider how the Neo-Platonic architecture treaties of the Renaissance sought to establish abstract and ideal rules and frameworks to secure any future works. Through repetition of the regular, the work becomes an example of a presumed eternal and essentially true idea. Or consider the ambitions of the modernist town planning, as they were expressed in the resolutions of CIAM as well as in concrete town planning proposals, in which the specific purpose was to transform the town’s quantitative environment into qualitative by means of ‘abstraction and repetition’. The architects of modernism and the Renaissance shared a confidence in the possibilities of the abstraction to establish a template for the individual example. Consequently, both lines of thinking demonstrate confidence that by means of mathematics and the Euclidian geometry, an essential world structure is found which may justify the qualitative validity of abstract rules. And that is precisely why the repetition of the structures and types of the abstraction becomes a design-theoretical imperative. Whilst the Renaissance treaties gave the impression of being carried by an insight into the world’s eternal – divine – structure, the modernists were orientated towards the technological or the natural. However, to some extent the rules were the same, as Colin Rowe pointed out in his famous article, ‘The Mathematics of the Ideal Villa’. Rowe compares– in continuation of Rudolf Wittkower’s Renaissance studies – Palladio’s and Le Corbusier’s basic plans for villas and demonstrates remarkable similarities between the syntactic geometric organizational principles of the plans. To a certain degree, modernism naturalizes the divinely founded rules of the Renaissance. And because of this, it gives rise to expectations that, as is the case with the Renaissance treatises, architectural theory should develop ideas and rules that are valid for the concrete assignment, notwithstanding that they – the rules – are developed in abstract independence of any contingent situation.Those are the types of expectations to the theory that Simon argues against when insisting that the work is contingent. He claims that the individual work differs unpredictably from the rules and typologies that existed prior to the work. However, Simon’s skepticism towards normative design theories does not imply that he finds theoretical work irrelevant for the creation of the contingent. On the contrary, Simon’s ambition is to establish a mutual experimental relation between theory and practice.

  16. Les tribunaux, et non pas les liens de parenté, offrent de meilleures ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    29 janv. 2018 ... Les recherches menées au Bangladesh et en Inde ont révélé que les femmes et les personnes provenant de populations marginalisées ont besoin de tribunaux qui fonctionnent bien pour exploiter leur plein potentiel.

  17. Pas på pastaen fra i går

    DEFF Research Database (Denmark)

    Abildgaard, Inger; Skibsted, Leif Horsfelt

    2017-01-01

    Der kan være bakterier i ris og pasta fra dagen før. En sporedannende bakterie kan vokse frem og danne giftstoffer, når de kogte ris eller den kogte pasta gemmes.......Der kan være bakterier i ris og pasta fra dagen før. En sporedannende bakterie kan vokse frem og danne giftstoffer, når de kogte ris eller den kogte pasta gemmes....

  18. Bertolt Brecht? „Il n’y a pas de hors-texte”

    Directory of Open Access Journals (Sweden)

    Marta Karasińska

    2009-01-01

    Full Text Available With his theory of the epic theatre and its most important category V-Effekt, Bertolt Brecht can be included within precursors of the current of modern reflection on discourse, crisis of representation and transitivity of that which is literary with that which is theatrical, the stage character of the text and textuality of the stage. Disproving of the role of mimesis, the importance of quotation and repetition as rudimentary acting strategy, replacement of great narrations with a fragment, joining a work and a commentary, intertextual games, metatextuality and metatheatricality as a foundation of stage aesthetics encourage us to locate Brecht’s theatrical output in the context of reflection of Deridda, Foucault and Barthes.

  19. Interacciones sin nombre. Un caso emblemático: Ne me quitte pas (Cirque du Soleil)

    OpenAIRE

    Quezada-Macchiavello, Óscar; Universidad de Lima (Perú)

    2014-01-01

    El presente artículo esboza una teoría tensiva, figural, de la interacción, que se opone y complementa con la teoría narrativa y fi gurativa propuesta por Eric Landowski. Esta última propone una taxonomía de las interacciones dispuesta en el cuadrado semiótico; aquella, mientras tanto, respetando dicha taxonomía, la dispone en intervalo(s) sobre los que se deslizan cursos vectoriales. Estos últimos dan cuenta de cuatro zonas de tensión: desprogramación, reprogramación, desajuste, reajuste. Es...

  20. OGM : étiqueté ou pas, selon l’unité choisie !

    OpenAIRE

    2017-01-01

    En avril 2017, le Centre Commun de Recherche (CCR) de la Commission européenne a publié un rapport sur la quantification des OGM : il témoigne de la volonté de la Commission de vouloir artificiellement diminuer les quantités mesurées d’OGM dans les produits alimentaires. Résultat ? La présence d’OGM mais sans étiquetage. Petit cours d’unités de mesures...

  1. Ceci N'est Pas Une Pipe (en inglés

    Directory of Open Access Journals (Sweden)

    Luis Rojo de Castro

    2012-12-01

    Full Text Available AbstractThis article proposes a descriptive reflection on the processes of decontextualization of objects pertaining to modern culture. It starts its journey with images of the Ethnographic Museum at the Trocadero in Paris, founded in 1878 and transformed into the  Museum of Man in 1930. The thesis of the article is about  uncovering the cultural and productive mechanisms of  decontextualization and re‐contextualization characteristic of the 20th century, based on the original images of the Ethnographic Museum and of artists such as Braque, Breton or Picasso, along with images of urban spaces from that particular period of time  (galleries and arcades.All these photographs have something in common: they offer us interior and interiorized spaces in which objects are grouped together and float with a surprising degree of autonomy. They  are fragments from other cultures, other systems, that are now “collected” together next to other fragments. Alien to their  original function, decontextualized from their original  environment, they now share a common space, forced to  participate in a system of relations that turns them into objects, makes them opaque, and separates them from their origin and  “nature.” From an active role (cultural, semiotic, social, etc., they have gone to play a passive role. They have lost the meaning that belonged to them, and now they wait for the  observer to endow them with the new fruit of the relationship created between them, which will take them to a new place.This technique of 'strangeness and fragmentation' causes the dismemberment underlying "system objects" of our own time, in which coherence of relations systems (specific to each place has been replaced by the exuberance of simulating production and  experience.Key wordsdecontextualization, images, mechanisms, collection, place

  2. L'Afrique ne va-t-elle pas vers une diminution de ses avantages ...

    African Journals Online (AJOL)

    The fall of Berlin Wall had put an end to the world bi-polarisation: communist and capitalist systems. Nowadays, there is a multitude of poles that are transforming the international trade. The mastering by the industrialised countries and the New Industrialised Countries (NIC) of technology, research-development, and ...

  3. Comparison of irradiated and hydrogen implanted German RPV steels using PAS technique

    Energy Technology Data Exchange (ETDEWEB)

    Pecko, Stanislav, E-mail: stanislav.pecko@stuba.sk; Sojak, Stanislav; Slugeň, Vladimír

    2015-12-15

    Highlights: • German RPV steels were originally studied by positron annihilation spectroscopy. • Neutron irradiated and hydrogen ion implanted specimens were studied. • Both irradiation ways caused to increase of defect size. • We determined that the defect size was higher in implanted specimens. - Abstract: Radiation degradation of nuclear materials can be experimentally simulated via ion implantation. In our case, German reactor pressure vessel (RPV) steels were studied by positron annihilation lifetime spectroscopy (PALS). This spectroscopic method is a really effective tool for the evaluation of microstructural changes and for the analysis of degradation of reactor steels due to irradiation. German commercial reactor pressure vessel steels, originally from CARISMA program, were used in our study. The German experimental reactor VAK was selected as the proper irradiation facility in the 1980s. A specimen in as-received state and 2 different irradiated cuts from the same material were measured by PALS and size of defects with their intensity was indentified. Afterwards there was prepared an experiment with concern in simulation of neutron irradiation by hydrogen ion implantation on a linear accelerator with energy of 100 keV. Results are concerning on comparison between defects caused by neutron irradiation and hydrogen implantation. The size and intensity of defects reached a similar level as in the specimens irradiated in the nuclear reactor due to hydrogen ions implantation.

  4. Effect varroa op volksgrootte pas zichtbaar als het te laat is?

    NARCIS (Netherlands)

    Dooremalen, van C.; Cornelissen, B.; Langevelde, van F.

    2014-01-01

    De parasitaire mijt Varroa destructor is altijd en overal aanwezig in volken van onze honingbijen. Varroa verkot het leven van de volwassen bij, wat resulteert in een verhoogde kans op wintersterfte. Ondanks leen relatief geringe wintersterfte in 2012-2013 en 2013-2014 is het identificeren van een

  5. Culture of Prevention of Consumption of Psychoactive Substances (pas in the Family

    Directory of Open Access Journals (Sweden)

    María Eugenia Agudelo Bedoya

    2012-08-01

    Full Text Available The article presents the findings of a study on “Family Typology and Dynamics and their relation to the consumption of Psychoactive Substances in Children and Adolescents of the Private Schools in Medellín”. Likewise, it reviews the research carried out in Colombia and abroad on the relations among a family environment characterized by difficulties and gaps in communication, family cohesion, the exercise of authority, and the consumption of illegal psychoactive substances in children and adolescents.

  6. Opnieuw belicht: De pas de deux tussen de filmmuseale praktijk en filmhistorische debatten

    NARCIS (Netherlands)

    Lameris, B.G.

    2007-01-01

    What is the interrelation between film museums and film history writing? This question formed the starting point for this research into the history of film museum practice. Focusing on the history of the Amsterdam Film Museum (1946 - 1996), this study examines the ways in which the history of

  7. Maladie de Rendu-Osler: un diagnostic à ne pas méconnaitre ...

    African Journals Online (AJOL)

    Homme, âgé de 78 ans, ayant des antécédents familiaux d'épistaxis chronique non explorée, avait depuis l'âge de 45 ans des épisodes d'épistaxis récidivante, bilatérale, spontanée et de faible abondance isolée. L'examen physique a objectivé des lésions cutanéo-muqueuses à type de télangiectasies au niveau des ...

  8. Phéochromocytome et grossesse: une association rare à ne pas ...

    African Journals Online (AJOL)

    Le diagnostic avait été évoqué devant une hypertension artérielle paroxystique et un taux élevé d'acide vanyl mandélique. La localisation ... Pregnancy associated with pheochromocytoma is extremely uncommon but may have potentially disastrous consequences for both the mother and fetus. The authors report on 2 ...

  9. ÉTUDE DE CAS — Burkina Faso : Apprendre à ne pas être pauvre ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    22 déc. 2010 ... Qu'est-ce qu'une collectivité d'un pays pauvre comme le Burkina Faso peut bien retirer de mieux connaître son état de pauvreté ? .... Représenter les données par des illustrations faciles à comprendre (une par indicateur — taille de la population, santé et nutrition, installations sanitaires, éducation) sur ...

  10. Lorsque la croissance ne suffit pas : en quête d'une économie ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    21 juil. 2016 ... Bien que la croissance ait été modérée ces dernières années, on s'attend à ce qu'elle reprenne bientôt. On observe toutefois des ... L'un des principaux enjeux est le fait que l'économie de l'Afrique s'est développée sans qu'aucune transformation structurelle n'ait été apportée. Les experts ont souligné ...

  11. La Grèce, pas si balkanique que ça

    Directory of Open Access Journals (Sweden)

    Michel Sivignon

    2009-01-01

    Full Text Available En Grèce, les troubles violents qui se poursuivent depuis la mort d’un jeune de 15 ans tué par un policier le 6 décembre 2008 mettent en lumière les difficultés profondes que rencontre la société grecque. Elles sont moins dues au maintien d’archaïsmes qu’à l’intégration à brides abattues dans l’Union Européenne et aux contraintes de la mondialisation qui touchent au premier chef la jeunesse dans ses efforts pour passer dans le monde du travail.In Greece the riots which bursted on December 6th after the death of a youth killed by a policeman and are going on show the deep difficulties which the Greek society must face . These difficulties are related to local archaisms in Greek society and overall to a very fast integration into the European Union and to the constraints of globalisation. In these respects, young people are deeply concerned: it is very difficult for them to escape unemployment

  12. Nuclear weapon race does not stop; Le nucleaire ne desarme pas

    Energy Technology Data Exchange (ETDEWEB)

    Vahe Ter, Minassian

    2005-04-01

    60 years after Hiroshima, the race for nuclear weaponry keeps on. The comprehensive test ban treaty (CTBT), signed in 1996 by the 5 official nuclear-weapon-owning states (Usa, Russia, China, U.K. and France), has not yet been implemented because its implementation requires the ratification of 44 states that harbour on their territories industrial or research nuclear reactors. Till now only 33 such states have ratified CTBT. CTBT aims at prohibiting any nuclear test whatever the amount of energy released in it. Countries like Usa, North-Korea, Russia, soon Iran... are suspected to develop new types of nuclear warfare. For 2005 the American Congress have decided to freeze the funding of programmes dedicated to the development of 'mini-nukes' like the bunker-burster. The international network of monitoring stations will soon cover all the world and will be able to detect and locate, in an almost automated way, any test involving an energy greater than 1 kiloton. 321 stations have been settled and their efficient detection systems are based on seismic or infra-sound or radioactivity or hydro-acoustic analysis. (A.C.)

  13. Pathogen-Reduced, Extended Platelet Storage in Platelet Additive Solution (PAS)

    Science.gov (United States)

    2016-10-01

    Research Subjects. XI. STUDY PROCEDURES Screening An abbreviated version of blood donor screening will be performed including completion of a study...carefully monitored for adverse reactions ; i.e., fever, chills, dyspnea, urticaria or pain (infusion site, chest pain or other). Any adverse reactions ...During apheresis collection and infusion of platelets, the subject will be carefully monitored for adverse reactions ; e.g., fever, chills, dyspnea

  14. Fish fauna from Gârla Pasărea, a heavy modified former floodplain watercourse

    Directory of Open Access Journals (Sweden)

    NĂVODARU Ion

    2008-10-01

    Full Text Available The “Gârla Pasarea” was a former flood plane watercourse in connection with Vedea River discharged in Danube River. The floodplane was embanked for agriculture polder, Vedea River was redirected to discharge direct into Danube River and Gârla Pasarea was cut in several sectors, connected through underground tubes. Fish fauna inventory of Gârla Pasarea was performed in august 2007, using for shallow water backpack electrofisher and deep large water by Nordic gillnets. The species richness includes 15 fish species with a gradient of increasing from upstream to downstream. The most frequent species (very abundant are two exotic respectively, Pseudorasbora parva and Carassius gibelio that survive in extreme condition. Four species are included in Annexes of Emergency Order of Romanian Govern No.57/2007, concerning regime of natural protected area,conservation of natural habitats and wild flora and fauna, respectively Aspius aspius, Cobitis danubialis (elangoides and Misgurnus fossilis are included in Annex 3 that need designate of Special Protected Area for conservation (SPA, andProterorhinus marmoratus (semilunaris is included in Annex 4B, for species of national interest that need strict protection. Recovering and conservation of fish fauna need ecological restoration based on rebuilding of longitudinal connectivity of Gârla Pasarea sectors, reconnect with Vedea River and lateral connectivity of Danube River with it former floodplane.

  15. Multiple functions and essential roles of nuclear receptor coactivators of bHLH-PAS family.

    Science.gov (United States)

    Pecenova, L; Farkas, Robert

    2016-07-01

    Classical non-peptide hormones, such as steroids, retinoids, thyroid hormones, vitamin D3 and their derivatives including prostaglandins, benzoates, oxysterols, and bile acids, are collectively designated as small lipophilic ligands, acting via binding to the nuclear receptors (NRs). The NRs form a large superfamily of transcription factors that participate virtually in every key biological process. They control various aspects of animal development, fertility, gametogenesis, and numerous metabolic pathways, and can be misregulated in many types of cancers. Their enormous functional plasticity, as transcription factors, relates in part to NR-mediated interactions with plethora of coregulatory proteins upon ligand binding to their ligand binding domains (LBD), or following covalent modification. Here, we review some general views of a specific group of NR coregulators, so-called nuclear receptor coactivators (NRCs) or steroid receptor coactivators (SRCs) and highlight some of their unique functions/roles, which are less extensively mentioned and discussed in other reviews. We also try to pinpoint few neglected moments in the cooperative action of SRCs, which may also indicate their variable roles in the hormone-independent signaling pathways.

  16. Le Mal africain – pas si mal que ça !

    Directory of Open Access Journals (Sweden)

    Mike Singleton

    2011-02-01

    Full Text Available De l’avis engagé d’une génération précédente d’observateurs occidentaux, aussi bien leurs propres couches populaires que la plupart des peuples primitifs se sont laissé faire par le rouleau compresseur de la Modernité. En Angleterre, où un surplus de fumier chevalin avait “libéré” pour le marché de l’emploi une main-d’œuvre paysanne aussi dépaysée que pléthorique (Wrigley, 1988, les Luddites (Thompson, 1968, dignes descendants d’autres défenseurs des causes perdues du Royaume comme les «Dig...

  17. Pas de deux: An Intricate Dance of Anther Smut and Its Host

    Directory of Open Access Journals (Sweden)

    Su San Toh

    2018-02-01

    Full Text Available The successful interaction between pathogen/parasite and host requires a delicate balance between fitness of the former and survival of the latter. To optimize fitness a parasite/pathogen must effectively create an environment conducive to reproductive success, while simultaneously avoiding or minimizing detrimental host defense response. The association between Microbotryum lychnidis-dioicae and its host Silene latifolia serves as an excellent model to examine such interactions. This fungus is part of a species complex that infects species of the Caryophyllaceae, replacing pollen with the fungal spores. In the current study, transcriptome analyses of the fungus and its host were conducted during discrete stages of bud development so as to identify changes in fungal gene expression that lead to spore development and to identify changes associated with infection in the host plant. In contrast to early biotrophic phase stages of infection for the fungus, the latter stages involve tissue necrosis and in the case of infected female flowers, further changes in the developmental program in which the ovary aborts and a pseudoanther is produced. Transcriptome analysis via Illumina RNA sequencing revealed enrichment of fungal genes encoding small secreted proteins, with hallmarks of effectors and genes found to be relatively unique to the Microbotryum species complex. Host gene expression analyses also identified interesting sets of genes up-regulated, including those involving stress response, host defense response, and several agamous-like MADS-box genes (AGL61 and AGL80, predicted to interact and be involved in male gametophyte development.

  18. In de maat en uit de pas : Utrechtse dorpsbesturen 1780-1830

    NARCIS (Netherlands)

    van Schaik, Wim

    2018-01-01

    Due to growing discontent about the national government in the 1780’s a revolutionary movement attempted to regain the old days of the Golden Age, with its local autonomies. The effect of this Patriotic movement was the opposite of what they had intended. The creation of the Bataafse Republiek at

  19. La formation des professionnels de l'environnement : pas seulement une question de connaisances scientifiques

    OpenAIRE

    Piette, Sylvie-Anne; Leclercq, Dieudonné

    1998-01-01

    Encouraging personnel in companies to adopt environmentally-friendly behaviours in one of the tasks expected from environmental professionals. This paper reflects on the training and communication skills needed to meet these expectations, based on a theory that describes the motivation behind humain behavioural patterns. Peer reviewed

  20. The Millennial's Perception of Tattoos: Self Expression or Business Faux Pas?

    Science.gov (United States)

    Foltz, Kristen A.

    2014-01-01

    This article examines the perceptions and beliefs of Millennials regarding visible tattoos and the impact of tattoos on potential employment. Despite tattoos becoming more accepted and mainstream in society, studies show that individuals with visible tattoos are often hired at a lower rate than people without visible tattoos. A survey of current…

  1. The Chute du Ciel: A Pas-de-Deux between a Shaman and an Anthropologist

    Directory of Open Access Journals (Sweden)

    Fernando Giobellina Brumana

    2017-08-01

    Full Text Available This article is the result of a book published recently that met with acclaim among leading anthropologists as a watershed in literature on the discipline. It revolves around the long message sent by a Yanomami shaman who, from his Amazon stronghold, talks to us as white people through a French anthropologist with whom he has maintained a long ethnographic relationship. The message is expressed on several levels: an overwhelmingly baroque cosmology, an extremely rich life story, a savage ethnography of the white world, and an indictment of the danger of universal annihilation implied by white incursion on Amazon life. After the rather belated presentation of the book, the article explores the shaman-ethnologist relationship underlying this extremely ambitious work and the unsurprising equivalence between the shaman’s accusation and the ideology of repudiation of ourselves so common in our own media.

  2. Pas de Deux: Active Ulcerative Colitis in an HIV-Positive Patient

    Directory of Open Access Journals (Sweden)

    David C Pearson

    1996-01-01

    Full Text Available A 40-year-old male who was found to be human immunodeficiency virus-positive when he presented with bloody diarrhea in 1986 is described. Clinical, laboratory, endoscopic and histological findings were all compatible with ulcerative colitis, and stool cultures were repeatedly negative for pathogens. Colitis was initially mild and controlled with intermittent oral aminosalicylic acid products. Since 1993 he has had more significant symptoms requiring prednisone up to 40 mg/day. Repeat colonoscopy disclosed pancolitis and biopsies did not show evidence of cytomegalovirus infection. He has not had an acquired immune deficiency syndrome-defining illness. CD4 cells fell below normal as his colitis worsened. This case raises questions about immune regulation in ulcerative colitis because the patient has active disease in addition to a reduced number of T helper cells. It also presents a difficult management problem because the patient has a limited life expectancy and is reluctant to accept colectomy, and further immunosuppressive therapy may be dangerous.

  3. , TOUCHE PAS À MA TERRE, I ! ' C'EST MA VIE !

    International Development Research Centre (IDRC) Digital Library (Canada)

    nouvelles lois afin d'assurer un plus grand contrôle sur leurs terres arables. C'est ... phénomène, du respect des réglementations locales de gestion foncière. ...... imposé dans la mesure où, l'Etat ayant octroyé les différents permis à. Newcrest ...

  4. Un pas de géant pour l'infiniment petit

    CERN Multimedia

    Daetwyler, Jean-Jacques

    2003-01-01

    Yesterday at CERN, the biggest particle detector in the world was inaugurated by Pascal Couchepin. To the physicists, he has offered a royal present: the "Palais de l'Equilibre" which will become a visitors centre (2 pages)

  5. High Tc superconductivity in YBa2Cu3O7-x studied by PAC and PAS

    International Nuclear Information System (INIS)

    Zhu Shengyun; Li Anli; Zheng Shengnan; Huang Hanchen; Li Donghong; Din Honglin; Du Hongshan; Sun Hancheng

    1993-01-01

    High T c superconductivity has been investigated in YBaCuO by both perturbed angular correlation and positron annihilation spectroscopy techniques as a function of temperature from 77 to 300 K. An abrupt change has been observed in the positron lifetime and Doppler broadening and the electric field gradient and its asymmetry parameter across T c , indicating a transition of two- to one-dimensional Cu-O-Cu chain structure and a charge transfer from CuO layers to CuO chains. An anomaly of the normal state has been demonstrated around 125 K, which is attributed to the structural instability. (orig.)

  6. Hariduspoliitika tekitab peavalu kõigile Euroopa liidu riikidele / Nikolaus van der Pas ; interv. Sirje Tohver

    Index Scriptorium Estoniae

    Pas, Nikolaus van der

    2004-01-01

    Euroopa Komisjoni Hariduse ja Kultuuri Peadirektoraadi direktor külastas Eestit ja rääkis Balti riikide haridussüsteemi kindlustamisest, eluaegse õppe tagamisest ja hariduse rahastamisest. Kommenteerib Made Kirtsi

  7. Pourquoi la philosophie indienne ne doit pas être laissée aux seuls philosophes

    OpenAIRE

    Bronkhorst, Johannes

    2017-01-01

    Des historiens de l’astronomie, de la linguistique ou de la médecine indiennes anciennes, on attend généralement qu’ils soient familiers des contreparties occidentales modernes de ces disciplines. Mais qu’en est-il de la philosophie ? Et tout d’abord, existe-t-il en Inde ancienne quelque chose comme une philosophie dont on pourrait faire l’histoire ? Et si oui, qui en sera le meilleur exégète ? Le philosophe attentif aux enjeux systématiques, ou l’historien sensible aux contextes de productio...

  8. Kalivodův zápas o marxismus bez pověr a iluzí

    Czech Academy of Sciences Publication Activity Database

    Zumr, Josef

    2012-01-01

    Roč. 60, mimořádné číslo 2 (2012), s. 259-267 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : Robert Kalivoda * Marx ism * Hussite movement * Karl Marx * Sigmund Freud Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology

  9. « J'aurais préféré ne pas le savoir » : pourquoi les femmes au ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    17 août 2017 ... Tout au long de mon enfance et de ma jeunesse, le VIH était la crainte à avoir, synonyme d'une condamnation à mort. Malheureusement, malgré les défis et les préjugés qui demeurent, le Swaziland a fait des progrès importants. Le dépistage du VIH et les programmes de counseling sont largement ...

  10. Ascite fébrile chez la femme, ne pas méconnaitre une tumeur de ...

    African Journals Online (AJOL)

    La découverte de ces métastases ovariennes était survenue à distance des foyers primitifs. L'atteinte des ovaires était bilatérale dans le premier cas et unilatérale droite dans le second cas. Le diagnostic est apporté par la tomodensitométrie abdominopelvienne dans les deux cas. La fibroscopie oesogastroduodénale avait ...

  11. Plasticity of the PAS domain and a potential role for signal transduction in the histidine kinase DcuS

    NARCIS (Netherlands)

    Etzkorn, M.; Kneuper, H.; Dünnwald, P.; Vijayan, V.; Krämer, J.; Griesinger, C.; Becker, S.; Unden, G.; Baldus, M.

    2008-01-01

    The mechanistic understanding of how membrane-embedded sensor kinases recognize signals and regulate kinase activity is currently limited. Here we report structure-function relationships of the multidomain membrane sensor kinase DcuS using solidstate NMR, structural modeling and mutagenesis.

  12. Simulation of Rn-222 decay products concentration deposited on a filter. Description of radon1.pas computer program

    International Nuclear Information System (INIS)

    Machaj, B.

    1996-01-01

    A computer program allowing simulation of activity distribution of 222 Rn short lived decay products deposited on a filter against time is presented, for any radiation equilibrium degree of the decay products. Deposition of the decay products is simulated by summing discrete samples every 1/10 min in the sampling time from 1 to 10 min. The concentration (activity) of the decay products is computed in one minute intervals in the range 1 - 100 min. The alpha concentration and the total activity of 218 Po + 214 Po produced are computed in the range 1 to 100 min as well. (author). 10 refs, 4 figs

  13. Genetic evidence for function of the bHLH-PAS protein Gce/Met as a juvenile hormone receptor

    Czech Academy of Sciences Publication Activity Database

    Jindra, Marek; Uhlířová, M.; Charles, J.-P.; Smýkal, V.; Hill, R. J.

    2015-01-01

    Roč. 11, č. 7 (2015), e1005394 ISSN 1553-7404 Grant - others:Marie Curie International Outgoing Fellowship Award(CZ) 276569 Institutional support: RVO:60077344 Keywords : juvenile hormone Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 6.661, year: 2015 http://journals.plos.org/plosgenetics/article?id=10.1371/journal.pgen.1005394

  14. De l'injure en pays maure ou « qui ne loue pas critique »

    Directory of Open Access Journals (Sweden)

    Catherine Taine-Cheikh

    2009-05-01

    Full Text Available Catherine Taine-Cheikh, qui s'intéresse au phénomène de l'injure dans la société arabophone de Mauritanie, commence par étudier les différents termes du dialecte hassâniyya qui relèvent de ce champ sémantique. Elle s'attache ensuite à montrer l'importance et la complexité de l'« effet injure », dans cette société fortement imprégnée par les valeurs de l'honneur où non seulement la critique mais aussi la louange peuvent apparaître comme des manifestations de l'injure. Passant en revue diverses situations empruntées à la vie quotidienne ou puisées dans des matériaux littéraires (écrits et surtout oraux, l'auteur relève diverses stratégies adoptées, soit par les injurieurs, soit par les injuriaires, pour tenter de maîtriser les effets des mots (ou gestes « déplacés ». Bien que le problème du contrôle de soi semble presque toujours primordial, la gestion de l'injure laisse apparaître une différenciation importante en fonction du sexe et du statut relatif des acteurs sociaux concernés.

  15. Bernard Thibault au chevet du CERN "La précarité n'est pas inéluctable"

    CERN Multimedia

    Monin, Valérie

    2003-01-01

    Bernard Thibault, General Secretary of the CGT, came yesterday to CERN to take note directly of the difficulties for the 1500 workers employed by outsourcing firms on the CERN site. He presented a project for a Site Convention

  16. Recent experience of IFFM PAS in the design process of lowhead propeller hydraulic turbines for Small Hydro

    International Nuclear Information System (INIS)

    Kaniecki, M; Krzemianowski, Z

    2010-01-01

    The paper contains the short description of the design process of the axial flow turbines for Small Hydro. The crucial elements of the process are: ARDES programme for 1D inverse problem (containing the statistic information of the well performed hydraulic units, applying the lifting aerofoil theory); determination of universal hill diagram and optimization of the runner blades geometry by utilization of the 3D CFD codes. As the result of design process with utilization of both design steps, the generated runner blades geometry (1D inverse problem) and some computational results of 3D CFD solver have been presented. As the conclusion some crucial remarks of the designed process have been brought forward.

  17. Escarabajos Pasálidos (Coleoptera: Passalidae de Colombia. III: una nueva especie de la Sierra Nevada de Santa Marta

    Directory of Open Access Journals (Sweden)

    Amat García Germán

    1998-11-01

    Full Text Available El género Spasalus Kaup fue considerado por Gravely (1918 como sinónimo de Paxillus Mac Leay y posteriormente revalidado por Reyes-Castillo (1973. Los individuos pertenecientes a este género son Passalini de pequeño tamaño que no sobrepasan los 30 mm; presentan la maza antenal con 5 artejos, el borde anterior de la cabeza casi recto y los ángulos anteriores del clípeo visibles dorsalmente. El género es endémico de Suramérica y las Antillas y cuenta con seis especies descritas; su área de diversificación se presenta en la región amazónico-guyanesa (Fonscca 1990, 1992. Describimos la primera especie del género conocida de Colombia, Spasalus paulinae, hallada en la región norte del país.

  18. Pourquoi pas nous? Statut social et 'adultéité politique' des femmes gando au Bénin

    DEFF Research Database (Denmark)

    Hahonou, Eric Komlavi

    2012-01-01

    In African political cultures, being a young woman of servile status seems to combine all the criteria for marginalization vis-à-vis the political sphere. However, since the democratic decentralization reforms in western Africa, the rules of the local political game have changed. In Northern Benin......, young intellectual women of servile (Gando) origin have been able to gain positions of power after the 2008 cities elections. This article analyzes the conditions of this female political emergence. Without questioning male dominance or being mere instruments of male politicians, these political women...

  19. Pourquoi les légumes moches n'arrivent pas à s'imposer en France

    OpenAIRE

    Mourad, Marie

    2015-01-01

    Mars 2014: des carottes à deux jambes et des aubergines aux formes biscornues font leur apparition dans les rayons d'un magasin Intermarché à Provins (77), dans le cadre du Pacte national contre le gaspillage alimentaire signé par l'enseigne en juin 2013. La vente de ces « légumes moches », propulsée par la créativité de l'agence de communication Marcel, a eu un succès rarement égalé en grande distribution. Si ces légumes n'ont d'abord été vendus que pendant deux jours et dans un unique m...

  20. Intervenir contre le harcèlement au travail : soigner et sévir ne suffisent pas

    Directory of Open Access Journals (Sweden)

    Chantal Leclerc

    2005-11-01

    Full Text Available Quelles sont les voies d’intervention privilégiées et à promouvoir en matière de lutte contre le harcèlement psychologique au travail ? La tendance actuelle des entreprises est de se doter de politiques et de prévoir le recours à des services de médiation ou à des procédures d’enquête. L’article analyse d’abord les avantages et les limites de ces formes d’intervention à saveur fortement psychologique ou juridique. La mise au jour des éléments organisationnels en présence dans plusieurs situations de harcèlement permet ensuite de comprendre qu’une lutte efficace contre le harcèlement ne peut se réduire à des interventions individuelles faites en marge des lieux concrets du travail. Les interventions à promouvoir doivent contribuer à retisser les liens de solidarité fragilisés par des formes d’organisation du travail et de gestion qui placent les personnes en situation constante d’insécurité, de surcharge et de compétition. Elles doivent permettre la parole et l’action collectives.Which ways and means should we encourage and promote to combat psychological harassment in the workplace? The current trend in companies is to adopt policies and to plan for mediation services or official inquiry procedures. The present paper analyses first the advantages and limitations of these interventions, which are of a highly psychological or legal nature. Next, by bringing to light the managerial processes involved in numerous harassment situations, we understand that an effective fight against harassment cannot be reduced to individual interventions on the margins of the actual workplace. The interventions to be promoted should therefore help strengthen the bonds of solidarity weakened by forms of work organization and management that put people in constant situations of insecurity, overwork and competition. These interventions must allow collective action and expression.Cúales son las vías de intervención privilegiadas y a promover en materia de lucha contra el acoso psicológico en el trabajo ?. La tendencia actual en las empresas es dotarse de políticas y prever el recurso a servicios de mediación o a procedimientos de encuesta. El artículo analiza las ventajas y los límites de estas formas de intervención a sabor fuertemente psicológico o jurídico. La revelación de la presencia de elementos organizacionales en varias situaciones de acoso, permite comprender que una lucha eficaz contra el acoso, no puede reducirse a intervenciones individuales hechas al margen del lugar de trabajo. Las intervenciones a promover deben contribuir a reparar los lazos de solidaridad fragilizados por formas de organización del trabajo y de gestión que colocan a las personas en situaciones de constante inseguridad, de sobrecarga de trabajo y de competición. Deben permitir la palabra y la acción colectivas.

  1. Screening for Mental Health Problems in Adults with Learning Disabilities Using the Mini PAS-ADD Interview

    Science.gov (United States)

    Devine, Maurice; Taggart, Laurence; McLornian, Paula

    2010-01-01

    Prevalence rates vary considerably regarding the mental health of people with learning disabilities. This variation is a consequence of the assessment methods used to identify such clinical conditions and also different populations studied. The aim of this study was to screen for mental health problems in adults with mild-to-moderate learning…

  2. Benoît de Cornulier, La musique n’est pas dans les paroles: exemples de Verlaine, Baudelaire, Fuzelier

    OpenAIRE

    Raffi, Maria Emanuela

    2016-01-01

    Da profondo conoscitore della metrica francese, particolarmente del xix secolo, Benoît de Cornulier affronta qui lo sterminato tema della «musique des vers» osservando come l’unica nozione realmente pertinente, ma inevitabilmente vaga, sia quella di «rythme», dato che la metrica musicale e quella letteraria risultano «radicalement différentes». Prendendo in esame L’Art poétique di Verlaine, l’A. verifica l’effettiva presenza dell’impair, verso che esiste «intellectuellement» ma non «rythmique...

  3. Ordinateurs: Efficaces ou pas? (La Perspective d'une Enseignante) (Computers: Effective or Not? [One Teacher's Perspective]).

    Science.gov (United States)

    Pellerin, Micheline

    1999-01-01

    Examined the effectiveness of computer assisted language learning among two groups of students enrolled in an intermediate French course. One group of students spent more time each week in a computer laboratory than did a second group of students. Overall, students who spent more time in the laboratory had higher class averages at the end of the…

  4. Brûlure chez l’épileptique: brûlure pas comme les autres

    Science.gov (United States)

    Boukind, S.; Elatiqi, O.K.; Dlimi, M.; Elamrani, D.; Benchamkha, Y.; Ettalbi, S.

    2015-01-01

    Summary L’association brûlure et épilepsie est une constatation fréquente au Maroc. Ces brûlures, souvent itératives, touchent le plus souvent des femmes jeunes de milieu rural. L’accident survient habituellement au domicile, le plus souvent dans la cuisine à la suite d’une chute sur un moyen de cuisson posé au sol. Elles peuvent être inaugurales de la maladie mais surviennent plus souvent chez des patients connus mais au traitement mal suivi. Les conséquences de ces brûlures, toujours profondes, sont souvent dramatiques en termes de séquelles, chez des patients ayant déjà une insertion sociale rendue difficile par l’épilepsie. La prise en charge doit être multidisciplinaire et concerner à la fois la brûlures et l’épilepsie. Des mesures de prévention simples, visant à équilibrer l’épilepsie et éviter au patient de se trouver seul à proximité d’une source de chaleur, doivent être mises en place. PMID:27252613

  5. Popes through the Looking Glass, or «Ceci n’est pas un pape»

    Directory of Open Access Journals (Sweden)

    Tommaso di Carpegna Falconieri

    2012-04-01

    Full Text Available This paper introduces Clement III (Wibert of Ravenna in the context of the general phenomenon of the antipopes, a vast and fundamentally medieval subject. The theme can be approached in two substantially different ways: from the well-established, official position, which condemns the antipopes as schismatics and subverters of the divine order; or from the perspective of an observer who attempts to examine the phenomenon from the inside. This study opts for the latter vantage point, as do the three papers that it introduces. In them, the antipopes take shape as historical personages who believed in their own legitimacy as popes, who often had large followings, and who received their mark of infamy—that is, the title of antipope—because they were defeated by their opponents. With the first of the two methods (the official, well-established one, history is interpreted in reverse, giving events after-the-fact justifications. With the second analytical strategy, the interpreter instead views history in the historical present and tries to comprehend how events unfolded within the dynamics of the myriad possibilities, changes, and inversions of course that life presents. In this sense, the essays in this collection look not at «anti-popes» but rather at «other-popes» reflected in the mirrors of their adversaries—adversaries who won their respective struggles and were thus able to transmit their own visions of events as the sole vehicles of truth. In the same spirit, these essays consider not antipopes but rather individuals who, like the pipe in Magritte’s painting, come down to us not in their authentic dimension but rather through the filters of representation.

  6. "Y yo pasé, sereno entre los viles: Estado, Revolución e Iglesia en Cuba, 1959-1961"

    Directory of Open Access Journals (Sweden)

    Izaskun ÁLVAREZ CUARTERO

    2009-11-01

    Full Text Available RESUMEN: El presente artículo aborda las relaciones mantenidas entre la Iglesia católica y el gobierno de La Habana desde el triunfo de la Revolución hasta 1961, fecha de la salida de numerosos sacerdotes y religiosas de la isla. Se reconstruye y analiza un corto período de tiempo que marcaría un punto de inflexión en dichas relaciones, iniciando una nueva etapa dentro del largo proceso revolucionario cubano.ABSTRACT: The present article studies the relations between the Catholic Church and the govenment of Havana from the triumph of the Revolution to 1961; in this year, most of the priests and nuns were sent of the island. The article analyzes that time which means a valuable change in the nature of those relations, beginning a new phase within the long Cuban revolutionary process.

  7. Popis mnoha zápasů: diskurz, subjekt a moc v myšlení Judith Butlerové

    Czech Academy of Sciences Publication Activity Database

    Matonoha, Jan; Górská, M.

    2008-01-01

    Roč. 56, č. 6 (2008), s. 805-829 ISSN 0009-0468 Institutional research plan: CEZ:AV0Z90560517 Keywords : gender studies * Butler , Judith * discourse Subject RIV: AJ - Letters, Mass-media, Audiovision

  8. A FOURIER TRANSFORM INFRARED PHOTOACOUSTIC SPECTROSCOPY (FTIR-PAS) STUDY OF THE ADSORPTION OF ORGANOPHOSPHORUS COMPOUNDS ON HEAT-TREATED MAGNESIUM OXIDE. (R825549C015)

    Science.gov (United States)

    The perspectives, information and conclusions conveyed in research project abstracts, progress reports, final reports, journal abstracts and journal publications convey the viewpoints of the principal investigator and may not represent the views and policies of ORD and EPA. Concl...

  9. National Assembly: the energy war is not a doomsday; Assemblee Nationale: la guerre de l'energie n'est pas une fatalite

    Energy Technology Data Exchange (ETDEWEB)

    Sorin, F

    2006-11-15

    The seriousness of the energy problem at which is confronted the world has been too long underestimated.It can bring risks of conflict. To avoid that the 'energy war' be a doomsday, it is important to modify these strains in factors of cooperation. (N.C.)

  10. New archaeorthopteran insects from the Late Carboniferous of the Nord and Pas-de-Calais basins in northern France (Insecta: Cnemidolestodea, Panorthoptera).

    Science.gov (United States)

    Coty, David; Háva, Jiří; Prokop, Jakub; Roques, Patrick; Nel, André

    2014-10-29

    New polyneopteran insects are described from Pennsylvanian (Bashkirian, Moscovian) compressed fossils from the North of France (Insecta: Archaeorthoptera). Discovery of wing apex with distinct venation, e.g., apical fusion of RA with RP, numerous parallel posterior branches of RP with transversal crossveins, can be assigned to cf. Tococladus sp. (Cnemidolestodea: Tococladidae). It represents the second record of Cnemidolestodea from the Avion locality apart from Aviocladus pectinatus Prokop et al., 2014. Bruaylogus magnificus gen. et sp. nov., based on forewing venation, is attributed to Panorthoptera nec Orthoptera having some distinct characters for the placement either close to Oedischiidae or a more basal position possibly with affinities to genus Heterologus. Aviologus duquesnei gen. et sp. nov., based on forewing venation, differs from Oedischiidae by the presence of basal fork of M far from point of separation between M and Cu and fusion of MA with first posterior branch of RP. Aviologus share a long stem of M and simple CuPaβ with Heterologus duyiwuer and H. langfordorum, but both differ in well separated median and radial veins. These new fossils demonstrate that the archaeorthopterid insect fauna from the North of France was rather diverse with links to late Carboniferous and early Permian assemblages in Euramerica such as the Mazon Creek, Carbondale Formation or Elmo, Wellington Formation (Illinois, Kansas, USA) entomofaunas.

  11. My objective: zero contempt, not zero risk;Mon objectif n'est pas le risque zero mais le zero mepris

    Energy Technology Data Exchange (ETDEWEB)

    Delevoye, J.P. [Mediateur de la Republique, 75 - Paris (France)

    2009-12-15

    With technology, scientific research and dissemination of knowledge, medical practice has improved thereby achieving an efficient health care system. However, it would be appropriate to consider the human dimension of medicine as a key development. There are two major challenges in risk management: organizational management of risk on one hand and the management of human relationship with the patient especially when problems arise, on the other. It is therefore a question of achieving awareness, managing a culture change in the medical circle i.e. moving from a culture of guilt to a culture of error and finally relaxing the atmosphere of mutual distrust that exists between health professionals and patients. Indeed, the relation 'health professional-patient' has deteriorated over time due to poor risk management. An educational effort must be done to avoid frustration of the patient and contribute to zero contempt. On reflection, this means that the quality of a system is due to the individual quality of its members, the quality of methods and the organization in place. (author)

  12. Effectiveness of a physical activity program on cardiovascular disease risk in adult primary health-care users: the “Pas-a-Pas” community intervention trial

    Directory of Open Access Journals (Sweden)

    Victoria Arija

    2017-06-01

    Full Text Available Abstract Background Physical activity is a major, modifiable, risk factor for cardiovascular disease (CVD that contributes to the prevention and management of CVD. The aim of this study was to assess the short- and medium-term effectiveness of 9 months of a supervised physical activity program, including sociocultural activities, on CVD risk in adults. Methods Multicentered, randomized, controlled community intervention involving 364 patients in four primary care centers. The participants were randomly assigned to a Control Group (CG = 104 or Intervention Group (IG = 260; mean age 65.19 years; 76.8% women. The intervention consisted of 120 min/week walking (396 METs/min/week and sociocultural gathering once a month. Clinical history, physical activity, dietary intake, CVD risk factors (smoking, systolic and diastolic blood pressure, weight, waist circumference, BMI, total cholesterol, LDL- and HDL-cholesterol, triglycerides, glycosylated hemoglobin and glucose and global CVD risk were assessed at baseline and at the end of the intervention and multivariate models were applied to the data. Incidence of adverse cardiovascular events and continued adherence to the physical activity were assessed 2 years after intervention. Results At the end of the intervention period, in the IG relative to the CG group, there was a significant increase in physical activity (774.81 METs/min/week, a significant change during the intervention period in systolic blood pressure (−6.63 mmHg, total cholesterol (−10.12 mg/dL and LDL-cholesterol (−9.05 mg/dL even after adjustment for potential confounders. At 2 years after the intervention, in the IG, compared with the CG, tthe incidence of adverse cardiovascular events was significantly lower (2.5% vs. 10.5% and the adherence to regular physical activity was higher (72.8% vs 27.2% in IG compared to CG. Conclusions This community-based physical activity program improved cardiovascular health in the short- as well as medium-term, and promoted regular physical activity in the medium-term in older Spanish adults. Trials registration Clinicaltrials.gov ID NCT02767739 . Trial registered on May 5th, 2016. Retrospectively registered

  13. Dysbindin (DTNBP1, 6p22.3) is Associated with Childhood-Onset Psychosis and Endophenotypes Measured by the Premorbid Adjustment Scale (PAS)

    Science.gov (United States)

    Gornick, M. C.; Addington, A. M.; Sporn, A.; Gogtay, N.; Greenstein, D.; Lenane, M.; Gochman, P.; Ordonez, A.; Balkissoon, R.; Vakkalanka, R.; Weinberger, D. R.; Rapoport, J. L.; Straub, R. E.

    2005-01-01

    Straub "et al." ("2002") recently identified the 6p22.3 gene dysbindin (DTNBP1) through positional cloning as a schizophrenia susceptibility gene. We studied a rare cohort of 102 children with onset of psychosis before age 13. Standardized ratings of early development, medication response, neuropsychological and cognitive performance, premorbid…

  14. "Je n'aimais pas ce public..." Une pratique active du texte litteraire ("I Didn't Like This Public..." An Active Exercise with the Literary Text).

    Science.gov (United States)

    Dell'Utri, Salvatore

    1990-01-01

    A series of French language classroom exercises to be used over four class sessions applies principles of semiotics to literary textual analysis. The session themes include decoding and interpreting, reconstructing meaning, sociocultural connotations in the text, and sense of time and space. (MSE)

  15. Le soglie invalicabili: la sicurezza di genere / Des seuils à ne pas franchir : la sécurité de genre / Thresholds not to be crossed: gender security

    Directory of Open Access Journals (Sweden)

    Brollo Marina

    2013-07-01

    Full Text Available Il tema della violenza, sia fisica che sessuale, sulle donne è di strettissima attualità. In questo lavoro dopo aver illustrato come il corpo delle donne sia visto in maniera differente nei diversi ambiti della vita economica, sociale, giuridica, si cercherà di quantificare il fenomeno della violenza sulle donne che può anche essere inteso come un modo per varcare la soglia del corpo femminile, cercando di capire chi sono gli autori delle violenze, dove hanno luogo e quale forma assumono. RésuméLe thème de la violence physique et sexuelle infligée aux femmes demeure d'une brûlante actualité. Après avoir illustré la perception du corps des femmes dans les divers domaines de la vie économique, sociale, juridique, nous essayons dans cet article de quantifier le phénomène de la violence infligée aux femmes ; une brutalité qui peut aussi être vue comme un moyen de franchir le seuil du corps féminin. Nous cherchons aussi à comprendre qui sont les auteurs des violences, où elles se déroulent et sous quelles formes.AbstractPhysical and sexual violence against women is a present phenomenon. In this paper, after illustrating the different ways of how women's body are perceived in various areas of economic, social, and legal life, we will try to evaluate the prevalence of violence against women: this phenomenon could also be interpreted as a way of crossing the threshold of a female body.Moreover, we will try to understand who commits violence against women, where and how.

  16. Déclinaison d’une base de données 3D – Sur les pas de Breuil, une visite virtuelle de Lascaux

    Directory of Open Access Journals (Sweden)

    Valérie Feruglio

    2012-04-01

    Full Text Available Nous présentons ici un exemple de déclinaison grand public sous forme d’un produit multimédia de la base de données 3D du site de Lascaux établie en premier lieu à fin d’étude et de conservation. Les étapes de la création de ce produit ainsi que les acteurs et les moyens techniques mis en œuvre sont exposés. Ce travail est lié à l’établissement d’un cahier des charges, en amont de la numérisation 3D sur le terrain, émanant des archéologues afin que le budget et le choix des résolutions et définitions soient pris en compte.In this article we present the example of a multimedia product of the Lascaux cave 3D database prepared for presentation to the general public. This database was first established for purposes of study and conservation. The steps undertaken in the creation of the product and the actors and the technical means employed are analysed. The project is designed to underpin the specifications prior to 3D scanning of the site, specifications drawn up by archaeologists to ensure that the project will take into account budgetary considerations and the appropriate choice of resolution and definition.

  17. Ne jetons pas le Wiktionnaire avec l'oripeau du Web ! Etudes et réalisations fondées sur le dictionnaire collaboratif

    Directory of Open Access Journals (Sweden)

    Sajous Franck

    2014-07-01

    Plus précisément, nous questionnons la légitimité des ressources « approvisionnées par les foules » et nous étudions dans quelle mesure le Wiktionnaire peut, par ses spécificités, compléter les ressources dictionnairiques existantes dans le cadre d’études linguistiques ciblées et, d’autre part, servir de point de départ à la constitution d’un lexique électronique pour des domaines comme le traitement automatique des langues et la psycholinguistique. Notre contribution à la caractérisation du Wiktionnaire s'accompagne de la mise à disposition de deux lexiques construits à partir du dictionnaire collaboratif : - le premier est un lexique flexionnel et phonologique à très large couverture. Destiné notamment aux applications de TAL, nous donnons également des exemples d'utilisations de ce lexique en linguistique outillée. - le second est un lexique orienté vers la psycholinguistique. Dérivé du premier, il contient moins d'entrées, mais comprend pour chacune d'elle un ensemble d'informations habituellement utilisées dans cette discipline. Ces lexiques sont à la fois téléchargeables librement et interrogeables en ligne.

  18. Reduction at the source of household wastes: why not trying the inciting tariffing?; La reduction a la source des dechets menagers: pourquoi ne pas essayer la tarification incitative?

    Energy Technology Data Exchange (ETDEWEB)

    Glachant, M.

    2002-11-01

    This article discusses how the existing financing tools of the household wastes management implemented in France can be changed to become inciting tools for the reduction of the volume of wastes at the source. It comprises 5 parts: the first part presents the present day way of financing of the public utility of household wastes in France and discusses its (very modest) inciting effect. In the next two parts the possible modalities to make it more inciting are discussed. These parts stresses on two questions: is it better to charge the upstream producers via contributions to chartered companies or to charge the downstream households via volume- or weight-proportional fees? How much should they pay? Then some experiences of inciting tariffing are briefly reviewed: the Duales German system of upstream charging and the US and Dutch downstream charging systems. (J.S.)

  19. ’Les Baoulé ne sont pas des oiseaux pour manger du riz’. Food, migrations and ecology in South-West Ivory Coast

    Directory of Open Access Journals (Sweden)

    François Ruf

    2010-12-01

    Full Text Available La Côte d’Ivoire est le plus grand théâtre des migrations cacaoyères en Afrique sub-saharienne, depuis le Sahel et les régions de savane vers les forêts humides du golfe de Guinée. Dans tout le sud-ouest de la Côte d’Ivoire, se côtoient trois grands groupes de populations, les autochtones, les migrants d’originaires du centre du pays, et les migrants venus du Burkina Faso, ayant construit des modèles alimentaires spécifiques avant de se rencontrer. L’objectif est d’identifier les évolutions depuis leur rencontre dans les forêts du sud-ouest, puis d’en expliquer les déterminants. Les données collectées auprès de 110 planteurs, par questionnaires et interviews, sont limitées à la composante alimentaire des céréales, tubercules, banane plantain. Le résultat le plus important est une conversion partielle des régimes alimentaires des migrants vers le riz, longtemps l’alimentation de base des autochtones. Au cours de la même période de 30 ans, les autochtones suivent un chemin opposé, réduisant leur consommation de riz, abandonnant presque la production. Pour expliquer cette énigme sociologique, les thèses néo-malthusiennes appliquées à la Côte d’Ivoire, un temps contestées, sont remises à l’ordre du jour, teintées d’innovations boserupiennes. À la croisée des changements écologiques, économiques et sociaux, la raréfaction des terres, la disparition des forêts au cours du déroulement du cycle du cacao, l’accès différencié au travail, jouent un rôle décisif dans ces changements alimentaires, via des bouleversements dans les systèmes de production et les rapports sociaux.The Ivory Coast is the largest space for cocoa migrations in sub-Saharan Africa, extending from the Sahel and savannah regions to the rainforests of the Gulf of Guinea. In the southwest of Ivory Coast, three major population groups live side by side: natives, migrants coming from the central region of the country, and migrants coming from Burkina Faso. Each group had built its own particular food patterns and habits before they met. The aim of this paper is to identify the evolution since they met in this region and explain the determining factors. Data obtained from questionnaires and interviews passed with 110 farmers is limited to the following dietary components: cereals, tubers and plantain. The most important finding is the partial conversion of migrants’ diet to rice, which used to be natives’ daily diet. During the same 30-year period, natives followed the opposite path, reducing their rice consumption, almost abandoning rice production. To explain this sociological enigma, neo-Malthusian theories applied to Ivory Coast, which were disputed for a while, are now back on the agenda, coloured with Boserupian innovations. At the intersection of economic and ecological change, land depletion and forest disappearance occuring during the cocoa cycle, differentiated access to labour, play an important role in food pattern changes.

  20. Spatial and Temporal Variations in Diatoms from la Chaine des Lacs Urban Watershed, Nord-Pas France, in Relation to Water Quality

    Science.gov (United States)

    Noble, P. J.; Van de Vijver, B.; Verleyen, E.; Prygiel, J.; Ivanovsky, A.; Lesven, L.; Billon, G.

    2016-12-01

    Diatom analysis was conducted on lake sediments in la Chaîne des Lacs (CDL), a shallow eutrophic urban park and storm control system in Villeneuve d'Ascq, France, to address both the present day water quality, and the evolution of this urban system over its 40 year history. The main lake, Lac du Héron (LDH), received recent attention because of water quality problems, including eutrophication, harmful algal blooms, and invasion by the macrophyte Elodea in 2012. A total of 17 sites were collected in CDL, 11 of which were in LDH, to document spatial variability, and a 26cm long core addresses historical changes. The bulk of the diatom assemblage in LDH can be classified as both eutrophic and moderately metal tolerant, using modern national diatom indices developed and used by the French regional water agencies. Surface sediment samples within LDH show large spatial variations in %Cocconeis placentula whose habitat is epiphytic growth on Elodea. Other variation is reflected in the phytoplankton composition both spatially, and interannually. Aulacoseira muzzanensis and Cyclostephanos dubius showed greater abundance in the open water habitats in LDH, whereas sites in CDL outside of LDH had greater Cyclotella meneghiniana. Temporally, Stephanodicsus (largely S. hantzschii), the dominant diatom in early spring, were present in greater abundances in the 2016 surface sediment samples than in any of the 2015 samples. One possible explanation is that the 2016 samples, taken March 30th, preferentially preserved the early spring Stephanodiscus bloom, in contrast to the 2015 samples, which were taken in January. The sediment core provides an historical record, where the uppermost 4cm plot with the bulk of the LDH surface samples and contain abundant Cocconeis, 4 -14cm is phytoplankton-rich, largely Cyclostephanos dubius and Aulacoseira muzzanensis, and represents a less weed-choked environment prior to the 2012 Elodea invasion. The base of the core is dominated by Amphora and Rhoicosphenia abbreviata, is most similar to an outlier site on the Marque River, and represents early conditions after the reservoir was established. Continued work will focus on relating these results to urban development, improvements of the sewage system, and meteorological patterns.

  1. Étude du passage de la modélisation hydrologique de AIGA au pas de temps infra-horaire

    OpenAIRE

    Organde, D.; Maire, A.; Javelle, P.

    2015-01-01

    / Dans le cadre de son action pour la prévision des inondations, le Service Central d'Hydrométéorologie et d'Appui à la Prévision des Inondations (SCHAPI) prévoit la mise en service (courant 2016) d'un système d'avertissement des crues soudaines basé sur la méthode AIGA améliorée ces dernières années pour être étendue au territoire national. Des pistes d'amélioration du système sont étudiées pour une application ultérieure. Une de ces améliorations consiste à passer le modèle hydrologique du ...

  2. Nécrologie: Ivan Impens (1935-2014. Celui qui ne dépasse pas son maître est un pauvre disciple

    Directory of Open Access Journals (Sweden)

    Bogaert, J.

    2014-01-01

    Full Text Available Obituary: Ivan Impens (1935-2014. Poor is the disciple who does not surpass his master. La gale sarcoptique ovine est la forme de gale la plus répandue au Nord-est algérien. Elle est due à Sarcoptes scabiei var. ovis. Une vaste enquête a été entreprise afin de déterminer la prévalence et le profil saisonnier de la maladie. Durant une période d'une année, plusieurs aspects ont été étudiés au Nord-est algérien. La prévalence moyenne de la maladie s'élevait à 12,02% sur les marchés à bestiaux de trois régions (Souk Ahras, Guelma et Tebessa. La période à haut risque s'est étalée de décembre à mars; quant au reste de l'année, le taux d'infestation est faible voire nul. L'infestation clinique a atteint 60% des cheptels de la région d'El-Tarf, et 49,5% des ovins examinés se sont révélés galeux. La maladie frappe les animaux de tout âge avec un taux d'infestation de 50,5% chez les brebis, 37% chez les agneaux et 22,3% chez les béliers. L'étude des aspects lésionnels et cliniques de la population ovine parasitée à El-Tarf a révélé que 55% d'individus présentaient une atteinte du museau, 30% montraient une extension des lésions crouteuses vers le chanfrein et le front, 10% avaient la tête totalement envahie par les croutes et uniquement 5% révélaient une extension vers les extrémités. Il semble que la charge parasitaire totale a une forte corrélation avec l'étendue des lésions.

  3. Je ne suis pas Charlie. Metadiscourses of impoliteness following “France’s 9/11” in selected print media

    Directory of Open Access Journals (Sweden)

    Ferenčík Milan

    2015-12-01

    Full Text Available Almost immediately after the Charlie Hebdo shootings of 7 January 2015, some print media made room for alternative opinions of what had happened. The articles and the discussions they inspired are replete with evaluations which lend themselves to analysis using methods and procedures of Politeness Theory. The paper examines an example of a metadiscourse of (impoliteness which questions the “moral orders” underlying the cartoonists’ as well as other participants’ social practices vis-à-vis their ideological foundations, esp. freedom of speech as one of the principal liberties of our society. To that end, the approach to politeness as “social practice” is employed which, while insisting on multiple understandings of politeness, places participants’ evaluations at the centre of politeness research.

  4. Infusion of water into a coal mass, carried out at the mines of Houilleres du Bassin du Nord et du Pas-de-Calais

    Energy Technology Data Exchange (ETDEWEB)

    1977-01-01

    This paper reports on research work concerning water infusion in order to reduce dust danger at working face. It also describes development of the process since 1950; improvements to various low flow methods; and factors governing the choice of a process. Infusion can be carried out from working face, or from levels. The paper also describes hole drilling (equipment and methods used); fitting out holes (equipment, cementing); inspection; and non-stop infusion.

  5. roLverWAgTinge vAn Ags PAsTors: voorsTeLLe vir 'n voorTgeseTTe ...

    African Journals Online (AJOL)

    tor god volkome vertrou en bereidwillig is om sy onderdaan ten alle tye te wees. dit sal hulle ook in staat stel om hulle .... hou wat uitgewys is, is onder andere beplanning, organisasie, spanbou, vision ering, bemarking en .... tor en 'n literatuurkontrole oor teologiese opleiding kan 'n voorlopige vToP vir pastors volgens Putter ...

  6. World won't be without hydrocarbons by 2030; Le monde ne sera pas sans hydrocarbures d'ici 2030

    Energy Technology Data Exchange (ETDEWEB)

    Pauron, M

    2008-11-15

    Despite the financial crisis and the revisited 2007 prospects, the 2008 edition of the 'World Energy Outlook' (WEO-2008) of the International Energy Agency (OECD/IEA) foresees a regular increase of oil and gas demand. WEO-2008 draws on the experience of another turbulent year in energy markets to provide new energy projections to 2030, region by region and fuel by fuel. It incorporates the latest data and policies. WEO-2008 focuses on two pressing issues facing the energy sector today: - Prospects for oil and gas production: How much oil and gas exists and how much can be produced? Will investment be adequate? Through field-by-field analysis of production trends at 800 of the world's largest oil fields, an assessment of the potential for finding and developing new reserves and a bottom-up analysis of upstream costs and investment, WEO-2008 takes a hard look at future global oil and gas supply. - Post-2012 climate scenarios: What emissions limits might emerge from current international negotiations on climate change? What role could cap-and-trade and sectoral approaches play in moving to a low-carbon energy future? Two different scenarios are assessed, one in which the atmospheric concentration of emissions is stabilised at 550 parts per million (ppm) in CO{sub 2} equivalent terms and the second at the still more ambitious level of 450 ppm. The implications for energy demand, prices, investment, air pollution and energy security are fully spelt out. This ground-breaking analysis will enable policy makers to distill the key choices as they strive to agree in Copenhagen in 2009 on a post-Kyoto climate framework. The good news in this energy outlook is that renewable energies will become in 2020 the second source of power generation.

  7. Fillon hier, Sarkozy demain La fête n'a pas été gâchée par la panne

    CERN Document Server

    Colson, Sébastien

    2008-01-01

    At CERN, the French Prime Minister inaugurated yesterday the LHC, even if the famous particle accelerator is actually not running. Tomorrow, it's the President of the Republic who will reveal his reflation program. (2 pages)

  8. High T[sub c] superconductivity in YBa[sub 2]Cu[sub 3]O[sub 7-x] studied by PAC and PAS

    Energy Technology Data Exchange (ETDEWEB)

    Zhu Shengyun (China Inst. of Atomic Energy, Beijing, BJ (China)); Li Anli (China Inst. of Atomic Energy, Beijing, BJ (China)); Zheng Shengnan (China Inst. of Atomic Energy, Beijing, BJ (China)); Huang Hanchen (China Inst. of Atomic Energy, Beijing, BJ (China)); Li Donghong (China Inst. of Atomic Energy, Beijing, BJ (China)); Din Honglin (China Inst. of Atomic Energy, Beijing, BJ (China)); Du Hongshan (China Inst. of Atomic Energy, Beijing, BJ (China)); Sun Hancheng (China Inst. of Atomic Energy, Beijing, BJ (China))

    1993-11-01

    High T[sub c] superconductivity has been investigated in YBaCuO by both perturbed angular correlation and positron annihilation spectroscopy techniques as a function of temperature from 77 to 300 K. An abrupt change has been observed in the positron lifetime and Doppler broadening and the electric field gradient and its asymmetry parameter across T[sub c], indicating a transition of two- to one-dimensional Cu-O-Cu chain structure and a charge transfer from CuO layers to CuO chains. An anomaly of the normal state has been demonstrated around 125 K, which is attributed to the structural instability. (orig.)

  9. Collectors practices and the preserving of their memories: Objects of the First World War in Nord Pas de Calais and west Flanders

    Directory of Open Access Journals (Sweden)

    Agnieszka SMOLCZEWSKA-TONA

    2012-01-01

    Full Text Available This article examines the preserving of the memory shared by collectors and mediators of objects from the Great War in the context of museum mediation. The notion of the memory is understood in this article as the body of knowledge acquired, held and shared by these collectors within the framework of their practice of collection and mediation. We look firstly at the informational and communicative dimension of these collectors’ memory. We show that the collector’s memory relating to the objects collected takes a variety of different forms and that it is primarily communicated in oral and gestural form. The results of our analysis lead us to the conclusion that, today, only audiovisual recording techniques allow preserving a precise copy of memories for the long term. The second part of our analysis presents an audiovisual protocol for preparing, recording and storage of these memory traces.

  10. The Wireless Craze, The Unlimited Bandwidth Myth, The Spectrum Auction Faux Pas, and the Punchline to Ronald Coase's 'Big Joke': An Essay on Airwave Allocation Policy

    OpenAIRE

    Hazlett, Thomas W.

    2001-01-01

    In 1959 the Federal Communications Commission invited economist Ronald Coase to testify about his proposal for market allocation of radio spectrum rights. The FCC's first question: 'Is this all a big joke'' Today, however, leading policy makers, including the current FCC Chair, decry the 'spectrum drought' produced by administrative allocation and call for the creation of private bandwidth markets. This essay examines marketplace trends driving regulators' change of humor, and considers the p...

  11. Schritt fur Schritt: Die Durschsetzung der Rechte geistig behinderter Menschen; Pas a Pas: La mise en application des droits des personnes handicapees mentales; Paso a Paso: Puesta en practica de los derechos de los deficientes mentales (Step by Step: Implementation of the Rights of Mentally Retarded Persons).

    Science.gov (United States)

    International League of Societies for the Mentally Handicapped, Brussels (Belgium).

    The booklet presents the proceedings (in English, French, Spanish, and German) of Session 62 of the Seventh World Congress of the International League of Societies for the Mentally Handicapped, detailing some analytical guidelines for national societies on the implementation of the rights of mentally retarded persons. Rights discussed include…

  12. Stāstu stāstīšanas izmantošana lasīšanas veicināšanas pasākumos

    OpenAIRE

    Mežjāne, Signe

    2014-01-01

    Bakalaura darba mērķis ir noskaidrot, vai stāstu stāstīšana ir efektīvs lasīšanas veicināšanas paņēmiens bērniem. Pētījuma problēma ir mūsdienu bērnu nevēlēšanās lasīt, lasīšanu varētu veicināt stāstu stāstīšana bibliotēkās. Darbā tiek analizēts stāstu stāstīšanas process atbilstoši bērnu vecumposmam, izmantojot dažādus runas stilus. Teorētiskā bāze ir balstīta uz Lasītāja reakcijas kritikas teoriju un Runas darbības teoriju. Galvenie pētījuma uzdevumi ir noskaidrot, vai Latvijas bibliotē...

  13. ["Baltic Declaration"--telemedicine and mHealth as support for clinical processes in cardiology. The opinion of the Committee of Informatics and Telemedicine of the Polish Society of Cardiology and Telemedicine Clinical Sciences Committee of the PAS].

    Science.gov (United States)

    Piotrowicz, Ryszard; Grabowski, Marcin; Balsam, Paweł; Kołtowski, Łukasz; Kozierkiewicz, Adam; Zajdel, Justyna; Piotrowicz, Ewa; Kowalski, Oskar; Mitkowski, Przemysław; Kaźmierczak, Jarosław; Kalarus, Zbigniew; Opolski, Grzegorz

    2015-01-01

    For several decades we have observed the development of data transmission technology on an unprecedented scale. With the development of such technology there has also appeared concepts on the use of these solutions in health care systems. Over the last decade telemedicine has been joined by the concept of mHealth, which is based on mobile devices mainly to monitor selected biomedical parameters. On 10 October 2014, during the conference Baltic Electrocardiology Autumn - Telemedicine and Arrhythmia (BEATA), a debate was held with the participation of physicians, politicians, businessmen, and representatives of the Government (Ministry of Health, National Health Fund, Social Insurance Institution) concerning the use of telecardiology services in daily practice. During the meeting issues were discussed such as: telemedicine solutions available throughout the world, analysis of their effectiveness based on clinical trials, funding opportunities, their legal status, and the development perspectives of telecardiology in Poland. The result of the meeting was a document called the "Baltic Declaration". The declaration is a call for proven and profitable technologies to be introduced into clinical practice. The declaration also indicates that the variety of available technological solutions are merely tools, and the utility of such tools stems not only from their modernity, but also primarily from matching their functionality to the features of the health interventions that are to be improved.

  14. Why the compound Yba sub 2 Cu sub 3 O sub 6 is not a superconductor. Pourquoi le compose YBa sub 2 Cu sub 3 O sub 6 n'est-il pas un supraconducteur

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, M [Paris-11, Univ., 91 - Orsay (FR); Gupta, R P [CEA Centre d' Etudes Nucleaire de Saclay, 91 - Gif-sur-Yvette (FR). Dept. de Technologie

    1989-01-01

    A comparative study of the electronic structure of superconducting YBa{sub 2}Cu{sub 3}O{sub 7} and non superconducting YBa{sub 2}Cu{sub 3}O{sub 6} is presented. Our calculation shows that the densities of states at the Cu sites with pyramidal coordination and at its four oxygen neighboring sites in the horizontal planes are very similar in the superconducting and non-superconducting phases. Thus, the bidimensional character is unaltered in the two compounds. However, unlike for YBa{sub 2}Cu{sub 3}O{sub 7}, we find that in YBa{sub 2}Cu{sub 3}O{sub 6}, the Cu atoms of the linear chain sites and the oxygen atoms with which it interacts along the c axis are respectively in the charged state Cu{sup +} and O{sup 2-}; these sites are insulating since the densities of states at the Fermi energy is almost nil. These results suggest the importance of the linear Cu-O chains in the superconducting properties.

  15. A treaty more alarming than efficient. The dismantled warheads will not be destroyed. Danger; Un traite plus inquietant qu'efficace. Les ogives demantelees ne seront pas detruites. Risque

    Energy Technology Data Exchange (ETDEWEB)

    Riche, P.; Despic-Popovic, H.; Nougayrede, N

    2002-07-01

    This political analysis presents the new treaty of nuclear weapons dismantling between Russia and Usa. In fact the warheads will not be completely dismantling but only stocked, leading to a possible recovery by terrorists. It underlines the real interests of this agreement which are more economic than peaceful. (A.L.B.)

  16. Pourquoi les Parents Ne Veulent-Ils Pas Participer? Voici Quelques Recommandations pour Ameliorer les Relations Ecole-Foyer (Why Don't Parents Want to Participate? There Are Some Recommendations for Improving Home-School Relations).

    Science.gov (United States)

    Foisy, Gerson

    1980-01-01

    The article describes a Quebec study to identify the causes of parental nonparticipation in the schools and includes six recommendations with specific examples for remedying the situation. It stresses the importance of home-school communication, information dissemination, and parental school committees. (SB)

  17. Écrire « l’histoire [qui] n’existe pas ». L’enquête généalogique de Colombe Schneck et de Maryline Desbiolles

    Directory of Open Access Journals (Sweden)

    Evelyne Ledoux-Beaugrand

    2012-01-01

    Full Text Available Les récits L’increvable Monsieur Schneck de Colombe Schneck et Primo de Maryline Desbiolles interrogent un passé familial lacunaire et s’emploient à remonter la trace d’ancêtres, anonymes au regard des grands événements de l’histoire, dont l’existence a été oblitérée par le secret et le passage du temps. Cet article analyse les modalités ainsi que les limites de l’enquête généalogique déployée par les narratrices de ces récits et se penche sur la posture de chiffonnière adoptée par ces dernières dans leur recherche d’un passé familial dont il ne reste que des vestiges. Colombe Schneck’s L’Increvable Monsieur Schneck and Maryline Desbiolles’s Primo are both concerned with the lacunas in the family story and endeavor to find traces left by anonymous ancestors whose existences have been wiped out by family secrets or by the passage of the time. This paper examines the terms and the limits of the genealogical investigations led by the narrators of Schneck and Desbiolles’ narratives, while paying particular attention to the “rag-picker’s” posture they adopt in their exploration of a familial past of which only vestiges remain.

  18. Bali: an agreement in principle for post-Kyoto negotiations but no emissions reduction targets - Panorama 2008; Bali: un accord de principe pour des negociations post-Kyoto mais pas d'objectif de reduction - Panorama 2008

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2008-07-01

    Ten years have passed since December 1997, when the United Nations Framework Convention on Climate Change (UNFCCC) was signed in Kyoto. It's been a decade of tough international negotiations, leading to the beginnings of an international CO{sub 2} emissions trading market, whose future past 2012 remains uncertain. The December negotiations in Bali may not have produced a successor to the Kyoto Protocol, but they did get all parties to the Convention to sign an agreement in principle to post- Kyoto negotiations.

  19. Enseigner le FLE avec deux œuvres portant deux regards sur la francophonie: le film Chocolat de Claire Denis et le roman Allah n’est pas obligé d’Ahmadou Kourouma

    Directory of Open Access Journals (Sweden)

    Clotilde Barbier

    2013-11-01

    Through these two works, we will propose a pedagogical approach to discover and analyze the linguistic and cultural phenomena that African French-speaking countries represent nowadays in our teaching practice. This analysis will allow us to partly understand its origin and also to know who is the Other, in history, in culture, in language (in his languages as far as Kourouma is concerned.The incursion in the field of visual artistic expression through cinema and artistic written expression through literature gives a sensorial and emotional dimension complementary to the purely linguistic and cultural learning process and the humanistic touch necessary to any teaching / learning practice that involves self-construction and relationships with others.

  20. What are become Moruroa and Fangataufa? The dismantling of tests sites did not happen; Que sont devenus Moruroa et Fangataufa? le demantelement des sites d'essais n'a pas eu lieu

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    Officially, the nuclear test sites of French polynesia have been dismantled. It would be more correct to say that the installations build on the Moruroa atolls have been destroyed. From the end of nuclear tests, the Cea constructions and installations, the most susceptible to be contaminated have been ruined without exterior witness. Nobody knows if the usual procedures of decontamination have been observed. About 15% of materials from he Moruroa base have been distributed as gifts to the local communities in french Polynesia. other materials have been transferred or sold. The observatory of French nuclear weapons estimates the cost of the closing of the French Polynesia test sites to about 15 milliards of Francs, including the compensations paid to the Polynesian government during 10 yeas, so be it hundred times the cost announced by the militaries in 1998. The observatory of French nuclear weapons estimates that the real assessment of radioactive waste being on Moruroa and Fangataufa atolls has not been completely made by the experts of IAEA. This assessment is still to make. The observatory of French nuclear weapons notices that the Moruroa and Fangataufa atolls stay under military status. It recommends that these atolls be reintegrated to the Polynesian land patrimony in order to allow independent expertise. (N.C.)

  1. Recordar lo que no pasó: memoria y usos del olvido en torno a la recepción de los refugiados judíos del nazismo en México

    Directory of Open Access Journals (Sweden)

    Gleizer, Daniela

    2012-08-01

    Full Text Available Although the Mexican authorities closed the doors to Jewish immigration during the Nazi period, the memory of this episode has been reconfigured over time and transformed into the opposite view. This article analyzes the process of how the collective memory was reinterpreted – in the governmental sector as much as within the Jewish community itself – and why the image of the country’s welcoming of Jewish refugees is the one that prevailed.

    Si bien las autoridades mexicanas cerraron las puertas del país al exilio judío durante el nazismo, el recuerdo de este episodio ha sido reconfigurado en el tiempo para convertirse en su imagen opuesta. Este artículo analiza cómo ha sido el proceso de reelaboración de la memoria colectiva —tanto en el sector gubernamental como en el de la comunidad judía— y por qué ha terminado prevaleciendo la imagen de la apertura del país hacia los refugiados judíos.

  2. Sėjomainų ir tarpinių pasėlių įtaka dirvos piktžolėtumui ir fermentų aktyvumui ekologinėje žemdirbystėje

    OpenAIRE

    Jasionė, Vaidutė

    2011-01-01

    Tyrimai atlikti 2008–2009 m. Lietuvos žemės ūkio universiteto Bandymų stotyje. Dirvožemis – karbonatingas sekliai glėjiškas išplautžemis (Calc(ar)i-Epihypogleyic Luvisol). Tyrimo A veiksnys – 4 septynių narių sėjomainų rotacijos su nevienoda azotą fiksuojančių augalų dalimi: I – 43 proc. (daugiametės žolės → daugiametės žolės → žieminiai kviečiai → vasariniai miežiai → žirniai → žieminiai kviečiai → miežiai), II – 43 proc. (daugiametės žolės → žieminiai kviečiai → žirniai → vasariniai miežia...

  3. Human Salivary Alpha-Amylase (EC.3.2.1.1) Activity and Periodic Acid and Schiff Reactive (PAS) Staining: A Useful Tool to Study Polysaccharides at an Undergraduate Level

    Science.gov (United States)

    Fernandes, Ruben; Correia, Rossana; Fonte, Rosalia; Prudencio, Cristina

    2006-01-01

    Health science education is presently in discussion throughout Europe due to the Bologna Declaration. Teaching basic sciences such as biochemistry in a health sciences context, namely in allied heath education, can be a challenging task since the students of preclinical health sciences are not often convinced that basic sciences are clinically…

  4. Sexuální výchova dětí s PAS staršího školního věku

    OpenAIRE

    BLAŽKOVÁ, Renata

    2014-01-01

    Sexuality and sexual needs are very important part of life of every human. There is necessary to treat every sensitive aspects of sexual disposition for suitable development of these needs the best way is sex education in the correct form. For many parents, there is a big problem to explain this topic to their children at the right time, by the correct form and appropriately at all. This problem is so much complicated for parents of children with Autism spectrum disorder. Their children have ...

  5. Analýza úspešnosti vybraných pasívnych a aktívnych investičných stratégií

    OpenAIRE

    Tomášik, Ivan

    2011-01-01

    This working paper discusses in its first section differences between active and passive investment strategies. It also deals with convenience of active funds by overcoming returns of indices size of fees and share of assets in active and passive investment forms. It also discusses index investing and exchange traded funds. The second chapter deals with short selling, its history, regulation, fees and criteria for short selling. Last chapter analyzed financial indicators of stock titles from ...

  6. Formulation de la tomographie des temps de première arrivée à partir d'une méthode de gradient : un pas vers une tomographie interactive

    OpenAIRE

    Taillandier , Cédric

    2008-01-01

    First arrival traveltime tomography aims at inferring a seismic wave propagation velocity model from first arrival traveltimes picked on seismograms. The velocity model inferred can be used directly to perform a structural interpretation of the subsurface or as an initial model for another seismic imaging method. This technique can be applied at different scales from geotechnical studies to seismology through oil exploration. The geophysicist know-how plays an important role in the difficult ...

  7. Evaluating sustainable logistics for Local Food Systems and using colaboration as a tool for rationnalization in the retail-wholesale sector: A case study in the Nord-Pas de Calais region, France

    OpenAIRE

    Duault, Agathe

    2015-01-01

    Localizing the organic food system is a key element for sustaining the development of organic agriculture globally. Local Food Systems (LFS) are often attributed to having advantages but their economic, ecological and social performances are questioned mainly due to low logistics rationalization. The organic retail-wholesale sector is particularly affected by logistics problems (low-volume delivery, and numerous delivery points). This study evaluates collaboration as a tool for logistic ratio...

  8. What are become Moruroa and Fangataufa? The dismantling of tests sites did not happen; Que sont devenus Moruroa et Fangataufa? le demantelement des sites d'essais n'a pas eu lieu

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    Officially, the nuclear test sites of French polynesia have been dismantled. It would be more correct to say that the installations build on the Moruroa atolls have been destroyed. From the end of nuclear tests, the Cea constructions and installations, the most susceptible to be contaminated have been ruined without exterior witness. Nobody knows if the usual procedures of decontamination have been observed. About 15% of materials from he Moruroa base have been distributed as gifts to the local communities in french Polynesia. other materials have been transferred or sold. The observatory of French nuclear weapons estimates the cost of the closing of the French Polynesia test sites to about 15 milliards of Francs, including the compensations paid to the Polynesian government during 10 yeas, so be it hundred times the cost announced by the militaries in 1998. The observatory of French nuclear weapons estimates that the real assessment of radioactive waste being on Moruroa and Fangataufa atolls has not been completely made by the experts of IAEA. This assessment is still to make. The observatory of French nuclear weapons notices that the Moruroa and Fangataufa atolls stay under military status. It recommends that these atolls be reintegrated to the Polynesian land patrimony in order to allow independent expertise. (N.C.)

  9. Uso de un sistema de información geoespacial para la evaluación socioeconómica de los servicios ambientales en la cuenca Guayalejo-Tamesí (Tamaulípas, México)

    OpenAIRE

    Requena Lara, Glenda Nelly

    2014-01-01

    Texto completo descargado desde Teseo La presente investigación tuvo como objetivo plasmar en un mapa el valor que representan para la sociedad del estado mexicano de Tamaulipas, los servicios ambientales (SSAA) de la porción tamaulipeca de la cuenca Guayalejo-Tamesí; y con esa base, plantear estrategias básicas de ordenamiento territorial orientadas a su uso, manejo y conservación. El área de estudio ocupa cerca de 15,000 Km2, que representan casi un 18% del estado de Tamaulipas, ubicado...

  10. Wall boilers connected to the controlled mechanical gas ventilation system cannot be shifted easily...; Les ''murales'' raccordees a la VMC gaz ne voyagent pas facilement...

    Energy Technology Data Exchange (ETDEWEB)

    Dujin, M. [CEP-Veritas, 75 - Paris (France)

    1999-10-01

    Mainly for aesthetical reasons, in renovated and new buildings, gas boilers are more and more often shifted from the kitchen (their traditional place) to other rooms (bathroom, storeroom, toilets..) and connected to the controlled mechanical ventilation system. In this case, several questions can arise concerning the respect of the gas safety regulations: compatibility of the ventilation system, conformability of the extraction system, sufficient amount of air supply, sufficient heating power etc.. This paper takes stock of this safety problem. (J.S.)

  11. Un peu de désordre n'est pas du tout désagréable Clara Gaspar se passionne pour son métier au CERN, sans jamais oublier son Portugal

    CERN Multimedia

    Imhof, Michel

    2002-01-01

    Clara Gaspar is passionately fond of her job at CERN and enjoys the enrichment of life being in an international community. She misses some things and will never forget Portugal but counts Geneva as her home (2 pagees)

  12. Discrepancy between low levels of mTOR activity and high levels of p-S6 in primary central nervous system lymphoma may be explained by PAS domain-containing serine/threonine-protein kinase-mediated phosphorylation

    DEFF Research Database (Denmark)

    Marosvari, Dora; Nagy, Noemi; Kriston, Csilla

    2018-01-01

    The primary aim of this study was to determine mTOR-pathway activity in primary central nervous system lymphoma (PCNSL), which could be a potential target for therapy. After demonstrating that p-S6 positivity largely exceeded mTOR activity, we aimed to identify other pathways that may lead to S6...... phosphorylation. We measured mTOR activity with immunohistochemistry for p-mTOR and its downstream effectors p(T389)-p70S6K1, p-S6, and p-4EBP1 in 31 cases of PCNSL and 51 cases of systemic diffuse large B-cell lymphoma (DLBCL) and evaluated alternative S6 phosphorylation pathways with p-RSK, p(T229)-p70S6K1...... responsible for S6 phosphorylation, PASK proved to be positive in all cases of PCNSL and DLBCL. Inhibition of PASK resulted in reduced expression of p-S6 in BHD1-cells. This is the first study demonstrating an mTOR independent p-S6 activity in PCNSL and that PASK may contribute to the phosphorylation of S6...

  13. Paired associative stimulation targeting the tibialis anterior muscle using either mono or biphasic transcranial magnetic stimulation

    DEFF Research Database (Denmark)

    Mrachacz-Kersting, Natalie; Stevenson, Andrew James Thomas

    2017-01-01

    Paired associative stimulation (PAS) protocols induce plastic changes within the motor cortex. The objectives of this study were to investigate PAS effects targeting the tibialis anterior (TA) muscle using a biphasic transcranial magnetic stimulation (TMS) pulse form and, to determine whether...... a reduced intensity of this pulse would lead to significant changes as has been reported for hand muscles using a monophasic TMS pulse. Three interventions were investigated: (1) suprathreshold PAbi-PAS (n = 11); (2) suprathreshold PAmono-PAS (n = 11) where PAS was applied using a biphasic or monophasic......% for subthreshold PAbi-PAS. PAS using a biphasic pulse form at subthreshold intensities induces similar effects to conventional PAS....

  14. « Vos pensées ne sont pas mes pensées et mes chemins ne sont pas vos chemins » (Isaïe 55.8 : une réflexion sur le thème de l’ordre dans les Suspiria de Profundis (1845 de Thomas De Quincey  “For my thoughts are not your thoughts, neither are your ways my ways” (Isaiah 55:8: Reflections on the Theme of Order in Thomas De Quincey’s Suspiria de Profundis (1845

    Directory of Open Access Journals (Sweden)

    Frédéric Slaby

    2009-05-01

    Full Text Available This article looks at the theme of order in Thomas De Quincey’s Suspiria de Profundis (1845. Although chaos is easily noticeable in De Quincey’s digressional style, order is also a recurring motif in the narrative of this mature work. Indeed, for the Protestant and Romantic author plagued by suffering, chaos and order are the starting points for broader reflections. De Quincey discovers that chaos in the outer and inner worlds is but apparent, and that deciphering these worlds enables him to see a unifying or organizing force beneath contraries and paradoxes. As a consequence, in his hermeneutics based on the scandal of suffering, De Quincey introduces the notion of obliqueness operating through the masks behind which God acts, thus retracing the very paths taken by God and disclosing his own theology.

  15. « Vos pensées ne sont pas mes pensées et mes chemins ne sont pas vos chemins » (Isaïe 55.8) : une réflexion sur le thème de l’ordre dans les Suspiria de Profundis (1845) de Thomas De Quincey  “For my thoughts are not your thoughts, neither are your ways my ways” (Isaiah 55:8): Reflections on the Theme of Order in Thomas De Quincey’s Suspiria de Profundis (1845)

    OpenAIRE

    Frédéric Slaby

    2009-01-01

    This article looks at the theme of order in Thomas De Quincey’s Suspiria de Profundis (1845). Although chaos is easily noticeable in De Quincey’s digressional style, order is also a recurring motif in the narrative of this mature work. Indeed, for the Protestant and Romantic author plagued by suffering, chaos and order are the starting points for broader reflections. De Quincey discovers that chaos in the outer and inner worlds is but apparent, and that deciphering these worlds enables him to...

  16. Ethical Issues in the Social Worker's Role in Physician-Assisted Suicide.

    Science.gov (United States)

    Manetta, Ameda A.; Wells, Janice G.

    2001-01-01

    Presents results of an exploratory study of social workers' views on physician-assisted suicide (PAS), situations in which PAS would be favored, and whether there is a difference in education or training on mental health issues, ethics, or suicide between social workers who favor PAS and those who oppose PAS. (BF)

  17. Euthanasia or physician-assisted suicide? A survey from the Netherlands.

    Science.gov (United States)

    Kouwenhoven, Pauline S C; van Thiel, Ghislaine J M W; Raijmakers, Natasja J H; Rietjens, Judith A C; van der Heide, Agnes; van Delden, Johannes J M

    2014-03-01

    Legalizing euthanasia or physician-assisted suicide (PAS) is a current topic of debate in many countries. The Netherlands is the only country where legislation covers both. To study physicians' experiences and attitudes concerning the choice between euthanasia and PAS. A questionnaire including vignettes was sent to a random sample of 1955 Dutch general practitioners, elderly care physicians and medical specialists. In total, 793 physicians (41%) participated. There was no clear preference for euthanasia (36%) or PAS (34%). Two thirds of physicians thought that PAS underlines the autonomy and responsibility of the patient and considered this a reason to choose PAS. Reasons for not choosing PAS were expected practical problems. A minority (22%) discussed the possibility of PAS with their patient in case of a request for assistance in dying. Patients receiving PAS more often experienced psychosocial suffering in comparison with patients receiving euthanasia. In vignettes of patients with a request for assistance in dying due to psychosocial suffering, physicians agreed more often with the performance of PAS than with euthanasia. Dutch physicians perceive a difference between euthanasia and PAS. Although they believe PAS underlines patient autonomy and responsibility, the option of PAS is rarely discussed with the patient. The more psychosocial in nature the patient's suffering, the more physicians choose PAS. In these cases, PAS seems to fulfil physicians' preferences to emphasize patient autonomy and responsibility. Expected technical problems and unfamiliarity with PAS also play a role. Paradoxically, the choice for PAS is predominantly a physician's one.

  18. Paired Associative Stimulation Targeting the Tibialis Anterior Muscle using either Mono or Biphasic Transcranial Magnetic Stimulation

    Directory of Open Access Journals (Sweden)

    Natalie Mrachacz-Kersting

    2017-04-01

    Full Text Available Paired associative stimulation (PAS protocols induce plastic changes within the motor cortex. The objectives of this study were to investigate PAS effects targeting the tibialis anterior (TA muscle using a biphasic transcranial magnetic stimulation (TMS pulse form and, to determine whether a reduced intensity of this pulse would lead to significant changes as has been reported for hand muscles using a monophasic TMS pulse. Three interventions were investigated: (1 suprathreshold PAbi-PAS (n = 11; (2 suprathreshold PAmono-PAS (n = 11 where PAS was applied using a biphasic or monophasic pulse form at 120% resting motor threshold (RMT; (3 subthreshold PAbi-PAS (n = 10 where PAS was applied as for (1 at 95% active motor threshold (AMT. The peak-to-peak motor evoked potentials (MEPs were quantified prior to, immediately following, and 30 min after the cessation of the intervention. TA MEP size increased significantly for all interventions immediately post (61% for suprathreshold PAbi-PAS, 83% for suprathreshold PAmono-PAS, 55% for subthreshold PAbi-PAS and 30 min after the cessation of the intervention (123% for suprathreshold PAbi-PAS, 105% for suprathreshold PAmono-PAS, 80% for subthreshold PAbi-PAS. PAS using a biphasic pulse form at subthreshold intensities induces similar effects to conventional PAS.

  19. Fiches pratiques: "Oui, je viens de Taiwan"; L'habit ne fait pas le moine; Objets inanimes avez-vous donc une ame?; La Bourse et la voix (Practical Ideas: "Yes, I Come from Taiwan"; The Clothes Don't Make the Man; Inanimate Objects, Do You Have a Soul?; The Stock Exchange and the Voice).

    Science.gov (United States)

    Durbant, Jean-Claude; And Others

    1988-01-01

    Four ideas for classroom instruction are presented, including an approach to teaching foreign nationals or immigrants, a lesson in clothing and its terminology, an explanation of the symbolism and language of the French Revolution, and a description of how to use radio programs about economics. (MSE)

  20. Ouvrir la porte à des pratiques euthanasiques? Pas aussi simple que les Rapports de la Société royale, du Barreau du Québec et de la Commission spéciale sur le mourir dans la dignité le laissent croire

    Directory of Open Access Journals (Sweden)

    Saint-Arnaud, Jocelyne

    2013-06-01

    Full Text Available The Royal Society of Canada, the Bar of Quebec and the Special Commission on Dying with Dignity took position in favour of voluntary euthanasia. The Quebec government has prepared a draft bill in which voluntary euthanasia can be considered as an option in end-of-life care. This bill aims to define regulatory guidelines that, if followed, will protect medical doctors from lawsuits. The main argument supporting this project is based on respect for autonomy. This article argues that other values, such as pursuit of the common good, ought also to be taken into account. This article describes the experience of the Netherlands to show that a slippery slope is possible and that legal measures do not necessarily bring more transparency in medical practices concerning euthanasia. Prudence requires that adequate palliative care be accessible for all before defining legal measures on voluntary euthanasia.

  1. Hyperthyroidism and thyroid cancer: the diagnosis is not always what is expected. contribution of the SPECT-T.D.M. in the diagnosis; Hyperthyroidie et cancer thyroidien: le diagnostic n'est pas toujours celui attendu. Apport de la TEMP-TDM dans le diagnostic

    Energy Technology Data Exchange (ETDEWEB)

    Chabert, C.; Garby, L.; Scheiber, C.; Bournaud, C. [Centre de medecine nucleaire, groupement hospitalier Est, Lyon, (France); Picq, R. [service d' endocrinologie, clinique Saint-Charles, Roussillon, (France); Chaix, P.A. [HFME, service de chirurgie gynecologique, (France)

    2009-05-15

    The objective is to illustrate the interest of a tomo-scintigraphy coupled to computed tomography (SPECT-T.D.M.) in the scintigraphy with iodine 131. Conclusions: The ovarian mature teratomas of several tissues are germinal tumors more often benign ones, able to include some thyroid tissue. This one is in the most of case, non functional and of gynecological presentation. Exceptionally, the thyroid contingent is responsible of a hyperthyroidism whom diagnosis is often delayed. The contribution of hybrid imaging allowed an immediate diagnosis and a fast management of the patient. (N.C.)

  2. From malnutrition to HIV: spirulina is an effective solution which continues to reveal its secrets De la malnutrition au VIH : la spiruline arme efficace qui n’en finit pas de livrer ses secrets De la malnutrición al VIH: la espirulina como arma eficaz que no cesa de revelar secretos

    Directory of Open Access Journals (Sweden)

    Raphaëlle Birot

    2012-04-01

    Full Text Available Spirulina presents major advantages in the fight against chronic malnutrition based on its micronutrient composition, its health potential and the fact that it can be grown locally. International solidarity associations, such as Antenna Technologies and Entrepreneurs du Monde whose goal is to reduce extreme poverty and public health problems in developing countries, have undertakenproduction and distribution programmes of spirulina, especially in West Africa. The quality of spirulina produced in these developing countries continues to increase to the extent that it can now be exported. Thus, associations such as Spirulidaire market a traditional, fair and supportive spirulina in France and Europe and thus promote local producers.The perception of spirulina continues to evolve with the multiplication of field initiatives and the accumulation of scientific data. New studies demonstrate that spirulina also presents clinically significant anti-viral and immuno-stimulating effects in people infected by HIV.Sur la base de sa composition en micronutriments, de son potentiel pour la santé et du fait qu’elle soit cultivable localement, la spiruline présente des avantages majeurs dans la lutte contre la malnutrition chronique. Des associations de solidarité internationale, comme Antenna Technologies et Entrepreneurs du Monde qui ont comme vocation de réduire l’extrême pauvreté et les problèmes de santé publique dans les pays en développement, ont entrepris des programmes de culture et de distribution de spiruline notamment en Afrique de l’Ouest. La qualité de la spiruline produite dans ces pays en développement ne cesse d’augmenter et est telle qu’elle permet son exportation. C’est ainsi que des associations comme Spirulidaire commercialisent une spiruline artisanale, équitable et solidaire en France et en Europe et permettent ainsi de soutenir les producteurs locaux.La perception de la spiruline ne cesse d’évoluer avec la multiplication des initiatives terrain, et l’accumulation de données scientifiques. De nouvelles études démontrent que la spiruline présente également des effets antiviraux et immunostimulants cliniquement significatifs chez des personnes infectées par le VIH.Sobre la base de su composición en micronutrientes, de su potencial para la salud y del hecho de que sea cultivable localmente, la espirulina presenta ventajas muy importantes en la lucha contra la malnutrición crónica. Asociaciones solidarias internacionales, como Antenna Technologies y Emprendedores del Mundo, que tienen por vocación reducir la extrema pobreza y los problemas de salud pública de los países en vías de desarrollo, han puesto en marcha programas de cultivo y distribución de espirulina, especialmente en África Occidental. La calidad de la espirulina producida en estos países en vías de desarrollo no cesa de aumentar y es tal que permite su exportación. Es por esto que asociaciones como Spirulidaire comercializan una espirulina artesanal, justa y solidaria en Francia y en Europa, permitiendo así sostener a los productores locales.La percepción de la espirulina no cesa de evolucionar con la multiplicación de iniciativas en el terreno y la acumulación de datos científicos. Los nuevos estudios realizados demuestran que la espirulina posee efectos antivirales e inmunoestimulantes clínicamente significativos en individuos infectados por el VIH.

  3. Amartya Kumar Sen, La démocratie des autres. Pourquoi la liberté n’est pas une invention de l’Occident, traduit de l’américain par Monique Bégot, Paris, Payot et Rivages (Manuels Payot, 85 p., 10 euros.

    Directory of Open Access Journals (Sweden)

    Muriel Gilardone

    2006-04-01

    Full Text Available La démocratie est certainement le fil conducteur de l’ensemble de l’œuvre – a priori épars – de l’économiste et philosophe Amartya Sen. D’une part, sa foi en la démocratie apparaît comme la raison première de sa volonté de défier le « théorème d’impossibilité » établi par Kenneth Arrow au début des années cinquante, et comme une ligne directrice dans sa recherche en théorie du choix social. D’autre part, dans ses analyses de problèmes sociaux plus empiriques, comme la famine ou les inégalités...

  4. Liberté de religion (art. 9 CEDH: droit de ne pas être contraint de révéler ses convictions religieuses et prélèvement à la source de l’impôt cultuel. L’affaire Wasmuth c. Allemagne

    Directory of Open Access Journals (Sweden)

    Nicolas Hervieu

    2011-03-01

    Full Text Available Il contributo, apparso su Actualités Droits-Libertés del 20 février 2011 (CREDOF, http://credof.u-paris10.fr/ e destinato anche alla rivista telematica “Combats pour les droits de l’homme”, è pubblicato per la cortese disponibilità del Centre de Recherches et d’Études sur les Droits Fondamentaux - Université Paris Ouest Nanterre La Défense.

  5. The risk of shortage of radioelements at medical use must not lead to overlook the reactors safety that produce them; Le risque de penurie de radioelements a usage medical ne doit pas conduire a faire l'impasse sur la surete des reacteurs qui les produisent

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2009-07-01

    As the reactors supplying the world production of radioelements for medical use have over 40 years of operation, the nuclear safety authority alerts the stake holders on the necessity to prevent the conflicts between public health and nuclear safety in the production of these elements; Asn estimates that the solution is not to extend the lifetime of the reactors but goes for a new international concerted approach. The most of the present production comes from five old reactors: N.R.U. at Chalk river (Canada, 40%), H.F.R. at Petten (Netherlands, 30%), Safari at Pelindaba (South Africa, 10%) B.R.2 at Mol (Belgium, 9%) and Osiris at Saclay (France, 5%). In this context, Asn organised in january 2009 a seminar on the safety-availability of facilities of radio-isotopes production with safety authorities of the concerned countries. Nea organised a seminar on the radiopharmaceuticals supply at the end of january 2009. (N.C.)

  6. « Et ils ne vécurent pas heureux » : la fin de Jane Eyre réécrite dans Charlotte de D.M. Thomas “And they didn’t live happily ever after”: D.M. Thomas’s Rewriting of the Ending of Jane Eyre in Charlotte

    Directory of Open Access Journals (Sweden)

    Armelle Parey

    2009-10-01

    Full Text Available D.M. Thomas’s rewriting of Jane Eyre in Charlotte (2000 takes the shape of a transformation of the ending which enables the second Mrs Rochester’s story to be continued in the West Indies, thus also acknowledging Jean Rhys’s Wide Sargasso Sea as another intertext. In order to challenge the narrative and ideological hierarchy of the source text by rewriting its ending, the pastiche defamiliarises it while some chapters set in 1999 move the limits of rewriting and take the reader into a narrative spiral.

  7. Utilisation du foncier agricole à des fins de culture de Jatropha dans le Bassin arachidier sénégalais: une démarche controversée et des gains pas à la hauteur des attendus du programme

    Directory of Open Access Journals (Sweden)

    Aminata Ndour

    2017-10-01

    Full Text Available Durant les années 2000, le secteur énergétique mondial a connu un tourment décisif du fait de la diminution des réserves, de la demande importante et surtout de la fluctuation des prix du pétrole. Le Sénégal, pays dépendant encore des énergies fossiles, s’est engagé dans une politique de diversification énergétique. Par conséquent, un programme biocarburant est initié. Le Bassin Arachidier est un des espaces sollicités pour l’application des politiques de promotion des biocarburants. Une zone du production agricole a accueilli une innovation énergétique. Ce fait marquant a guidé nos interrogations sur les problèmes énergétiques qui ont incité la culture de Jatropha dans le Bassin Arachidier. De façon spécifique, notre analyse de la filière Jatropha précise les stratégies déployées. Il est questions dans ce cas d’étudier les effets de Jatropha sur l’espace de production et les conditions de vie des agriculteurs, des risques de réduction des superficies de cultures traditionnelles.

  8. ¿Qué pasó con el trabajo?: de la centralidad de los zapatos, barcos y lacre a los problemas planteados por los cerdos volando Whatever happened to Work: from the centrality of shoes, ships and sealing-wax to the problems posed by flying pigs

    Directory of Open Access Journals (Sweden)

    Peter Spink

    2011-11-01

    Full Text Available Durante toda su vida disciplinaria, la psicología y la psicología social han tratado el trabajo como un hecho naturalizado y una parte inevitable de la existencia humana. Mientras que temas como las condiciones de trabajo, trabajo digno, trabajo y la subjetividad, trabajo y vocación, orientación vocacional pueden ser discutidos de una manera crítica, la centralidad general del discurso del trabajo ha permanecido intacta. En este ensayo se argumenta que las múltiples formas, posibilidades, contradicciones y restricciones presentes en las relaciones económicas actuales apuntan al debilitamiento, o incluso fragmentación, de la función articulatoria del trabajo y en los países del tercer mundo como Brasil, donde el modelo occidental del empleo asalariado nunca fue extensiva más que a una parte de la población, este proceso se vuelve doblemente complicado. En estas circunstancias, es importante buscar otro punto de partida para la discusión de la psicología social sobre la actividad económica, que pueda dar mayor visibilidad a las múltiples formas en que las personas “salen del paso” con el fin de mantener sus hogares y el desarrollar colectivos familiares.
    During their entire disciplinary lives, psychology and social psychology have treated work as a naturalized fact and an inevitable part of human existence. Whilst themes such as working conditions, decent work, work and subjectivity, work and vocation, guidance and careers may be discussed in a critical manner, the overall centrality of the work discourse is left untouched. In this essay it is argued that the multiple forms, possibilities, contradictions and restrictions present in contemporary economic relations are pointing to the weakening, or even fragmentation, of the articulating role of work and in third world countries like Brazil, where the western model of salaried wage employment was never extensive to more than a part of the population, this process is becomes doubly complicated. In these circumstances it is important to seek a different starting point for the social psychological discussion of economic activity, which can give greater visibility to the multiple ways in which people "get by" in order to keep their homes together, sustain households and develop family collectives.

  9. From malnutrition to HIV: spirulina is an effective solution which continues to reveal its secrets De la malnutrition au VIH : la spiruline arme efficace qui n’en finit pas de livrer ses secrets De la malnutrición al VIH: la espirulina como arma eficaz que no cesa de revelar secretos

    OpenAIRE

    Raphaëlle Birot; Diane de Jouvencel; Laetitia Raginel; Geneviève Rouillé

    2012-01-01

    Spirulina presents major advantages in the fight against chronic malnutrition based on its micronutrient composition, its health potential and the fact that it can be grown locally. International solidarity associations, such as Antenna Technologies and Entrepreneurs du Monde whose goal is to reduce extreme poverty and public health problems in developing countries, have undertakenproduction and distribution programmes of spirulina, especially in West Africa. The quality of spirulina produced...

  10. Contribution to the asymptotic estimation of the global error of single step numerical integration methods. Application to the simulation of electric power networks; Contribution a l'estimation asymptotique de l'erreur globale des methodes d'integration numerique a un pas. Application a la simulation des reseaux electriques

    Energy Technology Data Exchange (ETDEWEB)

    Aid, R.

    1998-01-07

    This work comes from an industrial problem of validating numerical solutions of ordinary differential equations modeling power systems. This problem is solved using asymptotic estimators of the global error. Four techniques are studied: Richardson estimator (RS), Zadunaisky's techniques (ZD), integration of the variational equation (EV), and Solving for the correction (SC). We give some precisions on the relative order of SC w.r.t. the order of the numerical method. A new variant of ZD is proposed that uses the Modified Equation. In the case of variable step-size, it is shown that under suitable restriction, on the hypothesis of the step-size selection, ZD and SC are still valid. Moreover, some Runge-Kutta methods are shown to need less hypothesis on the step-sizes to exhibit a valid order of convergence for ZD and SC. Numerical tests conclude this analysis. Industrial cases are given. Finally, an algorithm to avoid the a priori specification of the integration path for complex time differential equations is proposed. (author)

  11. Paired-Associative Stimulation-Induced Long-term Potentiation-Like Motor Cortex Plasticity in Healthy Adolescents

    Directory of Open Access Journals (Sweden)

    Jonathan C. Lee

    2017-05-01

    Full Text Available ObjectiveThe objective of this study was to evaluate the feasibility of using paired-associative stimulation (PAS to study excitatory and inhibitory plasticity in adolescents while examining variables that may moderate plasticity (such as sex and environment.MethodsWe recruited 34 healthy adolescents (aged 13–19, 13 males, 21 females. To evaluate excitatory plasticity, we compared mean motor-evoked potentials (MEPs elicited by single-pulse transcranial magnetic stimulation (TMS before and after PAS at 0, 15, and 30 min. To evaluate inhibitory plasticity, we evaluated the cortical silent period (CSP elicited by single-pulse TMS in the contracted hand before and after PAS at 0, 15, and 30 min.ResultsAll participants completed PAS procedures. No adverse events occurred. PAS was well tolerated. PAS-induced significant increases in the ratio of post-PAS MEP to pre-PAS MEP amplitudes (p < 0.01 at all post-PAS intervals. Neither socioeconomic status nor sex was associated with post-PAS MEP changes. PAS induced significant CSP lengthening in males but not females.ConclusionPAS is a feasible, safe, and well-tolerated index of adolescent motor cortical plasticity. Gender may influence PAS-induced changes in cortical inhibition. PAS is safe and well tolerated by healthy adolescents and may be a novel tool with which to study adolescent neuroplasticity.

  12. Metabolic activation of pyrrolizidine alkaloids: insights into the structural and enzymatic basis.

    Science.gov (United States)

    Ruan, Jianqing; Yang, Mengbi; Fu, Peter; Ye, Yang; Lin, Ge

    2014-06-16

    Pyrrolizidine alkaloids (PAs) are natural toxins widely distributed in plants. The toxic potencies of different PAs vary significantly. PAs are mono- or diesters of necine acids with a necine base. On the basis of the necine bases, PAs are classified into three types: retronecine-type, otonecine-type, and platynecine-type. Hepatotoxic PAs contain an unsaturated necine base. PAs exert hepatotoxicity through metabolic activation by hepatic cytochromes P450s (CYPs) to generate reactive intermediates which form pyrrole-protein adducts. These adducts provide a mechanism-based biomarker to assess PA toxicity. In the present study, metabolic activation of 12 PAs from three structural types was investigated first in mice to demonstrate significant variations in hepatic metabolic activation of different PAs. Subsequently, the structural and enzymatic factors affecting metabolic activation of these PAs were further investigated by using human liver microsomes and recombinant human CYPs. Pyrrole-protein adducts were detected in the liver and blood of mice and the in vitro systems treated with toxic retronecine-type and otonecine-type PAs having unsaturated necine bases but not with a platynecine-type PA containing a saturated necine base. Retronecine-type PAs produced more pyrrole-protein adducts than otonecine-type PAs with similar necine acids, demonstrating that the structure of necine base affected PA toxic potency. Among retronecine-type PAs, open-ring diesters generated the highest amount of pyrrole-protein adducts, followed by macrocyclic diesters, while monoesters produced the least. Only CYP3A4 and CYP3A5 activated otonecine-type PAs, while all 10 CYPs studied showed the ability to activate retronecine-type PAs. Moreover, the contribution of major CYPs involved also varied significantly among retronecine-type PAs. In conclusion, our findings provide a scientific basis for predicting the toxicities of individual PAs in biological systems based on PA structural

  13. Problems in developing an instrument for the rapid assessment of personality status.

    Science.gov (United States)

    Van Horn, E; Manley, C; Leddy, D; Cicchetti, D; Tyrer, P

    2000-06-01

    To assess the validity of a quick assessment instrument (10 minutes) for assessing personality status, the Rapid Personality Assessment Schedule (PAS-R). The PAS-R was evaluated in psychotic patients recruited in one of the centres involved in a multicentre randomised controlled trial of intensive vs standard case management (the UK700 case management trial). Patients were assessed using both a full version of the PAS (PAS-I - ICD version) and the PAS-R. The weighted kappa statistic was used to gauge the (criterion-related) validity of the PAS-R using the PAS-I as the gold standard. Both measure code personality status using a four-point rating of severity in addition to recording individual categories of personality disorder. One hundred fifty-five (77%) of 201 patients recruited were assessed with both instruments. The weighted kappa statistic was 0.31, suggesting only moderate agreement between the PAS-I and PAS-R instruments under the four-point rating format, and 0.39 for the dichotomous personality disorder/no disorder separation. The sensitivity (64%) and specificity (82%) of the PAS-R in predicting PAS-I personality disorder were as satisfactory as for other screening instruments but still somewhat disappointing, and the PAS-R had an overall diagnostic accuracy of 78%. The PAS-R is a quick and rough method of detecting personality abnormality but is not a substitute for a fuller assessment.

  14. Personal assistance services in the workplace: A literature review.

    Science.gov (United States)

    Dowler, Denetta L; Solovieva, Tatiana I; Walls, Richard T

    2011-10-01

    Personal assistance services (PAS) can be valuable adjuncts to the complement of accommodations that support workers with disabilities. This literature review explored the professional literature on the use of PAS in the workplace. Bibliographic sources were used to locate relevant research studies on the use of PAS in the workplace. The studies in this review used both qualitative and quantitative methods to identify current definitions of work-related and personal care-related PAS, agency-directed versus consumer-directed PAS, long-term and short-term funding issues, development of PAS policy, and barriers to successful implementation of PAS. The studies uncovered issues related to (a) recruiting, training, and retaining personal assistants, (b) employer concerns, (c) costs and benefits of workplace PAS, (d) wages and incentives for personal assistants, and (e) sources for financing PAS as a workplace accommodation. The findings reveal the value and benefits of effective PAS on the job. PAS can lead to successful employment of people with disabilities when other accommodations cannot provide adequate workplace support. Additionally, the evolution of workplace PAS is dependent on development of realistic PAS policy and funding options. Published by Elsevier Inc.

  15. Assessing shortfalls and complementary conservation areas for national plant biodiversity in South Korea.

    Science.gov (United States)

    Choe, Hyeyeong; Thorne, James H; Huber, Patrick R; Lee, Dongkun; Quinn, James F

    2018-01-01

    Protected areas (PAs) are often considered the most important biodiversity conservation areas in national plans, but PAs often do not represent national-scale biodiversity. We evaluate the current conservation status of plant biodiversity within current existing PAs, and identify potential additional PAs for South Korea. We modeled species ranges for 2,297 plant species using Multivariate Adaptive Regression Splines and compared the level of mean range representation in South Korea's existing PAs, which comprise 5.7% of the country's mainland area, with an equal-area alternative PA strategy selected with the reserve algorithm Marxan. We also used Marxan to model two additional conservation scenarios that add lands to approach the Aichi Biodiversity Target objectives (17% of the country). Existing PAs in South Korea contain an average of 6.3% of each plant species' range, compared to 5.9% in the modeled equal-area alternative. However, existing PAs primarily represent a high percentage of the ranges for high-elevation and small range size species. The additional PAs scenario that adds lands to the existing PAs covers 14,587.55 km2, and would improve overall plant range representation to a mean of 16.8% of every species' range. The other additional PAs scenario, which selects new PAs from all lands and covers 13,197.35 km2, would improve overall plant range representation to a mean of 13.5%. Even though the additional PAs that includes existing PAs represents higher percentages of species' ranges, it is missing many biodiversity hotspots in non-mountainous areas and the additional PAs without locking in the existing PAs represent almost all species' ranges evenly, including low-elevation ones with larger ranges. Some priority conservation areas we identified are expansions of, or near, existing PAs, especially in northeastern and southern South Korea. However, lowland coastal areas and areas surrounding the capital city, Seoul, are also critical for biodiversity

  16. Multiple heart-cutting two dimensional liquid chromatography quadrupole time-of-flight mass spectrometry of pyrrolizidine alkaloids.

    Science.gov (United States)

    van de Schans, Milou G M; Blokland, Marco H; Zoontjes, Paul W; Mulder, Patrick P J; Nielen, Michel W F

    2017-06-23

    Pyrrolizidine alkaloids (PAs) and their and the corresponding N-oxides (PAs-ox) are genotoxic plant metabolites which can be present as unwanted contaminants in food products of herbal origin like tea and food supplements. PAs and PAs-ox come in a wide variety of molecular structures including many structural isomers. For toxicity assessment it is important to determine the composition of a sample and to resolve all isomeric PAs and PAs-ox, which is currently not possible in one liquid or gas chromatographic (LC or GC) run. In this study an online two dimensional liquid chromatography quadrupole time-of-flight mass spectrometry (2D-LC QToF-MS) method was developed to resolve isomeric PAs and PAs-ox. After comprehensive column and mobile phase selection a polar endcapped C 18 column was used at pH 3 in the first dimension, and a cross-linked C 18 column at pH 10 in the second dimension. Injection solvents, column IDs, flow rates and temperatures were carefully optimized. The method with column selection valve switching described in this study was able to resolve and visualize 20 individual PAs/PAs-ox (6 sets of isomers) in one 2D-LC QToF-MS run. Moreover, it was shown that all isomeric PAs/PAs-ox could be unambiguously annotated. The method was shown to be applicable for the determination and quantification of isomeric PAs/PAs-ox in plant extracts and could be easily extended to include other PAs and PAs-ox. Copyright © 2017 Elsevier B.V. All rights reserved.

  17. Advances in defect characterizations of semiconductors using positrons

    International Nuclear Information System (INIS)

    Lynn, K.G.; Asoka-Kumar, P.

    1996-01-01

    Positron Annihilation Spectroscopy (PAS) is a sensitive probe for studying the electronic structure of defects in solids. The authors summarize recent developments in defect characterization of semiconductors using depth-resolved PAS. The progress achieved in extending the capabilities of the PAS method is also described

  18. Risk assessment for pyrrolizidine alkaloids detected in (herbal) teas and plant food supplements

    NARCIS (Netherlands)

    Chen, Lu; Mulder, Patrick P.J.; Louisse, Jochem; Peijnenburg, Ad; Wesseling, Sebas; Rietjens, Ivonne M.C.M.

    2017-01-01

    Pyrrolizidine alkaloids (PAs) are plant metabolites present in some botanical preparations, with especially 1,2-unsaturated PAs being of concern because they are genotoxic carcinogens. This study presents an overview of tumour data on PAs and points of departure (PODs) derived from them,

  19. Pharmacological evidences for antiamnesic potentials of ...

    African Journals Online (AJOL)

    Phyllanhus amarus (PAs) is commonly known as Bhumi amla and is traditionally used since centuries in ayurveda. The present study was undertaken to investigate the effects of PAs on cognitive functions and brain cholinesterase activity in mice. PAs (50, 100 and 200 mg/kg) produced a dose- dependent improvement in ...

  20. Protected area coverage of threatened vertebrates and ecoregions in Peru: Comparison of communal, private and state reserves.

    Science.gov (United States)

    Shanee, Sam; Shanee, Noga; Monteferri, Bruno; Allgas, Nestor; Alarcon Pardo, Alejandro; Horwich, Robert H

    2017-11-01

    Protected areas (PAs) are a conservation mainstay and arguably the most effective conservation strategy for species protection. As a 'megadiverse' country, Peru is a priority for conservation actions. Peruvian legislation allows for the creation of state PAs and private/communal PAs. Using publicly available species distribution and protected area data sets we evaluated the coverage of Threatened terrestrial vertebrate species distributions and ecoregions provided by both kinds of PA in Peru. Peru's state PA system covers 217,879 km 2 and private/communal PAs cover 16,588 km 2 . Of the 462 species of Threatened and Data Deficient species we evaluated, 75% had distributions that overlapped with at least one PA but only 53% had ≥10% of their distributions within PAs, with inclusion much reduced at higher coverage targets. Of the species we evaluated, 118 species are only found in national PAs and 29 species only found in private/communal PAs. Of the 17 terrestrial ecoregions found in Peru all are represented in PAs; the national PA system included coverage of 16 and private/communal PAs protect 13. One ecoregion is only protected in private/communal PAs, whereas four are only covered in national PAs. Our results show the important role private/communal PAs can play in the protection of ecological diversity. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. Designing a protected area network for conservation planning in Jhum landscapes of Garo Hills, Meghalaya

    Science.gov (United States)

    A. Kumar; Bruce Marcot; G. Talukdar

    2010-01-01

    We studied vegetation and land cover characteristics within the existing array of protected areas (PAs) in South Garo Hills of Meghalaya, northeast India and introduce the concept of protected area network (PAN) and methods to determine linkages of forests among existing PAs. We describe and analyze potential elements of a PAN, including PAs, reserved forests,...

  2. Development and Validation of the Poverty Attributions Survey

    Science.gov (United States)

    Bennett, Robert M.; Raiz, Lisa; Davis, Tamara S.

    2016-01-01

    This article describes the process of developing and testing the Poverty Attribution Survey (PAS), a measure of poverty attributions. The PAS is theory based and includes original items as well as items from previously tested poverty attribution instruments. The PAS was electronically administered to a sample of state-licensed professional social…

  3. Comment protéger la santé des travailleurs dans un système qui ne repose pas sur les notions d’aptitude et d’inaptitude ? How to protect workers’ health in a system that is not based on the concepts of “capacity” and “incapacity” Cómo proteger la salud de los trabajadores en un sistema que no se basa en los conceptos de aptitud et ineptitud ?

    Directory of Open Access Journals (Sweden)

    Robert Plante

    2010-02-01

    Full Text Available Au Québec, en santé au travail, l’approche de santé publique a été privilégiée à l’approche médicale individuelle, parce qu’elle est conséquente aux objectifs de la loi, à savoir la prise en charge par le milieu de ses problèmes et la diminution, voire l’élimination des dangers. Quant aux activités médicales individuelles, elles ne sont réalisées que lorsqu’elles sont légitimes, c’est-à-dire lorsque leur pertinence et leur efficacité sur le plan de la prévention ont été démontrées. Quelques évaluations l’ont confirmé, l’approche par programme des services de santé publique québécois fonctionne en général très bien et elle est efficace. Mieux que l’examen médical de chaque sujet, elle permet de centrer les énergies sur les expositions professionnelles et les composantes de l’organisation du travail susceptibles de provoquer des problèmes. Malgré toutes ses qualités, le système de santé au travail québécois se heurte à de sérieuses résistances institutionnelles et politiques qui ont compromis son développement et mènent progressivement à son essoufflement.In Québec, in occupational health, the public health approach has been favoured over the individual medical approach because it is consistent with the objectives of the law, namely this community taking charge of its problems, and the reduction and even elimination of risk factors. Individual medical activities are limited to cases where the relevance and effectiveness of preventive benefits have been demonstrated. Some evaluative studies have shown that this Québec public health program approach works well in general, and is effective. Compared with the medical examination of each subject, it has a better potential for focusing energies on occupational exposures and on work organizational factors that could cause problems. Despite all its advantages, the Québec occupational health system is facing serious institutional and political resistance that has compromised its development and is gradually leading it to its dysfunction.En Quebec, en salud laboral, el enfoque de salud pública ha favorecido el enfoque médico individual, porque éste es consecuente con los objetivos de la Ley, a saberse : la asunción por parte del medio de sus problemas y la disminución o eliminación de los riesgos. En cuanto a las actividades médicas individuales, estas no son realizadas sino una vez que son legitimas, le que quiere decir que se realizan cuando es demostrada su pertinencia y eficacia en el plano de la prevención. Algunas evaluaciones han confirmado que el enfoque por programa de servicios de salud pública en Quebec funciona muy bien y es eficaz. Mejor que el examen médico individual, este programa permite concentrar las energías en las exposiciones profesionales y en los componentes de la organización de trabajo que podrían provocar problemas. A pesar de todas sus cualidades, el sistema de salud laboral de Quebec, afronta serias oposiciones institucionales y políticas que han comprometido su desarrollo y conducen progresivamente a su estancamiento.

  4. Factors affecting the conversion of apple polyphenols to phenolic acids and fruit matrix to short-chain fatty acids by human faecal microbiota in vitro.

    Science.gov (United States)

    Bazzocco, Sarah; Mattila, Ismo; Guyot, Sylvain; Renard, Catherine M G C; Aura, Anna-Marja

    2008-12-01

    Proanthocyanidins (PAs) in apples are condensed tannins comprised mostly of (-)-epicatechin units with some terminal (+)-catechins. PAs, especially those having a long chain-length, are absorbed in the upper intestine only to a small extent and are passed to the colon. In the colon they are subjected to microbial metabolism by colonic microbiota. In the present article, the ability of human microbiota to ferment apple PAs is studied. Freeze-dried fruit preparations (apple, enzymatically digested apple, isolated cell-walls, isolated PAs or ciders) from two varieties, Marie Ménard and Avrolles, containing PAs of different chain lengths, were compared. Fermentation studies were performed in an in vitro colon model using human faecal microbiota as an inoculum. The maximal extent of conversion to known microbial metabolites, was observed at late time point for Marie Ménard cider, having short PAs. In this case, the initial dose also contributed to the extent of conversion. Long-chain PAs were able to inhibit the in vitro microbial metabolism of PAs shown as low maxima at early time points. Presence of isolated PAs also suppressed SCFA formation from carbohydrates as compared with that from apple cell wall or faecal suspension without substrates. The low maximal extents at early time points suggest that there is a competition between the inhibitory effect of the PAs on microbial activity, and the ability to convert PAs by the microbiota.

  5. Measuring Individual Differences in the Perfect Automation Schema.

    Science.gov (United States)

    Merritt, Stephanie M; Unnerstall, Jennifer L; Lee, Deborah; Huber, Kelli

    2015-08-01

    A self-report measure of the perfect automation schema (PAS) is developed and tested. Researchers have hypothesized that the extent to which users possess a PAS is associated with greater decreases in trust after users encounter automation errors. However, no measure of the PAS currently exists. We developed a self-report measure assessing two proposed PAS factors: high expectations and all-or-none thinking about automation performance. In two studies, participants responded to our PAS measure, interacted with imperfect automated aids, and reported trust. Each of the two PAS measure factors demonstrated fit to the hypothesized factor structure and convergent and discriminant validity when compared with propensity to trust machines and trust in a specific aid. However, the high expectations and all-or-none thinking scales showed low intercorrelations and differential relationships with outcomes, suggesting that they might best be considered two separate constructs rather than two subfactors of the PAS. All-or-none thinking had significant associations with decreases in trust following aid errors, whereas high expectations did not. Results therefore suggest that the all-or-none thinking scale may best represent the PAS construct. Our PAS measure (specifically, the all-or-none thinking scale) significantly predicted the severe trust decreases thought to be associated with high PAS. Further, it demonstrated acceptable psychometric properties across two samples. This measure may be used in future work to assess levels of PAS in users of automated systems in either research or applied settings. © 2015, Human Factors and Ergonomics Society.

  6. Pedunculated Pulmonary Artery Sarcoma Suggested by Transthoracic Echocardiography.

    Science.gov (United States)

    Wang, Xiaobing; Ren, Weidong; Yang, Jun

    2016-04-01

    Pulmonary artery sarcoma (PAS) is an extremely rare malignancy. It is usually found after it grows large enough to occupy almost the entire lumen of the pulmonary artery and causes serious clinical symptoms. Thus, it is usually difficult to distinguish PAS from pulmonary thromboembolism based on imaging examinations. Few case reports had shown the attachment of PAS to pulmonary artery, a key characteristic for diagnosis, and differential diagnosis of PAS. In this case, we found a PAS, which did not cause local obstruction and some tumor emboli, which obstructed the branches of the pulmonary arteries and caused pulmonary hypertension and clinical symptoms. Transthoracic echocardiography (TTE) revealed a part of the tumor attached to the intima of the main pulmonary artery with a peduncle and had obvious mobility, which was suggestive of PAS and differentiated it from the pulmonary thromboembolism. To our knowledge, this is the first case report of a pedunculated PAS suggested by TTE. Combined with pulmonary artery computed tomography angiography, the diagnosis of PAS is strongly suggested before the operation. This case indicates that TTE could reveal the attachment and mobility of PAS in the main pulmonary and may provide useful information for the diagnosis and differential diagnosis of PAS, especially a pedunculated PAS. © 2015, Wiley Periodicals, Inc.

  7. Are satisfaction with and self-management of personal assistance services associated with the life satisfaction of persons with physical disabilities?

    Science.gov (United States)

    Fleming-Castaldy, Rita P

    2011-01-01

    To examine the relationships between satisfaction with and self-management of personal assistance services (PAS) and the quality of life (QoL) of persons with disabilities. To test the postulate that consumer-directed PAS can fulfil the human need for control and contribute to a satisfactory life. A survey compared the perspectives of persons using consumer-directed PAS versus those using agency-directed. A Personal Data Form obtained demographics and PAS characteristics. The Quality of Life Inventory measured life satisfaction. A PAS questionnaire measured perceptions about the management of, desire for control of, and satisfaction with PAS. Data were analysed using SPSS®- 14. Significant relationships were found between QoL and satisfaction with PAS (p perceived control of PAS and satisfaction with PAS (p satisfaction with their PAS (p satisfaction, and QoL support the value of consumer-directed programmes. Rehabilitation professionals can use this knowledge to develop, implement and research practises that enable self-management.

  8. Regulating performance of poly(L-lactic acid) by Addition of N, N‧-Bis(Salicyloyl) p-phthalic acid dihydrazide

    Science.gov (United States)

    Cai, Yan-Hua; Tian, Liang-Liang; Zhao, Li-Sha; Zhang, Mei-Xia

    2017-10-01

    Within this work, the influence of a crystallization accelerator N, N‧-bis(salicyloyl) p-phthalic acid dihydrazide (PAS) on the non-isothermal crystallization behavior, melting behavior, thermal stability, and light transmittance of poly(L-lactic acid) (PLLA) was investigated by differential scanning calorimetry (DSC), x-ray diffraction (XRD), thermogravimetric analysis (TGA), and light transmittance meter. Comparative analysis of the non-isothermal crystallization behavior of the primary PLLA and PLLA/PAS samples revealed an important role of PAS in promoting the crystallization of PLLA in cooling. Additionally, the concentration of PAS and cooling rate also exhibited significant effect on the non-isothermal crystallization process, and the 3 wt% PAS causes the PLLA to have the highest the onset crystallization temperature and the crystallization peak temperature, and the largest non-isothermal crystallization enthalpy. However, the increase of cooling rate resulted in the decrease of crystal growth ability, weakening the crystallization of PLLA. The investigating on the melting behavior under different conditions further confirmed the crystallization promoting effect of PAS for PLLA, and the crystallization temperature, resulting from the different crystal growth rate, affected remarkably the melting behavior of PLLA/3%PAS sample. The addition of PAS could not change the thermal decomposition behavior of the primary PLLA, but decreased the onset decomposition temperature with an increase of PAS concentration in PLLA matrix. Similarly, the incorporation of PAS is unfavourable to the light transmittance of the primary PLLA.

  9. Advanced practice registered nurses and physician assistants in sleep centers and clinics: a survey of current roles and educational background.

    Science.gov (United States)

    Colvin, Loretta; Cartwright, Ann; Collop, Nancy; Freedman, Neil; McLeod, Don; Weaver, Terri E; Rogers, Ann E

    2014-05-15

    To survey Advanced Practice Registered Nurse (APRN) and Physician Assistant (PA) utilization, roles and educational background within the field of sleep medicine. Electronic surveys distributed to American Academy of Sleep Medicine (AASM) member centers and APRNs and PAs working within sleep centers and clinics. Approximately 40% of responding AASM sleep centers reported utilizing APRNs or PAs in predominantly clinical roles. Of the APRNs and PAs surveyed, 95% reported responsibilities in sleep disordered breathing and more than 50% in insomnia and movement disorders. Most APRNs and PAs were prepared at the graduate level (89%), with sleep-specific education primarily through "on the job" training (86%). All APRNs surveyed were Nurse Practitioners (NPs), with approximately double the number of NPs compared to PAs. APRNs and PAs were reported in sleep centers at proportions similar to national estimates of NPs and PAs in physicians' offices. They report predominantly clinical roles, involving common sleep disorders. Given current predictions that the outpatient healthcare structure will change and the number of APRNs and PAs will increase, understanding the role and utilization of these professionals is necessary to plan for the future care of patients with sleep disorders. Surveyed APRNs and PAs reported a significant deficiency in formal and standardized sleep-specific education. Efforts to provide formal and standardized educational opportunities for APRNs and PAs that focus on their clinical roles within sleep centers could help fill a current educational gap.

  10. The role of bicarbonate in platelet additive solution for apheresis platelet concentrates stored with low residual plasma.

    Science.gov (United States)

    Radwanski, Katherine; Min, Kyungyoon

    2013-03-01

    Complex platelet additive solutions (PASs) are required to store platelet (PLT) concentrates with plasma levels below 30%. Previously, apheresis PLTs stored with 5% plasma in acetate- and bicarbonate-containing PAS maintained stable pH and bicarbonate levels during 7-day storage. Due to this observation, the necessity of added bicarbonate in PAS was investigated and whether the concurrent increase in PAS pH after bicarbonate addition had any effect on PLT storage. Apheresis PLTs were stored in 5% plasma-95% high- or low-pH PAS, with or without bicarbonate (n=10 per arm). Bicarbonate PAS PLTs were paired and nonbicarbonate PAS PLTs were paired (split from same double-dose collection). PLTs were evaluated for in vitro variables on Days 1 and 7 and up to Day 14 if the Day 7 pH was higher than 6.2. PLT pH was maintained above 7.3 to Day 14 in bicarbonate PAS PLTs while pH failures below 6.2 were observed in 4 of 10 and 2 of 10 units on Day 7 in low- and high-pH nonbicarbonate PAS arms, respectively. Day 7 in vitro variables in nonbicarbonate PAS PLTs with pH values of higher than 6.2 were comparable to Day 7 variables in bicarbonate PAS PLTs. The pH of bicarbonate PAS did have a small effect on pH and bicarbonate levels in PLT units, but did not have an effect on functional variables and metabolism. Bicarbonate was not required to maintain in vitro PLT function in 5% plasma-95% PAS, but was required as a pH buffer and increased PAS pH did not significantly contribute to this effect. © 2012 American Association of Blood Banks.

  11. Schizotypal perceptual aberrations of time: correlation between score, behavior and brain activity.

    Directory of Open Access Journals (Sweden)

    Shahar Arzy

    Full Text Available A fundamental trait of the human self is its continuum experience of space and time. Perceptual aberrations of this spatial and temporal continuity is a major characteristic of schizophrenia spectrum disturbances--including schizophrenia, schizotypal personality disorder and schizotypy. We have previously found the classical Perceptual Aberration Scale (PAS scores, related to body and space, to be positively correlated with both behavior and temporo-parietal activation in healthy participants performing a task involving self-projection in space. However, not much is known about the relationship between temporal perceptual aberration, behavior and brain activity. To this aim, we composed a temporal Perceptual Aberration Scale (tPAS similar to the traditional PAS. Testing on 170 participants suggested similar performance for PAS and tPAS. We then correlated tPAS and PAS scores to participants' performance and neural activity in a task of self-projection in time. tPAS scores correlated positively with reaction times across task conditions, as did PAS scores. Evoked potential mapping and electrical neuroimaging showed self-projection in time to recruit a network of brain regions at the left anterior temporal cortex, right temporo-parietal junction, and occipito-temporal cortex, and duration of activation in this network positively correlated with tPAS and PAS scores. These data demonstrate that schizotypal perceptual aberrations of both time and space, as reflected by tPAS and PAS scores, are positively correlated with performance and brain activation during self-projection in time in healthy individuals along the schizophrenia spectrum.

  12. Designing universal primers for the isolation of DNA sequences encoding Proanthocyanidins biosynthetic enzymes in Crataegus aronia

    Directory of Open Access Journals (Sweden)

    Zuiter Afnan

    2012-08-01

    Full Text Available Abstract Background Hawthorn is the common name of all plant species in the genus Crataegus, which belongs to the Rosaceae family. Crataegus are considered useful medicinal plants because of their high content of proanthocyanidins (PAs and other related compounds. To improve PAs production in Crataegus tissues, the sequences of genes encoding PAs biosynthetic enzymes are required. Findings Different bioinformatics tools, including BLAST, multiple sequence alignment and alignment PCR analysis were used to design primers suitable for the amplification of DNA fragments from 10 candidate genes encoding enzymes involved in PAs biosynthesis in C. aronia. DNA sequencing results proved the utility of the designed primers. The primers were used successfully to amplify DNA fragments of different PAs biosynthesis genes in different Rosaceae plants. Conclusion To the best of our knowledge, this is the first use of the alignment PCR approach to isolate DNA sequences encoding PAs biosynthetic enzymes in Rosaceae plants.

  13. UPLC-MS/MS method for determination of selected pyrrolizidine alkaloids in feed.

    Science.gov (United States)

    Bolechová, Martina; Cáslavský, Josef; Pospíchalová, Markéta; Kosubová, Petra

    2015-03-01

    Alkaloids known as secondary metabolites are grouped by typical structural characteristics into large families such as pyrrolizidine alkaloids (PAs) comprising more than 350 individual heterocyclic compounds. The PAs present a serious health risk to human and livestock; hence there is a need for methods that allow these dangerous plant toxins to be determined. In this study, a fast, reliable and sensitive approach is proposed to identify and quantify PAs in feed samples. PAs including monocrotaline, senkirkine, senecionine, seneciphylline and retrorsine were determined by ultra-performance liquid chromatography coupled with tandem mass spectrometry. Sample preparation was based on a modified QuEChERS approach. The mean recovery, precision, matrix effects and limits of quantification were assessed for three matrices within the method validation. The presented method was used to inspect 41 various feed samples, where the presence of PAs was expected. Roughages and feed for rabbits contained the highest levels of PAs, in general. Copyright © 2014 Elsevier Ltd. All rights reserved.

  14. Simultaneous analysis of hepatotoxic pyrrolizidine alkaloids and N-oxides in comfrey root by LC-ion trap mass spectrometry.

    Science.gov (United States)

    Wuilloud, Jorgelina C A; Gratze, Samuel R; Gamble, Bryan M; Wolnik, Karen A

    2004-02-01

    The purpose of the current study was to develop a LC-MS(n) method for the analysis of pyrrolizidine alkaloids (PAs) in comfrey. Published data presents an extensive list of PAs and their N-oxides present in comfrey. However, standards are not commercially available for any of the PAs typically present in comfrey. Those PAs that are not stereoisomers were readily resolved on a C(18) column using a water-acetonitrile gradient as the mobile phase. The use of a selective technique, LC-MS/MS, allowed us to identify groups of PAs and their N-oxides, as well as identify the number of PAs present in each group, including those that were not completely resolved chromatographically.

  15. Investigation of pyrrolizidine alkaloids and their N-oxides in commercial comfrey-containing products and botanical materials by liquid chromatography electrospray ionization mass spectrometry.

    Science.gov (United States)

    Altamirano, Jorgelina C; Gratz, Samuel R; Wolnik, Karen A

    2005-01-01

    Pyrrolizidine alkaloids (PAs) and their N-oxides are found in several plant families throughout the world. PAs are potentially toxic to the liver and/or lungs in humans and may cause acute liver failure, cirrhosis, pneumonitis, or pulmonary hypertension. PAs are also carcinogenic to animals, and they have been linked to the development of hepatocellular and skin squamous cell carcinomas as well as liver angiosarcomas. According to experimental studies, the quantity of PAs in some herbal teas and dietary supplements is sufficient to be carcinogenic in exposed individuals. A method for the extraction and identification of PAs and their N-oxides in botanical materials and commercial comfrey-containing products has been developed using liquid chromatography electrospray ionization mass spectrometry. Following optimization of the extraction procedure and the chromatographic conditions, the method was applied to the analysis of 10 herbal remedies. All of the products that were labeled to contain comfrey were found to contain measurable quantities of PAs.

  16. Radiation damage analysis by positron annihilation spectroscopy

    International Nuclear Information System (INIS)

    Siegel, R.W.

    1979-01-01

    The application of positron annihilation spectroscopy (PAS) to the characterization and study of defects in metals produced by radiation damage is discussed. The physical basis for the positron annihilation techniques (lifetime, Doppler broadening, angular correlation) is introduced and the techniques briefly described. Some examples of the application of PAS to radiation damage analysis are presented with a view toward elucidating the particular advantages of PAS over more traditional defect characterization techniques

  17. La "main invisible" dans les langues et la confection de dictionnaires ...

    African Journals Online (AJOL)

    user

    conduit à atteindre un objectif qui n'était pas dans leurs intentions, d'autant plus que c'est dans ce cas qu'ils sont ..... colonisation. Nous considérons l'écriture comme "la liste de signes graphiques ..... locuteurs ne parlent pas, et ils veulent faire parler ce que les locuteurs n'ont pas standardisé. .... tue aucun mal. Le signe ...

  18. A concise entry into nonsymmetrical alkyl polyamines.

    Science.gov (United States)

    Pirali, Tracey; Callipari, Grazia; Ercolano, Emanuela; Genazzani, Armando A; Giovenzana, Giovanni Battista; Tron, Gian Cesare

    2008-10-02

    The synthesis of nonsymmetrical polyamines (PAs) has, up to now, been problematic due to lengthy synthetic procedures, lack of regioselectivity, and very poor atom economy. An innovative synthetic protocol for nonsymmetrical PAs using a modified Ugi reaction ( N-split Ugi) which simplifies the synthesis of these tricky compounds is described. We believe that this new synthesis may open the door for the generation of new and pharmacologically active PAs.

  19. Immunocytochemical demonstration of polyamines in nucleoli and nuclei

    DEFF Research Database (Denmark)

    Shin, Masashi; Nakamuta, Hiromichi; Oda-Ueda, Naoko

    2008-01-01

    in both nucleoli and nuclei of a variety of cell types. Detection of nucleolar and nuclear PAs required novel pretreatment procedures involving protease and/or DNase digestion of specimens prior to immunoreaction. Double fluorescence staining confirmed the localizations. This suggests that PAs may...... be important to the formation of ribosomes in nucleoli, as well as adds support to biochemical studies suggesting that PAs are involved in many biological events in the nucleus. Further biochemical studies will be needed to substantiate this hypothesis....

  20. Agents de changement : la philanthropie dans certains pays d'Asie ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    29 avr. 2016 ... Le contexte de l'élaboration des politiques en Asie du Sud-Est entrave généralement les efforts philanthropiques, car les bailleurs de fonds ne reçoivent pas de reconnaissance, bénéficient de très peu d'incitations fiscales et n'ont pas de services de soutien sur lesquels compter. On ne peut donc pas ...

  1. Characteristics and Sampling Efficiencies of Two Personal Aerosol Samplers

    Science.gov (United States)

    2007-07-01

    stainless steel and plastic; therefore, it can be decontaminated easily by immersing in decontamination solution. 9 PAS-2 PAS-1 Figure 3. Picture of PAS...portable, and easy to use for decontamination . The sampling efficiency tests were conducted with monodisperse 0.5-, 1-, and 2.1-gtm fluorescent...Scientific, Corp., Palo Alto, CA). The PSL aerosols were generated using a 24 jet Collison nebulizer and then passed through a radioactive isotope (Kr-85

  2. Stochastic Control Theory, Nonlinear Structural Mechanics and Applied Combinatorics

    Science.gov (United States)

    1989-05-12

    More specifically: (") x 3 PAS and Steiner triple systems; (") x 4 PAS and Steiner triple systems which can be nested; and (’) x 5 PAS and Steiner ...am Rudolf Wille CONCEPTUAL SCALING Technische Hochschule Darmstadt Abstract: Scaling of empirical data uses formal patterns to lead to a better...of Arizona Jan 18 - 22 Wille, Rudolf Technische Hochschule Darmstadt Jan 17 - 23 21 APPLICATIONS OF COMBINATORICS AND GRAPH THEORY TO THE BIOLOGICAL

  3. Anterior chamber angle imaging with swept-source optical coherence tomography: measuring peripheral anterior synechia in glaucoma.

    Science.gov (United States)

    Lai, Isabel; Mak, Heather; Lai, Gilda; Yu, Marco; Lam, Dennis S C; Leung, Christopher K S

    2013-06-01

    To investigate the use of swept-source optical coherence tomography (OCT) for measuring the area and degree of peripheral anterior synechia (PAS) involvement in patients with angle-closure glaucoma. Cross-sectional study. Twenty-three eyes with PAS (detected by indentation gonioscopy) from 20 patients with angle-closure glaucoma (20 eyes had primary angle-closure glaucoma and 3 eyes had angle-closure glaucoma secondary to chronic anterior uveitis [n = 2] and Axenfeld-Rieger syndrome [n = 1]). The anterior chamber angles were evaluated with indentation gonioscopy and imaged by swept-source OCT (Casia OCT, Tomey, Nagoya, Japan) in room light and in the dark using the "angle analysis" protocol, which was composed of 128 radial B-scans each with 512 A-scans (16-mm scan length). The area and degree of PAS involvement were measured in each eye after manual detection of the scleral spur and the anterior irido-angle adhesion by 2 masked observers. The interobserver variability of the PAS measurements was calculated. The agreement of PAS assessment by gonioscopy and OCT, the area and the degree of PAS involvement, and the intraclass correlation coefficient (ICC) of interobserver PAS measurements. The area of PAS (mean ± standard deviation) was 20.8 ± 16.9 mm(2) (range, 3.9-74.9 mm(2)), and the degree of PAS involvement was 186.5 ± 79.9 degrees (range, 42-314 degrees). There was no difference in the area of PAS (P = 0.90) and the degree of PAS involvement (P = 0.95) between images obtained in room light and in the dark. The interobserver ICCs were 0.99 (95% confidence interval [CI], 0.98-1.00) for the area of PAS and 0.99 (95% CI, 0.97-1.00) for the degree of PAS involvement. There was good agreement of PAS assessment between gonioscopy and OCT images (kappa = 0.79; 95% CI, 0.67-0.91). Swept-source OCT allows visualization and reproducible measurements of the area and degree of PAS involvement, providing a new paradigm for evaluation of PAS progression and risk assessment

  4. Enseignement technique/Technical Training

    CERN Multimedia

    1998-01-01

    Bureautique et techniques administratives/Office Automation & Administrative Techniques - Premiers pas/Getting started - E-Mail - Management Tools - WWW - Applications bureautiques/Office applications

  5. The practice of euthanasia and physician-assisted suicide in the United States: adherence to proposed safeguards and effects on physicians.

    Science.gov (United States)

    Emanuel, E J; Daniels, E R; Fairclough, D L; Clarridge, B R

    1998-08-12

    Despite intense debates about legalization, there are few data examining the details of actual euthanasia and physician-assisted suicide (PAS) cases in the United States. To determine whether the practices of euthanasia and PAS are consistent with proposed safeguards and the effect on physicians of having performed euthanasia or PAS. Structured in-depth telephone interviews. Randomly selected oncologists in the United States. Adherence to primary and secondary safeguards for the practice of euthanasia and PAS; regret, comfort, and fear of prosecution from performing euthanasia or PAS. A total of 355 oncologists (72.6% response rate) were interviewed on euthanasia and PAS. On 2 screening questions, 56 oncologists (15.8%) reported participating in euthanasia or PAS; 53 oncologists (94.6% response rate) participated in in-depth interviews. Thirty-eight of 53 oncologists described clearly defined cases of euthanasia or PAS. Twenty-three patients (60.5%) both initiated and repeated their request for euthanasia or PAS, but 6 patients (15.8%) did not participate in the decision for euthanasia or PAS. Thirty-seven patients (97.4%) were experiencing unremitting pain or such poor physical functioning they could not perform self-care. Physicians sought consultation in 15 cases (39.5%). Overall, oncologists adhered to all 3 main safeguards in 13 cases (34.2%): (1) having the patient initiate and repeat the request for euthanasia or PAS, (2) ensuring the patient was experiencing extreme physical pain or suffering, and (3) consulting with a colleague. Those who adhered to the safeguards had known their patients longer and tended to be more religious. In 28 cases (73.7%), the family supported the decision. In all cases of pain, patients were receiving narcotic analgesia. Fifteen patients (39.5%) were enrolled in a hospice. While 19 oncologists (52.6%) received comfort from having helped a patient with euthanasia or PAS, 9 (23.7%) regretted having performed euthanasia or PAS, and

  6. Ácaros asociados a dos especies de Odontotaenius(Coleóptera: Passalidae) en México

    OpenAIRE

    Barrios-Torres, Pilar Liliana; Villegas-Guzmán, Gabriel A.

    2015-01-01

    Resumen:Los ácaros se relacionan con pasálidos, estableciendo una asociación temporal para transportarse (foresia). Se conocen más de 200 especies de ácaros forontes de pasálidos. El objetivo del estudio fue conocer la diversidad de ácaros asociados a dos especies de Odontotaenius,así como determinar sus sitios de fijación. Se recolectaron pasálidos de troncos en descomposición en seis estados de México. Se encontraron 80 pasálidos con ácaros (64 de O. zodiacusy 16 de O. striatopunctatus),en ...

  7. A novel ultra-performance liquid chromatography hyphenated with quadrupole time of flight mass spectrometry method for rapid estimation of total toxic retronecine-type of pyrrolizidine alkaloids in herbs without requiring corresponding standards.

    Science.gov (United States)

    Zhu, Lin; Ruan, Jian-Qing; Li, Na; Fu, Peter P; Ye, Yang; Lin, Ge

    2016-03-01

    Nearly 50% of naturally-occurring pyrrolizidine alkaloids (PAs) are hepatotoxic, and the majority of hepatotoxic PAs are retronecine-type PAs (RET-PAs). However, quantitative measurement of PAs in herbs/foodstuffs is often difficult because most of reference PAs are unavailable. In this study, a rapid, selective, and sensitive UHPLC-QTOF-MS method was developed for the estimation of RET-PAs in herbs without requiring corresponding standards. This method is based on our previously established characteristic and diagnostic mass fragmentation patterns and the use of retrorsine for calibration. The use of a single RET-PA (i.e. retrorsine) for construction of calibration was based on high similarities with no significant differences demonstrated by the calibration curves constructed by peak areas of extract ion chromatograms of fragment ion at m/z 120.0813 or 138.0919 versus concentrations of five representative RET-PAs. The developed method was successfully applied to measure a total content of toxic RET-PAs of diversified structures in fifteen potential PA-containing herbs. Copyright © 2014 Elsevier Ltd. All rights reserved.

  8. Construct validity of a revised Physical Activity Scale and testing by cognitive interviewing

    DEFF Research Database (Denmark)

    Andersen, Lise G; Groenvold, Mogens; Jørgensen, Torben

    2010-01-01

    ), previously found to overestimate physical activity. RESULTS: Cognitive interviewing revealed few problems in the questions on physical activity in different domains. No problems regarding the structure of the questionnaire were identified. The agreement between PAS 1 and PAS 2 MET-scores was high among...... was evaluated by cognitive interviewing in 16 Danish men and women aged 21-70 years. Construct validity was validated in 342 men and women aged 35-66 years by assessing agreement between 24-h MET-scores obtained from average weekly physical activity measured by PAS 2 and a 24-h Physical Activity Scale (PAS 1...

  9. Evaluation and application of a passive air sampler for polycylic aromatic hydrocarbons (PAHs).

    Science.gov (United States)

    Esen, Fatma; Evci, Yildiz M; Tasdemir, Yucel

    2017-08-24

    Sampling of 15 PAHs by the use of both passive air sampler developed (D-PAS) in our research group and PAS (C-PAS) having widespread use in the literature was conducted to compare the performances of the samplers. Sampling was carried out for 1-year period (February 2013-February 2014), in different sampling periods by employing D-PAS and C-PAS. D-PAS and C-PAS were run in parallel for 10, 20, 30, 40 and 60 days. Sampling rates were calculated for both PASs by the use of concentration values obtained from a high-volume air sampler (HVAS). It was determined that calculated sampling values are different from each other by definition of design of C-PAS and D-PAS and difference in environment as velocity of wind and temperature are having different effects upon sampling rates. Collected σ 15 PAHs amounts of 10-day periods in spring, summer, autumn and winter were obtained as 576 ± 333, 209 ± 29, 2402 ± 910 and 664 ± 246 ng for D-PAS and 1070 ± 522, 318 ± 292, 6062 ± 1501 and 6089 ± 4018 ng for C-PAS, respectively. In addition, according to seasons, when collected PAHs in two different samplers were considered, similar results were obtained for the summer time in which no combustion takes place with the aim of domestic heating, while there were differences determined for the seasons with combustion in need of domestic heating. Gas-phase σ 15 PAHs' concentrations were reported depending on seasons in the spring, summer, autumn and winter sequences as 46 ± 32, 9 ± 3, 367 ± 207 and 127 ± 93 ng m -3 for HVAS, respectively.

  10. Pyrrolizidine and tropane alkaloids in teas and the herbal teas peppermint, rooibos and chamomile in the Israeli market.

    Science.gov (United States)

    Shimshoni, Jakob Avi; Duebecke, Arne; Mulder, Patrick P J; Cuneah, Olga; Barel, Shimon

    2015-01-01

    Dehydro pyrrolizidine alkaloids (dehydro PAs) are carcinogenic phytotoxins prevalent in the Boraginaceae, Asteraceae and Fabaceae families. Dehydro PAs enter the food and feed chain by co-harvesting of crops intended for human and animal consumption as well as by carry-over into animal-based products such as milk, eggs and honey. Recently the occurrence of dehydro PAs in teas and herbal teas has gained increasing attention from the EU, due to the high levels of dehydro PAs found in commercially available teas and herbal teas in Germany and Switzerland. Furthermore, several tropane alkaloids (TAs, e.g. scopolamine and hyoscyamine) intoxications due to the consumption of contaminated herbal teas were reported in the literature. The aim of the present study was to determine the dehydro PAs and TAs levels in 70 pre-packed teabags of herbal and non-herbal tea types sold in supermarkets in Israel. Chamomile, peppermint and rooibos teas contained high dehydro PAs levels in almost all samples analysed. Lower amounts were detected in black and green teas, while no dehydro PAs were found in fennel and melissa herbal teas. Total dehydro PAs concentrations in chamomile, peppermint and rooibos teas ranged from 20 to 1729 μg/kg. Except for black tea containing only mono-ester retrorsine-type dehydro PAs, all other teas and herbal teas showed mixed patterns of dehydro PA ester types, indicating a contamination by various weed species during harvesting and/or production. The TA levels per teabag were below the recommended acute reference dose; however, the positive findings of TAs in all peppermint tea samples warrant a more extensive survey. The partially high levels of dehydro PAs found in teas and herbal teas present an urgent warning letter to the regulatory authorities to perform routine quality control analysis and implement maximum residual levels for dehydro PAs.

  11. Assessment of Light Pollution Impact on Protected Areas in China

    Science.gov (United States)

    Jiang, W.; He, G.; Ni, Y.

    2017-09-01

    The Protected Areas (PAs) with natural, ecological and cultural value play important role in biological processes, biodiversity and ecosystem service. During the past years of rapid urban expansion in China, the spatial range and intensity of light pollution unprecedented increase. Historically, optical remote sensing and field survey data had been used to reveal that human activities impacted on PAs for individual areas and few papers documented the issue of light pollution impact on PAs at national scale. Here, time series night-time light satellite images of Defense Meteorological Satellite Program Operational Linescan System (DMSP-OLS) were selected to assess the light pollution impacted on PAs in China. The method we proposed can be effectively applied to assess the impact of light pollution on PAs and the percent of dark PAs decreased by 35.38 % from 1992 to 2012 at nationwide. The trend of light pollution of most PAs in stable, however, light pollution of the local area is increase significantly, especially in northern Xinjiang, Gansu, Xizang, Yunnan, Jiangsu and Shandong. Considering the current status of light pollution encroach into PAs, two strategies of appropriate buffer zone and wide measured for light pollution are also recommend.

  12. Creating Protected Areas on Public Lands: Is There Room for Additional Conservation?

    Directory of Open Access Journals (Sweden)

    Rodrigo A Arriagada

    Full Text Available Most evaluations of the effectiveness of PAs have relied on indirect estimates based on comparisons between protected and unprotected areas. Such methods can be biased when protection is not randomly assigned. We add to the growing literature on the impact of PAs by answering the following research questions: What is the impact of Chilean PAs on deforestation which occurred between 1986 and 2011? How do estimates of the impact of PAs vary when using only public land as control units? We show that the characteristics of the areas in which protected and unprotected lands are located differ significantly. To satisfactorily estimate the effects of PAs, we use matching methods to define adequate control groups, but not as in previous research. We construct control groups using separately non-protected private areas and non-protected public lands. We find that PAs avoid deforestation when using unprotected private lands as valid controls, however results show no impact when the control group is based only on unprotected public land. Different land management regimes, and higher levels of enforcement inside public lands may reduce the opportunity to add additional conservation benefits when the national systems for PAs are based on the protection of previously unprotected public lands. Given that not all PAs are established to avoid deforestation, results also admit the potential for future studies to include other outcomes including forest degradation (not just deforestation, biodiversity, wildlife, primary forests (not forests in general, among others.

  13. Applications of Positron Annihilation Spectroscopy

    OpenAIRE

    Asoka-Kumar , P.; Lynn , K.

    1995-01-01

    We describe the application of Positron Annihilation Spectroscopy (PAS) to some selected technologically important systems. The method involves a nondestructive probe to detect low levels of open-volume defects. The discussion shows the application of PAS to a wide range of advanced material systems.

  14. African Voices on Structural Adjustment : A Companion to Our ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    histoire et l'avenir de l'ajustement structurel en Afrique. Chaque étude évalue le rendement des politiques d'ajustement structurel (PAS) à l'égard d'un secteur ou d'un enjeu en particulier. Dans chaque cas, on évalue la compatibilité des PAS avec ...

  15. The physician assistant workforce in Indiana: preparing to meet future health care needs.

    Science.gov (United States)

    Snyder, Jennifer; Zorn, Jennifer; Gjerde, Tom; Burkhart, Jennifer; Rosebrock, Lori

    2011-12-01

    This study identifies baseline demographic and descriptive statistics for physician assistants (PAs) in Indiana from 1978 to 2010. Data were obtained from Indiana Professional Licensing Agency applications, the Indiana State Department of Health, and PA educational programs. Descriptive statistics were used to characterize the PA workforce as well as their supervising physicians. Most PAs working in Indiana were born and educated outside the state. Of those educated in Indiana, 77% obtained an initial license in Indiana; as of May 2010, 62% were still licensed in the state. In the past 8 years, Indiana had a 97% increase in active licensed PAs. Only 24% of PAs work in primary care; 92% work in metropolitan areas. For 40 years, PAs have increasingly worked in areas that are medically underserved or experiencing a shortage of health professionals. However, the overall numbers of PAs working in those areas remain low. More PAs in Indiana are practicing in medical specialties than in primary care. As health care policy and regulatory changes evolve, future studies will be needed to understand the impact on the health care workforce of Indiana PAs. This study will serve as a baseline for those studies.

  16. Earthy and musty off-flavor episodes in catfish split-pond aquaculture systems

    Science.gov (United States)

    The interest and use of variations of partitioned aquaculture systems (PAS) by the southeastern U.S. catfish farming industry continues to grow. Split-pond systems, one type of PAS, are designed to improve management of dissolved oxygen levels and fish waste products (e.g., ammonia) compared to conv...

  17. Physician-assisted suicide: the legal slippery slope.

    Science.gov (United States)

    Walker, R M

    2001-01-01

    In Oregon, physicians can prescribe lethal amounts of medication only if requested by competent, terminally ill patients. However, the possibility of extending the practice to patients who lack decisional capacity exists. This paper examines why the legal extension of physician-assisted suicide (PAS) to incapacitated patients is possible, and perhaps likely. The author reviews several pivotal court cases that have served to define the distinctions and legalities among "right-to-die" cases and the various forms of euthanasia and PAS. Significant public support exists for legalizing PAS and voluntary euthanasia in the United States. The only defenses against sliding from PAS to voluntary euthanasia are adhering to traditional physician morality that stands against it and keeping the issue of voluntary euthanasia legally framed as homicide. However, if voluntary euthanasia evolves euphemistically as a medical choice issue, then the possibility of its legalization exists. If courts allow PAS to be framed as a basic personal right akin to the right to refuse treatment, and if they rely on right-to-die case precedents, then they will likely extend PAS to voluntary euthanasia and nonvoluntary euthanasia. This would be done by extending the right to PAS to incapacitated patients, who may or may not have expressed a choice for PAS prior to incapacity.

  18. Performance Appraisals Systems in the Middle Eeast

    DEFF Research Database (Denmark)

    Giangreco, Antonio; Carugati, Andrea; Pilati, Massimo

    2010-01-01

    ) articulated around five main logics: control, continuity, formality, information and motivation. On the basis of this literature review and exemplified through a case study, we show that research on PAS in the ME cannot be conducted assuming the same logics. The evaluation of success and failure of PAS...

  19. Compartir fitxers amb Dropbox

    OpenAIRE

    Torres, Begoña; Halbaut, Lyda; Aróztegui Trenchs, Montserrat

    2013-01-01

    Dropbox és un servei d’allotjament de fitxers en línia, que ens permet emmagatzemar els nostres documents al núvol de manera gratuïta. Es mostra pas a pas com donar-se d'alta al Dropbox i compartir documents.

  20. Concentrations of proanthocyanidins in common foods and estimations of normal consumption.

    Science.gov (United States)

    Gu, Liwei; Kelm, Mark A; Hammerstone, John F; Beecher, Gary; Holden, Joanne; Haytowitz, David; Gebhardt, Susan; Prior, Ronald L

    2004-03-01

    Proanthocyanidins (PAs) have been shown to have potential health benefits. However, no data exist concerning their dietary intake. Therefore, PAs in common and infant foods from the U.S. were analyzed. On the bases of our data and those from the USDA's Continuing Survey of Food Intakes by Individuals (CSFII) of 1994-1996, the mean daily intake of PAs in the U.S. population (>2 y old) was estimated to be 57.7 mg/person. Monomers, dimers, trimers, and those above trimers contribute 7.1, 11.2, 7.8, and 73.9% of total PAs, respectively. The major sources of PAs in the American diet are apples (32.0%), followed by chocolate (17.9%) and grapes (17.8%). The 2- to 5-y-old age group (68.2 mg/person) and men >60 y old (70.8 mg/person) consume more PAs daily than other groups because they consume more fruit. The daily intake of PAs for 4- to 6-mo-old and 6- to 10-mo-old infants was estimated to be 1.3 mg and 26.9 mg, respectively, based on the recommendations of the American Academy of Pediatrics. This study supports the concept that PAs account for a major fraction of the total flavonoids ingested in Western diets.

  1. S'attaquer à l'inflation et à la réforme du régime de retraite au Liban ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    20 avr. 2016 ... Comme les personnes n'ayant pas occupé un emploi officiel n'y sont pas admissibles, nombre de personnes, parmi lesquelles des vendeurs de rue, des jeunes, des pigistes, des personnes au foyer et des handicapés, se voient refuser une couverture. Ces personnes font souvent appel aux membres de ...

  2. para-Aminosalicylic acid is a prodrug targeting dihydrofolate reductase in Mycobacterium tuberculosis.

    Science.gov (United States)

    Zheng, Jun; Rubin, Eric J; Bifani, Pablo; Mathys, Vanessa; Lim, Vivian; Au, Melvin; Jang, Jichan; Nam, Jiyoun; Dick, Thomas; Walker, John R; Pethe, Kevin; Camacho, Luis R

    2013-08-09

    para-Aminosalicylic acid (PAS) is one of the antimycobacterial drugs currently used for multidrug-resistant tuberculosis. Although it has been in clinical use for over 60 years, its mechanism(s) of action remains elusive. Here we report that PAS is a prodrug targeting dihydrofolate reductase (DHFR) through an unusual and novel mechanism of action. We provide evidences that PAS is incorporated into the folate pathway by dihydropteroate synthase (DHPS) and dihydrofolate synthase (DHFS) to generate a hydroxyl dihydrofolate antimetabolite, which in turn inhibits DHFR enzymatic activity. Interestingly, PAS is recognized by DHPS as efficiently as its natural substrate para-amino benzoic acid. Chemical inhibition of DHPS or mutation in DHFS prevents the formation of the antimetabolite, thereby conferring resistance to PAS. In addition, we identified a bifunctional enzyme (riboflavin biosynthesis protein (RibD)), a putative functional analog of DHFR in a knock-out strain. This finding is further supported by the identification of PAS-resistant clinical isolates encoding a RibD overexpression mutation displaying cross-resistance to genuine DHFR inhibitors. Our findings reveal that a metabolite of PAS inhibits DHFR in the folate pathway. RibD was shown to act as a functional analog of DHFR, and as for DHFS, both were shown to be associated in PAS resistance in laboratory strains and clinical isolates.

  3. Acceptability for French People of Physician-Assisted Suicide

    Science.gov (United States)

    Frileux, Stephanie; Sastre, Maria Teresa Munoz; Antonini, Sophie; Mullet, Etienne; Sorum, Paul Clay

    2004-01-01

    Our aim was to understand better how people judge the acceptability of physician-assisted suicide (PAS). We found that, for people in France of all ages and for elderly people with life-threatening illnesses, acceptability is an additive combination of the number of requests for PAS, the patient's age, the amount of physical suffering, and the…

  4. Physician Assisted Suicide: Knowledge and Views of Fifth-Year Medical Students in Germany

    Science.gov (United States)

    Schildmann, Jan; Herrmann, Eva; Burchardi, Nicole; Schwantes, Ulrich; Vollmann, Jochen

    2006-01-01

    Suicide and assisted suicide are not criminal acts in Germany. However, attempting suicide may create a legal duty for physicians to try to save a patient's life. This study presents data on medical students' legal knowledge and ethical views regarding physician assisted suicide (PAS). The majority of 85 respondents held PAS to be illegal. More…

  5. Just How Important Is the Messenger versus the Message? The Case of Framing Physician-Assisted Suicide

    Science.gov (United States)

    Haider-Markel, Donald P.; Joslyn, Mark R.

    2004-01-01

    As a political issue, death and dying topics only sometimes reach the political agenda. However, some issues, such as physician-assisted suicide (PAS) have been highly salient. This article explores attitudes toward PAS by examining the malleability of opinion when respondents are exposed to issue frames and when specific messengers present those…

  6. The early postnatal pattern of vesicle formation in different regions of the porcien small intestine

    DEFF Research Database (Denmark)

    Elbrønd, Vibeke Sødring; Weström, B.R.

    2007-01-01

    applied to visualize cytoplasmatic subcellular components such as fat (Oil red O) and carbohydrates (PAS). Appearance and morphology of the epithelial vesicles were compared. In the proximal region several small supranuclear and a single large subnuclear electron dense, eosinophilic and PAS+ vesicle were...

  7. Questionnaire-based survey suggests that the majority of Danish geriatricians are against euthanasia

    DEFF Research Database (Denmark)

    Ilvemark, Johan; Dahle, Bård; Matzen, Lars Erik

    2016-01-01

    INTRODUCTION: Euthanasia (EU) and/or physician-assisted suicide (PAS) is legal in some countries and being considered in others. Attitudes to EU/PAS among Danish geriatricians were studied. METHODS: An online questionnaire with 12 questions was e-mailed to all members of the Danish Geriatric...

  8. Attitudes towards, and wishes for, euthanasia in advanced cancer patients at a palliative medicine unit.

    Science.gov (United States)

    Johansen, Sissel; Hølen, Jacob Chr; Kaasa, Stein; Loge, Håvard Jon; Materstvedt, Lars Johan

    2005-09-01

    Most studies on attitudes towards euthanasia and physician-assisted suicide (PAS) have been conducted in healthy populations. The aim of this study is to explore and describe attitudes towards, and wishes for, euthanasia/PAS in cancer patients with short life expectancy. Semi-structured interviews with 18 cancer patients with a life expectancy of less than nine months. All patients were recruited from an inpatient palliative medicine unit. Patients holding a positive attitude towards euthanasia/PAS do not necessarily want euthanasia/PAS for themselves. Wishes are different from requests for euthanasia/PAS. Fear of future pain and a painful death were the main reasons given for a possible wish for euthanasia/PAS. Worries about minimal quality of life and lack of hope also contributed to such thoughts. Wishes for euthanasia/PAS were hypothetical; they were future oriented and with a prerequisite that intense pain, lack of quality of life and/or hope had to be present. Additionally, wishes were fluctuating and ambivalent. The wish to die in these patients does not seem to be constant. Rather, this wish is more appropriately seen as an ambivalent and fluctuating mental 'solution' for the future. Health care providers should be aware of this when responding to utterances regarding euthanasia/PAS.

  9. Kenya | Page 4 | IDRC - International Development Research Centre

    International Development Research Centre (IDRC) Digital Library (Canada)

    eau et les routes) n'affecte pas les femmes et les filles de la même manière que les hommes et les garçons. C'est pour cette raison que les gouvernements devraient élaborer des budgets sexospécifiques. Read more about Ne réduisez pas les ...

  10. Questionnaire-based survey suggests that the majority of Danish geriatricians are against euthanasia.

    Science.gov (United States)

    Ilvemark, Johan; Dahle, Bård; Matzen, Lars-Erik

    2016-02-01

    Euthanasia (EU) and/or physician-assisted suicide (PAS) is legal in some countries and being considered in others. Attitudes to EU/PAS among Danish geriatricians were studied. An online questionnaire with 12 questions was e-mailed to all members of the Danish Geriatric Society. The response rate was 46% (120/261). A total of 55.8% (67/120) disagreed that EU is ethically justifiable, whereas 22.5% (27/120) found that EU is justifiable. Furthermore, 13.3% (16/120) agreed that EU should be offered as an alternative to palliative treatment, 73.4% (88/120) disagreed. A total of 64.2% (67/120) disagreed that PAS is ethically justifiable, whereas 19.2% (23/120) found that PAS is justifiable. In all, 15% (18/120) agreed that PAS should be offered as an alternative to palliative treatment, whereas 76.6% (92/120) disagreed. The impact of legalisation of EU/PAS on the relationship between physician and patient was believed to be negative by 62.2% (74/119), positive by 12.6% (15/119) and without implications by 25.2% (30/119). Younger physicians tended to be more positive towards EU/PAS. The majority of Danish geriatricians are opposed to EU and PAS. none. none.

  11. Assaying total carotenoids in flours of corn and sweet potato flours by laser photoacoustic spectroscopy

    NARCIS (Netherlands)

    Luterotti, S.; Bicanic, D.D.; Kijak, K.; Grbesa, D.; Martinez, E.; Spruijt, R.B.

    2011-01-01

    This study describes the application of the laser photoacoustic spectroscopy (PAS) for quantification of total carotenoids (TC) in corn flours and sweetpotato flours. Overall, thirty-three different corn flours and nine sweetpotato flours were investigated. All PAS measurements were performed at

  12. Livestock Poisoning with Pyrrolizidine Alkaloid Containing Plants (Senecio, Crotalaria, Cynoglossum, Amsinckia, Heliotropium and Echium spp.)

    Science.gov (United States)

    Pyrrolizidine alkaloids (PAs) are potent liver toxins that have been identified in over 6,000 plants throughout the world. Alkaloids are nitrogen-based compounds with potent biological activity. About half of the identified PAs are toxic and several cause cancer (carcinogenic). PA-containing plants...

  13. Latin American protected areas: Protected from chemical pollution?

    Science.gov (United States)

    Rodríguez-Jorquera, Ignacio A; Siroski, Pablo; Espejo, Winfred; Nimptsch, Jorge; Choueri, Paloma Gusso; Choueri, Rodrigo Brasil; Moraga, Claudio A; Mora, Miguel; Toor, Gurpal S

    2017-03-01

    Protected areas (PAs) are critically important means to preserve species and maintain natural ecosystems. However, the potential impacts of chemical pollution on PAs are seldom mentioned in the scientific literature. Research on the extent of the occurrence of chemical pollution inside PAs and in-depth assessments of how chemical contaminants may adversely affect the maintenance of species abundance, species survival, and ecosystem functions are scarce to nonexistent. We investigated 1) the occurrence of chemical contaminants inside 119 PAs in Latin America from publically available databases, and 2) reviewed case studies of chemical contaminants and pollution in 4 Latin American PAs. Cases of chemical pollution and contamination inside Latin American PAs mostly originated from sources such as mining, oil, and gas extraction. To date, the focus of the research on chemical pollution research inside Latin American PAs has been primarily on the detection of contamination, typically limited to trace metals. Where management actions have occurred, they have been reactive rather than proactive. Protected areas established in wetlands are the most affected by chemical pollution. Based on the information from the pollution and/or contamination occurrence and the case studies analyzed, Latin American PAs are not well safeguarded from chemical pollution, resulting in both challenges and opportunities to conserve biodiversity and ecosystems. Integr Environ Assess Manag 2017;13:360-370. © 2016 SETAC. © 2016 SETAC.

  14. Improvement in equipment for initiating combustion of bituminous beds

    Energy Technology Data Exchange (ETDEWEB)

    Kleyev, A M; Galimov, R R; Smerkovich, Y S

    1981-01-01

    An experimental sample of a unit is developed based on the logging lifter PK-2 which was tested with initiation of intrabed combustion at the Sugushlinskiy field (viscosity of bitumen over 10/sup 3/ Pa.s) and Mordovo-Karmal'skiy field (viscosity of bitumen up to 3 Pa.s). Technical characteristics and operating principles of the unit are presented.

  15. Impact of extended maceration and regulated deficit irrigation (RDI) in Cabernet Sauvignon wines: characterization of proanthocyanidin distribution, anthocyanin extraction, and chromatic properties.

    Science.gov (United States)

    Casassa, L Federico; Larsen, Richard C; Beaver, Christopher W; Mireles, Maria S; Keller, Markus; Riley, William R; Smithyman, Russell; Harbertson, James F

    2013-07-03

    The impact of extended maceration (EM) was studied in Cabernet Sauvignon grapes sourced from a vineyard subjected to four regulated deficit irrigation (RDI) treatments: (I) 100% replenishment of crop evapotranspiration (100% ETc), (II) 70% ETc, (III) 25% ETc until véraison, followed by 100% ETc until harvest, and IV) 25% ETc. Each vineyard replicate was made into wine with two replicates designated as controls (10-day skin contact) and two as extended maceration (EM, 30-day skin contact). The mean degree of polymerization (mDP), size distribution, concentration, and composition of wine proanthocyanidins (PAs) and monomeric flavan-3-ols of 90 fractions were characterized by preparative and analytical HPLC techniques. The maceration length imparted a larger effect on most chemical parameters. The RDI treatment had no effect on the extraction patterns of anthocyanins, PAs, and/or on the origin of the PAs extracted into the wines. Conversely, EM led to anthocyanin losses and increased PA extraction during maceration, with ~73% of seed-derived PAs. Accordingly, the concentration of monomeric flavan-3-ols, oligomeric (2 ≤ mDP < 5) and polymeric PAs (mDP ≥ 5) was higher in EM wines. The size distribution of the wines' PAs revealed two major peaks as a function of concentration at mDP 2 (22-27% of total PAs mass) and at mDP 6-7 (12-17% of total PAs mass) and was found to follow a non-normal Rayleigh-type distribution.

  16. Physical Attractiveness, Attitude Similarity, and Length of Acquaintance as Contributors to Interpersonal Attraction Among Adolescents

    Science.gov (United States)

    Cavior, Norman; And Others

    1975-01-01

    Tenth and twelfth grade males and females who knew each other judged, within grade levels, their classmates on physical attractiveness (PA), perceived attitude similarity (PAS), and interpersonal attraction (IA). Regression analyses supported the hypotheses that PA and PAS are positively correlated. (Author)

  17. INCIDENCE DE LA COCHENILLE FARINEUSE DU MANGUIER ...

    African Journals Online (AJOL)

    AISA

    (ornementation, abris) étaient abattues. Tableau 1 : Impact de Rastrococcus invadens sur quelques caractéristiques agronomiques (évaluation après deux ans) .... sont certainement pas sans risque. En effet, alors qu'elles ne sont pas efficaces, les méthodes physiques sont destructrices. (abattage, brûlis). Quant aux ...

  18. Creating Protected Areas on Public Lands: Is There Room for Additional Conservation?

    Science.gov (United States)

    Arriagada, Rodrigo A; Echeverria, Cristian M; Moya, Danisa E

    2016-01-01

    Most evaluations of the effectiveness of PAs have relied on indirect estimates based on comparisons between protected and unprotected areas. Such methods can be biased when protection is not randomly assigned. We add to the growing literature on the impact of PAs by answering the following research questions: What is the impact of Chilean PAs on deforestation which occurred between 1986 and 2011? How do estimates of the impact of PAs vary when using only public land as control units? We show that the characteristics of the areas in which protected and unprotected lands are located differ significantly. To satisfactorily estimate the effects of PAs, we use matching methods to define adequate control groups, but not as in previous research. We construct control groups using separately non-protected private areas and non-protected public lands. We find that PAs avoid deforestation when using unprotected private lands as valid controls, however results show no impact when the control group is based only on unprotected public land. Different land management regimes, and higher levels of enforcement inside public lands may reduce the opportunity to add additional conservation benefits when the national systems for PAs are based on the protection of previously unprotected public lands. Given that not all PAs are established to avoid deforestation, results also admit the potential for future studies to include other outcomes including forest degradation (not just deforestation), biodiversity, wildlife, primary forests (not forests in general), among others.

  19. Northwest Territories Protected Areas Strategy: How community values are shaping the protection of wild spaces and heritage places

    Science.gov (United States)

    Angela Stadel; Raymond Taniton; Heidi Heder

    2002-01-01

    The Northwest Territories Protected Areas Strategy (NWT PAS), approved in 1999, presents a unique community-driven approach to establishing a network of protected areas in the North. The NWT PAS arose from increasing resource development pressures in the Northwest Territories and is being implemented in the context of the land claim and treaty processes. Aboriginal...

  20. The utility of periodic acid schiff with diastase and alcian blue stains on fine needle aspirates of breast and salivary gland neoplasms

    Directory of Open Access Journals (Sweden)

    N K Panicker

    2012-01-01

    Conclusion : Intracytoplasmic PAS-D-positive globules may be useful in differentiating benign and malignant lesions of breast. The presence of PAS-D positive granules are useful in differentiating various lesions of salivary glands. AB staining of stromal fragments in pleomorphic adenoma is useful in differentiating it from basal cell adenoma.

  1. Exploring Imperfect Squeezing Flow Measurements in a Teflon Geometry for Semisolid Foods

    NARCIS (Netherlands)

    Terpstra, M.E.J.; Janssen, A.M.; Linden, van der E.

    2007-01-01

    The method of imperfect lubricated squeezing flow in a Teflon¿ geometry has been explored for the characterization of elongational behavior of custard and mayonnaise. Two Newtonian products, one of low (0.07 Pas) and one of high (18 Pas) shear viscosity, were used as references. Measurements of

  2. A global assessment of the social and conservation outcomes of protected areas.

    Science.gov (United States)

    Oldekop, J A; Holmes, G; Harris, W E; Evans, K L

    2016-02-01

    Protected areas (PAs) are a key strategy for protecting biological resources, but they vary considerably in their effectiveness and are frequently reported as having negative impacts on local people. This has contributed to a divisive and unresolved debate concerning the compatibility of environmental and socioeconomic development goals. Elucidating the relationship between positive and negative social impacts and conservation outcomes of PAs is key for the development of more effective and socially just conservation. We conducted a global meta-analysis on 165 PAs using data from 171 published studies. We assessed how PAs affect the well-being of local people, the factors associated with these impacts, and crucially the relationship between PAs' conservation and socioeconomic outcomes. Protected areas associated with positive socioeconomic outcomes were more likely to report positive conservation outcomes. Positive conservation and socioeconomic outcomes were more likely to occur when PAs adopted comanagement regimes, empowered local people, reduced economic inequalities, and maintained cultural and livelihood benefits. Whereas the strictest regimes of PA management attempted to exclude anthropogenic influences to achieve biological conservation objectives, PAs that explicitly integrated local people as stakeholders tended to be more effective at achieving joint biological conservation and socioeconomic development outcomes. Strict protection may be needed in some circumstances, yet our results demonstrate that conservation and development objectives can be synergistic and highlight management strategies that increase the probability of maximizing both conservation performance and development outcomes of PAs. © 2015 The Authors. Conservation Biology published by Wiley Periodicals, Inc. on behalf of Society for Conservation Biology.

  3. Protecting important sites for biodiversity contributes to meeting global conservation targets

    DEFF Research Database (Denmark)

    Butchart, Stuart H. M.; Scharlemann, Jörn P.W.; Evans, Mike I.

    2012-01-01

    Protected areas (PAs) are a cornerstone of conservation efforts and now cover nearly 13% of the world's land surface, with the world's governments committed to expand this to 17%. However, as biodiversity continues to decline, the effectiveness of PAs in reducing the extinction risk of species re...

  4. Comparison of phytoplankton communities in catfish split-pond aquaculture systems with conventional ponds

    Science.gov (United States)

    There has been a growing interest and use of variations of partitioned aquaculture systems (PAS) in recent years by the southeastern United States of America farmed catfish industry. Split-pond systems, one type of PAS, are designed to better manage fish waste byproducts (e.g., ammonia) and dissolv...

  5. African Journal of Science and Technology: Submissions

    African Journals Online (AJOL)

    apparaîtront pas régulièrement. Veuillez utiliser de différents systèmes de croisées et de pointillages. Nous essayerons d'ouvrir le texte sur disquette ici, mais ce n'est pas toujours possible; alors veuillez utiliser une imprimante à laser de 600dpi pour ...

  6. Enhancing the Participation of Immigrant Families in Schools through Intermediary Organizations? the Case of Parents' Associations in Catalonia

    Science.gov (United States)

    Paniagua, Alejandro

    2018-01-01

    This paper discusses the results of an action-research project developed in a federation of Parents Associations (PAs) in Catalonia, aimed at helping PAs involve immigrant families. First, I nuance the idea of participation in schools to highlight some of the problems associated with participative initiatives targeting"'hard to reach"…

  7. AcEST: DK950886 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1|B8CNU1_9GAMM PAS domain protein OS=Shewanella piezotol... 35 3.0 tr|Q20684|Q206...ATI-LSRRIAVEYSDSEDDSEFDEVE 555 >tr|B8CNU1|B8CNU1_9GAMM PAS domain protein OS=Shewanella piezotolerans WP3 GN

  8. 4. Bend.pmd

    African Journals Online (AJOL)

    sulaiman.adebowale

    25 févr. 2008 ... C'est après la deuxième guerre mondiale que naît la notion de ..... cependant pas à ignorer des situations qui, très contrastées à l'échelle de la ..... nante occidentale, ils ne semblent cependant pas préconiser autre chose que.

  9. Physician assistants as servant leaders: meeting the needs of the underserved.

    Science.gov (United States)

    Huckabee, Michael J; Wheeler, Daniel W

    2011-01-01

    The purpose of this study was to determine if the level of servant leader characteristics in clinically practicing physician assistants (PAs) in underserved populations differed from PAs serving in other locales. Five subscales of servant leadership: altruistic calling, emotional healing, wisdom, persuasive mapping, and organizational stewardship, were measured in a quantitative study of clinically practicing PAs using a self-rating survey and a similar survey by others rating the PA. Of 777 PAs invited, 321 completed the survey. On a scale of 1 to 5, mean PA self-ratings ranged from 3.52 (persuasive mapping) to 4.05 (wisdom). Other raters' scores paired with the self-rated PA scores were comparable in all subscales except wisdom, which was rated higher by the other raters (4.32 by other raters, 4.01 by PAs, P= .002). There was no significant difference in the measures of servant leadership reported by PAs serving the underserved compared to PAs serving in other populations. Servant leader subscales were higher for PAs compared to previous studies of other health care or community leader populations. The results found that the PA population studied had a prominent level of servant leadership characteristics that did not differ between those working with underserved and nonunderserved populations.

  10. Applications of infrared photo-acoustic spectroscopy for wood samples

    Science.gov (United States)

    Mon-Lin Kuo; John F. McClelland; Siquan Luo; Po-Liang Chien; R.D. Walker; Chung-Yun Hse

    1988-01-01

    Various infrared (IR) spectroscopic techniques for the analysis of wood samples are briefly discussed. Theories and instrumentation of the newly developed photoacoustic spectroscopic (PAS) technique for measuring absorbance spectra of solids are presented. Some important applications of the PAS technique in wood science research are discussed. The application of the...

  11. 'Conservationists' and the 'Local People' in Biodiversity Conservation

    African Journals Online (AJOL)

    Studies on biodiversity in Africa show its rapid loss and degradation. This is commonly explained with non-sustainable use by local people. Across Africa, extensive systems of protected areas (PAs) have been established to mitigate this trend. Creation of PAs, however, resulted in manifold conflicts with people who depend ...

  12. Experiment list: SRX507386 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available SRX507386 dm3 Input control Input control Adult Ovary NA 7241558,94.8,40.6,561 GSM1361776: WT PAS preincuba...tion; Drosophila melanogaster; ChIP-Seq source_name=WT_WT_PAS preincubation || strai

  13. Experiment list: SRX507394 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 361784: mutant PAS preincubation; Drosophila melanogaster; ChIP-Seq source_name=mutant_mutant_PAS preincubat...SRX507394 dm3 Input control Input control Adult Ovary NA 7228130,93.9,47.6,224 GSM1

  14. Pyrrolizidine alkaloids in food: A spectrum of potential health consequences

    Science.gov (United States)

    Contamination of grain with 1,2-dehydropyrrolizidine ester alkaloids (dehydroPAs) and their N-oxides is responsible for large incidents of acute and subacute food poisoning, with high morbidity and mortality, in Africa and in central and south Asia. Herbal medicines and teas containing dehydroPAs ha...

  15. Diagnostic performance of Contrast-enhanced CT in Pyrrolizidine Alkaloids-induced Hepatic Sinusoidal Obstructive Syndrome

    Science.gov (United States)

    Kan, Xuefeng; Ye, Jin; Rong, Xinxin; Lu, Zhiwen; Li, Xin; Wang, Yong; Yang, Ling; Xu, Keshu; Song, Yuhu; Hou, Xiaohua

    2016-01-01

    Hepatic sinusoidal obstruction syndrome (HSOS) can be caused by pyrrolizidine alkaloids(PAs)-containing herbals. Since PAs exposure is obscure and clinical presentation of HSOS is unspecific, it is challenge to establish the diagnosis of PAs-induced HSOS. Gynura segetum is one of the most wide-use herbals containing PAs. The aim of our study is to describe the features of contrast-enhanced computed tomography (CT) in gynura segetum-induced HSOS, and then determine diagnostic performance of radiological signs. We retrospectively analyzed medical records and CT images of HSOS patients (71 cases) and the controls (222 cases) enrolled from January 1, 2008, to Oct 31, 2015. The common findings of contrast CT in PAs-induced HSOS included: ascites (100%), hepatomegaly (78.87%), gallbladder wall thickening (86.96%), pleural effusion (70.42%), hepatic vein narrowing (87.32%), patchy liver enhancement (92.96%), and heterogeneous hypoattenuation (100%); of these signs, patchy enhancement and heterogeneous hypoattenuation were valuable features. Then, the result of diagnostic performance demonstrated that contrast CT possessed better performance in diagnosing PAs-induced HSOS compared with various parameters of Seattle criteria. In conclusion, the patients with PAs-induced HSOS display distinct radiologic features at CT-scan, which reveals that contrast-enhanced CT provides an effective noninvasive method for diagnosing PAs-induced HSOS. PMID:27897243

  16. The associative brain at work

    DEFF Research Database (Denmark)

    Suppa, A.; Quartarone, A.; Siebner, H.

    2017-01-01

    with movement disorders and other neuropsychiatric diseases. The present review covers the physiology, pharmacology, pathology and motor effects of PAS. Further sections of the review focus on new protocols of “modified PAS” and possible future application of PAS in neuromorphic circuits designed for brain...

  17. A Column Generation Approach for Solving the Patient Admission Scheduling Problem

    DEFF Research Database (Denmark)

    Range, Troels Martin; Lusby, Richard Martin; Larsen, Jesper

    This paper addresses the Patient Admission Scheduling (PAS) problem. The PAS problem deals with assigning elective patients to beds, satisfying a number of soft and hard constraints. The problem can be seen as part of the functions of hospital management at an operational level. There exists a sm...... to produce new best solutions for ve out of six instances from a publicly available repository....

  18. Tree cover changes in- and ouside protected areas in China

    DEFF Research Database (Denmark)

    Nüchel, Jonas; Bøcher, Peder Klith; Svenning, J.-C.

    Protected areas (PAs) are one of the main tools in the global conservation of biodiversity and ecosystems. This is also the case for China. However, only few studies have investigated protected areas´ efficiency in maintaining ecosystems and biodiversity. One way to investigate this is to look...... at tree cover changes inside the PAs and on the surrounding areas. Using MODIS Vegetation Continuous Fields we mapped tree-cover changes between 2000-2010 in- and outside PAs in China. The PAs were extracted from the World Database on Protected Areas. Our aim were to investigated the following four...... between tree cover change and general human pressure. We did not find a significant correlation between tree cover change inside and outside PAs with increasing general human pressures. The lack of correlation could be due to the huge reforestation China has carried out the last years, mainly to stop...

  19. Statement on the risks for human health related to the presence of pyrrolizidine alkaloids in honey, tea, herbal infusions and food supplements

    DEFF Research Database (Denmark)

    Petersen, Annette

    day to assess the carcinogenic risks of PAs, and concluded that there is a possible concern for human health related to the exposure to PAs, in particular for frequent and high consumers of tea and herbal infusions. The Panel noted that consumption of food supplements based on PA-producing plants......, including the development of more sensitive and specific analytical methods. A recommendation was also issued on the generation of data to identify the toxic and carcinogenic potency of the PAs commonly found in food.......EFSA was asked by the European Commission to deliver a scientific opinion on the risks for human health related to the presence of pyrrolizidine alkaloids (PAs) in honey, tea, herbal infusions and food supplements and to identify the PAs of relevance in the aforementioned food commodities...

  20. Power, Avionics and Software - Phase 1.0:. [Subsystem Integration Test Report

    Science.gov (United States)

    Ivancic, William D.; Sands, Obed S.; Bakula, Casey J.; Oldham, Daniel R.; Wright, Ted; Bradish, Martin A.; Klebau, Joseph M.

    2014-01-01

    This report describes Power, Avionics and Software (PAS) 1.0 subsystem integration testing and test results that occurred in August and September of 2013. This report covers the capabilities of each PAS assembly to meet integration test objectives for non-safety critical, non-flight, non-human-rated hardware and software development. This test report is the outcome of the first integration of the PAS subsystem and is meant to provide data for subsequent designs, development and testing of the future PAS subsystems. The two main objectives were to assess the ability of the PAS assemblies to exchange messages and to perform audio testing of both inbound and outbound channels. This report describes each test performed, defines the test, the data, and provides conclusions and recommendations.

  1. A study of Canadian hospice palliative care volunteers' attitudes toward physician-assisted suicide.

    Science.gov (United States)

    Claxton-Oldfield, Stephen; Miller, Kathryn

    2015-05-01

    The purpose of this study was to examine the attitudes of hospice palliative care (HPC) volunteers who provide in-home support (n = 47) and members of the community (n = 58) toward the issue of physician-assisted suicide (PAS). On the first part of the survey, participants responded to 15 items designed to assess their attitudes toward PAS. An examination of individual items revealed differences in opinions among members of both the groups. Responses to additional questions revealed that the majority of volunteers and community members (1) support legalizing PAS; (2) would choose HPC over PAS for themselves if they were terminally ill; and (3) think Canadians should place more priority on developing HPC rather than on legalizing PAS. The implications of these findings are discussed. © The Author(s) 2014.

  2. Models and Approaches for Integrating Protected Areas with Their Surroundings: A Review of the Literature

    Directory of Open Access Journals (Sweden)

    Wenwu Du

    2015-06-01

    Full Text Available Several studies have identified threats that originate in areas surrounding protected areas (PAs. While there have been various efforts to integrate PAs with their surroundings, considerable challenges remain. Here we summarize these efforts to date, discuss their effectiveness, and provide recommendations for future research. Based on a broad literature review of theoretical and applied approaches, we have outlined 68 models for balancing conservation and sustainable development in PAs. We comprehensively analyzed 23 of these models for integrating PAs with their surroundings. They were divided into two categories: area-oriented and process-oriented approaches. This review reveals the absolute necessity of combining these two approaches for future conservation and sustainable development of PAs.

  3. Changes of free, soluble conjugated and bound polyamine titers of jojoba explants under sodium chloride salinity in vitro.

    Science.gov (United States)

    Roussos, Peter A; Pontikis, Constantine A

    2007-07-01

    Jojoba (Simmondsia chinensis L.) single node explants were cultured in a basal medium supplemented with 17.8 microM 6-benzyladenine and four levels of sodium chloride concentration (0, 56.41, 112.82 and 169.23 mM). The free, the soluble conjugated and the insoluble bound forms of polyamines (PAs) (putrescine (Put), spermidine (Spd) and spermine (Spm)) were determined monthly during a 3-month proliferation stage. Free Put and Spd were found in higher levels in the control treatment, while Spm content was higher in the salt treatments. All soluble conjugated PAs were found to be in lower concentrations in explants growing on medium supplemented with salt, while the opposite was true for the insoluble bound PAs. It appeared that certain PAs and PAs forms could play a significant role in the adaptation mechanism of jojoba under saline conditions.

  4. Personality Assessment Screener, Childhood Abuse, and Adult Partner Violence in African American Women Using Primary Care.

    Science.gov (United States)

    Porcerelli, John H; Hurrell, Kristen; Cogan, Rosemary; Jeffries, Keturah; Markova, Tsveti

    2015-12-01

    This study assessed the relationship between psychopathology with the Personality Assessment Screener (PAS) and childhood physical and sexual abuse and adult physical and sexual partner violence in a primary care sample of 98 urban-dwelling African American women. Patients completed the PAS, the Childhood Trauma Questionnaire, and the Conflict Tactics Scale. The PAS total score significantly correlated with all measures of childhood and adult abuse. Stepwise regression analyses revealed that PAS element scores of Suicidal Thinking and Hostile Control significantly predicted a history of childhood physical abuse; Suicidal Thinking, Hostile Control, and Acting Out significantly predicted a history of childhood sexual abuse; Suicidal Thinking, Negative Affect, and Alienation significantly predicted current adult partner physical violence; and Psychotic Features, Alcohol Problems, and Anger Control significantly predicted current adult sexual partner violence. The PAS appears to be a useful measure for fast-paced primary care settings for identifying patients who need a more thorough assessment for abuse. © The Author(s) 2015.

  5. Risques, lumières et obscurités: les éclairages de l’humanisme méthodologique

    Directory of Open Access Journals (Sweden)

    Roger Nifle

    2015-09-01

    Full Text Available Comme toute chose, pour les hommes, le risque s'entend en plusieurs Sens, comme aussi ils se le disent et se le racontent. Voilà posés les repères de l'Humanisme Méthodologique et son anthropologie fondamentale. Il y a risque là où l'hypothèse d'un dommage est envisagée. Mais cette hypothèse est une spéculation puisque si le dommage se produit alors le risque comme anticipation n'est plus ou pas le même, pouvant toujours en spéculer une autre. Pas d'imaginaire pas de risque. On dira volontiers inconscient celui qui ne voit pas ou ne mesure pas le risque tel qu'il est. Mais il n'est que dans la spéculation.

  6. Panic disorder: a review of DSM-IV panic disorder and proposals for DSM-V.

    Science.gov (United States)

    Craske, Michelle G; Kircanski, Katharina; Epstein, Alyssa; Wittchen, Hans-Ulrich; Pine, Danny S; Lewis-Fernández, Roberto; Hinton, Devon

    2010-02-01

    This review covers the literature since the publication of DSM-IV on the diagnostic criteria for panic attacks (PAs) and panic disorder (PD). Specific recommendations are made based on the evidence available. In particular, slight changes are proposed for the wording of the diagnostic criteria for PAs to ease the differentiation between panic and surrounding anxiety; simplification and clarification of the operationalization of types of PAs (expected vs. unexpected) is proposed; and consideration is given to the value of PAs as a specifier for all DSM diagnoses and to the cultural validity of certain symptom profiles. In addition, slight changes are proposed for the wording of the diagnostic criteria to increase clarity and parsimony of the criteria. Finally, based on the available evidence, no changes are proposed with regard to the developmental expression of PAs or PD. This review presents a number of options and preliminary recommendations to be considered for DSM-V.

  7. Associative cortico-cortical plasticity may affect ipsilateral finger opposition movements

    DEFF Research Database (Denmark)

    Rizzo, V; Bove, M; Naro, A

    2011-01-01

    We have recently demonstrated that cortico-cortical paired associative stimulation (cc-PAS) can modulate interhemispheric inhibition (IHI) in the human brain. Here we further explored the after effects of cc-PAS on fine hand movements. Ten healthy right-handed volunteers received 90 paired...... transcranial stimuli to the right and left primary motor hand area (M1(HAND)) at an interstimulus interval (ISI) of 8 ms. We studied the after effects of cc-PAS on the performance of repetitive finger opposition movements of different complexity on both hands using a sensor-engineered glove. A quantitative...... evaluation of the following parameters was performed: Touch Duration (TD), Inter Tapping Interval (ITI) and Number of Errors (NE). We confirmed previous data by showing that left-to-right and right-to-left cc-PAS attenuated IHI. The new finding is that both left-to-right and right-to-left cc-PAS were able...

  8. Protected Areas' Impacts on Brazilian Amazon Deforestation: Examining Conservation-Development Interactions to Inform Planning.

    Science.gov (United States)

    Pfaff, Alexander; Robalino, Juan; Herrera, Diego; Sandoval, Catalina

    2015-01-01

    Protected areas are the leading forest conservation policy for species and ecoservices goals and they may feature in climate policy if countries with tropical forest rely on familiar tools. For Brazil's Legal Amazon, we estimate the average impact of protection upon deforestation and show how protected areas' forest impacts vary significantly with development pressure. We use matching, i.e., comparisons that are apples-to-apples in observed land characteristics, to address the fact that protected areas (PAs) tend to be located on lands facing less pressure. Correcting for that location bias lowers our estimates of PAs' forest impacts by roughly half. Further, it reveals significant variation in PA impacts along development-related dimensions: for example, the PAs that are closer to roads and the PAs closer to cities have higher impact. Planners have multiple conservation and development goals, and are constrained by cost, yet still conservation planning should reflect what our results imply about future impacts of PAs.

  9. [A case of parental alienation].

    Science.gov (United States)

    Menz, Wolfgang

    2014-01-01

    The clinical term "Parental Alienation Syndrome" (PAS) was introduced in 1984 by Richard Gardner, an American psychiatrist. Gardner described PAS and its symptoms, as a personality disorder, which appears chiefly in connection to child custody disputes wherein a child turns suddenly and massively against the non-custodial parent without reasonable grounds for doing so. This action by the child is a result of the custodial parent's emotionally abusive attempts to incite the child against the non-custodial parent.Where the child's rejection is based on some real past experience, there is not PAS. PAS only occurs as a result of the custodial parent's actions. Despite intensive effort, PAS was not included in the new DSM-V. In this case, a particularly impressive case history of parental alienation is described and discussed.

  10. The chemical profile of pyrrolizidine alkaloids from selected greek endemic boraginaceae plants determined by gas chromatography/mass spectrometry.

    Science.gov (United States)

    Damianakos, Harilaos; Jeziorek, Malgorzata; Pietrosiuk, Agnieszka; Chinou, Ioanna

    2014-01-01

    Four Greek endemic Boraginaceae plants, Onosma erecta Sibth. & Sm., Onosma kaheirei Teppner, Onosma leptantha Heldr., and Cynoglossum columnae L. (aerial parts), were screened for their content of pyrrolizidine alkaloids (PAs). TLC with the Mattocks-Molyneux visualization reagent was used as a preliminary qualitative test for PA or PA N-oxide detection. The extracts of the species found to contain PAs and their N-oxides were further analyzed by GC/MS, so as to identify their structures by means of the mass spectra and retention index values of known PAs already published in the literature. Twenty-three PAs were identified. For additional peaks, recognized as possible PAs by their MS pattern, no exact structures were tentatively suggested, as a result of lack of matching literature data. Furthermore, a quantitative PA profile of the species was obtained.

  11. High and far: biases in the location of protected areas.

    Directory of Open Access Journals (Sweden)

    Lucas N Joppa

    Full Text Available BACKGROUND: About an eighth of the earth's land surface is in protected areas (hereafter "PAs", most created during the 20(th century. Natural landscapes are critical for species persistence and PAs can play a major role in conservation and in climate policy. Such contributions may be harder than expected to implement if new PAs are constrained to the same kinds of locations that PAs currently occupy. METHODOLOGY/PRINCIPAL FINDINGS: Quantitatively extending the perception that PAs occupy "rock and ice", we show that across 147 nations PA networks are biased towards places that are unlikely to face land conversion pressures even in the absence of protection. We test each country's PA network for bias in elevation, slope, distances to roads and cities, and suitability for agriculture. Further, within each country's set of PAs, we also ask if the level of protection is biased in these ways. We find that the significant majority of national PA networks are biased to higher elevations, steeper slopes and greater distances to roads and cities. Also, within a country, PAs with higher protection status are more biased than are the PAs with lower protection statuses. CONCLUSIONS/SIGNIFICANCE: In sum, PAs are biased towards where they can least prevent land conversion (even if they offer perfect protection. These globally comprehensive results extend findings from nation-level analyses. They imply that siting rules such as the Convention on Biological Diversity's 2010 Target [to protect 10% of all ecoregions] might raise PA impacts if applied at the country level. In light of the potential for global carbon-based payments for avoided deforestation or REDD, these results suggest that attention to threat could improve outcomes from the creation and management of PAs.

  12. Understanding protected area resilience: a multi-scale, social-ecological approach

    Science.gov (United States)

    Cumming, Graeme S.; Allen, Craig R.; Ban, Natalie C.; Biggs, Duan; Biggs, Harry C.; Cumming, David H.M; De Vos, Alta; Epstein, Graham; Etienne, Michel; Maciejewski, Kristine; Mathevet, Raphael; Moore, Christine; Nenadovic, Mateja; Schoon, Michael

    2015-01-01

    Protected areas (PAs) remain central to the conservation of biodiversity. Classical PAs were conceived as areas that would be set aside to maintain a natural state with minimal human influence. However, global environmental change and growing cross-scale anthropogenic influences mean that PAs can no longer be thought of as ecological islands that function independently of the broader social-ecological system in which they are located. For PAs to be resilient (and to contribute to broader social-ecological resilience), they must be able to adapt to changing social and ecological conditions over time in a way that supports the long-term persistence of populations, communities, and ecosystems of conservation concern. We extend Ostrom's social-ecological systems framework to consider the long-term persistence of PAs, as a form of land use embedded in social-ecological systems, with important cross-scale feedbacks. Most notably, we highlight the cross-scale influences and feedbacks on PAs that exist from the local to the global scale, contextualizing PAs within multi-scale social-ecological functional landscapes. Such functional landscapes are integral to understand and manage individual PAs for long-term sustainability. We illustrate our conceptual contribution with three case studies that highlight cross-scale feedbacks and social-ecological interactions in the functioning of PAs and in relation to regional resilience. Our analysis suggests that while ecological, economic, and social processes are often directly relevant to PAs at finer scales, at broader scales, the dominant processes that shape and alter PA resilience are primarily social and economic.

  13. Arranging for personal assistance services and assistive technology at work. A report of the rehabilitation research and training center on personal assistance services.

    Science.gov (United States)

    Stoddard, Susan; Kraus, Lewis

    2006-01-01

    For an employee with a disability, reasonable accommodation can make the difference in finding work, maintaining employment, and succeeding on the job. Today, employers and employees alike are more aware that appropriate accommodation, including workplace personal assistance services (PAS) as well as assistive technology, improves an employee's ability to succeed. While assistive technology is in widespread use as an accommodation, workplace personal assistance is less understood. The goal of the study was to learn more about how workplace PAS and AT are arranged for in the workplace, and the issues that arise. Structured phone interviews were conducted with 20 workplace PAS users, 21 employers familiar with workplace PAS, and 19 employment organizations. Interview transcripts are the basis for the qualitative analysis of findings. Requirements for personal assistance accommodations focus on task-related needs. Personal care needs at work are not included in the Americans with Disabilities act but may be needed by the employee. Employers and PAS users have developed many creative ways to address PAS need. Organizations can construct an approach that fits the needs, abilities, and constraints of each organization. The interview respondents have identified a number of practices that are succeeding, including establishment of policies for arranging for PAS; centralization of accommodation budgets to remove work unit disincentives; and providing a shared personal assistant for interpreting or for task-related and personal care tasks. A number of important research questions remain. What is the extent of the need for PAS in the workplace? Will an expanded PAS supply increase the employment opportunities for people with disabilities? Will better models of workplace PAS be adopted by employers?

  14. Using Africa's protected area network to estimate the global population of a threatened and declining species: a case study of the Critically Endangered White-headed Vulture Trigonoceps occipitalis.

    Science.gov (United States)

    Murn, Campbell; Mundy, Peter; Virani, Munir Z; Borello, Wendy D; Holloway, Graham J; Thiollay, Jean-Marc

    2016-02-01

    The White-headed Vulture Trigonoceps occipitalis (WhV) is uncommon and largely restricted to protected areas across its range in sub-Saharan Africa. We used the World Database on Protected Areas to identify protected areas (PAs) likely to contain White-headed Vultures. Vulture occurrence on road transects in Southern, East, and West Africa was adjusted to nests per km(2) using data from areas with known numbers of nests and corresponding road transect data. Nest density was used to calculate the number of WhV nests within identified PAs and from there extrapolated to estimate the global population. Across a fragmented range, 400 PAs are estimated to contain 1893 WhV nests. Eastern Africa is estimated to contain 721 nests, Central Africa 548 nests, Southern Africa 468 nests, and West Africa 156 nests. Including immature and nonbreeding birds, and accounting for data deficient PAs, the estimated global population is 5475 - 5493 birds. The identified distribution highlights are alarming: over 78% (n = 313) of identified PAs contain fewer than five nests. A further 17% (n = 68) of PAs contain 5 - 20 nests and 4% (n = 14) of identified PAs are estimated to contain >20 nests. Just 1% (n = 5) of PAs are estimated to contain >40 nests; none is located in West Africa. Whilst ranging behavior of WhVs is currently unknown, 35% of PAs large enough to hold >20 nests are isolated by more than 100 km from other PAs. Spatially discrete and unpredictable mortality events such as poisoning pose major threats to small localized vulture populations and will accelerate ongoing local extinctions. Apart from reducing the threat of poisoning events, conservation actions promoting linkages between protected areas should be pursued. Identifying potential areas for assisted re-establishment via translocation offers the potential to expand the range of this species and alleviate risk.

  15. POLYAR, a new computer program for prediction of poly(A sites in human sequences

    Directory of Open Access Journals (Sweden)

    Qamar Raheel

    2010-11-01

    Full Text Available Abstract Background mRNA polyadenylation is an essential step of pre-mRNA processing in eukaryotes. Accurate prediction of the pre-mRNA 3'-end cleavage/polyadenylation sites is important for defining the gene boundaries and understanding gene expression mechanisms. Results 28761 human mapped poly(A sites have been classified into three classes containing different known forms of polyadenylation signal (PAS or none of them (PAS-strong, PAS-weak and PAS-less, respectively and a new computer program POLYAR for the prediction of poly(A sites of each class was developed. In comparison with polya_svm (till date the most accurate computer program for prediction of poly(A sites while searching for PAS-strong poly(A sites in human sequences, POLYAR had a significantly higher prediction sensitivity (80.8% versus 65.7% and specificity (66.4% versus 51.7% However, when a similar sort of search was conducted for PAS-weak and PAS-less poly(A sites, both programs had a very low prediction accuracy, which indicates that our knowledge about factors involved in the determination of the poly(A sites is not sufficient to identify such polyadenylation regions. Conclusions We present a new classification of polyadenylation sites into three classes and a novel computer program POLYAR for prediction of poly(A sites/regions of each of the class. In tests, POLYAR shows high accuracy of prediction of the PAS-strong poly(A sites, though this program's efficiency in searching for PAS-weak and PAS-less poly(A sites is not very high but is comparable to other available programs. These findings suggest that additional characteristics of such poly(A sites remain to be elucidated. POLYAR program with a stand-alone version for downloading is available at http://cub.comsats.edu.pk/polyapredict.htm.

  16. Toxin-antitoxin systems are important for niche-specific colonization and stress resistance of uropathogenic Escherichia coli.

    Directory of Open Access Journals (Sweden)

    J Paul Norton

    Full Text Available Toxin-antitoxin (TA systems are prevalent in many bacterial genomes and have been implicated in biofilm and persister cell formation, but the contribution of individual chromosomally encoded TA systems during bacterial pathogenesis is not well understood. Of the known TA systems encoded by Escherichia coli, only a subset is associated with strains of extraintestinal pathogenic E. coli (ExPEC. These pathogens colonize diverse niches and are a major cause of sepsis, meningitis, and urinary tract infections. Using a murine infection model, we show that two TA systems (YefM-YoeB and YbaJ-Hha independently promote colonization of the bladder by the reference uropathogenic ExPEC isolate CFT073, while a third TA system comprised of the toxin PasT and the antitoxin PasI is critical to ExPEC survival within the kidneys. The PasTI TA system also enhances ExPEC persister cell formation in the presence of antibiotics and markedly increases pathogen resistance to nutrient limitation as well as oxidative and nitrosative stresses. On its own, low-level expression of PasT protects ExPEC from these stresses, whereas overexpression of PasT is toxic and causes bacterial stasis. PasT-induced stasis can be rescued by overexpression of PasI, indicating that PasTI is a bona fide TA system. By mutagenesis, we find that the stress resistance and toxic effects of PasT can be uncoupled and mapped to distinct domains. Toxicity was specifically linked to sequences within the N-terminus of PasT, a region that also promotes the development of persister cells. These results indicate discrete, multipurpose functions for a TA-associated toxin and demonstrate that individual TA systems can provide bacteria with pronounced fitness advantages dependent on toxin expression levels and the specific environmental niche occupied.

  17. McMYB12 Transcription Factors Co-regulate Proanthocyanidin and Anthocyanin Biosynthesis in Malus Crabapple.

    Science.gov (United States)

    Tian, Ji; Zhang, Jie; Han, Zhen-Yun; Song, Ting-Ting; Li, Jin-Yan; Wang, Ya-Ru; Yao, Yun-Cong

    2017-03-03

    The flavonoid compounds, proanthocyanidins (PAs), protect plants from biotic stresses, contribute to the taste of many fruits, and are beneficial to human health in the form of dietary antioxidants. In this study, we functionally characterized two Malus crabapple R2R3-MYB transcription factors, McMYB12a and McMYB12b, which co-regulate PAs and anthocyanin biosynthesis. McMYB12a was shown to be mainly responsible for upregulating the expression of anthocyanin biosynthetic genes by binding to their promoters, but to be only partially responsible for regulating PAs biosynthetic genes. In contrast, McMYB12b showed preferential binding to the promoters of PAs biosynthetic genes. Overexpression of McMYB12a and McMYB12b in tobacco (Nicotiana tabacum) altered the expression of flavonoid biosynthetic genes and promoted the accumulation of PAs and anthocyanins in tobacco petals. Conversely, transient silencing their expression in crabapple plants, using a conserved gene region, resulted in reduced PAs and anthocyanin production a green leaf phenotype. Meanwhile, transient overexpression of the two genes and silenced McMYB12s in apple (Malus domestica) fruit had a similar effect as overexpression in tobacco and silenced in crabapple. This study reveals a new mechanism for the coordinated regulation of PAs and anthocyanin accumulation in crabapple leaves, which depends on an auto-regulatory balance involving McMYB12a and McMYB12b expression.

  18. Veterinary surgeons' attitudes towards physician-assisted suicide: an empirical study of Swedish experts on euthanasia.

    Science.gov (United States)

    Lerner, Henrik; Lindblad, Anna; Algers, Bo; Lynöe, Niels

    2011-05-01

    To examine the hypothesis that knowledge about physician-assisted suicide (PAS) and euthanasia is associated with a more restrictive attitude towards PAS. A questionnaire about attitudes towards PAS, including prioritization of arguments pro and contra, was sent to Swedish veterinary surgeons. The results were compared with those from similar surveys of attitudes among the general public and physicians. All veterinary surgeons who were members of the Swedish Veterinary Association and had provided an email address (n=2421). Similarities or differences in response pattern between veterinary surgeons, physicians and the general public. The response pattern among veterinary surgeons and the general public was almost similar in all relevant aspects. Of the veterinarians 75% (95% CI 72% to 78%) were in favour of PAS, compared with 73% (95% CI 69% to 77%) among the general public. Only 10% (95% CI 5% to 15%) of the veterinary surgeons were against PAS, compared with 12% (95% CI 5% to 19%) among the general public. Finally, 15% (95% CI 10% to 21%) of veterinarians were undecided, compared with 15% (95% CI 8% to 22%) among the general public. Physicians had a more restrictive attitude to PAS than the general public. Since veterinary surgeons have frequent practical experience of euthanasia in animals, they do have knowledge about what euthanasia really is. Veterinary surgeons and the general public had an almost similar response pattern. Accordingly it seems difficult to maintain that knowledge about euthanasia is unambiguously associated with a restrictive attitude towards PAS.

  19. Modelling plant invasion pathways in protected areas under climate change: implication for invasion management

    Directory of Open Access Journals (Sweden)

    C.-J. Wang

    2017-12-01

    Full Text Available Global climate change may enable invasive plant species (IPS to invade protected areas (PAs, but plant invasion on a global scale has not yet been explicitly addressed. Here, we mapped the potential invasion pathways for IPS in PAs across the globe and explored potential factors determining the pathways of plant invasion under climate change. We used species distribution modelling to estimate the suitable habitats of 386 IPS and applied a corridor analysis to compute the potential pathways of IPS in PAs under climate change. Subsequently, we analysed the potential factors affecting the pathways in PAs. According to our results, the main potential pathways of IPS in PAs are in Europe, eastern Australia, New Zealand, southern Africa, and eastern regions of South America and are strongly influenced by changes in temperature and precipitation. Protected areas can play an important role in preventing and controlling the spread of IPS under climate change. This is due to the fact that measures are taken to monitor climate change in detail, to provide effective management near or inside PAs, and to control the introduction of IPS with a high capacity for natural dispersal. A review of conservation policies in PAs is urgently needed.

  20. The role of protected areas in land use/land cover change and the carbon cycle in the conterminous United States

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Xiaoliang [The Ecosystems Center, Marine Biological Laboratory, Woods Hole MA USA; Zhou, Yuyu [Departments of Geological and Atmospheric Sciences, Iowa State University, Ames IA USA; Liu, Yaling [Pacific Northwest National Laboratory, Joint Global Change Research Institute, College Park MD USA; Le Page, Yannick [Department Tapada da Ajuda, Centro de Estudos Florestais, Instituto Superior de Agronomia, Universidade de Lisboa, Lisbon Portugal

    2017-08-08

    Protected areas (PAs) cover about 22% of the conterminous United States. Understanding their role on historical land use and land cover change (LULCC) and on the carbon cycle is essential to provide guidance for environmental policies. In this study, we compiled historical LULCC and PAs data to explore these interactions within the terrestrial ecosystem model (TEM). We found that intensive LULCC occurred in the conterminous United States from 1700 to 2005. More than 3 million km2 of forest, grassland and shrublands were converted into agricultural lands, which caused 10,607 Tg C release from land ecosystems to atmosphere. PAs had experienced little LULCC as they were generally established in the 20th century after most of the agricultural expansion had occurred. PAs initially acted as a carbon source due to land use legacies, but their accumulated carbon budget switched to a carbon sink in the 1960s, sequestering an estimated 1,642 Tg C over 1700–2005, or 13.4% of carbon losses in non-PAs. We also find that PAs maintain larger carbon stocks and continue sequestering carbon in recent years (2001–2005), but at a lower rate due to increased heterotrophic respiration as well as lower productivity associated to aging ecosystems. It is essential to continue efforts to maintain resilient, biodiverse ecosystems and avoid large-scale disturbances that would release large amounts of carbon in PAs.

  1. The lion in West Africa is critically endangered.

    Directory of Open Access Journals (Sweden)

    Philipp Henschel

    Full Text Available The African lion has declined to 500 km² PAs and compiled evidence of lion presence/absence for a further eight PAs. All PAs were situated within Lion Conservation Units, geographical units designated as priority lion areas by wildlife experts at a regional lion conservation workshop in 2005. Lions were confirmed in only 4 PAs, and our results suggest that only 406 (273-605 lions remain in West Africa, representing <250 mature individuals. Confirmed lion range is estimated at 49,000 km², or 1.1% of historical range in West Africa. PAs retaining lions were larger than PAs without lions and had significantly higher management budgets. We encourage revision of lion taxonomy, to recognize the genetic distinctiveness of West African lions and highlight their potentially unique conservation value. Further, we call for listing of the lion as critically endangered in West Africa, under criterion C2a(ii for populations with <250 mature individuals. Finally, considering the relative poverty of lion range states in West Africa, we call for urgent mobilization of investment from the international community to assist range states to increase management effectiveness of PAs retaining lions.

  2. The productivity of physician assistants and nurse practitioners and health work force policy in the era of managed health care.

    Science.gov (United States)

    Scheffler, R M; Waitzman, N J; Hillman, J M

    1996-01-01

    Managed care is spreading rapidly in the United States and creating incentives for physician practices to find the most efficient combination of health professionals to deliver care to an enrolled population. Given these trends, it is appropriate to reexamine the roles of physician assistants (PAs) and nurse practitioners (NPs) in the health care workforce. This paper briefly reviews the literature on PA and NP productivity, managed care plans' use of PAs and NPs, and the potential impact of PAs and NPs on the size and composition of the future physician workforce. In general, the literature supports the idea that PAs and NPs could have a major impact on the future health care workforce. Studies show significant opportunities for increased physician substitution and even conservative assumptions about physician task delegation imply a large increase in the number of PAs and NPs that can be effectively deployed. However, the current literature has certain limitations that make it difficult to quantify the future impact of PAs and NPs. Among these limitations is the fact that virtually all formal productivity studies were conducted in fee-for-service settings during the 1970s, rather than managed care settings. In addition, the vast majority of PA and NP productivity studies have viewed PAs and NPs as physician substitutes rather than as members of interdisciplinary health care teams, which may become the dominant health care delivery model over the next 10-20 years.

  3. Mental health and other clinical correlates of euthanasia attitudes in an Australian outpatient cancer population.

    Science.gov (United States)

    Carter, G L; Clover, K A; Parkinson, L; Rainbird, K; Kerridge, I; Ravenscroft, P; Cavenagh, J; McPhee, J

    2007-04-01

    A majority of patients with cancer have been reported to endorse euthanasia and physician assisted suicide (PAS) in general and a substantial proportion endorse these for themselves. However, the potential influence of mental health and other clinical variables on these decisions is not well understood. This study of 228 outpatients attending an oncology clinic in Newcastle, Australia used a cross-sectional design and logistic regression modelling to examine the relationship of demographic, disease status, mental health and quality of life variables to attitudes toward euthanasia and PAS. The majority reported support for euthanasia (79%, n=179), for PAS (69%, n=158) and personal support for euthanasia/PAS (68%, n=156). However, few reported having asked their doctor for euthanasia (2%, n=5) or PAS (2%, n=5). Three outcomes were modelled: support for euthanasia was associated with active religious belief (adjusted odds ratio (AOR) 0.21, 95% CI: 0.10-0.46); support for PAS was associated with active religious belief (AOR 0.35, 95% CI: 18-0.70) and recent pain (AOR 0.87, 95% CI: 0.0.76-0.99); and personal support for euthanasia/PAS was associated with active religious belief (AOR 0.26, 95% CI: 0.14-0.48). Depression, anxiety, recent suicidal ideation, and lifetime suicide attempt were not independently associated with any of the three outcomes modelled. Copyright (c) 2007 John Wiley & Sons, Ltd.

  4. Physician-Assisted Suicide and Euthanasia: Emerging Issues From a Global Perspective.

    Science.gov (United States)

    Sprung, Charles L; Somerville, Margaret A; Radbruch, Lukas; Collet, Nathalie Steiner; Duttge, Gunnar; Piva, Jefferson P; Antonelli, Massimo; Sulmasy, Daniel P; Lemmens, Willem; Ely, E Wesley

    2018-01-01

    Medical professional societies have traditionally opposed physician-assisted suicide and euthanasia (PAS-E), but this opposition may be shifting. We present 5 reasons why physicians shouldn't be involved in PAS-E. 1. Slippery slopes: There is evidence that safeguards in the Netherlands and Belgium are ineffective and violated, including administering lethal drugs without patient consent, absence of terminal illness, untreated psychiatric diagnoses, and nonreporting; 2. Lack of self-determination: Psychological and social motives characterize requests for PAS-E more than physical symptoms or rational choices; many requests disappear with improved symptom control and psychological support; 3. Inadequate palliative care: Better palliative care makes most patients physically comfortable. Many individuals requesting PAS-E don't want to die but to escape their suffering. Adequate treatment for depression and pain decreases the desire for death; 4. Medical professionalism: PAS-E transgresses the inviolable rule that physicians heal and palliate suffering but never intentionally inflict death; 5. Differences between means and ends: Proeuthanasia advocates look to the ends (the patient's death) and say the ends justify the means; opponents disagree and believe that killing patients to relieve suffering is different from allowing natural death and is not acceptable. Physicians have a duty to eliminate pain and suffering, not the person with the pain and suffering. Solutions for suffering lie in improving palliative care and social conditions and addressing the reasons for PAS-E requests. They should not include changing medical practice to allow PAS-E.

  5. Rethinking the Role of Pedagogical Assistants: Establishing Cooperation between Roma Families and Schools in Serbia

    Directory of Open Access Journals (Sweden)

    Jelena Starčević

    2016-12-01

    Full Text Available The aim of the present paper is to examine the risks and challenges related to the cooperation of pedagogical assistants (PAs with Roma parents/ families and their work with Roma pupils, as well as to offer further insight into ways to overcome these risks and challenges. Roma pupils and parents/ families face numerous difficulties in education, which are reflected in prejudice, stereotypes and discrimination. The education policy measure of introducing PAs, formerly known as Roma teaching assistants, to the Serbian education system aimed to contribute to the learning and social participation of Roma pupils and to establish cooperation between school staff and Roma parents. The further segregation of Roma pupils and the reduced engagement of teachers in supporting Roma pupils and fostering communication with Roma parents are seen as possible risks related to the engagement of PAs. In order to minimise the risks, we propose a framework for defining and understanding the roles of teachers and PAs from an intercultural perspective. Relying on two concepts – intercultural sensitivity (IS and intercultural competence (IC – we elaborate the necessity of perceiving cultural differences in accordance with an ethnorelative world view, on the part of both teachers and PAs. In addition, we outline the cognitive, affective and behavioural aspects of IC that we believe teachers and PAs should possess. Further recommendations regarding the engagement of PAs and the minimisation of risks and challenges are proposed.

  6. Positron annihilation spectroscopy in condensed matter

    International Nuclear Information System (INIS)

    Brauer, G.

    1982-09-01

    The topic of positron annihilation spectroscopy (PAS) is the investigation of all aspects connected with the annihilation of slow positrons. This work deals with the application of PAS to different problems of materials science. The first chapter is an introduction to fundamental aspects of positron annihilation, as far as they are important to the different experimental techniques of PAS. Chapter 2 is concerned with the information obtainable by PAS. The three main experimental techniques of PAS (2γ-angular correlation, positron lifetime and Doppler broadening) are explained and problems in the application of these methods are discussed. Chapter 3 contains experimental results. According to the different fields of application it was subgrouped into: 1. Investigations of crystalline solids. Detection of structural defects in Cu, estimation of defect concentrations, study of the sintering of Cu powders as well as lattice defects in V 3 Si. 2. Chemical investigations. Structure of mixed solvents, selective solvation of mixed solvents by electrolytes as well as the micellization of sodium dodecylsulphate in aqueous solutions. 3. Investigations of glasses. Influence of heat treatment and production technology on the preorder of X-amorphous silica glass as well as preliminary measurements of pyrocerams. 4. Investigations of metallic glasses. Demonstration of the influence of production technology on parameters measurable by PAS. Chapter 4 contains a summary as well as an outlook of further applications of PAS to surface physics, medicine, biology and astrophysics. (author)

  7. French hospital nurses' opinion about euthanasia and physician-assisted suicide: a national phone survey.

    Science.gov (United States)

    Bendiane, M K; Bouhnik, A-D; Galinier, A; Favre, R; Obadia, Y; Peretti-Watel, P

    2009-04-01

    Hospital nurses are frequently the first care givers to receive a patient's request for euthanasia or physician-assisted suicide (PAS). In France, there is no consensus over which medical practices should be considered euthanasia, and this lack of consensus blurred the debate about euthanasia and PAS legalisation. This study aimed to investigate French hospital nurses' opinions towards both legalisations, including personal conceptions of euthanasia and working conditions and organisation. A phone survey conducted among a random national sample of 1502 French hospital nurses. We studied factors associated with opinions towards euthanasia and PAS, including contextual factors related to hospital units with random-effects logistic models. Overall, 48% of nurses supported legalisation of euthanasia and 29%, of PAS. Religiosity, training in pallative care/pain management and feeling competent in end-of-life care were negatively correlated with support for legalisation of both euthanasia and PAS, while nurses working at night were more prone to support legalisation of both. The support for legalisation of euthanasia and PAS was also weaker in pain treatment/palliative care and intensive care units, and it was stronger in units not benefiting from interventions of charity/religious workers and in units with more nurses. Many French hospital nurses uphold the legalisation of euthanasia and PAS, but these nurses may be the least likely to perform what proponents of legalisation call "good" euthanasia. Improving professional knowledge of palliative care could improve the management of end-of-life situations and help to clarify the debate over euthanasia.

  8. Development of an Analytical Method for Analyzing Pyrrolizidine Alkaloids in Different Groups of Food by UPLC-MS/MS.

    Science.gov (United States)

    Chung, Stephen W C; Lam, Chi-Ho

    2018-03-21

    Suspected nontargeted pyrrolizidine alkaloids (PAs), without analytical reference standard, were observed and interfered with the determination of targeted PAs in complex food matrices, especially for spices samples. Selectivity and applicability of multiple reaction monitoring (MRM) transitions, multistage fragmentation (MS3), and MRM with differential ion mobility spectrometry (DMS) for eliminating false positive identifications were evaluated. Afterward, a selective and sensitive LC-MS/MS method for the determination of 15 PAs and 13 PA N-oxides in foodstuffs was developed. The sample preparation and cleanup are applicable to a wide range of foodstuffs, including cereal products, dairy products, meat, eggs, honey, tea infusion, and spices. Freezing-out of the raw extract and the water/acetonitrile washing steps in a solid phase extraction was found to efficiently remove complex matrices. The method was validated at 0.05 μg kg -1 for general food and 0.5 μg kg -1 for spices, with reference to the Eurachem Guide. The estimated limit of quantifications of different PAs was in the range of 0.010-0.087 μg kg -1 for general food and 0.04-0.76 μg kg -1 for spices. Isotopically labeled PAs were used as internal standards to correct the variation of PAs/PANs performance in different food commodities. Matrix effects observed in complex food matrices could be reduced by solvent dilution. Recoveries of PAs and PA N-oxides were all seen within 50-120%.

  9. Identification of Toxic Pyrrolizidine Alkaloids and Their Common Hepatotoxicity Mechanism

    Directory of Open Access Journals (Sweden)

    Xinmiao Yan

    2016-03-01

    Full Text Available Pyrrolizidine Alkaloids (PAs are currently one of the most important botanical hepatotoxic ingredients. Glutathion (GSH metabolism is the most reported pathway involved in hepatotoxicity mechanism of PAs. We speculate that, for different PAs, there should be a common mechanism underlying their hepatotoxicity in GSH metabolism. Computational methods were adopted to test our hypothesis in consideration of the limitations of current experimental approaches. Firstly, the potential targets of 22 PAs (from three major PA types in GSH metabolism were identified by reverse docking; Secondly, glutathione S-transferase A1 (GSTA1 and glutathione peroxidase 1 (GPX1 targets pattern was found to be a special characteristic of toxic PAs with stepwise multiple linear regressions; Furthermore, the molecular mechanism underlying the interactions within toxic PAs and these two targets was demonstrated with the ligand-protein interaction analysis; Finally, GSTA1 and GPX1 were proved to be significant nodes in GSH metabolism. Overall, toxic PAs could be identified by GSTA1 and GPX1 targets pattern, which suggests their common hepatotoxicity mechanism: the interfering of detoxication in GSH metabolism. In addition, all the strategies developed here could be extended to studies on toxicity mechanism of other toxins.

  10. Identification of Toxic Pyrrolizidine Alkaloids and Their Common Hepatotoxicity Mechanism.

    Science.gov (United States)

    Yan, Xinmiao; Kang, Hong; Feng, Jun; Yang, Yiyan; Tang, Kailin; Zhu, Ruixin; Yang, Li; Wang, Zhengtao; Cao, Zhiwei

    2016-03-07

    Pyrrolizidine Alkaloids (PAs) are currently one of the most important botanical hepatotoxic ingredients. Glutathion (GSH) metabolism is the most reported pathway involved in hepatotoxicity mechanism of PAs. We speculate that, for different PAs, there should be a common mechanism underlying their hepatotoxicity in GSH metabolism. Computational methods were adopted to test our hypothesis in consideration of the limitations of current experimental approaches. Firstly, the potential targets of 22 PAs (from three major PA types) in GSH metabolism were identified by reverse docking; Secondly, glutathione S-transferase A1 (GSTA1) and glutathione peroxidase 1 (GPX1) targets pattern was found to be a special characteristic of toxic PAs with stepwise multiple linear regressions; Furthermore, the molecular mechanism underlying the interactions within toxic PAs and these two targets was demonstrated with the ligand-protein interaction analysis; Finally, GSTA1 and GPX1 were proved to be significant nodes in GSH metabolism. Overall, toxic PAs could be identified by GSTA1 and GPX1 targets pattern, which suggests their common hepatotoxicity mechanism: the interfering of detoxication in GSH metabolism. In addition, all the strategies developed here could be extended to studies on toxicity mechanism of other toxins.

  11. Characterization and screening of pyrrolizidine alkaloids and N-oxides from botanicals and dietary supplements using UHPLC-high resolution mass spectrometry.

    Science.gov (United States)

    Avula, Bharathi; Sagi, Satyanarayanaraju; Wang, Yan-Hong; Zweigenbaum, Jerry; Wang, Mei; Khan, Ikhlas A

    2015-07-01

    The UHPLC-QToF-MS analysis of pyrrolizidine alkaloids (PAs) from various parts of 37 botanicals and 7 products was performed. A separation by LC was achieved using a reversed-phase column and a gradient of water/acetonitrile each containing formic acid as the mobile phase. MS-MS detection was used because of its high selectivity, and ability to provide structural information. Free base and N-oxides were observed by this method. PAs were analyzed and detected in plants from three different families, viz., Asteraceae, Boraginaceae and Fabaceae. The Asteraceae family was found to contain senecionine and lycopsamine type PAs. The Boraginaceae family contained lycopsamine and heliotrine type PAs and the Fabaceae family contained senecionine and monocrotaline type PAs. These PAs may serve as important markers for the detection of these plant materials in food and dietary supplements. PAs were identified in 44 samples by comparing their retention times, accurate mass and mass fragmentation patterns with those of 25 reference standards. Copyright © 2015 Elsevier Ltd. All rights reserved.

  12. Synergistic effects of pyrrolizidine alkaloids and lipopolysaccharide on preterm delivery and intrauterine fetal death in mice.

    Science.gov (United States)

    Guo, Yu; Ma, Zhenguo; Kou, Hao; Sun, Rongze; Yang, Hanxiao; Smith, Charles Vincent; Zheng, Jiang; Wang, Hui

    2013-08-29

    Preterm birth is the leading cause of death for newborn infants, and lipopolysaccharide (LPS) is commonly used to induce preterm delivery in experimental animals. Pyrrolizidine alkaloids (PAs) are widespread and occur in foods, herbs, and other plants. This study was to investigate the synergistic effects of LPS and two representative PAs, retrorsine (RTS) and monocrotaline (MCT), on preterm delivery and fetal death. Pregnant Kunming mice were divided into seven groups: control, RTS, MCT, LPS, RTS+LPS and two MCT+LPS groups. Animals in PAs and PAs+LPS groups were dosed intragastrically with RTS (10mg/kg) or MCT (20 mg/kg or 60 mg/kg) from gestational day (GD) 9 to GD16; mice given LPS were injected intraperitoneally with 150 μg/kg on GD15.5. Latencies to delivery, numbers of pups live and dead at birth were recorded, and livers of live neonates were collected. The incidence of LPS-induced preterm birth was enhanced in dams pretreated with MCT, and combination of PAs and LPS increased fetal mortality from PAs. The enhancement of LPS-induced preterm delivery and fetal demise in animals exposed chronically to PAs and other substances found in foods and beverages consumed widely by humans merits further focused investigation. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  13. Characterization of an apically derived epithelial membrane glycoprotein from bovine milk, which is expressed in capillary endothelia in diverse tissues.

    Science.gov (United States)

    Greenwalt, D E; Mather, I H

    1985-02-01

    A glycoprotein (PAS IV) of apparent Mr 76,000 was purified from bovine milk-fat-globule membrane and partially characterized. PAS IV contained mannose, galactose, and sialic acid as principal sugars (approximately 5.3% total carbohydrate [wt/wt]) and existed in milk in at least four isoelectric variants. The glycoprotein appeared to be an integral membrane protein by several criteria. PAS IV was recovered in the detergent phase of Triton X-114 extracts of milk-fat-globule membrane at room temperature. When bound to membrane, PAS IV was resistant to digestion by a number of proteinases, although after solubilization with non-ionic detergents, the protein was readily degraded. Amino acid analysis of the purified protein revealed a high percentage of amino acids with nonpolar residues. The location of PAS IV was determined in bovine tissues by using immunofluorescence techniques. In mammary tissue, PAS IV was located on both the apical surfaces of secretory epithelial cells and endothelial cells of capillaries. This glycoprotein was also detected in endothelial cells of heart, liver, spleen, pancreas, salivary gland, and small intestine. In addition to mammary epithelial cells, PAS IV was also located in certain other epithelial cells, most notably the bronchiolar epithelial cells of lung. The potential usefulness of this protein as a specific marker of capillary endothelial cells in certain tissues is discussed.

  14. Physician-assisted suicide-a clean bill of health?

    Science.gov (United States)

    Preston, Robert

    2017-09-01

    Physician-assisted suicide (PAS) laws have been enacted in five US States and, along with physician-administered euthanasia, in Canada and the Netherlands. Annual reports of the Oregon Health Authority and published research papers. Not all recipients of lethal drugs use them to end their lives. Improvements in palliative care provision. Rising numbers of deaths from PAS. Emergence of 'doctor shopping' and multiple-prescribing. Absence of qualitative scrutiny of assessment process. No re-assessment or oversight when prescribed drugs are ingested. Recent pressures to extend Oregon's PAS law. Reasons given for seeking PAS indicate this is a societal rather than a clinical issue and raise the question whether adjudicating on requests for legalized PAS is an appropriate role for doctors. Research into quality of decision-making in requests for PAS and into potential role of doctors as expert witnesses rather than judges in requests for PAS. © The Author 2017. Published by Oxford University Press. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com

  15. Synchronization of finite-size particles by a traveling wave in a cylindrical flow

    Science.gov (United States)

    Melnikov, D. E.; Pushkin, D. O.; Shevtsova, V. M.

    2013-09-01

    Motion of small finite-size particles suspended in a cylindrical thermocapillary flow with an azimuthally traveling wave is studied experimentally and numerically. At certain flow regimes the particles spontaneously align in dynamic accumulation structures (PAS) of spiral shape. We find that long-time trajectories of individual particles in this flow fall into three basic categories that can be described, borrowing the dynamical systems terminology, as the stable periodic, the quasiperiodic, and the quasistable periodic orbits. Besides these basic types of orbits, we observe the "doubled" periodic orbits and shuttle-like particle trajectories. We find that ensembles of particles having periodic orbits give rise to one-dimensional spiral PAS, while ensembles of particles having quasiperiodic orbits form two-dimensional PAS of toroidal shape. We expound the reasons why these types of orbits and the emergence of the corresponding accumulation structures should naturally be anticipated based on the phase locking theory of PAS formation. We give a further discussion of PAS features, such as the finite thickness of PAS spirals and the probable scenarios of the spiral PAS destruction. Finally, in numerical simulations of inertial particles we observe formation of the spiral structures corresponding to the 3:1 "resonance" between the particle turnover frequency and the wave oscillations frequency, thus confirming another prediction of the phase locking theory. In view of the generality of the arguments involved, we expect the importance of this structure-forming mechanism to go far beyond the realm of the laboratory-friendly thermocapillary flows.

  16. Cross-national Epidemiology of Panic Disorder and Panic Attacks in the World Mental Health Surveys

    Science.gov (United States)

    de Jonge, Peter; Roest, Annelieke M.; Lim, Carmen C.W.; Florescu, Silvia E.; Bromet, Evelyn; Stein, Dan; Harris, Meredith; Nakov, Vladimir; Caldas-de-Almeida, Jose Miguel; Levinson, Daphna; Al-Hamzawi, Ali O.; Haro, Josep Maria; Viana, Maria Carmen; Borges, Gui; O’Neill, Siobhan; de Girolamo, Giovanni; Demyttenaere, Koen; Gureje, Oye; Iwata, Noboru; Lee, Sing; Hu, Chiyi; Karam, Aimee; Moskalewicz, Jacek; Kovess-Masfety, Viviane; Navarro-Mateu, Fernando; Browne, Mark Oakley; Piazza, Maria; Posada-Villa, José; Torres, Yolanda; ten Have, Margreet L.; Kessler, Ronald C.; Scott, Kate M.

    2016-01-01

    Context The scarcity of cross-national reports and the changes in DSM-5 regarding panic disorder (PD) and panic attacks (PAs) call for new epidemiological data on PD and PAs and its subtypes in the general population. Objective To present representative data about the cross-national epidemiology of PD and PAs in accordance with DSM-5 definitions. Design and Setting Nationally representative cross-sectional surveys using the World Health Organization Composite International Diagnostic Interview version 3.0. Participants Respondents (n=142,949) from 25 high, middle and lower-middle income countries across the world aged 18 years or older. Main Outcome Measures PD and presence of single and recurrent PAs. Results Lifetime prevalence of PAs was 13.2% (s.e. 0.1%). Among persons that ever had a PA, the majority had recurrent PAs (66.5%; s.e. 0.5%), while only 12.8% fulfilled DSM-5 criteria for PD. Recurrent PAs were associated with a subsequent onset of a variety of mental disorders (OR 2.0; 95% CI 1.8–2.2) and their course (OR 1.3; 95% CI 1.2–2.4) whereas single PAs were not (OR 1.1; 95% CI 0.9–1.3 and OR 0.7; 95% CI 0.6–0.8). Cross-national lifetime prevalence estimates were 1.7% (s.e. 0.0%) for PD with a median age of onset of 32 (IQR 20–47). Some 80.4% of persons with lifetime PD had a lifetime comorbid mental disorder. Conclusions We extended previous epidemiological data to a cross-national context. The presence of recurrent PAs in particular is associated with subsequent onset and course of mental disorders beyond agoraphobia and PD, and might serve as a generic risk marker for psychopathology. PMID:27775828

  17. Stimulus uncertainty enhances long-term potentiation-like plasticity in human motor cortex.

    Science.gov (United States)

    Sale, Martin V; Nydam, Abbey S; Mattingley, Jason B

    2017-03-01

    Plasticity can be induced in human cortex using paired associative stimulation (PAS), which repeatedly and predictably pairs a peripheral electrical stimulus with transcranial magnetic stimulation (TMS) to the contralateral motor region. Many studies have reported small or inconsistent effects of PAS. Given that uncertain stimuli can promote learning, the predictable nature of the stimulation in conventional PAS paradigms might serve to attenuate plasticity induction. Here, we introduced stimulus uncertainty into the PAS paradigm to investigate if it can boost plasticity induction. Across two experimental sessions, participants (n = 28) received a modified PAS paradigm consisting of a random combination of 90 paired stimuli and 90 unpaired (TMS-only) stimuli. Prior to each of these stimuli, participants also received an auditory cue which either reliably predicted whether the upcoming stimulus was paired or unpaired (no uncertainty condition) or did not predict the upcoming stimulus (maximum uncertainty condition). Motor evoked potentials (MEPs) evoked from abductor pollicis brevis (APB) muscle quantified cortical excitability before and after PAS. MEP amplitude increased significantly 15 min following PAS in the maximum uncertainty condition. There was no reliable change in MEP amplitude in the no uncertainty condition, nor between post-PAS MEP amplitudes across the two conditions. These results suggest that stimulus uncertainty may provide a novel means to enhance plasticity induction with the PAS paradigm in human motor cortex. To provide further support to the notion that stimulus uncertainty and prediction error promote plasticity, future studies should further explore the time course of these changes, and investigate what aspects of stimulus uncertainty are critical in boosting plasticity. Copyright © 2016 Elsevier Ltd. All rights reserved.

  18. Effects of high latitude protected areas on bird communities under rapid climate change.

    Science.gov (United States)

    Santangeli, Andrea; Rajasärkkä, Ari; Lehikoinen, Aleksi

    2017-06-01

    Anthropogenic climate change is rapidly becoming one of the main threats to biodiversity, along with other threats triggered by human-driven land-use change. Species are already responding to climate change by shifting their distributions polewards. This shift may create a spatial mismatch between dynamic species distributions and static protected areas (PAs). As protected areas represent one of the main pillars for preserving biodiversity today and in the future, it is important to assess their contribution in sheltering the biodiversity communities, they were designated to protect. A recent development to investigate climate-driven impacts on biological communities is represented by the community temperature index (CTI). CTI provides a measure of the relative temperature average of a community in a specific assemblage. CTI value will be higher for assemblages dominated by warm species compared with those dominated by cold-dwelling species. We here model changes in the CTI of Finnish bird assemblages, as well as changes in species densities, within and outside of PAs during the past four decades in a large boreal landscape under rapid change. We show that CTI has markedly increased over time across Finland, with this change being similar within and outside PAs and five to seven times slower than the temperature increase. Moreover, CTI has been constantly lower within than outside of PAs, and PAs still support communities, which show colder thermal index than those outside of PAs in the 1970s and 1980s. This result can be explained by the higher relative density of northern species within PAs than outside. Overall, our results provide some, albeit inconclusive, evidence that PAs may play a role in supporting the community of northern species. Results also suggest that communities are, however, shifting rapidly, both inside and outside of PAs, highlighting the need for adjusting conservation measures before it is too late. © 2016 John Wiley & Sons Ltd.

  19. [Attitudes and experiences regarding physician assisted suicide : A survey among members of the German Association for Palliative Medicine].

    Science.gov (United States)

    Jansky, Maximiliane; Jaspers, Birgit; Radbruch, Lukas; Nauck, Friedemann

    2017-01-01

    The need to regulate physician-assisted suicide (PAS) and organizations offering assisted suicide has been controversially debated in Germany. Before the German parliament voted on various drafts in November 2015, the German Association for Palliative Medicine surveyed its members on their attitudes and experiences regarding PAS. Items for the survey were derived from the literature and consented in a focus group. 2005-2015 - PubMed: PAS [Title/Abstract] UND survey (all countries), grey literature. We invited 5152 members of the DGP to participate in the online/paper survey. Descriptive quantitative and content analytic qualitative analysis of data using SPSS and MaxQDA. We obtained 1811 valid data sets (response rate 36.9%). 33.7% of the participants were male, 43.6% were female, and 0.4% identifed as other. Physicians accounted for 48.5% of the respondents, 17.8% nurses, other professions 14.3%, and about 20% of the data was missing socio-demographic information. More than 90% agreed that "wishes for PAS may be ambivalent" and "are rather a wish to end an unbearable situation". Of the 833 participating physicians, 56% refused participating in PAS and 74.2% had been asked to perform PAS. PAS was actually performed by 3%. Of all participating members, 56% approved of a legal ban of organizations offering assisted suicide. More than 60% of all professions agreed that PAS is not a part of palliative care. The respondents show a broad spectrum of attitudes, only partly supporting statements of relevant bodies, such as DGP. Because many are confronted with the issue, PAS is relevant to professionals in palliative care.

  20. Attitudes of young neurosurgeons and neurosurgical residents towards euthanasia and physician-assisted suicide.

    Science.gov (United States)

    Broekman, M L D; Verlooy, J S A

    2013-11-01

    Euthanasia and physician assisted suicide (PAS) are two controversial topics in neurosurgical practice. Personal attitudes and opinions on these important issues may vary between professionals, and may also depend on their location since current legislation differs between European countries. As these issues may have significant impact on clinical practice, the goal of the present study was to survey the opinions of neurosurgical residents and young neurosurgeons across Europe with respect to euthanasia and physician assisted suicide. We performed a survey among the participants of the European Association of Neurosurgical Societies (EANS) training courses (2011-2012), asking residents and young neurosurgeons nine questions on euthanasia and PAS. For the analysis of this survey, we divided all 295 participants into four European regions (North, South, East, West). We found that even though most residents are aware of regulations about euthanasia or PAS in their country or hospital, a substantial number were not aware of the regulations. We observed no significant differences in terms of their opinions on euthanasia and PAS among the four European regions. While most are actually in favor of euthanasia or PAS, if legally allowed, under appropriate circumstances, very few neurosurgeons would be willing to actively participate in these end-of-life practices. The results of this first survey on neurosurgical residents' attitudes towards euthanasia and PAS show that a significant number of residents is not familiar with national and/or local regulations regarding euthanasia and PAS. If legally allowed, most residents would be in favor of euthanasia and PAS, but only a minority would be willing to actively participate in these practices. We did not observe a difference in stances on euthanasia and PAS among residents from different regions in Europe.

  1. Trends and determinants of end-of-life practices in ALS in the Netherlands.

    Science.gov (United States)

    Maessen, M; Veldink, Jan H; Onwuteaka-Philipsen, B D; de Vries, J M; Wokke, J H J; van der Wal, G; van den Berg, L H

    2009-09-22

    In the Netherlands, the proportion of patients with amyotrophic lateral sclerosis (ALS) who choose the option of euthanasia or physician-assisted suicide (PAS) is relatively high (20%). The objective of this study was to determine which factors influence end-of-life practices in ALS and whether rates are changing over time. In a cohort survey, 204 physicians and 198 informal caregivers (response rates 75% and 80%) of patients with ALS who died between 2000 and 2005 filled out questionnaires of the end-of-life circumstances of the patient. Results were compared with those of a similar study performed during the period 1994-1998. In 2000-2005, 16.8% of the patients decided on euthanasia or PAS compared to 20.2% in 1994-1998. Thirty-one (14.8%) patients died during continuous deep sedation (CDS) in 2000-2005. Euthanasia or PAS, but not CDS, were significantly associated with religion not being important to the patient, being more educated, and dying at home. Euthanasia or PAS were not associated with quality of care items or symptoms of depression. Loss of function was similar in both groups. Informal caregivers of patients who died after euthanasia or PAS more frequently reported fear of choking (p = 0.003), no chance of improvement (p = 0.001), loss of dignity (p = 0.02), being dependent on others (p = 0.002), and fatigue (p = 0.018) as reasons for shortening life. Hopelessness was associated with euthanasia or PAS, as with CDS. The frequency of euthanasia or physician-assisted suicide (PAS) in amyotrophic lateral sclerosis (ALS) appeared stable over time and 1 in 7 patients died during CDS. CDS is relatively common in ALS, but appears to have other determinants than euthanasia or PAS. Subjective factors may be important in explaining euthanasia or PAS in ALS.

  2. Thr202Ala in thyA Is a Marker for the Latin American Mediterranean Lineage of the Mycobacterium tuberculosis Complex Rather than Para-Aminosalicylic Acid Resistance

    KAUST Repository

    Feuerriegel, S.

    2010-08-30

    Single nucleotide polymorphisms (SNPs) involved in the development of resistance represent powerful markers for the rapid detection of first- and second-line resistance in clinical Mycobacterium tuberculosis complex (MTBC) isolates. However, the association between particular mutations and phenotypic resistance is not always clear-cut, and phylogenetic SNPs have been misclassified as resistance markers in the past. In the present study, we investigated the utility of a specific polymorphism in thyA (Thr202Ala) as a marker for resistance to para-aminosalicyclic acid (PAS). Sixty-three PAS-susceptible MTBC strains comprising all major phylogenetic lineages, reference strain H37Rv, and 135 multidrug-resistant (MDR) strains from Germany (comprising 8 PAS-resistant isolates) were investigated for the presence of Thr202Ala. In both strain collections, the Thr202Ala SNP was found exclusively in strains of the Latin American Mediterranean (LAM) lineage irrespective of PAS resistance. Furthermore, PAS MICs (0.5 mg/liter) for selected LAM strains (all containing the SNP) and non-LAM strains (not containing the SNP), as well as the results of growth curve analyses performed in liquid 7H9 medium in the presence of increasing PAS concentrations (0 to 2.0 mg/liter), were identical. In conclusion, our data demonstrate that the Thr202Ala polymorphism in thyA is not a valid marker for PAS resistance but, instead, represents a phylogenetic marker for the LAM lineage of the M. tuberculosis complex. These findings challenge some of the previous understanding of PAS resistance and, as a consequence, warrant further in-depth investigations of the genetic variation in PAS-resistant clinical isolates and spontaneous mutants.

  3. Global patterns of protection of elevational gradients in mountain ranges.

    Science.gov (United States)

    Elsen, Paul R; Monahan, William B; Merenlender, Adina M

    2018-05-21

    Protected areas (PAs) that span elevational gradients enhance protection for taxonomic and phylogenetic diversity and facilitate species range shifts under climate change. We quantified the global protection of elevational gradients by analyzing the elevational distributions of 44,155 PAs in 1,010 mountain ranges using the highest resolution digital elevation models available. We show that, on average, mountain ranges in Africa and Asia have the lowest elevational protection, ranges in Europe and South America have intermediate elevational protection, and ranges in North America and Oceania have the highest elevational protection. We use the Convention on Biological Diversity's Aichi Target 11 to assess the proportion of elevational gradients meeting the 17% suggested minimum target and examine how different protection categories contribute to elevational protection. When considering only strict PAs [International Union for Conservation of Nature (IUCN) categories I-IV, n = 24,706], nearly 40% of ranges do not contain any PAs, roughly half fail to meet the 17% target at any elevation, and ∼75% fail to meet the target throughout ≥50% of the elevational gradient. Observed elevational protection is well below optimal, and frequently below a null model of elevational protection. Including less stringent PAs (IUCN categories V-VI and nondesignated PAs, n = 19,449) significantly enhances elevational protection for most continents, but several highly biodiverse ranges require new or expanded PAs to increase elevational protection. Ensuring conservation outcomes for PAs with lower IUCN designations as well as strategically placing PAs to better represent and connect elevational gradients will enhance ecological representation and facilitate species range shifts under climate change. Copyright © 2018 the Author(s). Published by PNAS.

  4. Why do we lose protected areas? Factors influencing protected area downgrading, downsizing and degazettement in the tropics and subtropics.

    Science.gov (United States)

    Symes, William S; Rao, Madhu; Mascia, Michael B; Carrasco, L Roman

    2016-02-01

    Protected areas (PAs) are an essential tool for the conservation of biodiversity globally. Previous studies have focussed on the effectiveness of PAs and the design of optimal PA networks. However, not all PAs remain intact permanently; many PAs undergo downgrading, downsizing and/or degazettement (PADDD), a fact largely ignored until recently. The drivers of enacted PADDD events and the factors influencing its spatial occurrence are poorly understood, potentially undermining the efficacy of PAs and PA networks. Here we examine the spatial relationship between PADDD and economic, demographic and structural variables, using a 110-year data set of 342 enacted PADDD events across 44 countries in the tropics and subtropics. We find that the probability of an enacted PADDD event increases with the size of the PA and through a synergistic interaction between PA size and local population densities. Our results are robust to the under-reporting of enacted PADDD events that occur among smaller PAs and in regions with lower population density. We find an economic motive for PADDD events, given that the opportunity costs associated with larger PAs are higher, on average, than smaller PAs. Our findings suggest a need for conservation practitioners to better consider PA characteristics, as well as the social, economic and political context in which PAs are situated, to aid the creation of more efficient and sustainable PA networks. In particular, the dynamics of enacted PADDD events highlight the need to explicitly consider PA robustness as a core component of systematic conservation planning for PA networks. © 2015 John Wiley & Sons Ltd.

  5. Impaired induction of long-term potentiation-like plasticity in patients with high-functioning autism and Asperger syndrome.

    Science.gov (United States)

    Jung, Nikolai H; Janzarik, Wibke G; Delvendahl, Igor; Münchau, Alexander; Biscaldi, Monica; Mainberger, Florian; Bäumer, Tobias; Rauh, Reinhold; Mall, Volker

    2013-01-01

    We aimed to investigate the induction of long-term potentiation (LTP)-like plasticity by paired associative stimulation (PAS) in patients with high-functioning autism and Asperger syndrome (HFA/AS). PAS with an interstimulus interval between electrical and transcranial magnetic stimulation of 25 ms (PAS(25)) was performed in patients with HFA/AS (n=9; eight males, one female; mean age 17 y 11 mo, SD 4 y 5 mo) and in typically developing age-matched volunteers (n=9; five males, four females; mean age 22 y 4 mo, SD 5 y 2 mo). The amplitude of motor-evoked potentials was measured before PAS(25), immediately after stimulation, and 30 minutes and 60 minutes later. A PAS protocol adapted to individual N20 latency (PAS(N20+2)) was performed in six additional patients with HFA/AS. Short-interval intracortical inhibition was measured using paired-pulse stimulation. In contrast to the typically developing participants, the patients with HFA/AS did not show a significant increase in motor-evoked potentials after PAS(25). This finding could also be demonstrated after adaptation for N20 latency. Short-interval intracortical inhibition of patients with HFA/AS was normal compared with the comparison group and did not correlate with PAS effect. Our results show a significant impairment of LTP-like plasticity induced by PAS in individuals with HFA/AS compared with typically developing participants. This finding is in accordance with results from animal studies as well as human studies. Impaired LTP-like plasticity in patients with HFA/AS points towards reduced excitatory synaptic connectivity and deficits in sensory-motor integration in these patients. © The Authors. Developmental Medicine & Child Neurology © 2012 Mac Keith Press.

  6. Families as catalysts for peer adherence support in enhancing hope for people living with HIV/AIDS in South Africa.

    Science.gov (United States)

    Masquillier, Caroline; Wouters, Edwin; Mortelmans, Dimitri; Booysen, Frederik le Roux

    2014-01-01

    Hope is an essential dimension of successful coping in the context of illnesses such as HIV/AIDS, because positive expectations for the future alleviate emotional distress, enhance quality of life and have been linked to the capacity for behavioural change. The social environment (e.g. family, peers) is a regulator of hope for people living with HIV/AIDS (PLWHA). In this regard, the dual aim of this article is (1) to analyze the influence of a peer adherence support (PAS) intervention and the family environment on the state of hope in PLWHA and (2) to investigate the interrelationship between the two determinants. The Effective AIDS Treatment and Support in the Free State study is a prospective randomized controlled trial. Participants were recruited from 12 public antiretroviral treatment (ART) clinics across five districts in the Free State Province of South Africa. Each of these patients was assigned to one of the following groups: a control group receiving standard care, a group receiving additional biweekly PAS or a group receiving PAS and nutritional support. Latent cross-lagged modelling (Mplus) was used to analyse the impact of PAS and the family environment on the level of hope in PLWHA. The results of the study indicate that neither PAS nor the family environment has a direct effect on the level of hope in PLWHA. Subsequent analysis reveals a positive significant interaction between family functioning and PAS at the second follow-up, indicating that better family functioning increases the positive effect of PAS on the state of hope in PLWHA. The interplay between well-functioning families and external PAS generates higher levels of hope, which is an essential dimension in the success of lifelong treatment. This study provides additional insight into the important role played by family dynamics in HIV/AIDS care, and it underscores the need for PAS interventions that are sensitive to the contexts in which they are implemented.

  7. Chemical fingerprinting identifies Echium vulgare, Eupatorium cannabinum and Senecio spp. as plant species mainly responsible for pyrrolizidine alkaloids in bee-collected pollen.

    Science.gov (United States)

    Kast, Christina; Kilchenmann, Verena; Reinhard, Hans; Droz, Benoit; Lucchetti, Matteo Angelo; Dübecke, Arne; Beckh, Gudrun; Zoller, Otmar

    2018-02-01

    Various studies have shown that bee-collected pollen sold as nutritional supplements may contain toxic pyrrolizidine alkaloids (PAs) and, thus, pose a potential health risk for consumers. The level of contamination may vary according to its geographical and botanical origin. Here, the PA content of pollen produced in Switzerland was studied and 32 commercially available bee-collected pollen supplements produced between 2010 and 2014 were analysed. In addition, at what time period bees collect PA-containing pollen was investigated. Hence, this study looked into the occurrence of PAs in pollen samples collected daily during two-to-three consecutive seasons. Furthermore, the PA spectrum in pollen was compared to the spectrum found in flower heads of PA-plants to unambiguously identify plants responsible for PA contamination of pollen. The PA concentration of commercial and daily collected pollen was determined by target analysis using an HPLC-MS/MS system, allowing the detection of 18 different PAs and PA N-oxides found in the genera Echium, Eupatorium and Senecio, while the comparison of the PA spectrum in pollen and flower heads was performed by LC-HR-MS, allowing the detection of all PA types in a sample, including saturated, non-carcinogenic PAs. Of the commercially available pollen, 31% contained PAs with a mean concentration of 319 ng/g, mainly Echium- and Eupatorium-type PAs, while the PA concentrations were below the limit of quantitation (LOQ) in 69% of the pollen samples. Bees collected pollen containing Echium-type PAs mainly in June and July, while they gathered pollen containing Eupatorium-type PAs from mid-July to August. Senecio-type PAs appeared from June to September. Comparison of the PA array in pollen and plants identified E. vulgare and E. cannabinum as the main plants responsible for PA contamination of Swiss bee-collected pollen, and to a lesser extent also identified plants belonging to the genus Senecio.

  8. Pharmacological Modulation of Long-Term Potentiation-Like Activity in the Dorsolateral Prefrontal Cortex

    Directory of Open Access Journals (Sweden)

    Bahar Salavati

    2018-04-01

    Full Text Available Background: Long-term potentiation (LTP depends on glutamatergic neurotransmission and is modulated by cholinergic, dopaminergic and GABAergic inputs. Paired associative stimulation (PAS is a neurostimulation paradigm that, when combined with electroencephalography (EEG, assesses LTP-like activity (PAS-induced LTP in the dorsolateral prefrontal cortex (DLPFC. Thus, we conducted a study to assess the role of cholinergic, dopaminergic, GABAergic and glutamatergic neurotransmission on PAS-induced LTP in the DLPFC. We hypothesized that increasing the dopaminergic tone with L-DOPA and the cholinergic tone with rivastigmine will enhance PAS-induced LTP, while increasing the GABAergic tone with baclofen and inhibiting glutamatergic neurotransmission with dextromethorphan will reduce it compared to placebo.Methods: In this randomized controlled, double-blind cross-over within-subject study, 12 healthy participants received five sessions of PAS to the DLPFC in a random order, each preceded by the administration of placebo or one of the four active drugs. PAS-induced LTP was assessed after each drug administration and compared to PAS-induced LTP after placebo.Results: As predicted, L-DOPA and rivastigmine resulted in enhanced PAS-induced LTP in the DLPFC and dextromethorphan inhibited it compared to placebo. In contrast, baclofen did not significantly suppress PAS-induced LTP compared to placebo.Conclusions: This study provides a novel approach to study DLPFC neuroplasticity and its modulation in patients with brain disorders that are associated with abnormalities in these neurochemical systems. This study was based on a single dose administration of each drug. Given that these drugs are typically administered chronically, future studies should assess the effects of chronic administration.

  9. Ultra-Performance Liquid Chromatography Hyphenated with Quadrupole-Orbitrap Mass Spectrometry for Simultaneous Determination of Necine-Core-Structure Pyrrolizidine Alkaloids in Crotalaria sessiliflora L. without all Corresponding Standards.

    Science.gov (United States)

    Zhang, Wei; Huai, Wenbei; Zhang, Yi; Shen, Jincan; Tang, Xunyou; Xie, Xiujuan; Wang, Ke; Fan, Huajun

    2017-09-01

    Crotalaria sessiliflora L. is a Chinese traditional herb for treatment of cutaneum carcinoma and cervical carcinoma. In addition to monocrotaline, coexisting pyrrolizidine alkaloids (PAs) also require further quantification for quality control and pharmaceutical uses of the herb. To establish a UPLC-Q-Orbitrap/MS method of simultaneous determination of coexisting PAs with same parent structure for quality control and comprehensive researches of Crotalaria sessiliflora L. PAs in Crotalaria sessiliflora L. were analysed by UPLC-Q-Orbitrap/MS method. Coexisting PAs were identified by mass data of full MS-dd-MS 2 based on the characteristic fragmentation pattern and necine-core structure. Moreover, quantification of PAs was conducted by parallel reaction monitoring (PRM) mode using m/z 138, m/z 120 and m/z 94 from identical necine-core structure as quantitative ions with single monocrotaline standard for accurate calibration. Five PAs, named monocrotaline, retrorsine, senecionine, integerrimine, O-9-angeloylretronecine, were indentified and confirmed. Quantitative ions of m/z 138, m/z 120 and m/z 94 were used for quantification of PAs containing the necine-core structure in Crotalaria sessiliflora L. The results demonstrated that contents, precision and recoveries of the five PAs mentioned earlier were respectively 3.307-30.35 μg/g, 1.1-4.5% and 88.91-92.33% while using m/z 120 as the best quantitative ion. The UPLC-Q-Orbitrap/MS method was established for simultaneous determination of five PAs in Crotalaria sessiliflora L. without all corresponding standards, and was proved that it was simple, convenient and effective for comprehensive quality control and pharmaceutical uses. Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.

  10. A Medical Student Perspective on Physician-Assisted Suicide.

    Science.gov (United States)

    Rhee, John Y; Callaghan, Katharine A; Allen, Philip; Stahl, Amanda; Brown, Martin T; Tsoi, Alexandra; McInerney, Grace; Dumitru, Ana-Maria G

    2017-09-01

    Physician-assisted suicide and euthanasia (PAS/E) has been increasingly discussed and debated in the public arena, including in professional medical organizations. However, the medical student perspective on the debate has essentially been absent. We present a medical student perspective on the PAS/E debate as future doctors and those about to enter the profession. We argue that PAS/E is not in line with the core principles of medicine and that the focus should be rather on providing high-quality end-of-life and palliative care. Copyright © 2017 American College of Chest Physicians. Published by Elsevier Inc. All rights reserved.

  11. Foire aux questions Documents mentionnés dans la liste de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC CRDI

    12) Pourquoi n'ai-je pas besoin de fournir mon curriculum vitae ? 13) Faut-il que je fournisse des lettres de référence ? 14) Où dois-je envoyer tous les documents ? 15) Qu'arrive-t-il si je n'ai pas téléversé tous les documents et si toutes les références n'ont pas été fournies avant la date butoir ? Proposition de recherche.

  12. Metodología para determinar la distribución de puntos de acceso a servicios de gobierno electrónico

    OpenAIRE

    Montes Chunga, Mariuxi; Muñoz Hernandez, Susana

    2013-01-01

    Este trabajo es de interés para territorios en países en vías de desarrollo que tengan información escasa o limitada sobre la cual planificar Puntos de Acceso a Servicios (PAS). Está pensado para territorios que actualmente no cuenten con ningún o con escasos PAS y que estén interesados en aplicar esta estrategia para proveer de servicios a los ciudadanos de su territorio. Aquí se dan claves para tener una respuesta con base técnica para decidir cuántos PAS poner en el territorio y dónde ...

  13. Le Dictionnaire historique de l’adjectif-adverbe : de aimer haut à baiser utile

    Directory of Open Access Journals (Sweden)

    Hummel Martin

    2014-07-01

    (4\tJe suis sur le point d'arrêter nette ma conso de cannabis (2013 Notons que dans ces cas, une analyse en tant que prédicat second n’est pas concevable. Même si certains de ces exemples peuvent être considérés comme des cas d’hypercorrection, cela ne les explique pas tous. On observe un rapprochement aux prédicats seconds en ce que les AAs s’accordent avec un nom accessible, même s’ils n’en sont pas les modificateurs primaires.

  14. Interaction of Polyamines, Abscisic Acid, Nitric Oxide, and Hydrogen Peroxide under Chilling Stress in Tomato (Lycopersicon esculentum Mill.) Seedlings

    OpenAIRE

    Diao, Qiannan; Song, Yongjun; Shi, Dongmei; Qi, Hongyan

    2017-01-01

    Polyamines (PAs) play a vital role in the responses of higher plants to abiotic stresses. However, only a limited number of studies have examined the interplay between PAs and signal molecules. The aim of this study was to elucidate the cross-talk among PAs, abscisic acid (ABA), nitric oxide (NO), and hydrogen peroxide (H2O2) under chilling stress conditions using tomato seedlings [(Lycopersicon esculentum Mill.) cv. Moneymaker]. The study showed that during chilling stress (4°C; 0, 12, and 2...

  15. Characterization of an apically derived epithelial membrane glycoprotein from bovine milk, which is expressed in capillary endothelia in diverse tissues

    OpenAIRE

    1985-01-01

    A glycoprotein (PAS IV) of apparent Mr 76,000 was purified from bovine milk-fat-globule membrane and partially characterized. PAS IV contained mannose, galactose, and sialic acid as principal sugars (approximately 5.3% total carbohydrate [wt/wt]) and existed in milk in at least four isoelectric variants. The glycoprotein appeared to be an integral membrane protein by several criteria. PAS IV was recovered in the detergent phase of Triton X-114 extracts of milk-fat-globule membrane at room tem...

  16. A survey of an air monitoring program

    International Nuclear Information System (INIS)

    Lee, M.B.

    1997-01-01

    The objective of this report is to compare personal air sampling data to stationary air sampling data and to bioassay data that was taken during the decontamination and decommissioning of sixty-one plutonium glove boxes at Argonne National Laboratory (ANL) in 1995. An air monitoring program administered at Argonne National Laboratory was assessed by comparing personal air sampler (PAS) data, stationary air sampler (SAS) data, and bioassay data. The study revealed that the PAS and SAS techniques were equivalent when averaged over all employees and all workdays, but the standard deviation was large. Also, large deviations were observed in individual samples. The correlation between individual PAS results and bioassay results was low. Personal air samplers and bioassay monitoring played complementary roles in assessing the workplace and estimating intakes. The PAS technique is adequate for detection and evaluation of contaminated atmospheres, whereas bioassay monitoring is better for determining individual intakes

  17. Shallow nitrogen ion implantation: Evolution of chemical state and defect structure in titanium

    Energy Technology Data Exchange (ETDEWEB)

    Manojkumar, P.A., E-mail: manoj@igcar.gov.in [Indira Gandhi Centre for Atomic Research, Kalpakkam 603102 (India); Chirayath, V.A.; Balamurugan, A.K.; Krishna, Nanda Gopala; Ilango, S.; Kamruddin, M.; Amarendra, G.; Tyagi, A.K. [Indira Gandhi Centre for Atomic Research, Kalpakkam 603102 (India); Raj, Baldev [National Institute of Advanced Studies, Bangalore 560 012 (India)

    2016-09-15

    Highlights: • Low energy nitrogen ion implantation in titanium was studied. • Chemical and defect states were analyzed using SIMS, XPS and PAS. • SIMS and depth resolved XPS data showed good agreement. • Depth resolved defect and chemical states information were revealed. • Formation of 3 layers of defect states proposed to fit PAS results. - Abstract: Evolution of chemical states and defect structure in titanium during low energy nitrogen ion implantation by Plasma Immersion Ion Implantation (PIII) process is studied. The underlying process of chemical state evolution is investigated using secondary ion mass spectrometry and X-ray photoelectron spectroscopy. The implantation induced defect structure evolution as a function of dose is elucidated using variable energy positron annihilation Doppler broadening spectroscopy (PAS) and the results were corroborated with chemical state. Formation of 3 layers of defect state was modeled to fit PAS results.

  18. Protein (Cyanobacteria): 281806 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available se with PAS/PAC and GAF sensors Oscillatoria nigro-viridis PCC 7112 MIEESKSIKEKFGVLDSVPVGACLLQDDFVVLFWNTCLEE...YP_007117793.1 1117:4890 1150:2464 1158:318 482564:246 179408:246 diguanylate cycla

  19. Protein (Cyanobacteria): 279248 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available se with PAS/PAC and GAF sensors Arthrospira maxima CS-328 MMDKYLCPCCSEPLLIHIIAHKKIGFCMNCHQEMPLIEQSRQMATVTEPV...ZP_03273626.1 1117:4884 1150:2505 35823:234 129910:158 513049:158 diguanylate cycla

  20. Protein (Cyanobacteria): 279234 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09781866.1 1117:4884 1150:2505 35823:234 376219:95 putative Diguanylate cyclase with PAS/PAC and GAF sens...ors Arthrospira sp. PCC 8005 MNQLMEDRSKILWIAGNVGNDNHSLPQSILQNNGYEVHLVIGLKPAYNAIQSWP

  1. Protein (Cyanobacteria): 281805 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available se with PAS/PAC and GAF sensors Oscillatoria nigro-viridis PCC 7112 MYLILPDLYANMTYQIDERLNTSPCGFLSFADDGTIVMVN...YP_007118829.1 1117:4890 1150:2464 1158:318 482564:246 179408:246 diguanylate cycla

  2. Protein (Cyanobacteria): 285307 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ith PAS/PAC and Chase2 sensors Nostoc sp. PCC 7107 MSKQLGKSFVSSNLNLNLKQLLDRKYRQLVVAFSVAVCIILLRSVGMFQSLELAGLD...YP_007048593.1 1117:4890 1161:684 1162:948 1177:381 317936:58 diguanylate cyclase w

  3. Protein (Cyanobacteria): 279247 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09782276.1 1117:4884 1150:2505 35823:234 376219:114 putative Diguanylate cyclase with PAS/PAC and GAF sen...sors Arthrospira sp. PCC 8005 MMDKYLCPCCSEPLLIHIIAHKKIGFCMNCHQEMPLIEQSRQMATVTEPVDVS

  4. Protein (Cyanobacteria): 281376 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_08491810.1 1117:4890 1150:2448 44471:122 119532:63 756067:63 diguanylate cyclase with PAS/PAC and GAF sen...sors Microcoleus vaginatus FGP-2 MANMTYQIDELLNTSPCGFLSFADDGTILMVNATLLQLLGYETDELRERK

  5. Protein (Cyanobacteria): 281754 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available se with PAS/PAC and GAF sensors Oscillatoria nigro-viridis PCC 7112 MLYNNEILPTLTVESSPRSMNILLYKLLSLRRIEYIAVDR...YP_007115817.1 1117:4890 1150:2464 1158:318 482564:246 179408:246 diguanylate cycla

  6. Protein (Cyanobacteria): 286149 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YP_007068440.1 1117:4890 1161:684 1185:224 1186:169 99598:92 diguanylate cyclase with PAS/PAC and Chase2 sen...sors Calothrix sp. PCC 7507 MSKQLGKCLVKFIFGLKQSLGRGHRELITASSVVICILFLRSIGLLQFLELAALD

  7. Protein (Cyanobacteria): 280942 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available se with PAS/PAC and GAF sensors Crinalium epipsammum PCC 9333 MIEQDKTKDQLLAELATMRQLNNFLLFSGMGVQQHLEKLLIEEREF...YP_007141850.1 1117:4890 1150:2445 241421:53 241425:53 1173022:53 diguanylate cycla

  8. Protein (Cyanobacteria): 275943 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YP_007168782.1 1117:4879 1118:3357 92682:39 76023:39 65093:39 diguanylate cyclase with PAS/PAC and GAF senso...rs Halothece sp. PCC 7418 MDKYLARRTQDLRQQAQARLEQRERETDLNEMTPAELAHELEIHQTELEIQYEELQR

  9. Protein (Cyanobacteria): 281377 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_08493855.1 1117:4890 1150:2448 44471:122 119532:63 756067:63 diguanylate cyclase with PAS/PAC and GAF sen...sors Microcoleus vaginatus FGP-2 MIEESKSIKEKFGVLDSVPVGACLLQDDFVVLFWNTCLEEWTKIPRSQIL

  10. Protein (Cyanobacteria): 307154701 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YP_003890085.1 NC_014501 1117:8352 ... 1118:3762 1301283:19569 ... 43988:641 497965:226 ... PAS/PAC and GAF sens...ors-containing diguanylate cyclase Cyanothece sp. PCC 7822 MWEFISNFLAPKSYIPHGHCYLWQ

  11. New Spectrophotometric Methods for the Determination of p ...

    African Journals Online (AJOL)

    derivatizing reagents for the determination of p-aminosalicylic acid (PAS) in tablets. The derivatization was carried ... liquid chromatography (HPLC) [7,8], nuclear magnetic resonance ..... aminosalicylic acid and m-aminophenol by derivative.

  12. 2014 Highlights of Ferry Operations in the United States

    Science.gov (United States)

    2016-05-01

    Based on information provided by operators who responded to the 2014 National Census of Ferry Operators (NCFO), the Bureau of Transportation Statistics (BTS) conservatively estimates that ferries in the United States carried just over 115 million pas...

  13. The effect of passengers on teen driver behavior : traffic tech.

    Science.gov (United States)

    2012-04-01

    A number of studies have shown that passengers substantially : increase the risk of crashes for young, novice drivers. : This increased risk may result from distractions that young : passengers create for drivers. Alternatively, the presence : of pas...

  14. Personality Disorders in a Non-Patient Population in Nigeria ...

    African Journals Online (AJOL)

    Nigerian Medical Journal ... Abstract. Background: Studies of the epidemiology of personality disorders in Nigeria are scanty. ... and thereafter a structured clinical interview using the Personality Assessment Schedule (PAS) was conducted.

  15. Medical students' perspectives on euthanasia and physician ...

    African Journals Online (AJOL)

    autonomy is recognised as part of their inalienable constitutional rights, as .... these practices – as the SA Constitution regards individualism as equivalent to ... research relating to euthanasia/PAS, as religion and culture have a significant ...

  16. De l’avantage (ou non) de définir la science-fiction : théorie des genres, science-fiction et Histoire

    OpenAIRE

    Rieder, John

    2013-01-01

    Cet essai a pour but d’aider à la clarification et au renforcement de l’impact d’une théorie historique des genres dans les études sur la science-fiction. Il explique et défend cinq propositions sur ce genre, chacune pouvant servir de thèse en elle-même : la science-fiction est historique et mouvante ; la science-fiction n’a pas d’essence, pas de caractéristique unifiante, et pas de point originel ; la science-fiction n’est pas un ensemble de textes, mais plutôt un usage des textes et une man...

  17. Jute tegen onkruidgroei op plantspiegels : eik en beuk op droogtegevoelige grond gebaat bij plantmatten

    NARCIS (Netherlands)

    Hoksbergen, F.T.J.

    1985-01-01

    Onderzoeksresultaten met jute matten op plantspiegels van pas geplante bomen om deze onkruidvrij te houden bleken gunstig te zijn, vooral op droogtegevoelige gronden en voor de boomsoorten eik en beuk

  18. Simple and rapid quantification of total carotenoids in lyophilized apricots (prunus armeniaca L.) by means of reflectance colorimetry and photoacoustic spectrometry spectroscopy

    NARCIS (Netherlands)

    Doka, O.; Ficzek, G.; Luterotti, S.; Bicanic, D.D.; Spruijt, R.B.; Buijnsters, J.; Vegvari, G.

    2013-01-01

    Photoacoustic spectroscopy (PAS) and reflectance colorimetry are suggested as new tools for the analysis of total carotenoids in lyophilized apricot powders. The data obtained by these two techniques from seven apricot cultivars were compared to those acquired by spectrophotometry and

  19. Pyrrolizidine alkaloids in honey: comparison of analytical methods

    NARCIS (Netherlands)

    Kempf, M.; Wittig, M.; Reinhard, A.; Ohe, von der K.; Blacquière, T.; Raezke, K.P.; Michel, R.; Schreier, P.; Beuerle, T.

    2011-01-01

    Pyrrolizidine alkaloids (PAs) are a structurally diverse group of toxicologically relevant secondary plant metabolites. Currently, two analytical methods are used to determine PA content in honey. To achieve reasonably high sensitivity and selectivity, mass spectrometry detection is demanded. One

  20. Jeremy Rifkin, La troisième révolution industrielle. Comment le pouvoir latéral va transformer l’énergie, l’économie et le monde, Paris, Les Liens qui Libèrent, 2012, 414p.

    OpenAIRE

    Noé, Adam

    2013-01-01

    Certes, Jeremy Rifkin n’est pas aidé. « Prophète » pour les uns, « gourou » selon d’autres : difficile de croire que les qualificatifs qui lui sont ainsi destinés, parfois avec les meilleures intentions, ne soient pas, en d’autres milieux, empreints de connotations dépréciatives, fleurant bon la promotion de soi, le marketing médiatique et, pourquoi ne pas le dire, un certain charlatanisme. Il est vrai, Rifkin ne s’aide pas lui-même. Vraiment, a-t-on besoin d’anecdotes du genre : « La chancel...

  1. Final Report on Investigations of the influence of Helium concentration and implantation rate on Cavity Nucleation and Growth during neutron irradiation of Fe and EUROFER 97

    DEFF Research Database (Denmark)

    Eldrup, Morten Mostgaard; Singh, Bachu Narain; Golubov, S.

    This report presents results of investigations of damage accumulation during neutron irradiation of pure iron and EUROFER 97 steel with or without prior helium implantation. The defect microstructure, in particular the cavities, was characterized using Positron Annihilation Spectroscopy (PAS) and...

  2. Correspondence wit'h a pioneer, Jiirgen Lehmann (1898 - 1989 ...

    African Journals Online (AJOL)

    1991-01-05

    Jan 5, 1991 ... porary benefit and a public health hazard. S AIr Med J 1991; ... tion of PAS solutions in tuberculous fistulas, abscesses and ... therapy of 20 lung tuberculosis patients from March to October. 1944. .... A contributory factor was.

  3. 14 CFR 25.365 - Pressurized compartment loads.

    Science.gov (United States)

    2010-01-01

    ... flight, and stress concentrations and fatigue effects must be accounted for. (c) If landings may be made... small compartment. The size Ho must be computed by the following formula: Ho=PAs where, Ho=Maximum...

  4. Pain Amplification Syndrome: A Biopsychosocial Approach.

    Science.gov (United States)

    Namerow, Lisa B; Kutner, Emily C; Wakefield, Emily C; Rzepski, Barbara R; Sahl, Robert A

    2016-08-01

    Pediatric neurologists frequently encounter patients who present with significant musculoskeletal pain that cannot be attributed to a specific injury or illness, which can often be defined as pain amplification syndrome (PAS). PAS in children and adolescents is the result of a heightened pain sensitivity pathway, which is intensified by significant biological, psychological, and social contributors. Appropriate assessment and multimodal intervention of PAS are crucial to treatment success, including neurology and behavioral health collaborative treatment plans to restore patient function and reduce pain perception. Pediatric neurologists are imperative in the identification of patients with PAS, providing the family assurance in diagnosis and validation of pain, and directing patients to the appropriate multidisciplinary treatment pathway. Copyright © 2016 Elsevier Inc. All rights reserved.

  5. Differential Effects of Positive versus Negative Self-Involving Counselor Responses.

    Science.gov (United States)

    Remer, Pam; And Others

    1983-01-01

    Investigated the effects of positive and negative counselor disclosure using typescripts of hypothetical counseling interviews. Results indicated impact of condition was mixed, with each having some desirable effects. (PAS)

  6. Patterns of psychological acculturation in adult and adolescent Moroccan immigrants living in the Netherlands

    NARCIS (Netherlands)

    Stevens, G.W.J.M.; Pels, T.V.M.; Vollebergh, W.A.M.; Crijnen, A.A.M.

    2004-01-01

    Psychological acculturation patterns within a Moroccan adult and adolescent population in the Netherlands were determined through latent class analysis. The Psychological Acculturation Scale (PAS) was adapted, and strong psychometric properties were demonstrated. We found Dutch and Moroccan

  7. J.M. Barrie : Les masques de Jacobus Hook Partie I/II : Le Capitaine Hook à Eton ou Le Solitaire1

    OpenAIRE

    Faivre, Céline-Albin

    2013-01-01

    Cette causerie n’aurait pas lieu si le Doyen ne m’avait pas lancé un défi. Je me trouvai ici le 4 juin dernier, lorsque, pendant le déjeuner, au beau milieu de son discours, le Doyen me mit au défi de réfuter cette terrible accusation : « James Hook, le Capitaine pirate, était un grand mais non pas un bon Etonien. » Or, à mon avis, Hook était un bon mais non pas un grand Etonien ; et c’est cette envie de vous en convaincre qui m’a poussé à venir ici cet après-midi, tout en sachant néanmoins q...

  8. Debating death: religion, politics, and the Oregon Death With Dignity Act.

    Science.gov (United States)

    Purvis, Taylor E

    2012-06-01

    In 1994, Oregon passed the Oregon Death With Dignity Act, becoming the first state in the nation to allow physician-assisted suicide (PAS). This paper compares the public discussion that occurred in 1994 and during the Act's implementation in 1997 and examines these debates in relation to health care reform under the Obama administration. I argue that the 1994 and 1997 Oregon PAS campaigns and the ensuing public debate represent the culmination of a growing lack of deference to medical authority, concerns with the doctor-patient relationship, and a desire for increased patient autonomy over decisions during death. The public debate over PAS in Oregon underscored the conflicts among competing religious, political, and personal interests. More visible and widespread than any other American debate on PAS, the conflict in Oregon marked the beginning of the now nationwide problem of determining if and when a terminally ill person can choose to die.

  9. Volterra series based predistortion for broadband RF power amplifiers with memory effects

    Institute of Scientific and Technical Information of China (English)

    Jin Zhe; Song Zhihuan; He Jiaming

    2008-01-01

    RF power amplifiers(PAs)are usually considered as memoryless devices in most existing predistortion techniques.However,in broadband communication systems,such as WCDMA,the PA memory effects are significant,and memoryless predistortion cannot linearize the PAs effectively.After analyzing the PA memory effects,a novel predistortion method based on the simplified Volterra series is proposed to linearize broadband RF PAs with memory effects.The indirect learning architecture is adopted to design the predistortion scheme and the recursive least squares algorithm with forgetting factor is applied to identify the parameters of the predistorter.Simulation results show that the proposed predistortion method can compensate the nonlinear distortion and memory effects of broadband RF PAs effectively.

  10. Superfund Hazard Ranking System Training Course: Table of Contents

    Science.gov (United States)

    The Hazard Ranking System (HRS) training course is a four and ½ day, intermediate-level course designed for personnel who are required to compile, draft, and review preliminary assessments (PAs), site inspections (SIs), and HRS documentation records/packag

  11. Superfund Hazard Ranking System Training Course

    Science.gov (United States)

    The Hazard Ranking System (HRS) training course is a four and ½ day, intermediate-level course designed for personnel who are required to compile, draft, and review preliminary assessments (PAs), site inspections (SIs), and HRS documentation records/packag

  12. Dendrimeric Thin-Film Composite Membranes: Free Volume, Roughness, and Fouling Resistance

    KAUST Repository

    Phuoc, Duong; Zuo, Jian; Nunes, Suzana Pereira

    2017-01-01

    films with different crosslinked structures. The influences of the concentration and degree of branching (PAMAM generation) on free volume were analysed via positon annihilation spectroscopy (PAS) and correlated with the separation properties

  13. Emerging investigator series: As( v ) in magnetite: incorporation and redistribution

    Energy Technology Data Exchange (ETDEWEB)

    Huhmann, Brittany L. [Department of Civil and Environmental Engineering; University of Iowa; Iowa City; USA; Neumann, Anke [School of Engineering; Newcastle University; Newcastle upon Tyne; UK; Boyanov, Maxim I. [Biosciences Division; Argonne National Laboratory; Argonne; USA; Institute of Chemical Engineering; Kemner, Kenneth M. [Biosciences Division; Argonne National Laboratory; Argonne; USA; Scherer, Michelle M. [Department of Civil and Environmental Engineering; University of Iowa; Iowa City; USA

    2017-01-01

    <p>As coprecipitated with magnetite remained incorporated over time whereas sorbed As was redistributed and became increasingly incorporated into magnetite, both the absence and presence of aqueous Fe(ii).

  14. Racial and Gender Disparities in the Physician Assistant Profession.

    Science.gov (United States)

    Smith, Darron T; Jacobson, Cardell K

    2016-06-01

    To examine whether racial, gender, and ethnic salary disparities exist in the physician assistant (PA) profession and what factors, if any, are associated with the differentials. We use a nationally representative survey of 15,105 PAs from the American Academy of Physician Assistants (AAPA). We use bivariate and multivariate statistics to analyze pay differentials from the 2009 AAPA survey. Women represent nearly two-thirds of the profession but receive approximately $18,000 less in primary compensation. The differential reduces to just over $9,500 when the analysis includes a variety of other variables. According to AAPA survey, minority PAs tend to make slightly higher salaries than White PAs nationally, although the differences are not statistically significant once the control variables are included in the analysis. Despite the rough parity in primary salary, PAs of color are vastly underrepresented in the profession. The salaries of women lag in comparison to their male counterparts. © Health Research and Educational Trust.

  15. Untitled

    Indian Academy of Sciences (India)

    aminOSalicylic acid (PAS) has attracted wide interest, directed towards its synthesis by different methods,' estimation, pharmacology, preparation of derivatives and the study of compounds analogous to it. With a view to obtain drugs more potent ...

  16. Iõhviskaja volost nalazhivajet sotrudnitshestvo s Severnõm regionom Frantsii / Arno Rudis

    Index Scriptorium Estoniae

    Rudis, Arno

    2007-01-01

    Jõhvi vallavalitsuse delegatsioon viibis Prantsusmaal Nord Pas de Calais regioonis. Jõhvi valla asevallavanem Kristi Klaamann kohtumisest linnapeaga, toimunud arutelust tulevase koostöö üle kultuuri ja hariduse vallas

  17. Protected Areas’ Impacts on Brazilian Amazon Deforestation: Examining Conservation – Development Interactions to Inform Planning

    Science.gov (United States)

    Pfaff, Alexander; Robalino, Juan; Herrera, Diego; Sandoval, Catalina

    2015-01-01

    Protected areas are the leading forest conservation policy for species and ecoservices goals and they may feature in climate policy if countries with tropical forest rely on familiar tools. For Brazil's Legal Amazon, we estimate the average impact of protection upon deforestation and show how protected areas’ forest impacts vary significantly with development pressure. We use matching, i.e., comparisons that are apples-to-apples in observed land characteristics, to address the fact that protected areas (PAs) tend to be located on lands facing less pressure. Correcting for that location bias lowers our estimates of PAs’ forest impacts by roughly half. Further, it reveals significant variation in PA impacts along development-related dimensions: for example, the PAs that are closer to roads and the PAs closer to cities have higher impact. Planners have multiple conservation and development goals, and are constrained by cost, yet still conservation planning should reflect what our results imply about future impacts of PAs. PMID:26225922

  18. Tropical protected areas reduced deforestation carbon emissions by one third from 2000-2012.

    Science.gov (United States)

    Bebber, Daniel P; Butt, Nathalie

    2017-10-25

    Tropical deforestation is responsible for around one tenth of total anthropogenic carbon emissions, and tropical protected areas (PAs) that reduce deforestation can therefore play an important role in mitigating climate change and protecting biodiversity and ecosystem services. While the effectiveness of PAs in reducing deforestation has been estimated, the impact on global carbon emissions remains unquantified. Here we show that tropical PAs overall reduced deforestation carbon emissions by 4.88 Pg, or around 29%, between 2000 and 2012, when compared to expected rates of deforestation controlling for spatial variation in deforestation pressure. The largest contribution was from the tropical Americas (368.8 GgC y -1 ), followed by Asia (25.0 GgC y -1 ) and Africa (12.7 GgC y -1 ). Variation in PA effectiveness is largely driven by local factors affecting individual PAs, rather than designations assigned by governments.

  19. Succession planning : phase II.

    Science.gov (United States)

    2008-06-01

    Succession planning is an organizational investment in the future. Institutional : knowledge is a critical ingredient in the culture of an organization, and its intangible : value becomes significant when an organization is faced with the need to pas...

  20. Original Research

    African Journals Online (AJOL)

    home

    2014-06-15

    Jun 15, 2014 ... improvement of such institutional support systems like FTC (Farmers Training Center, etc) to increase .... Potential crop producers PAs (Peasant Associations) ..... production inputs like fertilizer, seed of improved maize.